1PPJE

Bovine cytochrome bc1 complex with stigmatellin and antimycin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
molecule tags Oxidoreductase
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
total genus 51
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1ppjE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1ppjE02
1O7MA 2E4PA 4HJLA 4NBGD 4OGQD 5HL4A 3L75E 4QDCA 3GTSA 2E75D 3TGUE 4NBDD 2BMQA 4HM1A 3CWBE 3GTEA 3L73E 1BGYE 1EG9A 2HMNA 3DQYA 4EMJB 3N0QA 1WQLA 1NDOA 2ZT9D 4QDDA 2QJYC 1VCKA 3L74E 2QJPC 2BMRA 1L0NE 4HM2A 1SQVE 3L71E 2GBWA 4NBCD 2XR8A 1G8KB 1SQPE 2XRXA 3VCAA 2HMJA 4H44D 2YFIA 1NTME 1G8JB 1O7WA 4QUQA 2B1XA 5KLVE 3H1JE 2BMOA 2YFLA 2BCCE 2A06E 1ULIA 3GL0A 2E74D 1BE3E 1PP9E 1NU1E 2DE5D 3BCCE 3FOUA 1NTZE 2Q3WA 1O7HA 2YIUC 4AIVA 2HMMA 1FQTA 2YVJB 2JO6A 3C0DA 2QJKC 3GB4A 3VCPA 1BCCE 4HM4A 4NBFD 3VMGD 4HM8A 3L72E 3VMID 4QDFB 2NUKA 5KKZC 2HMKA 1UUVA 4QDFA 4NBAD 4P1CH 2HMOA 4H13D 5AEWA 2I7FA 4NBHD 1RFSA 4QCKA 3H1IE 1O7GA 4HKVA 4P1BH 1L0LE 1P84E 1ZRTE 1KYOE 1JM1A 1O7NA 2CKFA 2ZYLA 3L70E 1O7PA 2XSHA 2YFJA 4HM3A 1SQBE 3GZYA 3D89A 3EQQA 3GOBA 1SQXE 2NVFA 2XSOA 4PD4E 4NB9D 2JZAA 3EN1A 3H1HE 4HM5A 4QUPA 1VF5D 1ULJA 3CXHE 1RIEA 2IBZE 4HM6A 2FYUE 2E4QA 2D2CD 1SQQE 5AEUA 1KB9E 2E76D 1VM9A 1NYKA 3H1KE 4D6TE 1UUWA 2NWFA 4QURA 3H1LE 4NB8D 4NBBD 4U3FE 2B24A 1SJGA 2NVGA 3GL2A 3GZXA 2DE6D 5CXMA 2QPZA 2DE7D 4H0LD 3VMHD 3AZCA 1EZVE 1NTKE 3GKEA 4HM0A 2NUMA 4PV1D 2FYNC 3CX5E 5BOKA 2NVEA 3GCEA 1PPJE 2HMLA 4NBED 4AAYB 2GBXA 1Q90C 5KLIC 4HM7A
chains in the Genus database with same CATH superfamily
1IFMA 2V7QH 2XNDH 4GT1A 4QDCA 1GW3A 4GKGA 2YKPA 3CWBE 1Q81Q 1BGYE 3M06A 1JOCA 5AW6B 1T8ZA 2OARA 2KZJA 1BE3D 2ZYAA 2M5AA 3H1LD 3PLNA 2W27A 4ASVA 5AVTB 2H43A 2IBZD 2N9BA 4WY4C 2W6BA 3RBXA 3B4SA 2E74D 2K1AA 2Z5IA 3M0AA 5CHXA 3L70J 4K35A 1N7LA 3NFQA 4W80A 3VTPC 2NUKA 1VQ7P 4NBAD 4DZOA 2HODA 2JP3A 2AEMA 4IL6E 3KZIH 3C1LA 1LWUA 3O6QB 3TDKA 1ZP0C 3GOBA 1L4AD 4PD4E 4M3LA 4HB1A 4WB4A 1W2BO 1S4XA 2YMYA 2J5UA 3L4FA 1T6AA 1BE3J 3V2QA 1FE6A 4DT0A 1BGYJ 3HE5A 1RE4A 3H1ID 2K88A 3I55P 3TYYA 2V4HA 2ZYGA 2GBXA 3L70G 5AW8B 4XA4A 3TGUE 1ZW0A 3TGUG 1IK7A 3AEGC 2AXTH 2QEXP 2QSIA 3AE6C 4AQRD 1XTCC 5H2FE 2WSFH 2QM8A 3LIEA 1K04A 5AW7B 1M1JB 1WT6A 2JO1A 1AJYA 2BCCG 4KJMA 1BE3E 1LTGC 5KLVD 1NTMD 4D6TG 1URQC 3QWOC 2KSJA 2LR2A 1HUCA 3MHVA 1PP9G 1G1IA 5AEWA 3RK2C 3BCCJ 3IF4A 2IYPA 3V2PA 1IFJA 1CW5A 1P84E 3PHLA 1KV4A 2ZFCA 3H25A 1KYOI 3L73G 1HBWA 2YO3A 4HM5A 2QG4A 3HD7B 1URQB 3B8EB 3L72J 2YKOA 1LTJA 2H7HA 2AXTE 3AE1C 2DE6D 1LT9B 2J59M 2O01H 2C9LY 2RMZA 4LGDE 2KNCB 2XV5A 3HUSC 1N8RQ 2FXPA 4L75A 2A45I 1FOSE 1L2PA 2R5BA 1LP1B 1OZHA 4HM7A 1RQUA 4NPFX 1OXZA 2N1TD 1GL2A 1DEEG 1N7SD 4CPGA 1KORA 2WSFJ 3VMXA 1NKZB 3AE4C 2ZT9D 2ZAEB 1VCKA 3KDPB 1S9KD 2UWJE 1N73A 1LGHB 2R44A 4EIJA 4H44D 1G8JB 2YFLA 1NU1E 1KYOD 1NTZE 4XFJA 3AE8C 1YJWP 1SQBD 4N78E 1JEKA 1T2KC 3E1IA 4JYCA 2OTKE 1BSNA 1L0ND 3WUTA 1FC2C 1SQPJ 1J1DC 3B5NC 3H1IE 4D6TD 5AW2B 4I6MC 1QL2A 4P1BH 1ZRTE 1ZMEC 1NTMK 3RL0B 1ZV8A 1QLED 2A45H 4HM3A 4W7YA 2NVFA 1N86A 2AEFA 1E79H 3H1JD 3VMZA 5KLVG 3CXHI 4W7ZA 1JY2N 5APXA 1LT9C 2KLUA 2D2CD 2P2UA 3PJSK 2KI7B 1KB9E 2WMMA 1NYKA 3P8MC 2Z5HA 1DD4A 2BEZF 1A02F 1GL2B 4U3FE 5AVZB 3L74D 3KQGA 1X9VA 3TGUJ 4HH2A 1ZR2A 2E75B 2E43A 2QRXA 4Y28J 2GUSA 5AVYB 2FKWB 3A0HE 2W8ZA 3Q1MA 2E4PA 2WSEJ 2KSEA 1RF0A 3GTSA 5AVVB 2VRSA 3U1AA 1KILE 2B87B 3N0QA 1URQA 3Q3DA 2QJPC 3RK2D 3H32B 1OWAA 4TT3H 3M9BA 1NGMB 2YFIA 2B1XA 1YBKA 3FX0A 2Y0CA 1U7MA 1J1EB 2N9YB 2LXCB 3BRVB 3GMAA 2KP8A 2KYVA 1HH0A 5KJ7A 3FXEA 1BCCE 3BASA 3L70D 4HM8A 1BDCA 5M1BA 1NTMJ 4WY4A 4NBHD 3U59A 2QJPB 1A02J 1SQBG 3SFDC 5CBOA 3L36A 3CCEP 5B66H 1JUNA 5CJ0A 1Z56A 3W67A 1YJ9P 2OTJP 5B5EH 2BCCD 3CXHE 1N2DC 4L73A 1SQQK 2IPPA 1OX3A 3M0DC 2NWFA 5CCGD 2WWWA 3HD7C 1VQOP 2LXBA 2FYUK 3O6QA 3MGNA 3V5BA 2WVRA 3RK3D 2IZ1A 3AEBC 2NVEA 3GCEA 2Q6QA 1PPJE 1IZNB 1N73C 1NKNA 4ASWA 2A06D 4GOFA 4UB6H 2HYNA 1HGVA 2FYNB 1BCCJ 4IOIH 1FAVA 4NBDD 5KLVK 3HTKA 1JY3N 4RJTA 1GU4A 5DJUB 3L74E 1YTZT 2WQYC 1JB0J 3L74G 2O01J 2FXMA 1XTGB 3TF5A 2JWDA 3CXHH 2L5GB 1ULIA 2ZT9B 4DJGA 2WT7A 1K05A 3L73J 1FDMA 3VMAA 3T97A 3JCUE 3MD0A 4ZMDA 2FXOA 3BCCG 2D2CC 1EQ7A 3IAOA 3T97B 2QVAA 3AE2C 5TISE 1SQXD 2E42A 2P58A 1HWTC 3L75G 1RE3C 1NYHA 1HJ0A 4D6TJ 1O7NA 4U3FD 1J1DB 2YFJA 1M1JC 4N3YB 3Q5SA 1JY3P 2BCCJ 2JZAA 3Q2YA 1Y47A 3AEAC 2KIKA 2Z4EA 1L4AB 3HE4A 3W68A 3CCRP 3CX5D 2PRRA 1NTKD 4HJGH 3TSIA 1UUWA 1Q86Q 2NVGA 3N7NA 4C7NB 1GMJA 1RF1B 1MV8A 5GTIE 2JEEA 1X79B 3GKEA 4PD4D 1JCDA 3II6A 1SS1A 4Y99B 2W83C 2KNCA 5CBNA 2KXPB 4HJLA 4H0LB 3D70A 3HUSA 2XDJA 1NU1D 4HM1A 2L91A 3H1JJ 3GTEA 1D7MA 3B71A 1PFIA 1PV3A 4EMJB 3MUDC 2K9JA 2Q3EA 3V2NA 1NTMG 2QJYC 3A0BH 4LLHA 3S9OA 4N6JA 3CCQP 1TU3F 1QEXA 5AVUB 1O7WA 2R32A 4AIVA 3G6EP 3MUDA 3VMGD 2WSSH 1S2EA 4H13D 1AQ5A 2ZXEB 3L71J 1JY2O 1UIXA 3PTZA 5APTA 1L0LE 1KILD 1L0LG 3AE7C 3HE5B 1RF1A 3LW5J 3L70E 4C7NA 1RHZB 4PD4I 4NB9D 3CI9A 1IFNA 1WMKA 4U7JA 3TK1A 1ULJA 2IX7C 2AEJA 2R5DA 1ZR4A 2Q9IA 3FXDA 1DH3A 3H1KE 3KZIE 1QVFO 3SWYA 1NOHA 4NB8D 4L74A 4L76A 5GTHE 3VMHD 1P84D 2E74C 3L75D 1PGOA 2AXCA 3JCUH 5KLVJ 3TGUD 1U57A 1BCCD 5KLIC 3N4XA 4DOJA 1OW8A 1YJNP 2NRGA 3RK3B 3MIWA 2JKVA 3C8VA 3L75E 3BRTB 3A0HH 3HRNA 3VN0A 2Q3IA 3JC22 1X8YA 3WUUA 1ZRTD 2LKMA 2XZRA 2NPSA 5AVWB 3H1LJ 4YXWH 1JMBA 2KZIA 3L71E 2M5AB 4GIFA 5CCHC 1UIIA 2E76C 3EWKA 2HPCA 1PP9E 1FZFA 5GTIH 4ZKPA 4I7ZB 5GTHH 2QJKC 2Q1KA 3L71D 1KYOH 2A06G 3RGUA 1IFPA 4QDFB 2ZT9C 1H0TA 1KILA 2HFED 3AEEC 1KQLA 5CCGA 2M3EA 2XKMA 1MKMA 1VQ9P 1RY3A 2WPSA 2FYZA 1SQVK 3A7OA 1SQBE 1YTZI 3EQQA 2G8YA 2M0BA 2NZ2A 4H44C 2MKVA 2HPCB 5AEUA 1GTWA 5TJHA 1IC2A 2RH0A 4QMAA 1P84H 1SVFA 1PZQA 4C7RA 2HG5D 1HTLC 2BEQD 3VYIA 2K9YA 1LTTC 4A7PA 1NTKK 1T2KD 3F5HA 5AVXB 1RF0C 1W2EA 1Q90C 2GA1A 3M91A 3CCVP 2BMQA 1CI6B 2PP6A 1BSHA 4H0LC 3AECC 1L0LJ 2BMRA 4PV1C 3AEFC 1SQQJ 1OMIA 5AW9B 1SQVE 1MFTA 2K3RA 2XR8A 1SQPE 3LW5H 2HMJA 3I56P 2YXQB 2Q7CA 4I7ZC 1QVGO 2BMOA 3CWBJ 3M9HA 4GODA 5APUA 3GL0A 1FZCB 3H1KG 3C0DA 1ZOYC 1AVOA 3R2PA 1G2CB 1IJDB 4RKUJ 5AW1B 3A5TA 5AW5B 1Q2NA 3HE4B 1S3JA 2N1TC 1JM1A 1NHLA 5TISH 4IL6X 1EDIA 1N7SC 1OVVA 2IBZG 1SQXE 4IFMA 3V6IA 4EDFA 1HGZA 2KUBA 1BDDA 3L71G 1S72P 4D6TE 2Q5UA 3GLMA 2PAJA 4TLFA 1JCCA 3HUSB 5AVSB 4I1LA 5AVRB 1FOSF 3L72D 2XNXA 1NTKE 2N1TB 3S4RA 3NXSA 3GF3A 3H1IJ 2WTYA 3BATA 1J1EC 3JSVC 1PPJD 1JM0A 1VQ8P 1FDOA 1FU1A 4DCKA 3WMM0 3CWBG 3KPEA 3CL3D 1RF1C 3O8ZA 4HM2A 2GBWA 2K37A 2XRXA 1VQ5P 1FZCC 4UB8E 1SQPK 5CCGC 2A06E 3U1CA 3WU2H 1JMMA 1FQTA 2V7QJ 3L72E 3FWNA 4GOEA 4JPZB 1JY3O 2WZ7A 1NTZG 2HR3A 3MTUE 1NJIQ 2XU6A 3H1KD 4HKVA 3SFEC 1AV1A 4OH8B 4EI2A 3OJAB 2CKFA 2ZYLA 1GL2D 1M8OB 4N78D 1LTJB 1NAYA 3EN1A 2KOGA 2M8RA 1RIEA 2WT7B 1LTBC 2YO2A 4AUWA 4R4LA 2E75C 2B24A 1NU1G 5H2FH 4H0LD 1EZVG 1LTIC 2QA4P 5CCHA 2NUMA 4PV1D 1SQPD 3I5CA 4NBED 2WSCH 2W6AA 1K9MQ 1FZEA 4PJ0E 2Y0EA 1O7MA 4NBGD 2FYUD 4EYYQ 3KXDA 4JF7A 1FZGA 3RK2B 5KAFH 3IR9A 1L0NK 1PGPA 1QX8A 3MZWB 2B89A 2BCCE 2K9JB 1IFIA 5APVA 5L8RJ 2JO6A 1SQVJ 4H13B 2JWAA 3CX5H 3AE5C 1SP4A 2H8PD 3CCUP 3FGAD 3IFMA 1IFDA 1AVYA 1LTJC 1DEBA 3V2RA 1KB9H 4Y99C 3P7KA 3BVHA 1NTZD 1Q7YQ 3GZYA 3D89A 1VF5B 1E5WA 1OVRA 3QH9A 2HLOA 2H88C 1JTHA 2ZJSE 1YYCA 3AE9C 5BVZA 1HJBA 5BU5A 1AA0A 4H13C 1L4AA 2FBWC 1YHQP 2QIWA 3CMEP 3LIDA 1KFMA 3GHGC 2PGDA 4JQ0D 1VQKP 1GK6A 1L0LK 1G1JA 1PIXA 1VF5C 2W6JH 2O01N 1SLQA 1R5LA 4O9BA 4OGQD 1NO4A 3CX5I 2PFXA 2KK7A 2OTLP 3HTKB 1GDTA 1NH4A 1U7JA 1L0NE 1YITP 3GW6A 3P8CE 4UB6E 1SQPG 3B5NA 1VQ4P 3CLQA 3G9RA 3L73D 1JNMA 3GF7A 1SQVD 1EXIA 3FOUA 3AE3C 3CCMP 4JBZA 1DX7A 2OYIC 2OQQA 1PPJG 4ZKUA 3OA7A 1VQMP 3G71P 5AW3B 1RFSA 3CMAP 1ZN5A 2HODB 2WSCJ 1USDA 1NVOA 1VQLP 1KB9I 2XSHA 1H0TB 1SFCB 3CCSP 1GZLA 3NTNA 4OWFA 3G4SP 5E79E 2IBZE 4BRYA 2FYUE 2R3SA 2E76D 3V4WA 4K3AA 3SWKA 4QURA 3H1LE 2C0WA 3L75J 1KMIZ 1LJ2A 1EDLA 4WWIA 4HM0A 4XE5B 4OGQB 1FJPA 1BGYD 2HMLA 1QL1A 1SFCC 1M1KQ 3CC4P 2A45G 1KQGB 3V4QA 1L0NJ 3WUVA 1KILC 3L73E 3K5BA 2FY8A 2HMNA 2B87A 1NU1J 3L35A 1NDOA 3H1HG 1P84I 1PP9D 1JY2P 3UIAA 4ZNCA 1G8KB 1Q90D 1NTME 5KTBA 4QUQA 3EFGA 3CCJP 2ZVOB 2O1KA 1O7HA 1YQ4C 1NAFA 3VP9A 3L72G 5AW0B 3RL0C 1FZAA 2FYUJ 1OFCX 4YTPC 1O7GA 1PGJA 1NTZJ 2YNYA 4LC1A 1KYOE 2QE7H 2KLVA 1M1JA 1RQVA 1MZ9A 3ITKA 1Q82Q 1RH5B 1VF5D 2W90A 5K5GB 1SQQE 4EOTA 1PP9J 2YXRB 2KS1A 5CCHD 5EFWB 3TNUB 4NBBD 1HVVA 3H32A 3CWBD 1URQD 3AZCA 1S5LE 1EZVE 4HKZH 2C9NY 4IFFA 1OVUA 3CX5E 3OAKA 1WRGA 2IYOA 1IO4A 1CI6A 2GM4A 2O1JA 2CPSA 3H1IG 4WY4D 3S1KA 4R4MA 1DD3A 2D2CB 3VMYA 1PGQA 3SWFA 2P7JA 1FDIA 3USSA 3G3ZA 2YIUB 5E79H 1KZUB 2IDBA 3KHUA 1M7LA 2JR8A 1LWUB 1GU5A 3CC2P 2P10A 1L4AC 2HMMA 3GB4A 2YVJB 3OW2O 3VCPA 2ZVNB 2YKQA 4WVZA 1BE3G 5KKZC 3CPWO 1EZVD 4P1CH 2MJZA 1VQNP 1LP1A 2P1JA 3H1HD 2KB7P 3GHGA 2ZYDA 1T3JA 4RESB 4PD4H 1O7PA 4WBAA 4H44B 3B5NB 2FYUG 3F89A 1VL2A 3H1HE 2RN0A 2B9BA 3RK3E 4C46A 2RKLA 1KTMA 5B66E 1VM9A 4IL6H 1OW6A 1JO5A 5CXMA 2QPZA 1N73B 1K73Q 3P32A 4GDOA 1LTAC 1FZCA 2Y9YA 3A0BE 2FYNC 2OYHB 1MUUA 1ZXGA 2N1TA 3A3YB 2JJLA 1N7SA 3CD6P 3VP8A 1RE3A 2E75D 5DJTB 1SQXJ 1KN7A 1K8AQ 5KJ7C 3D6ZA 5KAFE 5APYA 2BASA 1QGKB 2H89C 1HF9A 2DW3A 2C0XA 5CJ4A 1LWUC 4HYTB 3CC7P 4IFDK 3TNUA 3VCAA 2IZ0A 3Q5PA 3H1JE 1IK9A 1LTSC 1BCCG 4NPDA 1NTKJ 3CXHD 5AW4B 1JTHB 4NBFD 3H1HJ 5B5EE 3VOPA 5APQA 1UUVA 2NPSD 1M56D 1KD1Q 1S5LH 1SQBK 1KB9D 2I8DA 2OYHA 4B86A 1L0NG 1FBMA 1M57D 4BWNA 1SQQD 5KLIB 2XSOA 2OYOA 3D6YA 3EFFK 1RE4C 4HM6A 2YMKA 2OYIB 3ZDMA 3PH0A 2Y0DA 2OYHC 3R4YA 1VDFA 3H1LG 1SQBJ 1GW4A 3GL2A 1USEA 2ZXXA 3H6PA 1R5SA 1KC8Q 1VQPP 3WU2E 4KT0J 3RBZA 2WITA 3EQ2A 3FWLA 5BU8B 1X0TA 1AQTA 2IFMA 2SPZA 5HL4A 2QJKB 1Y9BA 4I2LC 4NPEA 1YIJP 5C39A 1EG9A 3PP5A 3DQYA 4KHXA 1WQLA 4QDDA 1GL2C 5KAIE 1W5CE 1J2JB 3RL0g 4NBCD 3B5ND 1L0LD 5AVQB 1AFOA 4AYCA 1M90Q 3HD7D 2NPSB 2O3JA 1YI2P 2E5YA 3A2AA 3BCCE 4JYBA 2Q3WA 2YIUC 3RK3C 1S1CX 4HM4A 3VMID 1KILB 1KQSO 2HMKA 4QDFA 2OGUA 3P8CD 1H88A 2I7FA 2I1JA 1BGYG 2OYIA 3M9QA 2WPRA 1OIPA 1LT1A 1MFZA 2FFDB 3GHGB 5CMZA 3H1KJ 4YPCA 2ITAA 3Q5RA 1LT9A 3PRJA 2KS1B 1H89A 3NMDA 4QUPA 1EDJA 3E1RA 1DIPA 1S5LX 1Y8AA 1PL5A 2E74B 2R3CA 1SQQG 3E7KA 2G3AA 5APWA 5KAIH 3C9IA 1T3UA 4RO0A 3GZXA 3L37A 4PV1B 2DE7D 1NTZK 2WPVB 5KJ7D 1NU1K 3SSUA 3H1JG 4Z1MH 2GUVA 2FFDC 1NWQA 1CZQA 3MP7B 2E5TA 1ZLLA 2IFNA 1VPCA 1KFNA 5APSA 4OVNF 1EXJA 4UB8H 1X22A 3CCLP 2JDIH 4PJ0H 1GD2E 3D71A 3M0DA 1FS0E 3HD7A 2NPSC 2E76B 3KYQA 1SQVG 2Y9ZA 2J58A 1SFCD 1N7SB 2QJYB 2CK3H 2WPQA 2POHA 5KLVE 3IN6A 1FJKA 1FZBA 2I1KA 1LNQA 2DE5D 1EZVI 2QM7A 1YQ3C 1GK4A 1CSBA 4WY4B 1G2CA 3AEDC 4BXLA 4MN4C 2HMOA 3ABVC 4YXDC 4QCKA 1EC5A 2IBZI 3BCCD 4OGQC 1EDKA 1OW7A 2M3BA 4U3FJ 1SQXG 1H8AA 2B88A 4BRYB 4U3FG 2E4QA 1S9KE 5KKZB 2P67A 3L74J 1R8EA 1SFCA 1SJGA 2CPBA 1SQXK 3GG2A 2WSEH 1NTKG 1VQ6P 1KQFB 2FFDA 3RL0D 5BOKA 4AAYB
chains in the Genus database with same CATH topology
1O7MA 2E4PA 4HJLA 4NBGD 4OGQD 5HL4A 3L75E 4QDCA 3GTSA 2E75D 3TGUE 4NBDD 2BMQA 4HM1A 3CWBE 3GTEA 3L73E 1BGYE 1EG9A 2HMNA 3DQYA 4EMJB 3N0QA 1WQLA 1NDOA 2ZT9D 4QDDA 2QJYC 1VCKA 3L74E 2QJPC 2BMRA 1L0NE 4HM2A 1SQVE 3L71E 2GBWA 4NBCD 2XR8A 1G8KB 1SQPE 2XRXA 3VCAA 2HMJA 4H44D 2YFIA 1NTME 1G8JB 1O7WA 4QUQA 2B1XA 5KLVE 3H1JE 2BMOA 2YFLA 2BCCE 2A06E 1ULIA 3GL0A 2E74D 1BE3E 1PP9E 1NU1E 2DE5D 3BCCE 3FOUA 1NTZE 2Q3WA 1O7HA 2YIUC 4AIVA 2HMMA 1FQTA 2YVJB 2JO6A 3C0DA 2QJKC 3GB4A 3VCPA 1BCCE 4HM4A 4NBFD 3VMGD 4HM8A 3L72E 3VMID 4QDFB 2NUKA 5KKZC 2HMKA 1UUVA 4QDFA 4NBAD 4P1CH 2HMOA 4H13D 5AEWA 2I7FA 4NBHD 1RFSA 4QCKA 3H1IE 1O7GA 4HKVA 4P1BH 1L0LE 1P84E 1ZRTE 1KYOE 1JM1A 1O7NA 2CKFA 2ZYLA 3L70E 1O7PA 2XSHA 2YFJA 4HM3A 1SQBE 3GZYA 3D89A 3EQQA 3GOBA 1SQXE 2NVFA 2XSOA 4PD4E 4NB9D 2JZAA 3EN1A 3H1HE 4HM5A 4QUPA 1VF5D 1ULJA 3CXHE 1RIEA 2IBZE 4HM6A 2FYUE 2E4QA 2D2CD 1SQQE 5AEUA 1KB9E 2E76D 1VM9A 1NYKA 3H1KE 4D6TE 1UUWA 2NWFA 4QURA 3H1LE 4NB8D 4NBBD 4U3FE 2B24A 1SJGA 2NVGA 3GL2A 3GZXA 2DE6D 5CXMA 2QPZA 2DE7D 4H0LD 3VMHD 3AZCA 1EZVE 1NTKE 3GKEA 4HM0A 2NUMA 4PV1D 2FYNC 3CX5E 5BOKA 2NVEA 3GCEA 1PPJE 2HMLA 4NBED 4AAYB 2GBXA 1Q90C 5KLIC 4HM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7M A;  2E4P A;  4HJL A;  4NBG D;  4OGQ D;  5HL4 A;  3L75 E;  4QDC A;  3GTS A;  2E75 D;  3TGU E;  4NBD D;  2BMQ A;  4HM1 A;  3CWB E;  3GTE A;  3L73 E;  1BGY E;  1EG9 A;  2HMN A;  3DQY A;  4EMJ B;  3N0Q A;  1WQL A;  1NDO A;  2ZT9 D;  4QDD A;  2QJY C;  1VCK A;  3L74 E;  2QJP C;  2BMR A;  1L0N E;  4HM2 A;  1SQV E;  3L71 E;  2GBW A;  4NBC D;  2XR8 A;  1G8K B;  1SQP E;  2XRX A;  3VCA A;  2HMJ A;  4H44 D;  2YFI A;  1NTM E;  1G8J B;  1O7W A;  4QUQ A;  2B1X A;  5KLV E;  3H1J E;  2BMO A;  2YFL A;  2BCC E;  2A06 E;  1ULI A;  3GL0 A;  2E74 D;  1BE3 E;  1PP9 E;  1NU1 E;  2DE5 D;  3BCC E;  3FOU A;  1NTZ E;  2Q3W A;  1O7H A;  2YIU C;  4AIV A;  2HMM A;  1FQT A;  2YVJ B;  2JO6 A;  3C0D A;  2QJK C;  3GB4 A;  3VCP A;  1BCC E;  4HM4 A;  4NBF D;  3VMG D;  4HM8 A;  3L72 E;  3VMI D;  4QDF B;  2NUK A;  5KKZ C;  2HMK A;  1UUV A;  4QDF A;  4NBA D;  4P1C H;  2HMO A;  4H13 D;  5AEW A;  2I7F A;  4NBH D;  1RFS A;  4QCK A;  3H1I E;  1O7G A;  4HKV A;  4P1B H;  1L0L E;  1P84 E;  1ZRT E;  1KYO E;  1JM1 A;  1O7N A;  2CKF A;  2ZYL A;  3L70 E;  1O7P A;  2XSH A;  2YFJ A;  4HM3 A;  1SQB E;  3GZY A;  3D89 A;  3EQQ A;  3GOB A;  1SQX E;  2NVF A;  2XSO A;  4PD4 E;  4NB9 D;  2JZA A;  3EN1 A;  3H1H E;  4HM5 A;  4QUP A;  1VF5 D;  1ULJ A;  3CXH E;  1RIE A;  2IBZ E;  4HM6 A;  2FYU E;  2E4Q A;  2D2C D;  1SQQ E;  5AEU A;  1KB9 E;  2E76 D;  1VM9 A;  1NYK A;  3H1K E;  4D6T E;  1UUW A;  2NWF A;  4QUR A;  3H1L E;  4NB8 D;  4NBB D;  4U3F E;  2B24 A;  1SJG A;  2NVG A;  3GL2 A;  3GZX A;  2DE6 D;  5CXM A;  2QPZ A;  2DE7 D;  4H0L D;  3VMH D;  3AZC A;  1EZV E;  1NTK E;  3GKE A;  4HM0 A;  2NUM A;  4PV1 D;  2FYN C;  3CX5 E;  5BOK A;  2NVE A;  3GCE A;  1PPJ E;  2HML A;  4NBE D;  4AAY B;  2GBX A;  1Q90 C;  5KLI C;  4HM7 A; 
#chains in the Genus database with same CATH topology
 1IFM A;  2V7Q H;  2XND H;  4GT1 A;  4QDC A;  1GW3 A;  4GKG A;  2YKP A;  3CWB E;  1Q81 Q;  1BGY E;  3M06 A;  1JOC A;  5AW6 B;  1T8Z A;  2OAR A;  2KZJ A;  1BE3 D;  2ZYA A;  2M5A A;  3H1L D;  3PLN A;  2W27 A;  4ASV A;  5AVT B;  2H43 A;  2IBZ D;  2N9B A;  4WY4 C;  2W6B A;  3RBX A;  3B4S A;  2E74 D;  2K1A A;  2Z5I A;  3M0A A;  5CHX A;  3L70 J;  4K35 A;  1N7L A;  3NFQ A;  4W80 A;  3VTP C;  2NUK A;  1VQ7 P;  4NBA D;  4DZO A;  2HOD A;  2JP3 A;  2AEM A;  4IL6 E;  3KZI H;  3C1L A;  1LWU A;  3O6Q B;  3TDK A;  1ZP0 C;  3GOB A;  1L4A D;  4PD4 E;  4M3L A;  4HB1 A;  4WB4 A;  1W2B O;  1S4X A;  2YMY A;  2J5U A;  3L4F A;  1T6A A;  1BE3 J;  3V2Q A;  1FE6 A;  4DT0 A;  1BGY J;  3HE5 A;  1RE4 A;  3H1I D;  2K88 A;  3I55 P;  3TYY A;  2V4H A;  2ZYG A;  2GBX A;  3L70 G;  5AW8 B;  4XA4 A;  3TGU E;  1ZW0 A;  3TGU G;  1IK7 A;  3AEG C;  2AXT H;  2QEX P;  2QSI A;  3AE6 C;  4AQR D;  1XTC C;  5H2F E;  2WSF H;  2QM8 A;  3LIE A;  1K04 A;  5AW7 B;  1M1J B;  1WT6 A;  2JO1 A;  1AJY A;  2BCC G;  4KJM A;  1BE3 E;  1LTG C;  5KLV D;  1NTM D;  4D6T G;  1URQ C;  3QWO C;  2KSJ A;  2LR2 A;  1HUC A;  3MHV A;  1PP9 G;  1G1I A;  5AEW A;  3RK2 C;  3BCC J;  3IF4 A;  2IYP A;  3V2P A;  1IFJ A;  1CW5 A;  1P84 E;  3PHL A;  1KV4 A;  2ZFC A;  3H25 A;  1KYO I;  3L73 G;  1HBW A;  2YO3 A;  4HM5 A;  2QG4 A;  3HD7 B;  1URQ B;  3B8E B;  3L72 J;  2YKO A;  1LTJ A;  2H7H A;  2AXT E;  3AE1 C;  2DE6 D;  1LT9 B;  2J59 M;  2O01 H;  2C9L Y;  2RMZ A;  4LGD E;  2KNC B;  2XV5 A;  3HUS C;  1N8R Q;  2FXP A;  4L75 A;  2A45 I;  1FOS E;  1L2P A;  2R5B A;  1LP1 B;  1OZH A;  4HM7 A;  1RQU A;  4NPF X;  1OXZ A;  2N1T D;  1GL2 A;  1DEE G;  1N7S D;  4CPG A;  1KOR A;  2WSF J;  3VMX A;  1NKZ B;  3AE4 C;  2ZT9 D;  2ZAE B;  1VCK A;  3KDP B;  1S9K D;  2UWJ E;  1N73 A;  1LGH B;  2R44 A;  4EIJ A;  4H44 D;  1G8J B;  2YFL A;  1NU1 E;  1KYO D;  1NTZ E;  4XFJ A;  3AE8 C;  1YJW P;  1SQB D;  4N78 E;  1JEK A;  1T2K C;  3E1I A;  4JYC A;  2OTK E;  1BSN A;  1L0N D;  3WUT A;  1FC2 C;  1SQP J;  1J1D C;  3B5N C;  3H1I E;  4D6T D;  5AW2 B;  4I6M C;  1QL2 A;  4P1B H;  1ZRT E;  1ZME C;  1NTM K;  3RL0 B;  1ZV8 A;  1QLE D;  2A45 H;  4HM3 A;  4W7Y A;  2NVF A;  1N86 A;  2AEF A;  1E79 H;  3H1J D;  3VMZ A;  5KLV G;  3CXH I;  4W7Z A;  1JY2 N;  5APX A;  1LT9 C;  2KLU A;  2D2C D;  2P2U A;  3PJS K;  2KI7 B;  1KB9 E;  2WMM A;  1NYK A;  3P8M C;  2Z5H A;  1DD4 A;  2BEZ F;  1A02 F;  1GL2 B;  4U3F E;  5AVZ B;  3L74 D;  3KQG A;  1X9V A;  3TGU J;  4HH2 A;  1ZR2 A;  2E75 B;  2E43 A;  2QRX A;  4Y28 J;  2GUS A;  5AVY B;  2FKW B;  3A0H E;  2W8Z A;  3Q1M A;  2E4P A;  2WSE J;  2KSE A;  1RF0 A;  3GTS A;  5AVV B;  2VRS A;  3U1A A;  1KIL E;  2B87 B;  3N0Q A;  1URQ A;  3Q3D A;  2QJP C;  3RK2 D;  3H32 B;  1OWA A;  4TT3 H;  3M9B A;  1NGM B;  2YFI A;  2B1X A;  1YBK A;  3FX0 A;  2Y0C A;  1U7M A;  1J1E B;  2N9Y B;  2LXC B;  3BRV B;  3GMA A;  2KP8 A;  2KYV A;  1HH0 A;  5KJ7 A;  3FXE A;  1BCC E;  3BAS A;  3L70 D;  4HM8 A;  1BDC A;  5M1B A;  1NTM J;  4WY4 A;  4NBH D;  3U59 A;  2QJP B;  1A02 J;  1SQB G;  3SFD C;  5CBO A;  3L36 A;  3CCE P;  5B66 H;  1JUN A;  5CJ0 A;  1Z56 A;  3W67 A;  1YJ9 P;  2OTJ P;  5B5E H;  2BCC D;  3CXH E;  1N2D C;  4L73 A;  1SQQ K;  2IPP A;  1OX3 A;  3M0D C;  2NWF A;  5CCG D;  2WWW A;  3HD7 C;  1VQO P;  2LXB A;  2FYU K;  3O6Q A;  3MGN A;  3V5B A;  2WVR A;  3RK3 D;  2IZ1 A;  3AEB C;  2NVE A;  3GCE A;  2Q6Q A;  1PPJ E;  1IZN B;  1N73 C;  1NKN A;  4ASW A;  2A06 D;  4GOF A;  4UB6 H;  2HYN A;  1HGV A;  2FYN B;  1BCC J;  4IOI H;  1FAV A;  4NBD D;  5KLV K;  3HTK A;  1JY3 N;  4RJT A;  1GU4 A;  5DJU B;  3L74 E;  1YTZ T;  2WQY C;  1JB0 J;  3L74 G;  2O01 J;  2FXM A;  1XTG B;  3TF5 A;  2JWD A;  3CXH H;  2L5G B;  1ULI A;  2ZT9 B;  4DJG A;  2WT7 A;  1K05 A;  3L73 J;  1FDM A;  3VMA A;  3T97 A;  3JCU E;  3MD0 A;  4ZMD A;  2FXO A;  3BCC G;  2D2C C;  1EQ7 A;  3IAO A;  3T97 B;  2QVA A;  3AE2 C;  5TIS E;  1SQX D;  2E42 A;  2P58 A;  1HWT C;  3L75 G;  1RE3 C;  1NYH A;  1HJ0 A;  4D6T J;  1O7N A;  4U3F D;  1J1D B;  2YFJ A;  1M1J C;  4N3Y B;  3Q5S A;  1JY3 P;  2BCC J;  2JZA A;  3Q2Y A;  1Y47 A;  3AEA C;  2KIK A;  2Z4E A;  1L4A B;  3HE4 A;  3W68 A;  3CCR P;  3CX5 D;  2PRR A;  1NTK D;  4HJG H;  3TSI A;  1UUW A;  1Q86 Q;  2NVG A;  3N7N A;  4C7N B;  1GMJ A;  1RF1 B;  1MV8 A;  5GTI E;  2JEE A;  1X79 B;  3GKE A;  4PD4 D;  1JCD A;  3II6 A;  1SS1 A;  4Y99 B;  2W83 C;  2KNC A;  5CBN A;  2KXP B;  4HJL A;  4H0L B;  3D70 A;  3HUS A;  2XDJ A;  1NU1 D;  4HM1 A;  2L91 A;  3H1J J;  3GTE A;  1D7M A;  3B71 A;  1PFI A;  1PV3 A;  4EMJ B;  3MUD C;  2K9J A;  2Q3E A;  3V2N A;  1NTM G;  2QJY C;  3A0B H;  4LLH A;  3S9O A;  4N6J A;  3CCQ P;  1TU3 F;  1QEX A;  5AVU B;  1O7W A;  2R32 A;  4AIV A;  3G6E P;  3MUD A;  3VMG D;  2WSS H;  1S2E A;  4H13 D;  1AQ5 A;  2ZXE B;  3L71 J;  1JY2 O;  1UIX A;  3PTZ A;  5APT A;  1L0L E;  1KIL D;  1L0L G;  3AE7 C;  3HE5 B;  1RF1 A;  3LW5 J;  3L70 E;  4C7N A;  1RHZ B;  4PD4 I;  4NB9 D;  3CI9 A;  1IFN A;  1WMK A;  4U7J A;  3TK1 A;  1ULJ A;  2IX7 C;  2AEJ A;  2R5D A;  1ZR4 A;  2Q9I A;  3FXD A;  1DH3 A;  3H1K E;  3KZI E;  1QVF O;  3SWY A;  1NOH A;  4NB8 D;  4L74 A;  4L76 A;  5GTH E;  3VMH D;  1P84 D;  2E74 C;  3L75 D;  1PGO A;  2AXC A;  3JCU H;  5KLV J;  3TGU D;  1U57 A;  1BCC D;  5KLI C;  3N4X A;  4DOJ A;  1OW8 A;  1YJN P;  2NRG A;  3RK3 B;  3MIW A;  2JKV A;  3C8V A;  3L75 E;  3BRT B;  3A0H H;  3HRN A;  3VN0 A;  2Q3I A;  3JC2 2;  1X8Y A;  3WUU A;  1ZRT D;  2LKM A;  2XZR A;  2NPS A;  5AVW B;  3H1L J;  4YXW H;  1JMB A;  2KZI A;  3L71 E;  2M5A B;  4GIF A;  5CCH C;  1UII A;  2E76 C;  3EWK A;  2HPC A;  1PP9 E;  1FZF A;  5GTI H;  4ZKP A;  4I7Z B;  5GTH H;  2QJK C;  2Q1K A;  3L71 D;  1KYO H;  2A06 G;  3RGU A;  1IFP A;  4QDF B;  2ZT9 C;  1H0T A;  1KIL A;  2HFE D;  3AEE C;  1KQL A;  5CCG A;  2M3E A;  2XKM A;  1MKM A;  1VQ9 P;  1RY3 A;  2WPS A;  2FYZ A;  1SQV K;  3A7O A;  1SQB E;  1YTZ I;  3EQQ A;  2G8Y A;  2M0B A;  2NZ2 A;  4H44 C;  2MKV A;  2HPC B;  5AEU A;  1GTW A;  5TJH A;  1IC2 A;  2RH0 A;  4QMA A;  1P84 H;  1SVF A;  1PZQ A;  4C7R A;  2HG5 D;  1HTL C;  2BEQ D;  3VYI A;  2K9Y A;  1LTT C;  4A7P A;  1NTK K;  1T2K D;  3F5H A;  5AVX B;  1RF0 C;  1W2E A;  1Q90 C;  2GA1 A;  3M91 A;  3CCV P;  2BMQ A;  1CI6 B;  2PP6 A;  1BSH A;  4H0L C;  3AEC C;  1L0L J;  2BMR A;  4PV1 C;  3AEF C;  1SQQ J;  1OMI A;  5AW9 B;  1SQV E;  1MFT A;  2K3R A;  2XR8 A;  1SQP E;  3LW5 H;  2HMJ A;  3I56 P;  2YXQ B;  2Q7C A;  4I7Z C;  1QVG O;  2BMO A;  3CWB J;  3M9H A;  4GOD A;  5APU A;  3GL0 A;  1FZC B;  3H1K G;  3C0D A;  1ZOY C;  1AVO A;  3R2P A;  1G2C B;  1IJD B;  4RKU J;  5AW1 B;  3A5T A;  5AW5 B;  1Q2N A;  3HE4 B;  1S3J A;  2N1T C;  1JM1 A;  1NHL A;  5TIS H;  4IL6 X;  1EDI A;  1N7S C;  1OVV A;  2IBZ G;  1SQX E;  4IFM A;  3V6I A;  4EDF A;  1HGZ A;  2KUB A;  1BDD A;  3L71 G;  1S72 P;  4D6T E;  2Q5U A;  3GLM A;  2PAJ A;  4TLF A;  1JCC A;  3HUS B;  5AVS B;  4I1L A;  5AVR B;  1FOS F;  3L72 D;  2XNX A;  1NTK E;  2N1T B;  3S4R A;  3NXS A;  3GF3 A;  3H1I J;  2WTY A;  3BAT A;  1J1E C;  3JSV C;  1PPJ D;  1JM0 A;  1VQ8 P;  1FDO A;  1FU1 A;  4DCK A;  3WMM 0;  3CWB G;  3KPE A;  3CL3 D;  1RF1 C;  3O8Z A;  4HM2 A;  2GBW A;  2K37 A;  2XRX A;  1VQ5 P;  1FZC C;  4UB8 E;  1SQP K;  5CCG C;  2A06 E;  3U1C A;  3WU2 H;  1JMM A;  1FQT A;  2V7Q J;  3L72 E;  3FWN A;  4GOE A;  4JPZ B;  1JY3 O;  2WZ7 A;  1NTZ G;  2HR3 A;  3MTU E;  1NJI Q;  2XU6 A;  3H1K D;  4HKV A;  3SFE C;  1AV1 A;  4OH8 B;  4EI2 A;  3OJA B;  2CKF A;  2ZYL A;  1GL2 D;  1M8O B;  4N78 D;  1LTJ B;  1NAY A;  3EN1 A;  2KOG A;  2M8R A;  1RIE A;  2WT7 B;  1LTB C;  2YO2 A;  4AUW A;  4R4L A;  2E75 C;  2B24 A;  1NU1 G;  5H2F H;  4H0L D;  1EZV G;  1LTI C;  2QA4 P;  5CCH A;  2NUM A;  4PV1 D;  1SQP D;  3I5C A;  4NBE D;  2WSC H;  2W6A A;  1K9M Q;  1FZE A;  4PJ0 E;  2Y0E A;  1O7M A;  4NBG D;  2FYU D;  4EYY Q;  3KXD A;  4JF7 A;  1FZG A;  3RK2 B;  5KAF H;  3IR9 A;  1L0N K;  1PGP A;  1QX8 A;  3MZW B;  2B89 A;  2BCC E;  2K9J B;  1IFI A;  5APV A;  5L8R J;  2JO6 A;  1SQV J;  4H13 B;  2JWA A;  3CX5 H;  3AE5 C;  1SP4 A;  2H8P D;  3CCU P;  3FGA D;  3IFM A;  1IFD A;  1AVY A;  1LTJ C;  1DEB A;  3V2R A;  1KB9 H;  4Y99 C;  3P7K A;  3BVH A;  1NTZ D;  1Q7Y Q;  3GZY A;  3D89 A;  1VF5 B;  1E5W A;  1OVR A;  3QH9 A;  2HLO A;  2H88 C;  1JTH A;  2ZJS E;  1YYC A;  3AE9 C;  5BVZ A;  1HJB A;  5BU5 A;  1AA0 A;  4H13 C;  1L4A A;  2FBW C;  1YHQ P;  2QIW A;  3CME P;  3LID A;  1KFM A;  3GHG C;  2PGD A;  4JQ0 D;  1VQK P;  1GK6 A;  1L0L K;  1G1J A;  1PIX A;  1VF5 C;  2W6J H;  2O01 N;  1SLQ A;  1R5L A;  4O9B A;  4OGQ D;  1NO4 A;  3CX5 I;  2PFX A;  2KK7 A;  2OTL P;  3HTK B;  1GDT A;  1NH4 A;  1U7J A;  1L0N E;  1YIT P;  3GW6 A;  3P8C E;  4UB6 E;  1SQP G;  3B5N A;  1VQ4 P;  3CLQ A;  3G9R A;  3L73 D;  1JNM A;  3GF7 A;  1SQV D;  1EXI A;  3FOU A;  3AE3 C;  3CCM P;  4JBZ A;  1DX7 A;  2OYI C;  2OQQ A;  1PPJ G;  4ZKU A;  3OA7 A;  1VQM P;  3G71 P;  5AW3 B;  1RFS A;  3CMA P;  1ZN5 A;  2HOD B;  2WSC J;  1USD A;  1NVO A;  1VQL P;  1KB9 I;  2XSH A;  1H0T B;  1SFC B;  3CCS P;  1GZL A;  3NTN A;  4OWF A;  3G4S P;  5E79 E;  2IBZ E;  4BRY A;  2FYU E;  2R3S A;  2E76 D;  3V4W A;  4K3A A;  3SWK A;  4QUR A;  3H1L E;  2C0W A;  3L75 J;  1KMI Z;  1LJ2 A;  1EDL A;  4WWI A;  4HM0 A;  4XE5 B;  4OGQ B;  1FJP A;  1BGY D;  2HML A;  1QL1 A;  1SFC C;  1M1K Q;  3CC4 P;  2A45 G;  1KQG B;  3V4Q A;  1L0N J;  3WUV A;  1KIL C;  3L73 E;  3K5B A;  2FY8 A;  2HMN A;  2B87 A;  1NU1 J;  3L35 A;  1NDO A;  3H1H G;  1P84 I;  1PP9 D;  1JY2 P;  3UIA A;  4ZNC A;  1G8K B;  1Q90 D;  1NTM E;  5KTB A;  4QUQ A;  3EFG A;  3CCJ P;  2ZVO B;  2O1K A;  1O7H A;  1YQ4 C;  1NAF A;  3VP9 A;  3L72 G;  5AW0 B;  3RL0 C;  1FZA A;  2FYU J;  1OFC X;  4YTP C;  1O7G A;  1PGJ A;  1NTZ J;  2YNY A;  4LC1 A;  1KYO E;  2QE7 H;  2KLV A;  1M1J A;  1RQV A;  1MZ9 A;  3ITK A;  1Q82 Q;  1RH5 B;  1VF5 D;  2W90 A;  5K5G B;  1SQQ E;  4EOT A;  1PP9 J;  2YXR B;  2KS1 A;  5CCH D;  5EFW B;  3TNU B;  4NBB D;  1HVV A;  3H32 A;  3CWB D;  1URQ D;  3AZC A;  1S5L E;  1EZV E;  4HKZ H;  2C9N Y;  4IFF A;  1OVU A;  3CX5 E;  3OAK A;  1WRG A;  2IYO A;  1IO4 A;  1CI6 A;  2GM4 A;  2O1J A;  2CPS A;  3H1I G;  4WY4 D;  3S1K A;  4R4M A;  1DD3 A;  2D2C B;  3VMY A;  1PGQ A;  3SWF A;  2P7J A;  1FDI A;  3USS A;  3G3Z A;  2YIU B;  5E79 H;  1KZU B;  2IDB A;  3KHU A;  1M7L A;  2JR8 A;  1LWU B;  1GU5 A;  3CC2 P;  2P10 A;  1L4A C;  2HMM A;  3GB4 A;  2YVJ B;  3OW2 O;  3VCP A;  2ZVN B;  2YKQ A;  4WVZ A;  1BE3 G;  5KKZ C;  3CPW O;  1EZV D;  4P1C H;  2MJZ A;  1VQN P;  1LP1 A;  2P1J A;  3H1H D;  2KB7 P;  3GHG A;  2ZYD A;  1T3J A;  4RES B;  4PD4 H;  1O7P A;  4WBA A;  4H44 B;  3B5N B;  2FYU G;  3F89 A;  1VL2 A;  3H1H E;  2RN0 A;  2B9B A;  3RK3 E;  4C46 A;  2RKL A;  1KTM A;  5B66 E;  1VM9 A;  4IL6 H;  1OW6 A;  1JO5 A;  5CXM A;  2QPZ A;  1N73 B;  1K73 Q;  3P32 A;  4GDO A;  1LTA C;  1FZC A;  2Y9Y A;  3A0B E;  2FYN C;  2OYH B;  1MUU A;  1ZXG A;  2N1T A;  3A3Y B;  2JJL A;  1N7S A;  3CD6 P;  3VP8 A;  1RE3 A;  2E75 D;  5DJT B;  1SQX J;  1KN7 A;  1K8A Q;  5KJ7 C;  3D6Z A;  5KAF E;  5APY A;  2BAS A;  1QGK B;  2H89 C;  1HF9 A;  2DW3 A;  2C0X A;  5CJ4 A;  1LWU C;  4HYT B;  3CC7 P;  4IFD K;  3TNU A;  3VCA A;  2IZ0 A;  3Q5P A;  3H1J E;  1IK9 A;  1LTS C;  1BCC G;  4NPD A;  1NTK J;  3CXH D;  5AW4 B;  1JTH B;  4NBF D;  3H1H J;  5B5E E;  3VOP A;  5APQ A;  1UUV A;  2NPS D;  1M56 D;  1KD1 Q;  1S5L H;  1SQB K;  1KB9 D;  2I8D A;  2OYH A;  4B86 A;  1L0N G;  1FBM A;  1M57 D;  4BWN A;  1SQQ D;  5KLI B;  2XSO A;  2OYO A;  3D6Y A;  3EFF K;  1RE4 C;  4HM6 A;  2YMK A;  2OYI B;  3ZDM A;  3PH0 A;  2Y0D A;  2OYH C;  3R4Y A;  1VDF A;  3H1L G;  1SQB J;  1GW4 A;  3GL2 A;  1USE A;  2ZXX A;  3H6P A;  1R5S A;  1KC8 Q;  1VQP P;  3WU2 E;  4KT0 J;  3RBZ A;  2WIT A;  3EQ2 A;  3FWL A;  5BU8 B;  1X0T A;  1AQT A;  2IFM A;  2SPZ A;  5HL4 A;  2QJK B;  1Y9B A;  4I2L C;  4NPE A;  1YIJ P;  5C39 A;  1EG9 A;  3PP5 A;  3DQY A;  4KHX A;  1WQL A;  4QDD A;  1GL2 C;  5KAI E;  1W5C E;  1J2J B;  3RL0 g;  4NBC D;  3B5N D;  1L0L D;  5AVQ B;  1AFO A;  4AYC A;  1M90 Q;  3HD7 D;  2NPS B;  2O3J A;  1YI2 P;  2E5Y A;  3A2A A;  3BCC E;  4JYB A;  2Q3W A;  2YIU C;  3RK3 C;  1S1C X;  4HM4 A;  3VMI D;  1KIL B;  1KQS O;  2HMK A;  4QDF A;  2OGU A;  3P8C D;  1H88 A;  2I7F A;  2I1J A;  1BGY G;  2OYI A;  3M9Q A;  2WPR A;  1OIP A;  1LT1 A;  1MFZ A;  2FFD B;  3GHG B;  5CMZ A;  3H1K J;  4YPC A;  2ITA A;  3Q5R A;  1LT9 A;  3PRJ A;  2KS1 B;  1H89 A;  3NMD A;  4QUP A;  1EDJ A;  3E1R A;  1DIP A;  1S5L X;  1Y8A A;  1PL5 A;  2E74 B;  2R3C A;  1SQQ G;  3E7K A;  2G3A A;  5APW A;  5KAI H;  3C9I A;  1T3U A;  4RO0 A;  3GZX A;  3L37 A;  4PV1 B;  2DE7 D;  1NTZ K;  2WPV B;  5KJ7 D;  1NU1 K;  3SSU A;  3H1J G;  4Z1M H;  2GUV A;  2FFD C;  1NWQ A;  1CZQ A;  3MP7 B;  2E5T A;  1ZLL A;  2IFN A;  1VPC A;  1KFN A;  5APS A;  4OVN F;  1EXJ A;  4UB8 H;  1X22 A;  3CCL P;  2JDI H;  4PJ0 H;  1GD2 E;  3D71 A;  3M0D A;  1FS0 E;  3HD7 A;  2NPS C;  2E76 B;  3KYQ A;  1SQV G;  2Y9Z A;  2J58 A;  1SFC D;  1N7S B;  2QJY B;  2CK3 H;  2WPQ A;  2POH A;  5KLV E;  3IN6 A;  1FJK A;  1FZB A;  2I1K A;  1LNQ A;  2DE5 D;  1EZV I;  2QM7 A;  1YQ3 C;  1GK4 A;  1CSB A;  4WY4 B;  1G2C A;  3AED C;  4BXL A;  4MN4 C;  2HMO A;  3ABV C;  4YXD C;  4QCK A;  1EC5 A;  2IBZ I;  3BCC D;  4OGQ C;  1EDK A;  1OW7 A;  2M3B A;  4U3F J;  1SQX G;  1H8A A;  2B88 A;  4BRY B;  4U3F G;  2E4Q A;  1S9K E;  5KKZ B;  2P67 A;  3L74 J;  1R8E A;  1SFC A;  1SJG A;  2CPB A;  1SQX K;  3GG2 A;  2WSE H;  1NTK G;  1VQ6 P;  1KQF B;  2FFD A;  3RL0 D;  5BOK A;  4AAY B; 
#chains in the Genus database with same CATH homology
 1O7M A;  2E4P A;  4HJL A;  4NBG D;  4OGQ D;  5HL4 A;  3L75 E;  4QDC A;  3GTS A;  2E75 D;  3TGU E;  4NBD D;  2BMQ A;  4HM1 A;  3CWB E;  3GTE A;  3L73 E;  1BGY E;  1EG9 A;  2HMN A;  3DQY A;  4EMJ B;  3N0Q A;  1WQL A;  1NDO A;  2ZT9 D;  4QDD A;  2QJY C;  1VCK A;  3L74 E;  2QJP C;  2BMR A;  1L0N E;  4HM2 A;  1SQV E;  3L71 E;  2GBW A;  4NBC D;  2XR8 A;  1G8K B;  1SQP E;  2XRX A;  3VCA A;  2HMJ A;  4H44 D;  2YFI A;  1NTM E;  1G8J B;  1O7W A;  4QUQ A;  2B1X A;  5KLV E;  3H1J E;  2BMO A;  2YFL A;  2BCC E;  2A06 E;  1ULI A;  3GL0 A;  2E74 D;  1BE3 E;  1PP9 E;  1NU1 E;  2DE5 D;  3BCC E;  3FOU A;  1NTZ E;  2Q3W A;  1O7H A;  2YIU C;  4AIV A;  2HMM A;  1FQT A;  2YVJ B;  2JO6 A;  3C0D A;  2QJK C;  3GB4 A;  3VCP A;  1BCC E;  4HM4 A;  4NBF D;  3VMG D;  4HM8 A;  3L72 E;  3VMI D;  4QDF B;  2NUK A;  5KKZ C;  2HMK A;  1UUV A;  4QDF A;  4NBA D;  4P1C H;  2HMO A;  4H13 D;  5AEW A;  2I7F A;  4NBH D;  1RFS A;  4QCK A;  3H1I E;  1O7G A;  4HKV A;  4P1B H;  1L0L E;  1P84 E;  1ZRT E;  1KYO E;  1JM1 A;  1O7N A;  2CKF A;  2ZYL A;  3L70 E;  1O7P A;  2XSH A;  2YFJ A;  4HM3 A;  1SQB E;  3GZY A;  3D89 A;  3EQQ A;  3GOB A;  1SQX E;  2NVF A;  2XSO A;  4PD4 E;  4NB9 D;  2JZA A;  3EN1 A;  3H1H E;  4HM5 A;  4QUP A;  1VF5 D;  1ULJ A;  3CXH E;  1RIE A;  2IBZ E;  4HM6 A;  2FYU E;  2E4Q A;  2D2C D;  1SQQ E;  5AEU A;  1KB9 E;  2E76 D;  1VM9 A;  1NYK A;  3H1K E;  4D6T E;  1UUW A;  2NWF A;  4QUR A;  3H1L E;  4NB8 D;  4NBB D;  4U3F E;  2B24 A;  1SJG A;  2NVG A;  3GL2 A;  3GZX A;  2DE6 D;  5CXM A;  2QPZ A;  2DE7 D;  4H0L D;  3VMH D;  3AZC A;  1EZV E;  1NTK E;  3GKE A;  4HM0 A;  2NUM A;  4PV1 D;  2FYN C;  3CX5 E;  5BOK A;  2NVE A;  3GCE A;  1PPJ E;  2HML A;  4NBE D;  4AAY B;  2GBX A;  1Q90 C;  5KLI C;  4HM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...