1PPQA

Nmr structure of 16th module of immune adherence receptor, cr1 (cd35)
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
EAEAKSCKTPPDPVNGMVHVITDIQVGSRITYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement receptor type 1
publication title Backbone dynamics of complement control protein (CCP) modules reveals mobility in binding surfaces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 4
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1ppqA01
3CALA 2EC3A 1QGBA 4JHSA 1OK1A 2XWBF 1NWVA 1QUBA 2MCZA 2RKZA 5I0QB 1GKGA 3R62A 1TPNA 1H03P 3O8EB 4B2RA 4J38B 3EJHA 2QY0A 2XRBA 2XRDA 1UOTP 1OK3A 1SRZA 2YRAA 1QO6A 2W80A 2IZ3A 1PPQA 2CG7A 4LOSA 3IU3I 2V8EA 3ZRZA 3ZD2A 1HCCA 4AYIA 5HYPA 3OEDC 1H04P 4DJZA 2EHFA 1FBRA 1TPGA 3TVJA 1E8BA 5FO8C 4A5WB 2IZ4A 1G4FA 1VVCA 3T5OA 4AYEA 3KZJA 2B5ID 3GOVA 2JGXA 3L89M 2MCYA 2WIIC 1MD8A 1OK9A 2UWNA 1G4GA 3GXEA 1MD7A 5HZPB 4C16A 2A55A 1E5GA 1H2PP 4B2SA 4ZH1D 1GKNA 2RKYA 4F4OC 2KRIA 4CSYA 4IGDA 3RJ3D 4YNXA 2XWJI 1VVDA 3IX0A 1E88A 4MUCA 2BZMA 4WJG2 1OJWA 1OJYA 3SW0X 1ZJKA 2JGWA 1OK2A 1O9AA 4ONTD 1GHQB 1Q3XA 4AYDA 4PZ5A 4K12A 2YBYA 2KMSA 2XQWC 3INBC 1TPMA 1C1ZA 3M7PA 2CG6A 5HYUB 1ELVA 3OXUD 3KXVA 3ZD1A 3ERBA 1HFHA 4AYMA 1LY2A 5HYTB 1GPZA 1OJVA 2RLQA 2ERJA 3OP8A 4LOTA 2LOJA 3NFPI 1CKLA 2G7IA 2RL0A 1Z92B 4FXGG 1HFIA 2JRAA 2W81A 1SS2A 2RLPA 2CKUA 3MQLA 1H2QP 4KKDA 2O39C 5JPMG 1U5MA
chains in the Genus database with same CATH superfamily
3CALA 2EC3A 3FGRA 1QGBA 4JHSA 1OK1A 2XWBF 1NWVA 1QUBA 2MCZA 2RKZA 5I0QB 1GKGA 3R62A 1TPNA 1H03P 3O8EB 4B2RA 2Y8TA 4J38B 3EJHA 2QY0A 4YIZA 5DN5A 2XRBA 2Y8RA 2XRDA 1UOTP 1OK3A 1SRZA 2YRAA 4MSLA 1QO6A 2W80A 2IZ3A 2X2ZA 1PPQA 2CG7A 4LOSA 3IU3I 3NJAA 4APLA 2V8EA 3ZRZA 3WSYA 3ZD2A 1HCCA 3F6KA 4AYIA 5HYPA 3OEDC 1H04P 4DJZA 2EHFA 2Y8SA 1FBRA 1TPGA 3TVJA 4N7EA 1E8BA 5FO8C 4A5WB 2IZ4A 1G4FA 1VVCA 3T5OA 4AYEA 4PO7A 3KZJA 2B5ID 3GOVA 2JGXA 3L89M 2MCYA 2WIIC 1MD8A 1OK9A 2UWNA 1G4GA 3GXEA 1MD7A 5HZPB 4C16A 2A55A 1E5GA 1H2PP 4B2SA 4ZH1D 1GKNA 4BWCA 3ZLEA 2RKYA 4F4OC 2KRIA 3CI0J 4IGDA 3RJ3D 4CSYA 4YNXA 2XWJI 1VVDA 3IX0A 1RLHA 1E88A 4MUCA 2BZMA 4WJG2 1OJWA 1OJYA 5DN4A 3SW0X 1ZJKA 2I2LA 2JGWA 1OK2A 1O9AA 4ONTD 1GHQB 1Q3XA 3WSXA 4PZ5A 4AYDA 4K12A 2YBYA 2KMSA 2XQWC 3INBC 1TPMA 1C1ZA 3M7PA 2CG6A 5HYUB 1ELVA 3OXUD 3KXVA 3ZD1A 3ERBA 1HFHA 2ZYCA 1LY2A 4AYMA 5HYTB 1GPZA 1OJVA 2RLQA 2ERJA 3OP8A 4LOTA 3K3TA 2LOJA 3NFPI 1CKLA 2G7IA 2RL0A 1Z92B 4FXGG 1HFIA 2JRAA 2W81A 3VWOA 3ZLDA 1SS2A 2RLPA 3FGTA 2CKUA 3MQLA 1H2QP 4KKDA 2O39C 5JPMG 1U5MA
chains in the Genus database with same CATH topology
3CALA 2EC3A 1QGBA 4JHSA 1OK1A 2XWBF 1NWVA 1QUBA 2MCZA 2RKZA 5I0QB 1GKGA 3R62A 1TPNA 1H03P 3O8EB 4B2RA 4J38B 3EJHA 2QY0A 2XRBA 2XRDA 1UOTP 1OK3A 1SRZA 2YRAA 1QO6A 2W80A 2IZ3A 1PPQA 2CG7A 4LOSA 3IU3I 2V8EA 3ZRZA 3ZD2A 1HCCA 4AYIA 5HYPA 3OEDC 1H04P 4DJZA 2EHFA 1FBRA 1TPGA 3TVJA 1E8BA 5FO8C 4A5WB 2IZ4A 1G4FA 1VVCA 3T5OA 4AYEA 3KZJA 2B5ID 3GOVA 2JGXA 3L89M 2MCYA 2WIIC 1MD8A 1OK9A 2UWNA 1G4GA 3GXEA 1MD7A 5HZPB 4C16A 2A55A 1E5GA 1H2PP 4B2SA 4ZH1D 1GKNA 2RKYA 4F4OC 2KRIA 4CSYA 4IGDA 3RJ3D 4YNXA 2XWJI 1VVDA 3IX0A 1E88A 4MUCA 2BZMA 4WJG2 1OJWA 1OJYA 3SW0X 1ZJKA 2JGWA 1OK2A 1O9AA 4ONTD 1GHQB 1Q3XA 4AYDA 4PZ5A 4K12A 2YBYA 2KMSA 2XQWC 3INBC 1TPMA 1C1ZA 3M7PA 2CG6A 5HYUB 1ELVA 3OXUD 3KXVA 3ZD1A 3ERBA 1HFHA 4AYMA 1LY2A 5HYTB 1GPZA 1OJVA 2RLQA 2ERJA 3OP8A 4LOTA 2LOJA 3NFPI 1CKLA 2G7IA 2RL0A 1Z92B 4FXGG 1HFIA 2JRAA 2W81A 1SS2A 2RLPA 2CKUA 3MQLA 1H2QP 4KKDA 2O39C 5JPMG 1U5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAL A;  2EC3 A;  1QGB A;  4JHS A;  1OK1 A;  2XWB F;  1NWV A;  1QUB A;  2MCZ A;  2RKZ A;  5I0Q B;  1GKG A;  3R62 A;  1TPN A;  1H03 P;  3O8E B;  4B2R A;  4J38 B;  3EJH A;  2QY0 A;  2XRB A;  2XRD A;  1UOT P;  1OK3 A;  1SRZ A;  2YRA A;  1QO6 A;  2W80 A;  2IZ3 A;  1PPQ A;  2CG7 A;  4LOS A;  3IU3 I;  2V8E A;  3ZRZ A;  3ZD2 A;  1HCC A;  4AYI A;  5HYP A;  3OED C;  1H04 P;  4DJZ A;  2EHF A;  1FBR A;  1TPG A;  3TVJ A;  1E8B A;  5FO8 C;  4A5W B;  2IZ4 A;  1G4F A;  1VVC A;  3T5O A;  4AYE A;  3KZJ A;  2B5I D;  3GOV A;  2JGX A;  3L89 M;  2MCY A;  2WII C;  1MD8 A;  1OK9 A;  2UWN A;  1G4G A;  3GXE A;  1MD7 A;  5HZP B;  4C16 A;  2A55 A;  1E5G A;  1H2P P;  4B2S A;  4ZH1 D;  1GKN A;  2RKY A;  4F4O C;  2KRI A;  4CSY A;  4IGD A;  3RJ3 D;  4YNX A;  2XWJ I;  1VVD A;  3IX0 A;  1E88 A;  4MUC A;  2BZM A;  4WJG 2;  1OJW A;  1OJY A;  3SW0 X;  1ZJK A;  2JGW A;  1OK2 A;  1O9A A;  4ONT D;  1GHQ B;  1Q3X A;  4AYD A;  4PZ5 A;  4K12 A;  2YBY A;  2KMS A;  2XQW C;  3INB C;  1TPM A;  1C1Z A;  3M7P A;  2CG6 A;  5HYU B;  1ELV A;  3OXU D;  3KXV A;  3ZD1 A;  3ERB A;  1HFH A;  4AYM A;  1LY2 A;  5HYT B;  1GPZ A;  1OJV A;  2RLQ A;  2ERJ A;  3OP8 A;  4LOT A;  2LOJ A;  3NFP I;  1CKL A;  2G7I A;  2RL0 A;  1Z92 B;  4FXG G;  1HFI A;  2JRA A;  2W81 A;  1SS2 A;  2RLP A;  2CKU A;  3MQL A;  1H2Q P;  4KKD A;  2O39 C;  5JPM G;  1U5M A; 
#chains in the Genus database with same CATH topology
 3CAL A;  2EC3 A;  3FGR A;  1QGB A;  4JHS A;  1OK1 A;  2XWB F;  1NWV A;  1QUB A;  2MCZ A;  2RKZ A;  5I0Q B;  1GKG A;  3R62 A;  1TPN A;  1H03 P;  3O8E B;  4B2R A;  2Y8T A;  4J38 B;  3EJH A;  2QY0 A;  4YIZ A;  5DN5 A;  2XRB A;  2Y8R A;  2XRD A;  1UOT P;  1OK3 A;  1SRZ A;  2YRA A;  4MSL A;  1QO6 A;  2W80 A;  2IZ3 A;  2X2Z A;  1PPQ A;  2CG7 A;  4LOS A;  3IU3 I;  3NJA A;  4APL A;  2V8E A;  3ZRZ A;  3WSY A;  3ZD2 A;  1HCC A;  3F6K A;  4AYI A;  5HYP A;  3OED C;  1H04 P;  4DJZ A;  2EHF A;  2Y8S A;  1FBR A;  1TPG A;  3TVJ A;  4N7E A;  1E8B A;  5FO8 C;  4A5W B;  2IZ4 A;  1G4F A;  1VVC A;  3T5O A;  4AYE A;  4PO7 A;  3KZJ A;  2B5I D;  3GOV A;  2JGX A;  3L89 M;  2MCY A;  2WII C;  1MD8 A;  1OK9 A;  2UWN A;  1G4G A;  3GXE A;  1MD7 A;  5HZP B;  4C16 A;  2A55 A;  1E5G A;  1H2P P;  4B2S A;  4ZH1 D;  1GKN A;  4BWC A;  3ZLE A;  2RKY A;  4F4O C;  2KRI A;  3CI0 J;  4IGD A;  3RJ3 D;  4CSY A;  4YNX A;  2XWJ I;  1VVD A;  3IX0 A;  1RLH A;  1E88 A;  4MUC A;  2BZM A;  4WJG 2;  1OJW A;  1OJY A;  5DN4 A;  3SW0 X;  1ZJK A;  2I2L A;  2JGW A;  1OK2 A;  1O9A A;  4ONT D;  1GHQ B;  1Q3X A;  3WSX A;  4PZ5 A;  4AYD A;  4K12 A;  2YBY A;  2KMS A;  2XQW C;  3INB C;  1TPM A;  1C1Z A;  3M7P A;  2CG6 A;  5HYU B;  1ELV A;  3OXU D;  3KXV A;  3ZD1 A;  3ERB A;  1HFH A;  2ZYC A;  1LY2 A;  4AYM A;  5HYT B;  1GPZ A;  1OJV A;  2RLQ A;  2ERJ A;  3OP8 A;  4LOT A;  3K3T A;  2LOJ A;  3NFP I;  1CKL A;  2G7I A;  2RL0 A;  1Z92 B;  4FXG G;  1HFI A;  2JRA A;  2W81 A;  3VWO A;  3ZLD A;  1SS2 A;  2RLP A;  3FGT A;  2CKU A;  3MQL A;  1H2Q P;  4KKD A;  2O39 C;  5JPM G;  1U5M A; 
#chains in the Genus database with same CATH homology
 3CAL A;  2EC3 A;  1QGB A;  4JHS A;  1OK1 A;  2XWB F;  1NWV A;  1QUB A;  2MCZ A;  2RKZ A;  5I0Q B;  1GKG A;  3R62 A;  1TPN A;  1H03 P;  3O8E B;  4B2R A;  4J38 B;  3EJH A;  2QY0 A;  2XRB A;  2XRD A;  1UOT P;  1OK3 A;  1SRZ A;  2YRA A;  1QO6 A;  2W80 A;  2IZ3 A;  1PPQ A;  2CG7 A;  4LOS A;  3IU3 I;  2V8E A;  3ZRZ A;  3ZD2 A;  1HCC A;  4AYI A;  5HYP A;  3OED C;  1H04 P;  4DJZ A;  2EHF A;  1FBR A;  1TPG A;  3TVJ A;  1E8B A;  5FO8 C;  4A5W B;  2IZ4 A;  1G4F A;  1VVC A;  3T5O A;  4AYE A;  3KZJ A;  2B5I D;  3GOV A;  2JGX A;  3L89 M;  2MCY A;  2WII C;  1MD8 A;  1OK9 A;  2UWN A;  1G4G A;  3GXE A;  1MD7 A;  5HZP B;  4C16 A;  2A55 A;  1E5G A;  1H2P P;  4B2S A;  4ZH1 D;  1GKN A;  2RKY A;  4F4O C;  2KRI A;  4CSY A;  4IGD A;  3RJ3 D;  4YNX A;  2XWJ I;  1VVD A;  3IX0 A;  1E88 A;  4MUC A;  2BZM A;  4WJG 2;  1OJW A;  1OJY A;  3SW0 X;  1ZJK A;  2JGW A;  1OK2 A;  1O9A A;  4ONT D;  1GHQ B;  1Q3X A;  4AYD A;  4PZ5 A;  4K12 A;  2YBY A;  2KMS A;  2XQW C;  3INB C;  1TPM A;  1C1Z A;  3M7P A;  2CG6 A;  5HYU B;  1ELV A;  3OXU D;  3KXV A;  3ZD1 A;  3ERB A;  1HFH A;  4AYM A;  1LY2 A;  5HYT B;  1GPZ A;  1OJV A;  2RLQ A;  2ERJ A;  3OP8 A;  4LOT A;  2LOJ A;  3NFP I;  1CKL A;  2G7I A;  2RL0 A;  1Z92 B;  4FXG G;  1HFI A;  2JRA A;  2W81 A;  1SS2 A;  2RLP A;  2CKU A;  3MQL A;  1H2Q P;  4KKD A;  2O39 C;  5JPM G;  1U5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...