1PPQA

Nmr structure of 16th module of immune adherence receptor, cr1 (cd35)
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
b'EAEAKSCKTPPDPVNGMVHVITDIQVGSRITYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement receptor type 1
publication title Backbone dynamics of complement control protein (CCP) modules reveals mobility in binding surfaces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 4
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1ppqA01
4JHSA 3GOVA 5HZPB 4IGDA 4AYIA 1OJYA 1O9AA 1UOTP 2UWNA 3ZD2A 2EHFA 1E88A 2W80A 1SS2A 1OK1A 5FO8C 1GHQB 3KXVA 3ZRZA 4LOSA 1H03P 1QO6A 1GKNA 5JPMG 1ZJKA 1E8BA 2RL0A 1OK3A 1OK9A 2RLPA 1Q3XA 1MD7A 2G7IA 4DJZA 2XRDA 1LY2A 3NFPI 2YRAA 3O8EB 4AYMA 2IZ3A 1VVCA 2B5ID 2ERJA 3ERBA 1TPNA 3ZD1A 2KRIA 4C16A 4LOTA 2RKYA 1FBRA 4WJG2 3MQLA 4A5WB 2XWJI 1QUBA 2CKUA 3INBC 1Z92B 4MUCA 2JRAA 2CG7A 1HCCA 2EC3A 3OXUD 1SRZA 2RKZA 5HYPA 5HYTB 3SW0X 1GKGA 2MCZA 3GXEA 3OP8A 1OK2A 1H04P 4PZ5A 4ONTD 1C1ZA 2JGWA 2BZMA 1G4GA 5I0QB 2LOJA 4FXGG 2O39C 4B2RA 1G4FA 2RLQA 1HFIA 4CSYA 4KKDA 2QY0A 2XQWC 2WIIC 3M7PA 4F4OC 3OEDC 1TPGA 4AYDA 3IU3I 1MD8A 2XWBF 3L89M 3EJHA 2CG6A 2MCYA 4AYEA 1QGBA 2YBYA 1ELVA 2V8EA 2XRBA 4J38B 2IZ4A 5HYUB 1VVDA 3IX0A 2A55A 1TPMA 3T5OA 2JGXA 2W81A 2KMSA 1OJWA 3R62A 3RJ3D 1HFHA 4YNXA 4K12A 1CKLA 1U5MA 1PPQA 4ZH1D 1GPZA 1OJVA 4B2SA 3TVJA 1E5GA 1NWVA 3CALA 1H2PP 3KZJA 1H2QP
chains in the Genus database with same CATH superfamily
4JHSA 3FGTA 3GOVA 5HZPB 4IGDA 4AYIA 1OJYA 1O9AA 1UOTP 2UWNA 3ZD2A 2EHFA 1E88A 2W80A 1SS2A 1OK1A 4N7EA 3K3TA 4MSLA 1RLHA 5FO8C 1GHQB 3KXVA 3ZRZA 4LOSA 1H03P 4APLA 3FGRA 2Y8TA 1QO6A 1GKNA 5JPMG 1ZJKA 1E8BA 2RL0A 1OK3A 1OK9A 2RLPA 1Q3XA 1MD7A 2G7IA 4DJZA 2XRDA 1LY2A 3NFPI 2YRAA 3O8EB 4AYMA 2IZ3A 1VVCA 2B5ID 2ERJA 3ERBA 1TPNA 3ZD1A 3VWOA 2KRIA 4C16A 4LOTA 2RKYA 1FBRA 4WJG2 3MQLA 4A5WB 2XWJI 1QUBA 3NJAA 2CKUA 3INBC 1Z92B 4MUCA 2JRAA 2CG7A 1HCCA 2EC3A 3OXUD 1SRZA 2X2ZA 2RKZA 4BWCA 5HYPA 5HYTB 3SW0X 1GKGA 4PO7A 2MCZA 3GXEA 3OP8A 1OK2A 1H04P 2I2LA 4PZ5A 4ONTD 4YIZA 1C1ZA 2JGWA 2BZMA 1G4GA 5I0QB 2LOJA 4FXGG 3F6KA 2O39C 3ZLDA 4B2RA 1G4FA 2RLQA 1HFIA 4CSYA 4KKDA 2QY0A 2XQWC 3CI0J 2Y8RA 3WSYA 2WIIC 3ZLEA 3M7PA 4F4OC 3OEDC 1TPGA 4AYDA 3IU3I 1MD8A 2XWBF 3WSXA 2ZYCA 5DN5A 3L89M 3EJHA 2CG6A 2MCYA 4AYEA 1QGBA 2YBYA 1ELVA 2V8EA 2XRBA 4J38B 2IZ4A 2Y8SA 5HYUB 1VVDA 3IX0A 2A55A 1TPMA 3T5OA 2JGXA 2W81A 2KMSA 1OJWA 3R62A 3RJ3D 1HFHA 4YNXA 4K12A 1CKLA 1U5MA 1PPQA 4ZH1D 1GPZA 1OJVA 4B2SA 3TVJA 1E5GA 1NWVA 3CALA 1H2PP 5DN4A 3KZJA 1H2QP
chains in the Genus database with same CATH topology
4JHSA 3GOVA 5HZPB 4IGDA 4AYIA 1OJYA 1O9AA 1UOTP 2UWNA 3ZD2A 2EHFA 1E88A 2W80A 1SS2A 1OK1A 5FO8C 1GHQB 3KXVA 3ZRZA 4LOSA 1H03P 1QO6A 1GKNA 5JPMG 1ZJKA 1E8BA 2RL0A 1OK3A 1OK9A 2RLPA 1Q3XA 1MD7A 2G7IA 4DJZA 2XRDA 1LY2A 3NFPI 2YRAA 3O8EB 4AYMA 2IZ3A 1VVCA 2B5ID 2ERJA 3ERBA 1TPNA 3ZD1A 2KRIA 4C16A 4LOTA 2RKYA 1FBRA 4WJG2 3MQLA 4A5WB 2XWJI 1QUBA 2CKUA 3INBC 1Z92B 4MUCA 2JRAA 2CG7A 1HCCA 2EC3A 3OXUD 1SRZA 2RKZA 5HYPA 5HYTB 3SW0X 1GKGA 2MCZA 3GXEA 3OP8A 1OK2A 1H04P 4PZ5A 4ONTD 1C1ZA 2JGWA 2BZMA 1G4GA 5I0QB 2LOJA 4FXGG 2O39C 4B2RA 1G4FA 2RLQA 1HFIA 4CSYA 4KKDA 2QY0A 2XQWC 2WIIC 3M7PA 4F4OC 3OEDC 1TPGA 4AYDA 3IU3I 1MD8A 2XWBF 3L89M 3EJHA 2CG6A 2MCYA 4AYEA 1QGBA 2YBYA 1ELVA 2V8EA 2XRBA 4J38B 2IZ4A 5HYUB 1VVDA 3IX0A 2A55A 1TPMA 3T5OA 2JGXA 2W81A 2KMSA 1OJWA 3R62A 3RJ3D 1HFHA 4YNXA 4K12A 1CKLA 1U5MA 1PPQA 4ZH1D 1GPZA 1OJVA 4B2SA 3TVJA 1E5GA 1NWVA 3CALA 1H2PP 3KZJA 1H2QP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JHS A;  3GOV A;  5HZP B;  4IGD A;  4AYI A;  1OJY A;  1O9A A;  1UOT P;  2UWN A;  3ZD2 A;  2EHF A;  1E88 A;  2W80 A;  1SS2 A;  1OK1 A;  5FO8 C;  1GHQ B;  3KXV A;  3ZRZ A;  4LOS A;  1H03 P;  1QO6 A;  1GKN A;  5JPM G;  1ZJK A;  1E8B A;  2RL0 A;  1OK3 A;  1OK9 A;  2RLP A;  1Q3X A;  1MD7 A;  2G7I A;  4DJZ A;  2XRD A;  1LY2 A;  3NFP I;  2YRA A;  3O8E B;  4AYM A;  2IZ3 A;  1VVC A;  2B5I D;  2ERJ A;  3ERB A;  1TPN A;  3ZD1 A;  2KRI A;  4C16 A;  4LOT A;  2RKY A;  1FBR A;  4WJG 2;  3MQL A;  4A5W B;  2XWJ I;  1QUB A;  2CKU A;  3INB C;  1Z92 B;  4MUC A;  2JRA A;  2CG7 A;  1HCC A;  2EC3 A;  3OXU D;  1SRZ A;  2RKZ A;  5HYP A;  5HYT B;  3SW0 X;  1GKG A;  2MCZ A;  3GXE A;  3OP8 A;  1OK2 A;  1H04 P;  4PZ5 A;  4ONT D;  1C1Z A;  2JGW A;  2BZM A;  1G4G A;  5I0Q B;  2LOJ A;  4FXG G;  2O39 C;  4B2R A;  1G4F A;  2RLQ A;  1HFI A;  4CSY A;  4KKD A;  2QY0 A;  2XQW C;  2WII C;  3M7P A;  4F4O C;  3OED C;  1TPG A;  4AYD A;  3IU3 I;  1MD8 A;  2XWB F;  3L89 M;  3EJH A;  2CG6 A;  2MCY A;  4AYE A;  1QGB A;  2YBY A;  1ELV A;  2V8E A;  2XRB A;  4J38 B;  2IZ4 A;  5HYU B;  1VVD A;  3IX0 A;  2A55 A;  1TPM A;  3T5O A;  2JGX A;  2W81 A;  2KMS A;  1OJW A;  3R62 A;  3RJ3 D;  1HFH A;  4YNX A;  4K12 A;  1CKL A;  1U5M A;  1PPQ A;  4ZH1 D;  1GPZ A;  1OJV A;  4B2S A;  3TVJ A;  1E5G A;  1NWV A;  3CAL A;  1H2P P;  3KZJ A;  1H2Q P; 
#chains in the Genus database with same CATH topology
 4JHS A;  3FGT A;  3GOV A;  5HZP B;  4IGD A;  4AYI A;  1OJY A;  1O9A A;  1UOT P;  2UWN A;  3ZD2 A;  2EHF A;  1E88 A;  2W80 A;  1SS2 A;  1OK1 A;  4N7E A;  3K3T A;  4MSL A;  1RLH A;  5FO8 C;  1GHQ B;  3KXV A;  3ZRZ A;  4LOS A;  1H03 P;  4APL A;  3FGR A;  2Y8T A;  1QO6 A;  1GKN A;  5JPM G;  1ZJK A;  1E8B A;  2RL0 A;  1OK3 A;  1OK9 A;  2RLP A;  1Q3X A;  1MD7 A;  2G7I A;  4DJZ A;  2XRD A;  1LY2 A;  3NFP I;  2YRA A;  3O8E B;  4AYM A;  2IZ3 A;  1VVC A;  2B5I D;  2ERJ A;  3ERB A;  1TPN A;  3ZD1 A;  3VWO A;  2KRI A;  4C16 A;  4LOT A;  2RKY A;  1FBR A;  4WJG 2;  3MQL A;  4A5W B;  2XWJ I;  1QUB A;  3NJA A;  2CKU A;  3INB C;  1Z92 B;  4MUC A;  2JRA A;  2CG7 A;  1HCC A;  2EC3 A;  3OXU D;  1SRZ A;  2X2Z A;  2RKZ A;  4BWC A;  5HYP A;  5HYT B;  3SW0 X;  1GKG A;  4PO7 A;  2MCZ A;  3GXE A;  3OP8 A;  1OK2 A;  1H04 P;  2I2L A;  4PZ5 A;  4ONT D;  4YIZ A;  1C1Z A;  2JGW A;  2BZM A;  1G4G A;  5I0Q B;  2LOJ A;  4FXG G;  3F6K A;  2O39 C;  3ZLD A;  4B2R A;  1G4F A;  2RLQ A;  1HFI A;  4CSY A;  4KKD A;  2QY0 A;  2XQW C;  3CI0 J;  2Y8R A;  3WSY A;  2WII C;  3ZLE A;  3M7P A;  4F4O C;  3OED C;  1TPG A;  4AYD A;  3IU3 I;  1MD8 A;  2XWB F;  3WSX A;  2ZYC A;  5DN5 A;  3L89 M;  3EJH A;  2CG6 A;  2MCY A;  4AYE A;  1QGB A;  2YBY A;  1ELV A;  2V8E A;  2XRB A;  4J38 B;  2IZ4 A;  2Y8S A;  5HYU B;  1VVD A;  3IX0 A;  2A55 A;  1TPM A;  3T5O A;  2JGX A;  2W81 A;  2KMS A;  1OJW A;  3R62 A;  3RJ3 D;  1HFH A;  4YNX A;  4K12 A;  1CKL A;  1U5M A;  1PPQ A;  4ZH1 D;  1GPZ A;  1OJV A;  4B2S A;  3TVJ A;  1E5G A;  1NWV A;  3CAL A;  1H2P P;  5DN4 A;  3KZJ A;  1H2Q P; 
#chains in the Genus database with same CATH homology
 4JHS A;  3GOV A;  5HZP B;  4IGD A;  4AYI A;  1OJY A;  1O9A A;  1UOT P;  2UWN A;  3ZD2 A;  2EHF A;  1E88 A;  2W80 A;  1SS2 A;  1OK1 A;  5FO8 C;  1GHQ B;  3KXV A;  3ZRZ A;  4LOS A;  1H03 P;  1QO6 A;  1GKN A;  5JPM G;  1ZJK A;  1E8B A;  2RL0 A;  1OK3 A;  1OK9 A;  2RLP A;  1Q3X A;  1MD7 A;  2G7I A;  4DJZ A;  2XRD A;  1LY2 A;  3NFP I;  2YRA A;  3O8E B;  4AYM A;  2IZ3 A;  1VVC A;  2B5I D;  2ERJ A;  3ERB A;  1TPN A;  3ZD1 A;  2KRI A;  4C16 A;  4LOT A;  2RKY A;  1FBR A;  4WJG 2;  3MQL A;  4A5W B;  2XWJ I;  1QUB A;  2CKU A;  3INB C;  1Z92 B;  4MUC A;  2JRA A;  2CG7 A;  1HCC A;  2EC3 A;  3OXU D;  1SRZ A;  2RKZ A;  5HYP A;  5HYT B;  3SW0 X;  1GKG A;  2MCZ A;  3GXE A;  3OP8 A;  1OK2 A;  1H04 P;  4PZ5 A;  4ONT D;  1C1Z A;  2JGW A;  2BZM A;  1G4G A;  5I0Q B;  2LOJ A;  4FXG G;  2O39 C;  4B2R A;  1G4F A;  2RLQ A;  1HFI A;  4CSY A;  4KKD A;  2QY0 A;  2XQW C;  2WII C;  3M7P A;  4F4O C;  3OED C;  1TPG A;  4AYD A;  3IU3 I;  1MD8 A;  2XWB F;  3L89 M;  3EJH A;  2CG6 A;  2MCY A;  4AYE A;  1QGB A;  2YBY A;  1ELV A;  2V8E A;  2XRB A;  4J38 B;  2IZ4 A;  5HYU B;  1VVD A;  3IX0 A;  2A55 A;  1TPM A;  3T5O A;  2JGX A;  2W81 A;  2KMS A;  1OJW A;  3R62 A;  3RJ3 D;  1HFH A;  4YNX A;  4K12 A;  1CKL A;  1U5M A;  1PPQ A;  4ZH1 D;  1GPZ A;  1OJV A;  4B2S A;  3TVJ A;  1E5G A;  1NWV A;  3CAL A;  1H2P P;  3KZJ A;  1H2Q P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...