1PPJE

Bovine cytochrome bc1 complex with stigmatellin and antimycin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1ppjE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1ppjE02
2I7FA 4QDDA 4U3FE 1O7NA 3L73E 4HM4A 1SJGA 1EG9A 2BMQA 1NTME 3CXHE 2E76D 2XSOA 2YFLA 4NBHD 3H1KE 1NDOA 1G8JB 4AAYB 3VMGD 1P84E 3DQYA 2JO6A 1BGYE 2NUKA 2YFJA 4HKVA 4QUPA 4HM1A 1PP9E 5AEWA 2A06E 2QJYC 5KLIC 2DE5D 1ULIA 1Q90C 2D2CD 5CXMA 3GZXA 4H44D 1KYOE 4PV1D 1NTKE 1RFSA 5HL4A 3TGUE 4QUQA 3VCPA 1JM1A 3GTSA 3GL2A 2JZAA 3VMID 5BOKA 3N0QA 1KB9E 1SQBE 4AIVA 3VMHD 1VM9A 2GBWA 2IBZE 1UUWA 3L75E 1SQPE 2GBXA 4NBGD 3GL0A 2XSHA 2Q3WA 2ZYLA 5KLVE 3L71E 1UUVA 4HM2A 1O7WA 4PD4E 2DE6D 1VF5D 4NBFD 2B24A 2HMMA 4P1BH 1BE3E 2FYNC 2HMJA 3C0DA 3GCEA 2E4QA 3D89A 3L70E 2FYUE 3L74E 4QDFB 1O7GA 2E74D 1FQTA 2B1XA 4NBAD 4NBDD 3CX5E 1WQLA 4H0LD 2NVEA 4QURA 4HJLA 3GTEA 1SQVE 4NBED 2DE7D 5AEUA 1NU1E 1SQQE 5KKZC 2BMOA 2NVGA 3GZYA 4HM5A 2YIUC 4H13D 4HM7A 2QJKC 3VCAA 2HMLA 4D6TE 2BMRA 4QDCA 4QCKA 1BCCE 2HMOA 2NWFA 1RIEA 2HMNA 4P1CH 4HM8A 4NB9D 1O7MA 3L72E 2CKFA 4NB8D 1O7PA 1VCKA 3AZCA 1EZVE 4NBBD 3GKEA 4OGQD 1PPJE 2NVFA 4NBCD 4HM3A 1ULJA 1NYKA 1ZRTE 1L0LE 3H1IE 2YFIA 1L0NE 1SQXE 2XRXA 4EMJB 1NTZE 3H1HE 2NUMA 3GOBA 3GB4A 4HM6A 1G8KB 1O7HA 2ZT9D 3CWBE 2QJPC 2YVJB 2E4PA 4QDFA 3EQQA 3H1JE 2BCCE 4HM0A 3BCCE 3FOUA 2XR8A 3EN1A 2E75D 2QPZA 3H1LE 2HMKA
chains in the Genus database with same CATH superfamily
2I7FA 4QDDA 3NFQA 2YFLA 1CI6B 3U59A 5AVZB 1OXZA 5AVRB 3PJSK 3RK2B 3FWLA 2G3AA 1SQQK 1G1IA 2V7QJ 1RFSA 1Y9BA 3CMAP 3GL2A 2A06D 4DT0A 1CW5A 4AIVA 3O6QA 1FOSF 1BCCJ 3AEAC 2QEXP 4BRYA 3RL0g 3CD6P 1SQVK 3HD7C 3L73D 5AW1B 1NTMJ 2Z5IA 4P1BH 3GCEA 2OTKE 3HE4B 2W8ZA 2OYIC 5GTHH 3HD7B 1NO4A 3MIWA 2H43A 4HM5A 3AEBC 1OWAA 4H13D 4HJGH 5KJ7D 1OMIA 2OYIB 2E74C 2NWFA 3AECC 1URQD 3CXHI 4K35A 2ZJSE 1FZBA 1NYKA 2E5TA 4IL6X 2NUMA 3IF4A 2WMMA 1G8KB 2N9YB 1GK6A 1NTKJ 2QJPC 1U57A 3H1JE 2OYOA 4HM0A 1L4AD 3L37A 3H1HD 4N78E 3G71P 2QPZA 2A45G 1NGMB 5AW9B 2QJPB 4HM4A 3I55P 1NDOA 4RO0A 2IYPA 1JM0A 4RJTA 1LT1A 3D71A 1QGKB 2QM8A 1X8YA 2YKPA 5K5GB 1LNQA 4H44C 1NKZB 3CX5H 1LTSC 4EDFA 3CXHD 3IAOA 1OVVA 3G3ZA 1KYOE 2WT7A 3H32A 5B5EH 5AVUB 4H44B 1KILC 3V4WA 3Q5PA 3SWKA 4DJGA 1SFCA 2HODB 1LT9A 2Q3WA 4Y28J 1CZQA 1KILB 1O7WA 1JUNA 1HJ0A 4U3FJ 4K3AA 4QDFB 3HD7D 1RE3C 1DH3A 3OW2O 1EXJA 3U1CA 4NBED 2L5GB 2DE7D 3AE8C 1EC5A 3VP9A 1L0LG 2NPSC 2M5AA 2R5DA 3N7NA 3R2PA 4HM8A 1KORA 1YJWP 2IBZI 1BGYJ 2RKLA 1FBMA 4HM3A 1VDFA 1OX3A 1UIIA 4EIJA 1DD3A 3AE4C 1G2CB 1VQ4P 1ZRTD 5GTHE 1SQPG 1QVGO 3GW6A 1S2EA 2I1JA 3Q1MA 2WSFJ 2BEQD 3PHLA 1SQQJ 2KIKA 4CPGA 5M1BA 1GDTA 3M06A 2D2CC 4HKZH 1VQ5P 2BEZF 1BE3J 3L72J 4QMAA 2DE5D 4IFMA 2B89A 2ZYDA 4DCKA 1KMIZ 4H44D 1GU4A 2D2CB 4EI2A 1DEEG 1LTJC 2Q3IA 2WPSA 2Q9IA 2KYVA 1EDKA 2JP3A 3T97A 4EYYQ 3L35A 3AEEC 1FAVA 1LTJB 3KQGA 1JOCA 3SWYA 1Y47A 1YITP 5B66H 3CMEP 5CMZA 5CBNA 4AUWA 2BCCG 3BCCG 3CX5E 3CC4P 3H1LG 4I7ZC 1EQ7A 3NXSA 3HE5B 3WUTA 2B9BA 1JY2O 3B71A 2OYHC 2W6BA 3L73J 3CCQP 3H1KJ 4I7ZB 1K05A 3RK3E 1P84I 2QVAA 3D6ZA 2OYHB 3H1IE 1NTZE 1ZLLA 5KAFH 4GODA 1U7MA 1M1KQ 1FJPA 1AA0A 3MTUE 3EFGA 2PAJA 1RF0C 4JBZA 2MKVA 2HMKA 2KSEA 1VQPP 2WPRA 4L74A 5BVZA 2KP8A 3KYQA 3KPEA 3N4XA 2B87B 1FZAA 2D2CD 2P10A 1L0LD 1P84D 2Y9YA 1VQ7P 3H1HJ 1M90Q 2JJLA 2K37A 3WUUA 1H0TB 1HWTC 2N1TA 1MZ9A 3WUVA 2IBZE 1UUWA 3L75E 2RMZA 5CCGC 2R5BA 3EFFK 1LGHB 2XSHA 2ZYAA 2YNYA 1NAYA 2JDIH 4HM2A 4XE5B 3M9BA 3WU2H 3ITKA 2HMMA 3FWNA 4L75A 1SQPD 1X79B 3H1JG 4NBAD 5AVXB 1IO4A 4PD4D 2M3EA 4HJLA 1LP1B 3GZYA 1L0LK 1YHQP 1BDCA 4D6TE 2WSEH 3BRVB 2HMOA 4P1CH 2HMNA 1G1JA 3AEGC 2KZJA 1GD2E 1PGOA 2G8YA 1ZV8A 2GUVA 5B66E 3GOBA 1O7HA 1NTMK 3MP7B 3EQQA 5C39A 4OGQC 1IFNA 2E76C 3SFDC 4UB8H 2AXTE 2BCCD 3BCCD 4OGQB 1GU5A 2J58A 2E76B 3JCUH 1GMJA 3TNUB 1DIPA 3CCEP 3H1LD 1PP9E 4OWFA 2FFDA 2QJYC 4IOIH 1KTMA 2WSCJ 5KAFE 1VQKP 3GTSA 4WY4A 4GOFA 2E42A 2QSIA 4W7YA 1SVFA 4AQRD 5KAIH 1LWUC 2O01H 5CHXA 2AEFA 1MFZA 5CCGD 2B24A 1NU1G 5KKZB 3C0DA 1JY3P 3S1KA 3L74E 3JSVC 1PZQA 3I56P 1A02F 2FXOA 3G9RA 1XTCC 4BXLA 2YIUC 1H89A 3VCAA 1OW7A 2ZYGA 1BCCE 3HD7A 1N2DC 4NB9D 2CKFA 3LW5H 1N86A 1KD1Q 1HJBA 2WITA 1BSHA 4H13C 3WU2E 1N7SB 3MGNA 5KJ7C 3A5TA 2CPSA 5E79H 4JQ0D 2WSFH 1FZEA 4H13B 2J5UA 1WMKA 3TK1A 4YXDC 2W6AA 1LTAC 2KLUA 3MD0A 4W80A 1YTZI 3GHGA 4NPDA 4YXWH 3H1JD 2E76D 3VOPA 4N78D 2GUSA 2KK7A 2QRXA 5KTBA 1X9VA 4HKVA 1OW8A 1SQBK 5BU8B 3P7KA 1VQ8P 2I1KA 1NTKE 3TGUE 3AE9C 3K5BA 1IFIA 1JO5A 2XU6A 1T2KD 1ZOYC 4R4MA 1Q82Q 2Q6QA 1KYOD 1VM9A 2GBWA 3VMXA 4JYBA 3SWFA 2MJZA 2W6JH 2K9JB 1S9KE 3H1IG 4UB8E 3E7KA 1NTZG 1NHLA 3B8EB 1N73B 1IK7A 1J1EB 2FYNC 1L0LJ 4H0LC 2HMJA 1KN7A 2IYOA 3JCUE 3I5CA 1YQ4C 1OVRA 1AV1A 3QH9A 1GW4A 4XFJA 2HODA 3Q5SA 1WQLA 4M3LA 1KILA 2H89C 3GTEA 2WSSH 4IL6H 3P8MC 2FYNB 4H0LB 2IPPA 2HMLA 1SQXG 3S9OA 1ZN5A 3CC7P 3W67A 4IFFA 5KAIE 1EZVE 1SQPJ 1N7SD 3HUSA 4JYCA 1RE3A 2Q5UA 3RK3C 5APWA 4KJMA 3IFMA 2Q1KA 3CWBE 5APVA 3B5NC 2IBZG 3RK3B 3L75G 2HPCB 1TU3F 5CBOA 5CJ4A 2NPSA 2KNCB 1NU1D 3AEFC 1HUCA 1DD4A 3B5NB 2XSOA 1G2CA 3VMGD 1BGYE 4DZOA 4QUPA 1FDMA 4MN4C 3GF7A 3HTKB 4HYTB 1BSNA 5AW6B 3CX5I 4D6TG 3USSA 3MHVA 1J1DC 3KZIH 5E79E 5L8RJ 3Q2YA 2BCCJ 3BCCJ 1RF1B 3H1LJ 1J1DB 1NU1K 1BE3E 2IFNA 3FXDA 1RE4C 1ZR2A 2JR8A 2W27A 1LTJA 4H0LD 4Y99C 2YXQB 1SQVE 3FXEA 4GOEA 3CCSP 3OAKA 3CX5D 5AW7B 2AEMA 4Y99B 3V2RA 1PP9G 5TISE 1O7MA 1AFOA 3AZCA 1PPJE 3HE5A 1IFDA 3RK3D 2ZT9D 3P32A 3EWKA 2Y0DA 3H1ID 3M9QA 4BRYB 1NTZD 1SQBJ 4IL6E 3B5ND 1R5SA 3L73E 1AJYA 3V2QA 4NBHD 3H1KE 3CCMP 1OW6A 3L74G 4ZKPA 3CCVP 3CL3D 3AE6C 5AEWA 1DEBA 2WSCH 3L70J 1PGJA 3PH0A 3FGAD 3GZXA 1SQXD 1EDJA 3G6EP 5HL4A 2WTYA 1T8ZA 1LTIC 3M0AA 1JMBA 5BOKA 3IN6A 3CC2P 1EDLA 2B87A 1OIPA 3TSIA 2B88A 2Z4EA 3TDKA 4O9BA 5KLVE 3VMAA 1HGZA 1HBWA 2M8RA 1EXIA 2IBZD 1K04A 1ZMEC 3L75D 4ZMDA 3BVHA 2FYUE 1WRGA 3HRNA 1S1CX 2H88C 3KDPB 1SQXK 5CCGA 1HTLC 3KZIE 4JF7A 2YO3A 1JTHA 4L73A 4ASVA 1O7PA 1ZR4A 1QVFO 2A45H 4LGDE 5APUA 4D6TD 2WT7B 4IFDK 1ZP0C 1ZW0A 3H32B 1JNMA 3TGUG 1FZCA 3PTZA 2XNDH 2L91A 2AXTH 2Y0CA 2YKQA 2HLOA 2YMYA 2HFED 2ZAEB 3V2PA 5AW4B 3P8CE 2JO6A 1KQFB 1L2PA 3NTNA 5APTA 5AW0B 3VCPA 4WVZA 4NPEA 1PP9D 1NU1J 3NMDA 1KFNA 1T3JA 2YXRB 3CCUP 2KSJA 3KXDA 1IZNB 1IFJA 2V7QH 1WT6A 1E79H 1HGVA 3VN0A 2XZRA 4RESB 2FY8A 3CWBG 2E4QA 1KQGB 1FQTA 1OZHA 1GZLA 2ITAA 4HH2A 2LXBA 3L74D 3M9HA 4N3YB 1JY3O 1LWUA 1NH4A 4PJ0H 1M8OB 2GA1A 4GT1A 1J2JB 1T6AA 1BCCD 1L0NE 3C9IA 3UIAA 2QA4P 1H88A 4HM6A 3V6IA 2FKWB 4WBAA 1RQUA 3T97B 2IFMA 1KB9H 3M0DC 3Q5RA 1KILE 5DJUB 1Q90D 2QM7A 2LR2A 3A7OA 5DJTB 4UB6H 3MUDC 1NJIQ 1FOSE 3BRTB 1BE3G 5H2FH 3DQYA 5KJ7A 4C7NA 1DX7A 1R8EA 3M91A 1SQVG 5AW8B 1SQPK 2V4HA 1URQA 2YO2A 1GL2C 1NTZJ 4OVNF 1JY3N 1VQ6P 1BDDA 2R3CA 2K1AA 1S5LX 2OGUA 2R3SA 1NTKD 1GL2B 2GBXA 1PPJG 3TGUD 2IDBA 2P1JA 3GL0A 2ZYLA 3L71E 1L4AA 2Y9ZA 1EZVI 1T3UA 2RN0A 2KLVA 1CI6A 2JWDA 1T2KC 1SQXJ 5AW3B 1S9KD 2B1XA 1K8AQ 2K9JA 4YTPC 2M0BA 1X22A 5AEUA 2WWWA 5KKZC 1KZUB 2SPZA 1AVOA 3H1KG 1Y8AA 3VMYA 2CK3H 2KI7B 1OVUA 1RIEA 3ABVC 1HF9A 3PP5A 1JMMA 2YFIA 2AXCA 1L0LE 1Q7YQ 3GB4A 3E1RA 1VQMP 3II6A 1EZVD 2N1TB 2E75C 3HE4A 5TJHA 1N7SC 1M56D 2H7HA 2C0XA 5KLVG 3CWBD 3V2NA 1GTWA 1MV8A 2E75B 1NTME 2Z5HA 3VTPC 4PJ0E 1G8JB 4D6TJ 2FYUG 2OYIA 3RL0B 1K9MQ 3CI9A 2YFJA 3Q3DA 2KNCA 5KLIC 3TF5A 3RBXA 3B5NA 2W90A 2WVRA 2IZ1A 5KLIB 1KB9E 1GL2D 3V4QA 3HTKA 3EQ2A 2E5YA 4NBGD 1QL2A 4UB6E 2DW3A 4B86A 5CCHC 1YTZT 4N6JA 5H2FE 2K3RA 2HR3A 1RH5B 2HG5D 2ZXEB 3S4RA 2POHA 1VQNP 1Q86Q 1PP9J 2AEJA 3ZDMA 1BE3D 1N73C 1J1EC 5TISH 4C46A 5AVWB 2O3JA 2XNXA 4JPZB 1EDIA 1M1JC 1SQVD 2PFXA 1FC2C 1W2EA 3GKEA 1RE4A 1MKMA 1KQLA 1M1JB 4WY4B 5AVQB 2N1TD 3A0HH 2HYNA 3O8ZA 1NOHA 1PPJD 3L74J 4QDFA 3L36A 3CCLP 3EN1A 2E75D 1ZXGA 2K88A 2H8PD 4U3FE 2QG4A 3RL0D 2ZXXA 2C9NY 2NZ2A 1SLQA 2ZT9C 3A0BH 2KOGA 2KXPB 1S3JA 3IR9A 1D7MA 2JWAA 3H1KD 1LTBC 2WPQA 2ZT9B 1XTGB 3GF3A 4PV1D 1YIJP 1FZGA 4QUQA 1JM1A 3AE5C 2M3BA 3LIEA 4HB1A 2QIWA 1SQBE 3G4SP 3AE2C 1U7JA 3OA7A 3RBZA 4ASWA 2O1JA 3SFEC 2Q3EA 1VF5C 1MUUA 2ZFCA 1W2BO 3CCJP 2I8DA 1L0NG 1UUVA 4XA4A 1NKNA 2DE6D 3GHGC 2WSEJ 4W7ZA 3W68A 1VF5B 3L70E 4ZKUA 1RF1C 2OQQA 5CCHD 5KLVD 2E74B 3JC22 2QE7H 3GHGB 1SQQE 2FYUD 2NVGA 1AVYA 3FX0A 2QJKC 3TGUJ 3CXHH 2W83C 1HH0A 2KS1B 4WB4A 2XKMA 1IFMA 3L72E 1Z56A 1JCDA 5APSA 2QJKB 2NVFA 4NBCD 3RK2D 4WY4D 2IX7C 1LJ2A 1YI2P 2FBWC 3GG2A 5GTIH 2YVJB 1LTTC 5KLVK 1FE6A 3L71G 1QX8A 2FYUK 4YPCA 4GIFA 1MFTA 1SP4A 4AAYB 4LLHA 1RHZB 1VQ9P 4HM1A 3A3YB 2A06E 4TT3H 3O6QB 5CXMA 2O01J 1IC2A 3P8CD 2OYHA 3HUSC 3A0HE 1YQ3C 2JZAA 4AYCA 3VMID 3VYIA 3CWBJ 1YJ9P 1M7LA 3VMHD 3OJAB 1IK9A 3HUSB 3A2AA 1VQLP 2JEEA 2WQYC 1VF5D 2WPVB 3A0BE 2E74D 2WZ7A 1FU1A 1RF0A 4OH8B 3CPWO 2NPSB 1BCCG 3LW5J 4QURA 1Q81Q 3H1JJ 2FYZA 3GMAA 1NU1E 3LIDA 2BMOA 1NTMG 4HM7A 1NTZK 1PL5A 4QDCA 4QCKA 2E43A 2RH0A 1H0TA 1PV3A 1IJDB 4TLFA 1K73Q 1R5LA 1VCKA 1JEKA 2PGDA 1S72P 1OFCX 2P58A 3H1HE 1NWQA 2A45I 2JKVA 2LXCB 3CLQA 1QL1A 1L0ND 1JB0J 1SQVJ 3KHUA 2O01N 2LKMA 1PIXA 1LP1A 2GM4A 1EG9A 2BMQA 3CXHE 1PGPA 1SFCC 3PLNA 1NTKG 2Y0EA 1LT9C 1KILD 2P2UA 3F5HA 1FDIA 3QWOC 5AVSB 1USDA 4KHXA 1ULIA 1Q90C 1SFCB 1LT9B 1M57D 3M0DA 2KZIA 4I6MC 2BASA 1VQOP 5AVYB 3TYYA 5GTIE 1NAFA 3MUDA 1L0NK 5B5EE 3BATA 5APYA 2NPSD 3D89A 3AE3C 3C8VA 2M5AB 1PFIA 1GL2A 3L71D 3TNUA 1YBKA 1EZVG 3VP8A 4U3FG 2OTLP 1YYCA 2VRSA 2PP6A 1RY3A 1P84H 3R4YA 4ZNCA 4NB8D 1AQTA 1W5CE 4I1LA 3GLMA 1ULJA 1ZRTE 5KLVJ 1SQXE 2Q7CA 4I2LC 5EFWB 4PD4I 1N7LA 3E1IA 1NVOA 1SQBG 2FYUJ 2E4PA 1PGQA 4DOJA 1BGYG 2N9BA 1JY2N 1KB9I 5AW2B 5AW5B 3WMM0 1O7NA 4PD4H 2KUBA 3V5BA 5BU5A 3L70G 4U7JA 1LTGC 2NUKA 4L76A 1S5LH 2P67A 1USEA 1SFCD 1NTMD 1KFMA 1SQQG 2UWJE 2J59M 1E5WA 1N7SA 3SSUA 1YJNP 3BASA 1H8AA 1FZCC 1JTHB 3N0QA 3L72G 3B4SA 3L4FA 1FZFA 1A02J 3D70A 1FZCB 1KB9D 2YKOA 1VL2A 3RGUA 3VMZA 1JY2P 1QLED 2OTJP 3H1IJ 4GDOA 2NVEA 1NYHA 2KB7P 2BMRA 2YMKA 2XDJA 2A06G 5CCHA 3U1AA 1KV4A 2FXMA 3H6PA 1S4XA 2NRGA 3AE1C 3AE7C 1N73A 3L73G 3H25A 2ZVOB 1Q2NA 1X0TA 3C1LA 3FOUA 5AVVB 1QEXA 1M1JA 1KC8Q 2QJYB 1CSBA 1UIXA 3L75J 2N1TC 3F89A 1SJGA 1NTKK 1KQSO 1P84E 2C0WA 3AEDC 4U3FD 2K9YA 4KT0J 5APQA 1GW3A 3MZWB 1L0NJ 1N8RQ 3RL0C 1IFPA 1LWUB 3D6YA 1FJKA 3PRJA 2P7JA 2PRRA 1SQPE 2C9LY 2HPCA 2XV5A 2JO1A 1AQ5A 4PV1C 3H1HG 1FS0E 1SQBD 4PD4E 4R4LA 4NBFD 1FDOA 4WWIA 1BGYD 2YIUB 1O7GA 1S5LE 2OARA 2CPBA 4NBDD 4PV1B 5APXA 4RKUJ 2FXPA 2IZ0A 3L70D 2ZVNB 1KYOI 1VPCA 4C7RA 4NPFX 1URQC 2O1KA 4LC1A 5CJ0A 1SS1A 1RQVA 4EOTA 4Z1MH 4C7NB 5AVTB 1SQQD 4NBBD 4OGQD 1URQB 2R32A 1RF1A 3L71J 2XRXA 2R44A 1KYOH 4A7PA 4EMJB 2FFDC 4GKGA 2KS1A 1L4AC 3L72D 1GK4A 1HVVA 2BCCE 4BWNA 3BCCE 3CCRP 2XR8A 3RK2C 4WY4C 2FFDB 1L4AB 1JCCA 3H1LE
chains in the Genus database with same CATH topology
2I7FA 4QDDA 4U3FE 1O7NA 3L73E 4HM4A 1SJGA 1EG9A 2BMQA 1NTME 3CXHE 2E76D 2XSOA 2YFLA 4NBHD 3H1KE 1NDOA 1G8JB 4AAYB 3VMGD 1P84E 3DQYA 2JO6A 1BGYE 2NUKA 2YFJA 4HKVA 4QUPA 4HM1A 1PP9E 5AEWA 2A06E 2QJYC 5KLIC 2DE5D 1ULIA 1Q90C 2D2CD 5CXMA 3GZXA 4H44D 1KYOE 4PV1D 1NTKE 1RFSA 5HL4A 3TGUE 4QUQA 3VCPA 1JM1A 3GTSA 3GL2A 2JZAA 3VMID 5BOKA 3N0QA 1KB9E 1SQBE 4AIVA 3VMHD 1VM9A 2GBWA 2IBZE 1UUWA 3L75E 1SQPE 2GBXA 4NBGD 3GL0A 2XSHA 2Q3WA 2ZYLA 5KLVE 3L71E 1UUVA 4HM2A 1O7WA 4PD4E 2DE6D 1VF5D 4NBFD 2B24A 2HMMA 4P1BH 1BE3E 2FYNC 2HMJA 3C0DA 3GCEA 2E4QA 3D89A 3L70E 2FYUE 3L74E 4QDFB 1O7GA 2E74D 1FQTA 2B1XA 4NBAD 4NBDD 3CX5E 1WQLA 4H0LD 2NVEA 4QURA 4HJLA 3GTEA 1SQVE 4NBED 2DE7D 5AEUA 1NU1E 1SQQE 5KKZC 2BMOA 2NVGA 3GZYA 4HM5A 2YIUC 4H13D 4HM7A 2QJKC 3VCAA 2HMLA 4D6TE 2BMRA 4QDCA 4QCKA 1BCCE 2HMOA 2NWFA 1RIEA 2HMNA 4P1CH 4HM8A 4NB9D 1O7MA 3L72E 2CKFA 4NB8D 1O7PA 1VCKA 3AZCA 1EZVE 4NBBD 3GKEA 4OGQD 1PPJE 2NVFA 4NBCD 4HM3A 1ULJA 1NYKA 1ZRTE 1L0LE 3H1IE 2YFIA 1L0NE 1SQXE 2XRXA 4EMJB 1NTZE 3H1HE 2NUMA 3GOBA 3GB4A 4HM6A 1G8KB 1O7HA 2ZT9D 3CWBE 2QJPC 2YVJB 2E4PA 4QDFA 3EQQA 3H1JE 2BCCE 4HM0A 3BCCE 3FOUA 2XR8A 3EN1A 2E75D 2QPZA 3H1LE 2HMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I7F A;  4QDD A;  4U3F E;  1O7N A;  3L73 E;  4HM4 A;  1SJG A;  1EG9 A;  2BMQ A;  1NTM E;  3CXH E;  2E76 D;  2XSO A;  2YFL A;  4NBH D;  3H1K E;  1NDO A;  1G8J B;  4AAY B;  3VMG D;  1P84 E;  3DQY A;  2JO6 A;  1BGY E;  2NUK A;  2YFJ A;  4HKV A;  4QUP A;  4HM1 A;  1PP9 E;  5AEW A;  2A06 E;  2QJY C;  5KLI C;  2DE5 D;  1ULI A;  1Q90 C;  2D2C D;  5CXM A;  3GZX A;  4H44 D;  1KYO E;  4PV1 D;  1NTK E;  1RFS A;  5HL4 A;  3TGU E;  4QUQ A;  3VCP A;  1JM1 A;  3GTS A;  3GL2 A;  2JZA A;  3VMI D;  5BOK A;  3N0Q A;  1KB9 E;  1SQB E;  4AIV A;  3VMH D;  1VM9 A;  2GBW A;  2IBZ E;  1UUW A;  3L75 E;  1SQP E;  2GBX A;  4NBG D;  3GL0 A;  2XSH A;  2Q3W A;  2ZYL A;  5KLV E;  3L71 E;  1UUV A;  4HM2 A;  1O7W A;  4PD4 E;  2DE6 D;  1VF5 D;  4NBF D;  2B24 A;  2HMM A;  4P1B H;  1BE3 E;  2FYN C;  2HMJ A;  3C0D A;  3GCE A;  2E4Q A;  3D89 A;  3L70 E;  2FYU E;  3L74 E;  4QDF B;  1O7G A;  2E74 D;  1FQT A;  2B1X A;  4NBA D;  4NBD D;  3CX5 E;  1WQL A;  4H0L D;  2NVE A;  4QUR A;  4HJL A;  3GTE A;  1SQV E;  4NBE D;  2DE7 D;  5AEU A;  1NU1 E;  1SQQ E;  5KKZ C;  2BMO A;  2NVG A;  3GZY A;  4HM5 A;  2YIU C;  4H13 D;  4HM7 A;  2QJK C;  3VCA A;  2HML A;  4D6T E;  2BMR A;  4QDC A;  4QCK A;  1BCC E;  2HMO A;  2NWF A;  1RIE A;  2HMN A;  4P1C H;  4HM8 A;  4NB9 D;  1O7M A;  3L72 E;  2CKF A;  4NB8 D;  1O7P A;  1VCK A;  3AZC A;  1EZV E;  4NBB D;  3GKE A;  4OGQ D;  1PPJ E;  2NVF A;  4NBC D;  4HM3 A;  1ULJ A;  1NYK A;  1ZRT E;  1L0L E;  3H1I E;  2YFI A;  1L0N E;  1SQX E;  2XRX A;  4EMJ B;  1NTZ E;  3H1H E;  2NUM A;  3GOB A;  3GB4 A;  4HM6 A;  1G8K B;  1O7H A;  2ZT9 D;  3CWB E;  2QJP C;  2YVJ B;  2E4P A;  4QDF A;  3EQQ A;  3H1J E;  2BCC E;  4HM0 A;  3BCC E;  3FOU A;  2XR8 A;  3EN1 A;  2E75 D;  2QPZ A;  3H1L E;  2HMK A; 
#chains in the Genus database with same CATH topology
 2I7F A;  4QDD A;  3NFQ A;  2YFL A;  1CI6 B;  3U59 A;  5AVZ B;  1OXZ A;  5AVR B;  3PJS K;  3RK2 B;  3FWL A;  2G3A A;  1SQQ K;  1G1I A;  2V7Q J;  1RFS A;  1Y9B A;  3CMA P;  3GL2 A;  2A06 D;  4DT0 A;  1CW5 A;  4AIV A;  3O6Q A;  1FOS F;  1BCC J;  3AEA C;  2QEX P;  4BRY A;  3RL0 g;  3CD6 P;  1SQV K;  3HD7 C;  3L73 D;  5AW1 B;  1NTM J;  2Z5I A;  4P1B H;  3GCE A;  2OTK E;  3HE4 B;  2W8Z A;  2OYI C;  5GTH H;  3HD7 B;  1NO4 A;  3MIW A;  2H43 A;  4HM5 A;  3AEB C;  1OWA A;  4H13 D;  4HJG H;  5KJ7 D;  1OMI A;  2OYI B;  2E74 C;  2NWF A;  3AEC C;  1URQ D;  3CXH I;  4K35 A;  2ZJS E;  1FZB A;  1NYK A;  2E5T A;  4IL6 X;  2NUM A;  3IF4 A;  2WMM A;  1G8K B;  2N9Y B;  1GK6 A;  1NTK J;  2QJP C;  1U57 A;  3H1J E;  2OYO A;  4HM0 A;  1L4A D;  3L37 A;  3H1H D;  4N78 E;  3G71 P;  2QPZ A;  2A45 G;  1NGM B;  5AW9 B;  2QJP B;  4HM4 A;  3I55 P;  1NDO A;  4RO0 A;  2IYP A;  1JM0 A;  4RJT A;  1LT1 A;  3D71 A;  1QGK B;  2QM8 A;  1X8Y A;  2YKP A;  5K5G B;  1LNQ A;  4H44 C;  1NKZ B;  3CX5 H;  1LTS C;  4EDF A;  3CXH D;  3IAO A;  1OVV A;  3G3Z A;  1KYO E;  2WT7 A;  3H32 A;  5B5E H;  5AVU B;  4H44 B;  1KIL C;  3V4W A;  3Q5P A;  3SWK A;  4DJG A;  1SFC A;  2HOD B;  1LT9 A;  2Q3W A;  4Y28 J;  1CZQ A;  1KIL B;  1O7W A;  1JUN A;  1HJ0 A;  4U3F J;  4K3A A;  4QDF B;  3HD7 D;  1RE3 C;  1DH3 A;  3OW2 O;  1EXJ A;  3U1C A;  4NBE D;  2L5G B;  2DE7 D;  3AE8 C;  1EC5 A;  3VP9 A;  1L0L G;  2NPS C;  2M5A A;  2R5D A;  3N7N A;  3R2P A;  4HM8 A;  1KOR A;  1YJW P;  2IBZ I;  1BGY J;  2RKL A;  1FBM A;  4HM3 A;  1VDF A;  1OX3 A;  1UII A;  4EIJ A;  1DD3 A;  3AE4 C;  1G2C B;  1VQ4 P;  1ZRT D;  5GTH E;  1SQP G;  1QVG O;  3GW6 A;  1S2E A;  2I1J A;  3Q1M A;  2WSF J;  2BEQ D;  3PHL A;  1SQQ J;  2KIK A;  4CPG A;  5M1B A;  1GDT A;  3M06 A;  2D2C C;  4HKZ H;  1VQ5 P;  2BEZ F;  1BE3 J;  3L72 J;  4QMA A;  2DE5 D;  4IFM A;  2B89 A;  2ZYD A;  4DCK A;  1KMI Z;  4H44 D;  1GU4 A;  2D2C B;  4EI2 A;  1DEE G;  1LTJ C;  2Q3I A;  2WPS A;  2Q9I A;  2KYV A;  1EDK A;  2JP3 A;  3T97 A;  4EYY Q;  3L35 A;  3AEE C;  1FAV A;  1LTJ B;  3KQG A;  1JOC A;  3SWY A;  1Y47 A;  1YIT P;  5B66 H;  3CME P;  5CMZ A;  5CBN A;  4AUW A;  2BCC G;  3BCC G;  3CX5 E;  3CC4 P;  3H1L G;  4I7Z C;  1EQ7 A;  3NXS A;  3HE5 B;  3WUT A;  2B9B A;  1JY2 O;  3B71 A;  2OYH C;  2W6B A;  3L73 J;  3CCQ P;  3H1K J;  4I7Z B;  1K05 A;  3RK3 E;  1P84 I;  2QVA A;  3D6Z A;  2OYH B;  3H1I E;  1NTZ E;  1ZLL A;  5KAF H;  4GOD A;  1U7M A;  1M1K Q;  1FJP A;  1AA0 A;  3MTU E;  3EFG A;  2PAJ A;  1RF0 C;  4JBZ A;  2MKV A;  2HMK A;  2KSE A;  1VQP P;  2WPR A;  4L74 A;  5BVZ A;  2KP8 A;  3KYQ A;  3KPE A;  3N4X A;  2B87 B;  1FZA A;  2D2C D;  2P10 A;  1L0L D;  1P84 D;  2Y9Y A;  1VQ7 P;  3H1H J;  1M90 Q;  2JJL A;  2K37 A;  3WUU A;  1H0T B;  1HWT C;  2N1T A;  1MZ9 A;  3WUV A;  2IBZ E;  1UUW A;  3L75 E;  2RMZ A;  5CCG C;  2R5B A;  3EFF K;  1LGH B;  2XSH A;  2ZYA A;  2YNY A;  1NAY A;  2JDI H;  4HM2 A;  4XE5 B;  3M9B A;  3WU2 H;  3ITK A;  2HMM A;  3FWN A;  4L75 A;  1SQP D;  1X79 B;  3H1J G;  4NBA D;  5AVX B;  1IO4 A;  4PD4 D;  2M3E A;  4HJL A;  1LP1 B;  3GZY A;  1L0L K;  1YHQ P;  1BDC A;  4D6T E;  2WSE H;  3BRV B;  2HMO A;  4P1C H;  2HMN A;  1G1J A;  3AEG C;  2KZJ A;  1GD2 E;  1PGO A;  2G8Y A;  1ZV8 A;  2GUV A;  5B66 E;  3GOB A;  1O7H A;  1NTM K;  3MP7 B;  3EQQ A;  5C39 A;  4OGQ C;  1IFN A;  2E76 C;  3SFD C;  4UB8 H;  2AXT E;  2BCC D;  3BCC D;  4OGQ B;  1GU5 A;  2J58 A;  2E76 B;  3JCU H;  1GMJ A;  3TNU B;  1DIP A;  3CCE P;  3H1L D;  1PP9 E;  4OWF A;  2FFD A;  2QJY C;  4IOI H;  1KTM A;  2WSC J;  5KAF E;  1VQK P;  3GTS A;  4WY4 A;  4GOF A;  2E42 A;  2QSI A;  4W7Y A;  1SVF A;  4AQR D;  5KAI H;  1LWU C;  2O01 H;  5CHX A;  2AEF A;  1MFZ A;  5CCG D;  2B24 A;  1NU1 G;  5KKZ B;  3C0D A;  1JY3 P;  3S1K A;  3L74 E;  3JSV C;  1PZQ A;  3I56 P;  1A02 F;  2FXO A;  3G9R A;  1XTC C;  4BXL A;  2YIU C;  1H89 A;  3VCA A;  1OW7 A;  2ZYG A;  1BCC E;  3HD7 A;  1N2D C;  4NB9 D;  2CKF A;  3LW5 H;  1N86 A;  1KD1 Q;  1HJB A;  2WIT A;  1BSH A;  4H13 C;  3WU2 E;  1N7S B;  3MGN A;  5KJ7 C;  3A5T A;  2CPS A;  5E79 H;  4JQ0 D;  2WSF H;  1FZE A;  4H13 B;  2J5U A;  1WMK A;  3TK1 A;  4YXD C;  2W6A A;  1LTA C;  2KLU A;  3MD0 A;  4W80 A;  1YTZ I;  3GHG A;  4NPD A;  4YXW H;  3H1J D;  2E76 D;  3VOP A;  4N78 D;  2GUS A;  2KK7 A;  2QRX A;  5KTB A;  1X9V A;  4HKV A;  1OW8 A;  1SQB K;  5BU8 B;  3P7K A;  1VQ8 P;  2I1K A;  1NTK E;  3TGU E;  3AE9 C;  3K5B A;  1IFI A;  1JO5 A;  2XU6 A;  1T2K D;  1ZOY C;  4R4M A;  1Q82 Q;  2Q6Q A;  1KYO D;  1VM9 A;  2GBW A;  3VMX A;  4JYB A;  3SWF A;  2MJZ A;  2W6J H;  2K9J B;  1S9K E;  3H1I G;  4UB8 E;  3E7K A;  1NTZ G;  1NHL A;  3B8E B;  1N73 B;  1IK7 A;  1J1E B;  2FYN C;  1L0L J;  4H0L C;  2HMJ A;  1KN7 A;  2IYO A;  3JCU E;  3I5C A;  1YQ4 C;  1OVR A;  1AV1 A;  3QH9 A;  1GW4 A;  4XFJ A;  2HOD A;  3Q5S A;  1WQL A;  4M3L A;  1KIL A;  2H89 C;  3GTE A;  2WSS H;  4IL6 H;  3P8M C;  2FYN B;  4H0L B;  2IPP A;  2HML A;  1SQX G;  3S9O A;  1ZN5 A;  3CC7 P;  3W67 A;  4IFF A;  5KAI E;  1EZV E;  1SQP J;  1N7S D;  3HUS A;  4JYC A;  1RE3 A;  2Q5U A;  3RK3 C;  5APW A;  4KJM A;  3IFM A;  2Q1K A;  3CWB E;  5APV A;  3B5N C;  2IBZ G;  3RK3 B;  3L75 G;  2HPC B;  1TU3 F;  5CBO A;  5CJ4 A;  2NPS A;  2KNC B;  1NU1 D;  3AEF C;  1HUC A;  1DD4 A;  3B5N B;  2XSO A;  1G2C A;  3VMG D;  1BGY E;  4DZO A;  4QUP A;  1FDM A;  4MN4 C;  3GF7 A;  3HTK B;  4HYT B;  1BSN A;  5AW6 B;  3CX5 I;  4D6T G;  3USS A;  3MHV A;  1J1D C;  3KZI H;  5E79 E;  5L8R J;  3Q2Y A;  2BCC J;  3BCC J;  1RF1 B;  3H1L J;  1J1D B;  1NU1 K;  1BE3 E;  2IFN A;  3FXD A;  1RE4 C;  1ZR2 A;  2JR8 A;  2W27 A;  1LTJ A;  4H0L D;  4Y99 C;  2YXQ B;  1SQV E;  3FXE A;  4GOE A;  3CCS P;  3OAK A;  3CX5 D;  5AW7 B;  2AEM A;  4Y99 B;  3V2R A;  1PP9 G;  5TIS E;  1O7M A;  1AFO A;  3AZC A;  1PPJ E;  3HE5 A;  1IFD A;  3RK3 D;  2ZT9 D;  3P32 A;  3EWK A;  2Y0D A;  3H1I D;  3M9Q A;  4BRY B;  1NTZ D;  1SQB J;  4IL6 E;  3B5N D;  1R5S A;  3L73 E;  1AJY A;  3V2Q A;  4NBH D;  3H1K E;  3CCM P;  1OW6 A;  3L74 G;  4ZKP A;  3CCV P;  3CL3 D;  3AE6 C;  5AEW A;  1DEB A;  2WSC H;  3L70 J;  1PGJ A;  3PH0 A;  3FGA D;  3GZX A;  1SQX D;  1EDJ A;  3G6E P;  5HL4 A;  2WTY A;  1T8Z A;  1LTI C;  3M0A A;  1JMB A;  5BOK A;  3IN6 A;  3CC2 P;  1EDL A;  2B87 A;  1OIP A;  3TSI A;  2B88 A;  2Z4E A;  3TDK A;  4O9B A;  5KLV E;  3VMA A;  1HGZ A;  1HBW A;  2M8R A;  1EXI A;  2IBZ D;  1K04 A;  1ZME C;  3L75 D;  4ZMD A;  3BVH A;  2FYU E;  1WRG A;  3HRN A;  1S1C X;  2H88 C;  3KDP B;  1SQX K;  5CCG A;  1HTL C;  3KZI E;  4JF7 A;  2YO3 A;  1JTH A;  4L73 A;  4ASV A;  1O7P A;  1ZR4 A;  1QVF O;  2A45 H;  4LGD E;  5APU A;  4D6T D;  2WT7 B;  4IFD K;  1ZP0 C;  1ZW0 A;  3H32 B;  1JNM A;  3TGU G;  1FZC A;  3PTZ A;  2XND H;  2L91 A;  2AXT H;  2Y0C A;  2YKQ A;  2HLO A;  2YMY A;  2HFE D;  2ZAE B;  3V2P A;  5AW4 B;  3P8C E;  2JO6 A;  1KQF B;  1L2P A;  3NTN A;  5APT A;  5AW0 B;  3VCP A;  4WVZ A;  4NPE A;  1PP9 D;  1NU1 J;  3NMD A;  1KFN A;  1T3J A;  2YXR B;  3CCU P;  2KSJ A;  3KXD A;  1IZN B;  1IFJ A;  2V7Q H;  1WT6 A;  1E79 H;  1HGV A;  3VN0 A;  2XZR A;  4RES B;  2FY8 A;  3CWB G;  2E4Q A;  1KQG B;  1FQT A;  1OZH A;  1GZL A;  2ITA A;  4HH2 A;  2LXB A;  3L74 D;  3M9H A;  4N3Y B;  1JY3 O;  1LWU A;  1NH4 A;  4PJ0 H;  1M8O B;  2GA1 A;  4GT1 A;  1J2J B;  1T6A A;  1BCC D;  1L0N E;  3C9I A;  3UIA A;  2QA4 P;  1H88 A;  4HM6 A;  3V6I A;  2FKW B;  4WBA A;  1RQU A;  3T97 B;  2IFM A;  1KB9 H;  3M0D C;  3Q5R A;  1KIL E;  5DJU B;  1Q90 D;  2QM7 A;  2LR2 A;  3A7O A;  5DJT B;  4UB6 H;  3MUD C;  1NJI Q;  1FOS E;  3BRT B;  1BE3 G;  5H2F H;  3DQY A;  5KJ7 A;  4C7N A;  1DX7 A;  1R8E A;  3M91 A;  1SQV G;  5AW8 B;  1SQP K;  2V4H A;  1URQ A;  2YO2 A;  1GL2 C;  1NTZ J;  4OVN F;  1JY3 N;  1VQ6 P;  1BDD A;  2R3C A;  2K1A A;  1S5L X;  2OGU A;  2R3S A;  1NTK D;  1GL2 B;  2GBX A;  1PPJ G;  3TGU D;  2IDB A;  2P1J A;  3GL0 A;  2ZYL A;  3L71 E;  1L4A A;  2Y9Z A;  1EZV I;  1T3U A;  2RN0 A;  2KLV A;  1CI6 A;  2JWD A;  1T2K C;  1SQX J;  5AW3 B;  1S9K D;  2B1X A;  1K8A Q;  2K9J A;  4YTP C;  2M0B A;  1X22 A;  5AEU A;  2WWW A;  5KKZ C;  1KZU B;  2SPZ A;  1AVO A;  3H1K G;  1Y8A A;  3VMY A;  2CK3 H;  2KI7 B;  1OVU A;  1RIE A;  3ABV C;  1HF9 A;  3PP5 A;  1JMM A;  2YFI A;  2AXC A;  1L0L E;  1Q7Y Q;  3GB4 A;  3E1R A;  1VQM P;  3II6 A;  1EZV D;  2N1T B;  2E75 C;  3HE4 A;  5TJH A;  1N7S C;  1M56 D;  2H7H A;  2C0X A;  5KLV G;  3CWB D;  3V2N A;  1GTW A;  1MV8 A;  2E75 B;  1NTM E;  2Z5H A;  3VTP C;  4PJ0 E;  1G8J B;  4D6T J;  2FYU G;  2OYI A;  3RL0 B;  1K9M Q;  3CI9 A;  2YFJ A;  3Q3D A;  2KNC A;  5KLI C;  3TF5 A;  3RBX A;  3B5N A;  2W90 A;  2WVR A;  2IZ1 A;  5KLI B;  1KB9 E;  1GL2 D;  3V4Q A;  3HTK A;  3EQ2 A;  2E5Y A;  4NBG D;  1QL2 A;  4UB6 E;  2DW3 A;  4B86 A;  5CCH C;  1YTZ T;  4N6J A;  5H2F E;  2K3R A;  2HR3 A;  1RH5 B;  2HG5 D;  2ZXE B;  3S4R A;  2POH A;  1VQN P;  1Q86 Q;  1PP9 J;  2AEJ A;  3ZDM A;  1BE3 D;  1N73 C;  1J1E C;  5TIS H;  4C46 A;  5AVW B;  2O3J A;  2XNX A;  4JPZ B;  1EDI A;  1M1J C;  1SQV D;  2PFX A;  1FC2 C;  1W2E A;  3GKE A;  1RE4 A;  1MKM A;  1KQL A;  1M1J B;  4WY4 B;  5AVQ B;  2N1T D;  3A0H H;  2HYN A;  3O8Z A;  1NOH A;  1PPJ D;  3L74 J;  4QDF A;  3L36 A;  3CCL P;  3EN1 A;  2E75 D;  1ZXG A;  2K88 A;  2H8P D;  4U3F E;  2QG4 A;  3RL0 D;  2ZXX A;  2C9N Y;  2NZ2 A;  1SLQ A;  2ZT9 C;  3A0B H;  2KOG A;  2KXP B;  1S3J A;  3IR9 A;  1D7M A;  2JWA A;  3H1K D;  1LTB C;  2WPQ A;  2ZT9 B;  1XTG B;  3GF3 A;  4PV1 D;  1YIJ P;  1FZG A;  4QUQ A;  1JM1 A;  3AE5 C;  2M3B A;  3LIE A;  4HB1 A;  2QIW A;  1SQB E;  3G4S P;  3AE2 C;  1U7J A;  3OA7 A;  3RBZ A;  4ASW A;  2O1J A;  3SFE C;  2Q3E A;  1VF5 C;  1MUU A;  2ZFC A;  1W2B O;  3CCJ P;  2I8D A;  1L0N G;  1UUV A;  4XA4 A;  1NKN A;  2DE6 D;  3GHG C;  2WSE J;  4W7Z A;  3W68 A;  1VF5 B;  3L70 E;  4ZKU A;  1RF1 C;  2OQQ A;  5CCH D;  5KLV D;  2E74 B;  3JC2 2;  2QE7 H;  3GHG B;  1SQQ E;  2FYU D;  2NVG A;  1AVY A;  3FX0 A;  2QJK C;  3TGU J;  3CXH H;  2W83 C;  1HH0 A;  2KS1 B;  4WB4 A;  2XKM A;  1IFM A;  3L72 E;  1Z56 A;  1JCD A;  5APS A;  2QJK B;  2NVF A;  4NBC D;  3RK2 D;  4WY4 D;  2IX7 C;  1LJ2 A;  1YI2 P;  2FBW C;  3GG2 A;  5GTI H;  2YVJ B;  1LTT C;  5KLV K;  1FE6 A;  3L71 G;  1QX8 A;  2FYU K;  4YPC A;  4GIF A;  1MFT A;  1SP4 A;  4AAY B;  4LLH A;  1RHZ B;  1VQ9 P;  4HM1 A;  3A3Y B;  2A06 E;  4TT3 H;  3O6Q B;  5CXM A;  2O01 J;  1IC2 A;  3P8C D;  2OYH A;  3HUS C;  3A0H E;  1YQ3 C;  2JZA A;  4AYC A;  3VMI D;  3VYI A;  3CWB J;  1YJ9 P;  1M7L A;  3VMH D;  3OJA B;  1IK9 A;  3HUS B;  3A2A A;  1VQL P;  2JEE A;  2WQY C;  1VF5 D;  2WPV B;  3A0B E;  2E74 D;  2WZ7 A;  1FU1 A;  1RF0 A;  4OH8 B;  3CPW O;  2NPS B;  1BCC G;  3LW5 J;  4QUR A;  1Q81 Q;  3H1J J;  2FYZ A;  3GMA A;  1NU1 E;  3LID A;  2BMO A;  1NTM G;  4HM7 A;  1NTZ K;  1PL5 A;  4QDC A;  4QCK A;  2E43 A;  2RH0 A;  1H0T A;  1PV3 A;  1IJD B;  4TLF A;  1K73 Q;  1R5L A;  1VCK A;  1JEK A;  2PGD A;  1S72 P;  1OFC X;  2P58 A;  3H1H E;  1NWQ A;  2A45 I;  2JKV A;  2LXC B;  3CLQ A;  1QL1 A;  1L0N D;  1JB0 J;  1SQV J;  3KHU A;  2O01 N;  2LKM A;  1PIX A;  1LP1 A;  2GM4 A;  1EG9 A;  2BMQ A;  3CXH E;  1PGP A;  1SFC C;  3PLN A;  1NTK G;  2Y0E A;  1LT9 C;  1KIL D;  2P2U A;  3F5H A;  1FDI A;  3QWO C;  5AVS B;  1USD A;  4KHX A;  1ULI A;  1Q90 C;  1SFC B;  1LT9 B;  1M57 D;  3M0D A;  2KZI A;  4I6M C;  2BAS A;  1VQO P;  5AVY B;  3TYY A;  5GTI E;  1NAF A;  3MUD A;  1L0N K;  5B5E E;  3BAT A;  5APY A;  2NPS D;  3D89 A;  3AE3 C;  3C8V A;  2M5A B;  1PFI A;  1GL2 A;  3L71 D;  3TNU A;  1YBK A;  1EZV G;  3VP8 A;  4U3F G;  2OTL P;  1YYC A;  2VRS A;  2PP6 A;  1RY3 A;  1P84 H;  3R4Y A;  4ZNC A;  4NB8 D;  1AQT A;  1W5C E;  4I1L A;  3GLM A;  1ULJ A;  1ZRT E;  5KLV J;  1SQX E;  2Q7C A;  4I2L C;  5EFW B;  4PD4 I;  1N7L A;  3E1I A;  1NVO A;  1SQB G;  2FYU J;  2E4P A;  1PGQ A;  4DOJ A;  1BGY G;  2N9B A;  1JY2 N;  1KB9 I;  5AW2 B;  5AW5 B;  3WMM 0;  1O7N A;  4PD4 H;  2KUB A;  3V5B A;  5BU5 A;  3L70 G;  4U7J A;  1LTG C;  2NUK A;  4L76 A;  1S5L H;  2P67 A;  1USE A;  1SFC D;  1NTM D;  1KFM A;  1SQQ G;  2UWJ E;  2J59 M;  1E5W A;  1N7S A;  3SSU A;  1YJN P;  3BAS A;  1H8A A;  1FZC C;  1JTH B;  3N0Q A;  3L72 G;  3B4S A;  3L4F A;  1FZF A;  1A02 J;  3D70 A;  1FZC B;  1KB9 D;  2YKO A;  1VL2 A;  3RGU A;  3VMZ A;  1JY2 P;  1QLE D;  2OTJ P;  3H1I J;  4GDO A;  2NVE A;  1NYH A;  2KB7 P;  2BMR A;  2YMK A;  2XDJ A;  2A06 G;  5CCH A;  3U1A A;  1KV4 A;  2FXM A;  3H6P A;  1S4X A;  2NRG A;  3AE1 C;  3AE7 C;  1N73 A;  3L73 G;  3H25 A;  2ZVO B;  1Q2N A;  1X0T A;  3C1L A;  3FOU A;  5AVV B;  1QEX A;  1M1J A;  1KC8 Q;  2QJY B;  1CSB A;  1UIX A;  3L75 J;  2N1T C;  3F89 A;  1SJG A;  1NTK K;  1KQS O;  1P84 E;  2C0W A;  3AED C;  4U3F D;  2K9Y A;  4KT0 J;  5APQ A;  1GW3 A;  3MZW B;  1L0N J;  1N8R Q;  3RL0 C;  1IFP A;  1LWU B;  3D6Y A;  1FJK A;  3PRJ A;  2P7J A;  2PRR A;  1SQP E;  2C9L Y;  2HPC A;  2XV5 A;  2JO1 A;  1AQ5 A;  4PV1 C;  3H1H G;  1FS0 E;  1SQB D;  4PD4 E;  4R4L A;  4NBF D;  1FDO A;  4WWI A;  1BGY D;  2YIU B;  1O7G A;  1S5L E;  2OAR A;  2CPB A;  4NBD D;  4PV1 B;  5APX A;  4RKU J;  2FXP A;  2IZ0 A;  3L70 D;  2ZVN B;  1KYO I;  1VPC A;  4C7R A;  4NPF X;  1URQ C;  2O1K A;  4LC1 A;  5CJ0 A;  1SS1 A;  1RQV A;  4EOT A;  4Z1M H;  4C7N B;  5AVT B;  1SQQ D;  4NBB D;  4OGQ D;  1URQ B;  2R32 A;  1RF1 A;  3L71 J;  2XRX A;  2R44 A;  1KYO H;  4A7P A;  4EMJ B;  2FFD C;  4GKG A;  2KS1 A;  1L4A C;  3L72 D;  1GK4 A;  1HVV A;  2BCC E;  4BWN A;  3BCC E;  3CCR P;  2XR8 A;  3RK2 C;  4WY4 C;  2FFD B;  1L4A B;  1JCC A;  3H1L E; 
#chains in the Genus database with same CATH homology
 2I7F A;  4QDD A;  4U3F E;  1O7N A;  3L73 E;  4HM4 A;  1SJG A;  1EG9 A;  2BMQ A;  1NTM E;  3CXH E;  2E76 D;  2XSO A;  2YFL A;  4NBH D;  3H1K E;  1NDO A;  1G8J B;  4AAY B;  3VMG D;  1P84 E;  3DQY A;  2JO6 A;  1BGY E;  2NUK A;  2YFJ A;  4HKV A;  4QUP A;  4HM1 A;  1PP9 E;  5AEW A;  2A06 E;  2QJY C;  5KLI C;  2DE5 D;  1ULI A;  1Q90 C;  2D2C D;  5CXM A;  3GZX A;  4H44 D;  1KYO E;  4PV1 D;  1NTK E;  1RFS A;  5HL4 A;  3TGU E;  4QUQ A;  3VCP A;  1JM1 A;  3GTS A;  3GL2 A;  2JZA A;  3VMI D;  5BOK A;  3N0Q A;  1KB9 E;  1SQB E;  4AIV A;  3VMH D;  1VM9 A;  2GBW A;  2IBZ E;  1UUW A;  3L75 E;  1SQP E;  2GBX A;  4NBG D;  3GL0 A;  2XSH A;  2Q3W A;  2ZYL A;  5KLV E;  3L71 E;  1UUV A;  4HM2 A;  1O7W A;  4PD4 E;  2DE6 D;  1VF5 D;  4NBF D;  2B24 A;  2HMM A;  4P1B H;  1BE3 E;  2FYN C;  2HMJ A;  3C0D A;  3GCE A;  2E4Q A;  3D89 A;  3L70 E;  2FYU E;  3L74 E;  4QDF B;  1O7G A;  2E74 D;  1FQT A;  2B1X A;  4NBA D;  4NBD D;  3CX5 E;  1WQL A;  4H0L D;  2NVE A;  4QUR A;  4HJL A;  3GTE A;  1SQV E;  4NBE D;  2DE7 D;  5AEU A;  1NU1 E;  1SQQ E;  5KKZ C;  2BMO A;  2NVG A;  3GZY A;  4HM5 A;  2YIU C;  4H13 D;  4HM7 A;  2QJK C;  3VCA A;  2HML A;  4D6T E;  2BMR A;  4QDC A;  4QCK A;  1BCC E;  2HMO A;  2NWF A;  1RIE A;  2HMN A;  4P1C H;  4HM8 A;  4NB9 D;  1O7M A;  3L72 E;  2CKF A;  4NB8 D;  1O7P A;  1VCK A;  3AZC A;  1EZV E;  4NBB D;  3GKE A;  4OGQ D;  1PPJ E;  2NVF A;  4NBC D;  4HM3 A;  1ULJ A;  1NYK A;  1ZRT E;  1L0L E;  3H1I E;  2YFI A;  1L0N E;  1SQX E;  2XRX A;  4EMJ B;  1NTZ E;  3H1H E;  2NUM A;  3GOB A;  3GB4 A;  4HM6 A;  1G8K B;  1O7H A;  2ZT9 D;  3CWB E;  2QJP C;  2YVJ B;  2E4P A;  4QDF A;  3EQQ A;  3H1J E;  2BCC E;  4HM0 A;  3BCC E;  3FOU A;  2XR8 A;  3EN1 A;  2E75 D;  2QPZ A;  3H1L E;  2HMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...