1PPZA

Trypsin complexes at atomic and ultra-high resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
224
structure length
223
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Trypsin Revisited: CRYSTALLOGRAPHY AT (SUB) ATOMIC RESOLUTION AND QUANTUM CHEMISTRY REVEALING DETAILS OF CATALYSIS.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ppzA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ppzA01
4CRFA 4CBNA 4IMQA 3UNQA 1QBOA 2ZNKH 4CR5A 1SFQB 3U8RH 1MKXK 4BANB 1YPEH 3E6PH 3O8CA 3A7TA 4UFEH 1YCPM 2Y81A 4YM9A 1ABJH 3GCNA 3TVJB 1FZZA 2ANMH 1E0FD 2XC4A 1LPZB 2ZGHA 3PWBA 5CMXH 1P0SH 2Z3CA 4IBLH 3Q76A 5C2ZA 4ABHA 4ABFA 1GG6B 4MPUA 2BZAA 4OGYA 1FLEE 1S83A 1A46H 3VGCC 2FOFA 1ELTA 3Q3KA 2VH6A 2SGPE 3RMNH 4YO9A 2UWLA 2BXTH 1IOEA 1C1UH 4WWYA 3SU2A 3SU3A 3BTQE 3PO1B 3P6ZB 2SGFE 1C5XB 2FYRA 1GVZA 3M5MA 1RXPA 4D76A 1C5MD 1C2LA 3ATMA 1O3PB 2Z9LA 2DUCA 1NPMA 1SGPE 1EQ9A 1O35A 3UR9A 8GCHG 1FJSA 1GBLA 3RXOA 5EXLA 2CGAA 3SQEE 1CA0B 1THRH 4INLA 4O9VA 4Q80A 1YPHC 4WH6A 1TMBH 2QIQA 1CBWC 3K65B 2ZU3A 3MNXA 4K2YA 1SGCA 5DP8A 1O2TA 2G00A 2WUCA 1O3HA 1O2OA 1QR3E 3QO6A 4IW4E 2HPQH 1V2VT 2OUAA 1GHVH 1JRSA 3PTBA 2ZTXA 1AVGH 3SHAH 2YOLA 3UFAA 4CH8B 1O0DH 2CJIA 3PB1E 1CU1A 2FOEA 4Y76A 1C5OH 1S81A 1Q31A 1GHAF 3NKKA 5C67A 1V2RT 1EZQA 4J2YB 1GCTB 4QT8C 2A7HA 3ZYDA 1TNKA 3P8GA 3PLKA 3PM3A 3VFEA 4NA9H 1V2PT 1UTOA 2D2DA 2ZDMA 1C5YB 1V2KT 1EZSC 5LH8A 4ISLA 2VU8E 2Q1JA 4FVBA 3PO1C 1GHBG 1ZJKA 3M5NA 1P57B 4UDWH 2QCYA 5K7RA 1GMCF 4B2BA 4Z6AH 3FVFB 1A1RA 1EB2A 3MNSA 1PQ7A 1XUGA 2ZDLA 1DFPA 1NRNH 1HB0B 1NT1A 3Q3YA 1O2HA 2G5VA 1JIRA 4GHTA 4LK4A 4RKOB 1ARCA 2PR3A 1C9PA 5GDSH 1GMDF 4BAQB 3VPKA 3TNSA 4X6PA 3TK5A 4FUBA 1AE8H 1S82A 1QA0A 1YF4A 3MO3A 1C5PA 5A2MH 4OS6A 4I8KA 4D7GA 5DGJA 1MAXA 3M37A 4Y7BA 3SNEA 4D9QA 3RU4D 2Y7ZA 1KXEA 4YT6H 5JYIA 1K1MA 2B5TB 3TH4H 1O3EA 1QJ6B 1GI6A 1LQDB 2ZU5A 1GBTA 1AZZA 1QB9A 2QAAA 2R9PA 5EQRA 1RD3B 1GBIA 1C1NA 1OX1A 1OSSA 1C1QA 1AD8H 2PV9B 1M9UA 1DOJA 1V6DA 1X7AC 1BCUH 1MTNB 1BTXA 2GKVE 2ZGJA 2H6MA 4AYYB 1BMLA 4Q7ZA 2EI6A 4TY7A 3FP8E 2OQ5A 2XW9A 3NUMA 2PWXA 5IYTA 4ZKNU 1Y5AT 2Q6DA 2VVUA 1ANDA 1J15A 2ZU4A 1BZXE 1EXFA 2OBOA 2C8XB 3ODDA 2ZQ2A 3SNCA 1YYY1 1EP5A 3MMGA 2ZDVH 2RG3A 4X1PU 3RXQA 2Y5GA 1V2UT 2Z94A 1GWAA 3KCGH 3VXEH 3KQDA 2ULLA 2W26A 2FXRA 3AW0A 2STAE 3GICB 3M35A 1YLDA 4U30A 1DLKB 1BTWA 2WYGA 3ZZDA 1G30B 1OOKB 4Y6DA 3RXDA 1TGSZ 1HIAB 3BSQA 3VB4A 1KXCA 1HXEH 1BTZA 2OC7A 2P8OB 2Q6FA 1OXGA 3RXSA 2F9NA 1UTMA 3D49H 5EPYA 5DG6A 5LPFA 4B75A 1DWBH 2ASUB 1GL1A 4IC5A 3RXGA 1UO6A 2ZHEH 1MU6B 4LZ4B 2GT7A 2OP9A 5EOKA 1ESTA 1A0HB 3GYMA 3S7HB 1XXFA 2Z6BD 1MTNC 2AERH 4UD9H 1OWEA 2BB4A 3A89A 4YT7H 1D9IA 1C5QA 3MI4A 1CGHA 1C2JA 1UMAH 3MFJA 1QGFA 4WY3A 1DDJA 4HI3A 2HNTF 2Y6TA 4WF8A 3SV9A 3V7TA 1T31A 2F9BH 3SBKA 1GVKB 3NZIA 1ZGVA 3GDUA 3STIA 2ZC9H 4AZ2B 2BDGA 1TX7A 3N7OA 1GI5A 2F3CE 2A7JA 4FXGH 1TQ7B 1ELCA 1TPOA 1FPHH 1QTFA 1W12U 3D23A 1NN6A 2B9LA 1D6RA 2BDCA 1H9HE 1BJVA 1T32A 3F9GA 1DWEH 4ABAA 3S9AA 1K1OA 3P17H 2Y82A 4ABIA 3SQHE 4ZKSU 3U1IB 4XSKU 1CT0E 1HJ9A 4ZHMU 1P2QA 1PFXC 1XUJA 5I46H 1S84A 3H7TA 2G51A 4O03A 1V2MT 1O3JA 1PYTC 1AB9B 1FPCH 2FTLE 3CS0A 2A4RA 1P3EA 3RXAA 2SGQE 1C1RA 1B7XB 1HAOH 1O2KA 1F7ZA 1NRPH 1CSOE 1G9IE 2BOKA 1TABE 3GY4A 6GCHF 3O8RA 1SLXB 1TE0A 4A6LA 2F9VA 1YPKH 2XWBI 1P10A 1Y3WA 2V35A 4VGCB 1Y5BT 1TRYA 1K1PA 2WV4A 2A32A 1Y8TA 3TLOA 4UE7H 3BTDE 1MD8A 1SLVB 3HPTB 4A1XA 1D4PB 3CENA 5EQQA 3TJOA 4K8YA 2BM2A 4NIWA 5C1YA 3F9HA 1OWJA 1FDPA 2FP7B 4AOQA 1GHWH 1VJ9U 4ZHLU 1ARBA 1V3XA 3STJA 1EAUA 2C90B 5ESBA 1NFUA 2STBE 2NU1E 1GHXH 5IDKA 2ZCLP 1QL7A 4K8BA 1YGCH 1B0EA 4ISHH 5PTPA 3TPIZ 2BLVA 2XBVA 3MH7A 4JZFH 5B6OA 1CA8B 2GX4A 3SUFA 4YTAA 1O39A 4JYVH 1PJPA 1FAXA 4FVDA 3V3MA 3M61U 2P16A 5C5OA 1LO6A 1XUKA 5ESTE 1GHAG 1HAZB 5HYOA 4WJG2 1D3DB 2VIVA 4VGCC 1MKWK 3RP2A 1A3EH 2GV6A 4IS5A 1YBWA 1AWHB 1ZYOA 1K21H 1FV9A 1O2VA 1PPEE 3TNTA 1CO7E 1RFNA 5FX5A 4Q2KA 1LKAA 3I78A 2FOBA 2H9TH 1ZPZA 2A31A 1HAGE 2ZCKP 1O5DH 4XE4A 4O3TA 1GMCG 4YOGA 3ZVGA 4THNH 4NIXA 2ZFTA 4U32A 1AZ8A 4HTCH 1XX9A 2VVVA 3BTHE 3ZVCA 3RXHA 1GMDG 1E36B 2A5IA 2ZFFH 1O5AB 3SU0A 2EA3A 2XBYA 3BTME 1K28D 3NK8A 1BBRK 3RXLA 1WTHD 4A7IB 5EG4A 4JK6A 4X2YA 1AFQB 1BJUA 1DICA 1ESAA 1SPJA 5EODA 3U9AH 1C2FA 2B7DH 1A0JA 1WTGH 1Z8JB 3MH4A 1NZQH 2ZI2H 1P02A 2GZ7A 2F9UA 2AH4X 2BDBA 4B74A 1PQ5A 1KYNA 3VEQB 2SGAA 4DW2U 1O33A 4DJZB 1HXFH 2M5TA 1O3CA 1FIZA 3LC3A 1A4WH 2CF9H 1GJ8B 4BXSA 1ZHPA 1J17T 4CRAA 3EDXB 3A7WA 1HAIH 1J9CH 1GMHF 3AASA 4I32A 3A82A 1MCTA 5FPYA 3RXFA 3V12A 1AUJA 2FWWA 4MNVA 4F4OC 1UK3A 1GI3A 2FX4A 2W7UA 1TGNA 4GLYA 1CHGA 1LDTT 1P09A 2FI3E 3LGVA 1Z8RA 2PFEA 2A5AA 1HNEE 3MHWU 4IC6A 2HWLB 1SGTA 1FY8E 4HZHA 2GZ9A 1BUIA 2XTTB 2ZGXH 1G3BA 2UWPA 3EGKH 1GJ7B 3HK6B 1ZOMA 2ZA5A 3MNCA 2OD3B 3SU5A 1DVAH 1AFQC 1AKSB 3SW2B 3VB3A 3PYHA 1LPGB 1MCVA 1W8BH 3ATLA 1SOTA 1NS3A 3LH1A 2BVXH 3TJNA 3RU4T 1ZPBA 1FY5A 1C1PA 1XKAC 3KIDU 2SGDE 4FUJA 3SNDA 2FM2A 5HM2A 1GDUA 1UVUH 2A45B 1E35B 2BD4A 1ZGIA 3SNBA 1KXAA 3TITA 1O3MA 1XVMA 1BB0B 3LU9B 4ISOA 4GPGA 1BBRE 5T6FA 2AYWA 2WYJA 2NU2E 4AYVB 1TIOA 1SOZA 1EP6A 3U8TH 3P92A 4Y0ZE 1GJ9B 3LGWA 1P9SA 2P94A 1IQEA 3M36A 1WOFA 4B2AA 1LVYA 1SC8U 4YOIA 4NIYA 3MOCA 1HUTH 3GCOA 3SN8A 2B8OH 3DUXH 4D7FA 2HVXA 1TYNA 4YZUA 1BMNH 3LGTA 4JZIA 1C5VA 1XUHA 5TCAA 2JH0D 2ZDAH 2EC9H 1TRMA 3A80A 3MU0A 3M7UA 2AGGX 4AG2A 2FS8A 1V2OT 4I8HA 4MNWA 3S69A 5JPMH 2PKSB 1PYTD 1MQ5A 4KTCA 1NRRH 4YESB 3ODFA 1IQIA 2W3KA 1T8MA 1OKXA 1BA8B 2P3TB 3MYWA 1DANH 1H1BA 2ZQ1A 4MVNA 3LT3A 3TJUA 1TQ0B 2XBXA 1ELFA 1HRTH 1C4U2 1MZAA 2ZPQA 1DPOA 3BIVH 3OU0A 4H42U 1QQUA 1Z8GA 5A0BA 4K69A 3OY5U 1GBFA 2R0LA 2PGQB 1KY9A 2PHBA 4GHQA 4RSPA 3SHCH 1DWCH 4WMDA 1NO9H 3A8AA 1TPAE 6GCHG 2V6NA 5DKMA 5C1XA 5DK1A 2ZFRH 2O8LA 4FU9A 3ZVBA 2BOHB 1AVXA 1TX6A 2ZPSA 1ZTLA 2DE8A 1C2KA 3KQBA 4Q7YA 5BRRE 3T29A 1O3FA 1XVOA 2Y80A 3LPRA 1DXPA 1XUIA 1ZSKA 1EPTB 1O2ZA 4X0WU 5A09A 3BTGE 1O2GH 3RC4A 3T2NA 4CHAB 3U69H 2G55A 4AG1A 1P01A 2YNAA 2ZTYA 1YPGH 4K1EA 1V2WT 4XBBA 2GCTB 2FEQH 1NRSH 1QCPA 1AHTH 1YPJH 2BY6X 3DFLA 3BTEE 1AU8A 1CQQA 4R0IA 1BHXB 2HNTC 3PMJA 4Y8YA 2ANYA 3D62A 3P8FA 1QRXA 4ISIH 1HCGA 1K1IA 3C27B 2PKAB 3A88A 8ESTE 1GI4A 3KQEA 5SGAE 3QN7A 2BMGB 1DLEA 3DFJA 2VGCB 1MBMA 3K6ZA 1GI1A 2G5NA 3GCTF 1CT2E 2R2WU 4Y10E 1BMMH 4JZEH 1T8NA 1B0FA 1GI9B 3OX7U 3FP7E 1EOJA 3ZZCA 2OC1A 2XCFA 3P8NA 1GJ4H 3AAUA 2XNIA 2AFQB 1MU8B 1F5KU 1GG6C 1A61H 1WBGB 3I77A 1GI0A 1DXWA 1V2QT 2G52A 4ZAEA 1O5CB 4CHAC 4FUIA 3QK1A 1MTVA 3NPSA 2VB0A 2GCTC 1O2JA 2G4UA 1Y3UA 4U2WA 4D9RA 1LMWB 2OCVB 2O8TA 5J4SA 3BN9A 1W14U 1DSTA 1TPSA 2O8WA 1CA0C 1L1GA 2GTBA 1WAYB 4BAMB 2GP9B 4H4FA 5E0JA 1O2XA 4X6OA 3LJOA 2BQWB 4DOQA 1NRQH 2BVRH 2FI4E 1E38B 1JWTA 1WQSA 1SB1H 3G01A 4Y71A 1FQ3A 2H5CA 1A7SA 2A4OA 1U6QA 2BD7A 3BTFE 1MBQA 3BEUA 3KL6A 4NWLA 1QRZA 5EU8A 1C5LH 1RTLA 2AGEX 4XDEA 3MU5A 1ZJDA 1MTSA 1BDAA 3ZZAA 1HAHH 3SU4A 1GCTC 1P2MA 3UY9A 1BRUP 3E91A 1GBDA 1MD7A 1C9TA 1YKTA 5HXFA 4SGAE 1AI8H 3E1XB 2ZZUH 1GMHG 1YP9A 9LPRA 1Z6EA 1OPHB 2PW8H 1P2IA 5FBIA 4NFFA 1S5SA 1FY4A 1O5GH 1EASA 4ABGA 3RXTA 1O2UA 2JH6D 3PLPA 5LGOA 1MZDA 3GISB 4CRCA 1G3CA 5DPAA 1BRBE 3EQ0H 4ABBA 5L6NH 4YLQH 1TB6H 1PQAA 5FXLA 3RC6A 1BOQA 2ZKSA 5L30H 5JB8S 4MDSA 4MQAA 1JBUH 2CV3A 2EEKA 3SGQE 3TGJE 2TGDA 1B5GH 1K22H 4A1TA 3M3SA 1O3LA 2BDYA 2C3SA 2FESH 3TH2H 1KTTB 3RXVA 1F5LA 3P95A 5F8TA 4E7RG 2AIQA 5A8ZA 3JZ1B 4KTUA 4NZQA 2BQ7B 1KXFA 1LVBA 5F8XA 2J2UA 5DO4H 1A0LA 3BEIB 4A92A 5DP6A 1GL0E 4I8JA 3RC5A 3M5LA 3RM0H 1QB6A 4K3JA 4CBOA 3KHVA 4INHA 1UK2A 1IQMA 3EA8A 2FOGA 2CMYA 4UEHH 3ZZBA 5GWZA 2J95A 5FCRA 2HOBA 2DE9A 2VIPA 4CRGA 2FI5E 4IN1A 4BAHB 5EQSA 4RKJB 3RMOH 6CHAB 1RTFB 1GJBB 1T7CA 1P05A 1TMUH 1VJAU 1GDQA 2UUKB 4WXVA 5EPNA 4CRDA 4TPIZ 5EXMA 1LHCH 1XKBC 2WPIS 2GCHF 2JH5D 3ITIA 3LGIA 1P9UA 3LGYA 4X2WA 1GVLA 2Z9KA 4TPYA 1EJNA 1O2NA 3MH6A 1P04A 1QQ4A 1UTNA 2KAIA 3TJVA 1GBCA 1W7XH 3RXRA 3A81A 3AAVA 1VZQH 5A0AE 1QBVH 1G37A 2EI8A 2ZEBA 1AWFH 2P8OC 1UHBA 1CHOF 2VJ1A 1GJCB 3M3TA 1HAPH 1SI5H 3O8DA 4Q7XA 1GJ5H 1LPKB 4XOJA 3LH3A 3SOSA 5A8YA 4Y0YE 5EGMA 1OS8A 2Y5HA 2BLOA 1K1NA 3UR6A 4NGAH 1Q3XA 2BZ6H 3OY6U 2BY5X 4JZ1A 4ZHAA 3LIWA 2IJOB 5DP3A 2Z9GA 1FONA 1NESE 1VITH 2CHAB 4I8LA 4UFDH 4Y8ZA 5HGGA 5C1UA 2BY9X 4R8TB 1SGIB 1IQFA 3K9XB 2QXGA 1O3IA 2BD9A 1BHXF 3HGNA 4X8SH 1RRKA 4KP0A 1EAWA 1RIWB 2ANWA 3S0NA 1DY8A 2ZFQH 1V2ST 2XBWA 6CHAC 1SQAA 1KXBA 1EX3A 1G2MA 4DIHH 4DIIH 2ZO3H 4OS5A 1ANEA 1QFKH 3SJIA 1VCWA 3VB6A 1EAXA 1ZSJA 1MAYA 3RU4E 4BTUB 2QXJA 4NZLA 1D3QB 1P2OA 4BOHA 2BTCE 1C2EA 1ZHMA 1KXDA 2AEIH 4KGAA 1OP8A 3EE0B 4GUXA 3PLBA 3RUOA 1E37B 1ELGA 4KKDA 3MU8A 1HAVA 2FLBH 3MO9A 1QL8A 1DSUA 4OS4A 3ATIA 1C5WB 1HGTH 4FUGA 1XM1A 1AB9C 4LOYH 4GCHF 1MTWA 1YCPH 5A8XA 1O5EH 2HGTH 3MNBA 3GCTG 1W0ZU 1C5ZB 1FN8A 1UCYH 1W0YH 1ZZZA 4DT7B 1G36A 4O97A 3E3TA 1C5RA 5I25A 3MWIU 1ESBA 1RIWC 3B8JA 4E05H 1F0UA 1W3CA 4NFEA 1HAYB 4DVAU 1ORFA 1KLIH 2PUXB 4JK5A 4OGXA 3A7XA 4OS7A 3SGBE 5GJ4B 2QXHA 1UTLM 1DUEA 3PROA 1KTSB 5C3NA 4X2VA 1RGQA 2ZFPH 2ILNA 2SFAA 1ZHRA 2PSYA 1OYQA 2G4TA 2BY7X 1GGDB 1UK4A 2ZWLH 1TWXB 4IN2A 2PUQH 1HAXB 3HKIB 7KMEH 2ZFSA 4TY6A 3PTNA 1ELAA 1SGNE 1O2QA 3HATH 1PPFE 1C4V2 3EYDA 1O3OA 3JZ2B 1BITA 1ELDE 2BX4A 2ALPA 3U98H 1A3BH 1K9OE 1LVOA 3M5OA 5JBCS 1ETTH 1RJXB 3A87A 3URCA 3SI4H 3DA9B 1F5RA 4MPWA 4K1SA 1BMAA 1IQNA 1T4UH 4HGCA 3M3VA 1SLWB 2AMQA 1C4Y2 1J8AA 3R3GB 1G2LA 1KSNA 1F0SA 3U1JB 3QZRA 4NIVA 2O8UA 3B23B 3F9FA 1C1VH 1SG8B 5K0HA 3FP6E 1TMTH 1Q2WA 3ZZ3A 1ZMLA 3MU4A 3MTYA 1DX5M 1FI8A 1G3DA 4WH8A 4Y7AA 2ZHWH 2CN0H 3P8OA 1GBJA 2VINA 2QF0A 1DWDH 3LONA 2A4QA 1EZUC 3A86A 1GCDA 2TBSA 2Z3DA 2OC0A 4FUFA 4GVUA 1P3CA 2AMDA 2H2ZA 1BRAA 3P70B 3ZYEA 1O31A 1BRCE 4AX9H 2FOCA 1EB1H 1GGDC 1LCYA 1UCYK 2P93A 2ZHDA 3T62A 4M7GA 1OWIA 1YLCA 1N6XA 5E2PA 2C4FH 1TOCB 4DG4A 4XBDA 1TGCA 1GBBA 1GPZA 3A7ZA 1LHGH 1SLUB 2TRMA 1OP0A 4KTSA 3KN2A 2ZHQH 1ZTKA 1ZRKA 2J9NA 5F03A 2C8ZB 3W95A 2W7SA 3SV2H 2K1QA 1CGJE 2ZCHP 1C2GA 8LPRA 1HYLA 1Z71A 3RXCA 1LVMA 3ZZ6A 4WXIA 1YPHE 4CR9A 1D3TB 3T27A 2BYAX 2TGPZ 2YNBA 2FLRH 2BVSH 4K60A 1WUNH 2ZGCA 2R0KA 2ZP0H 1MKXH 3SV7A 5BPEA 4JZDH 1O3KA 1RTKA 1P2KA 3FZZA 2NWNA 1IAUA 5CHAB 5JBTA 3EA9A 1C2MA 1H4WA 4JYUH 3W94A 1V2TT 4NSYA 1UVPA 2F9PA 3LKWA 3MU1A 1ETSH 4DCDA 2H9HA 1QHRB 2HRVA 1EOLA 3IWMA 2VWNA 1UTQA 3GCHB 5GPIB 2JKHA 1UVSH 1QNJA 2GCHG 3ZVAA 1WV7H 1J16A 2A0QB 2P3FH 3RMLH 3H5CB 1NM6A 3K2UA 1SGQE 2W5EA 5TCCA 1ACBE 1NFWA 1TAWA 1O3GA 1C5NH 1A5HA 1SSXA 1CHOG 4MPXA 2ZGBH 1O38A 1FY3A 1OP2A 1C5TA 2QC2A 3MO6A 2VVCA 2G8TA 2GVFA 3UQVA 1P11E 4I33A 1L1JA 2Z9IA 1W11U 1XMNB 2XC0A 1NY22 4ISNA 3QLPH 3E8LA 1F92A 1Y3YA 2PTNA 3PMHB 1KDQB 1EZXC 1K1JA 3I29A 2ANKH 1TA6A 3A83A 2QA9E 1SL3A 1MTUA 4INKA 1P2JA 2C8YB 4Z0KA 2OBQA 1O30A 1F2SE 1THSH 1O36A 3UNRA 1JRTA 2VWOA 2Z3EA 2QGRA 1DM4B 1C1OA 1RS0A 3KF2A 1MUEB 2ODYB 1TBZH 3BIUH 4Y79A 3RLYH 2VNTA 2NU4E 1BTYA 2F91A 4K1TA 2GGVB 3S9CA 1KIGH 4XFQA 3RM2H 4NCYA 4A1VA 4ZKRU 2SNWA 3ATKA 2PKSC 1PPBH 4XBCA 1TGTA 1JXPA 4K5ZA 1QL9A 2FMJA 5HMAA 1MMJN 1AGJA 5DP4A 1DUAA 3ZZ9A 3QDZB 2LPRA 4DY7B 4B71A 2FO9A 4ASHA 2AMPA 2VIWA 3HKJB 1DT2A 4AB8A 1D6WA 1AFEH 1ZSLA 2QXIA 2XXLA 2THFB 3H7OA 1FN6A 4GCHG 2WPLS 1QJ1B 2FX6A 3ELAH 2WPJS 2I6QA 4OS1A 3A84A 3SORA 2CXVA 1AO5A 3TIUA 4X1RU 1GI2A 1NFYA 2BLWA 1LKBA 3GDVA 1UTKA 2IN2A 3A8BA 2Q6GA 1ANBA 1QIXB 2SGEE 1TNGA 2SNVA 5AF9H 1GHYH 1TRNA 4LXBH 1ANCA 1P03A 3BTKE 1IHSH 2WINI 1HDTH 1C5UA 1TOMH 1O34A 3NXPA 3CP7A 1NU9A 4X1QU 1AN1E 1ELBA 2XRCA 1AE5A 3T25A 5GIBA 1EPTC 2OQUA 1YC0A 2GZ8A 5E0HA 6ESTA 1P8VC 4FU8A 4B76A 7LPRA 1BQYA 3FAOA 1NTPA 1XXDA 1ZLRA 3T26A 4AORA 1GBHA 4X8VH 1GJDB 3VB5A 1Z6JH 1SQOA 2J94A 1BIOA 1ZTJA 4AFSA 1L2EA 4ZXYH 2Y5FA 2R3UA 5E2OA 2OINA 1Z7KA 1UVTH 4PROA 3L6PA 2ZU2A 5ETXA 3F9EA 1DY9A 3GYLB 1V2JT 4BTTB 2A2QH 1S6FA 1C5SA 1G3EA 4I31A 5CE1A 2A5KA 2PLXA 3ZZ4A 2GMTB 1T8LA 2V0BA 2J4IA 5FBEA 4UONA 5EW2H 2CF8H 1QRWA 2PTCE 1OWDA 3SNAA 1Y3VA 4E06H 1A2CH 4GSOA 3SUGA 1ABIH 2LNCA 2VGCC 2RCEA 1H9LB 2VWLA 2TIOA 3T5FH 3O8BA 1HIAA 3TK9A 2UUJB 3BEFB 1XUFA 5DP7A 2A1DB 2OC8A 4OS2A 5A0CA 5E0GA 4X8TH 1AY6H 1WU1A 3E0PB 3IG6B 1PPHE 1L0ZA 1V2NT 2AIPA 3QTVH 3SZNA 1S0RA 1QBNA 4A5TS 1HJAB 1P12E 1C1SA 4UFGH 2RDLA 4H6SB 2JETB 3UOUA 4MG3A 5G4BA 4NA8A 1O2WA 4YOJA 3SUDA 1P06A 1V2LT 1MH0A 2GMTC 1O5BB 3NCLA 3A85A 3VXFH 1W2KH 3SV8A 4Y8XA 5FPTA 3K6YA 1TNHA 5JBBS 3SU1A 1C2DA 3WY8A 1GBMA 3KQCA 3GY8A 4B73A 2C8WB 1IQLA 1INCA 3V13A 4F49A 1O2SA 1SGDE 1TX8A 2BLQA 5EW1H 4ABJA 1EKBB 3SGAE 3BTTE 3ZVFA 3GY6A 2WPHS 2EI7A 2UUFB 1OYTH 1TALA 1TONA 3S9BA 1VR1H 3SV6A 3BV9B 1VITF 1Z1JA 1GDNA 3F68H 2OTVA 2ODPA 3IITA 4WMEA 3UWIA 4AB9A 2W3IA 1AMHA 1SBWA 1HJAC 1C1WH 1PPGE 3SI3H 4AN7A 1IQKA 2BX3A 1LHEH 3UREA 1HPGA 1QURH 2JETC 4HFPB 3Q3XA 4KELA 4X1SU 3UIRA 2WV5A 3FZDA 1WQVH 3M7QA 4WMFA 1SGRE 3URDA 3QWCH 2FYQA 5LPEA 1EUFA 2IOTA 3BF6H 1ZMNA 3F1SB 1UTJA 2TGAA 2BD2A 7GCHF 1JOUB 2I6SA 3SJ8A 2ZG0H 1BTUA 1TFXA 2HLCA 5TJXA 3TK6A 5GCHF 5AVDA 2QV1A 1VCPA 4WVPE 1C2IA 3QUMP 1GJAB 1K2I1 4AGKA 2A4GA 4X1NU 1FY1A 3LOXA 3UNSA 2FOHA 3TGKE 2FPZA 1JMOH 2QF3A 2TPIZ 3BTWE 1W10U 4MPVA 4J1YA 1O3AA 1Z8IB 2ESTE 1GBAA 1DITH 1P2NA 1QJ7B 2BD3A 1O3BA 5T6DA 3L33A 4Y11E 1ZR0A 3AW1A 4TWWA 1C1TA 4SGBE 1O2PA 3QGNB 1FXYA 1UTPA 1MKWH 2ZDKA 1FIWA 5GXPA 4NG9H 3RXEA 3BG4B 3SJKA 1L4ZA 2HALA 3SUEA 1CGIE 1SGYE 1H8DH 2J92A 4B1TA 7ESTE 1NFXA 2BQ6B 1O3NA 3KGPA 1AIXH 3MH5A 1F0TA 3RMMH 2Z9JA 1KLJH 3UOPA 4D8NA 1C1MA 3ESTA 3GY3A 3LGUA 2PGBB 1IQHA 4MTBA 1BTHH 1A5GH 1OWKA 3DT0H 3TH3H 1FNIA 4X8UH 4DGJA 3LC5A 2FDAA 1ZRBA 4JCNA 2ZTZA 3UPEA 3SJ9A 2D8WA 5AFYH 3PMAB 3AVZA 1S85A 1TGBA 1LHFH 1OWHA 1SGFA 4ZXXH 3Q00A 4TWYA 5L2ZH 3E0NB 5JB9S 3FFGA 2H5DA 1BBRH 2BD5A 2D1JA 3ZZ8A 2D26C 1UJ1A 5FAHA 1Z1IA 4X6NA 5L2YH 2KAIB 2AGIX 1GI7B 5DP9A 5FCKA 1ID5H 3VB7A 1SGFG 5C20A 3SU6A 1AVWA 1GJ6A 3UTUH 1YM0A 1YPLH 3TGIE 2OLGA 2ZU1A 4DURA 4FUEA 2CHAC 3KEEA 3HGPA 2P59A 2RA0A 1UHBB 2J38A 2XC5A 3BG4C 1QY6A 5DP5A 4BNRA 4E7NA 1L1NA 4FU7A 1N1LA 1NC6A 3RXMA 2R3YA 3RXPA 1TPPA 4FUCA 2O8MA 4FUHA 1SHHB 8GCHF 1LQEA 4CRBA 1H8IH 1EATA 2HPPH 1WSSH 1CVWH 1N8OB 3ZVDA 1GHZA 2GD4B 1WYKA 3A8DA 4X6MA 3ENSB 2QYIA 2TGTA 2ZIQH 4NA7A 1THPB 1TBRH 4TYDA 1O3DA 4O3UA 1ETRH 4RN6A 3CS7A 1ZPCA 5AHGH 2BDAA 3ATWA 1T8OA 3EA7A 3UWJH 1FMGA 5C5NA 3ZV8A 1O2RA 1SMFE 1ELEE 2FZZA 4CH2B 1TA2A 3A7YA 3PWCA 1JIMA 2BY8X 2Z7FE 5H4IB 1O32A 2ZDNA 3GDSA 1O2MA 2NU0E 2FODA 4GAWA 2UWOA 2H9EH 1N6YA 2ZECA 5F8ZA 5FPSA 2V3HH 2Y7XA 3SO3A 1Y59T 1GHBF 8KME2 1HAVB 1GI8B 2GDDA 1HV7A 1AKSA 2B0FA 2BHGA 3OSYA 5T3HA 5JBAS 3DHKH 3HK3B 3UQOA 2GT8A 2WPMS 1TNJA 1S6HA 1NROH 2VIQA 4CREA 4B2CA 4BAKB 4IGDA 2XWAA 1Y5UT 1N8OC 3RXUA 4I7YH 5FHTA 3ZVEA 1NU7B 4BXWA 1F0RA 2QN5T 1W7GH 2ALVA 1HJ8A 2BD8A 3F6UH 1TNIA 3Q77A 5T6GA 1W13U 4ABEA 5ABWA 1YCPK 2FS9A 1TLDA 5HM9A 1H9IE 3KNXA 2VIOA 4JYTA 5AFZH 4UFFH 2QY0B 1L4DA 1AQ7A 2F9OA 2GDEH 4ZROA 1LTOA 5EXNA 3E90B 1SVPA 2ZHFH 1J14A 1SGEE 2NU3E 9ESTA 1O2LA 2PSXA 3S7KB 2A2XH 3QGJA 1IHTH 3DD2H 4H6TA 3OTJE 2OXSA 4FUDA 3V0XA 4ESTE 4MNXA 3UUZA 2FIRH 3QZQA 1E34B 3RXIA 1KLTA 1GBEA 1CBWB 2GV7A 2BXUH 4MLFB 1SR5C 2ZF0H 4IMZA 1VGCB 4BAOB 4ZUHA 3RXKA 4AFZA 4NWKA 3FANA 2XYAA 3C1KA 2HNTE 1MQ6A 1SHYA 3BG8A 3RXJA 4AGJA 1ZMJA 1VITG 3GY5A 4ABDA 2FOMB 3QX5H 1DS2E 2VH0A 3NWUA 1DE7H 1FAKH 3SJOA 3TU7H 3D65E 3GY7A 4BTIB 1BT7A 4YLUA 2H1UA 3LJJA 4JMYA 1IQGA 1KDQA 2FOAA 3OYPA 4NSVA 1AUTC 1G32B 2A7CA 2WUBA 2P3UB 1EAIA 3EAJA 1C2HA 3R0FA 1VCQA 2AS9A 3RXBA 2XCNA 1ELVA 1TBQH 2F83A 4U01A 3QTOH 1FUJA 1PQ8A 1QA7A 3E16B 7GCHG 2BDIA 2UUYA 2WPKS 4ZMAH 5GCHG 1WCZA 3PMBB 1EPTA 1O5FH 6LPRA 3ZZ7A 2C93B 1PPZA 3M7TA 1UVOA 4ZH8A 1HFDA 1HLTH 2ZPRA 3RLWH 1O2YA 1UCYE 1K1LA 1T4VH 1VGCC 4LZ1H 5JDUB 2RA3A 1CE5A 1GBKA 1O37A 3A7VA 1Y3XA 2VIDA 5FX6A 1PPCE 2R2MB 1SQTA 1SFIA 3ZZ5A 3VGCB 1IQJA 3LDXH 1S0QA 1EJAA 1YPMH 1QB1A 1LHDH 2G81E 3L3TA 2J34A 3T28A 4AFUA 2IPHA 1A5IA 5LPRA 2PKAA 4MNYA 3U8OH 1CT4E 3B9FH 2O9QA 2V3OH 1TNLA 3PV4A 5CHAC 4ZKOU 1EJMA 3GY2A 1HBTH 3RDZA 3ZV9A 5J4QA 1D3PB 1BTPA 2VWMA 4I8GA 3GOVB 4X2XA 5F6MA 4AFQA 2BDHA 3A8CA 2ODQA 5DJ7A 2P95A 2FTMA 3GCHC 1O2IA 5E8EH
chains in the Genus database with same CATH superfamily
4CRFA 4CBNA 4IMQA 3UNQA 1QBOA 2ZNKH 1WXRA 4CR5A 1SFQB 3U8RH 1MKXK 4BANB 1YPEH 3E6PH 3O8CA 3A7TA 4UFEH 1YCPM 2Y81A 4YM9A 1ABJH 3GCNA 3TVJB 1FZZA 2ANMH 1E0FD 2XC4A 1LPZB 2ZGHA 3PWBA 5CMXH 1P0SH 2Z3CA 4IBLH 3Q76A 5C2ZA 4ABHA 4ABFA 1GG6B 4MPUA 2BZAA 4FOUC 4OGYA 1FLEE 1S83A 1A46H 3VGCC 2FOFA 1ELTA 3Q3KA 2VH6A 2SGPE 3RMNH 4YO9A 2UWLA 2BXTH 1IOEA 1C1UH 4WWYA 3SU2A 3SU3A 2LELA 3BTQE 3PO1B 3P6ZB 2SGFE 1C5XB 2FYRA 1GVZA 3M5MA 1RXPA 4D76A 1C5MD 1C2LA 3ATMA 1O3PB 2Z9LA 2DUCA 2WPDD 1NPMA 1SGPE 1EQ9A 1UW7A 1O35A 3UR9A 8GCHG 1FJSA 1GBLA 3RXOA 5EXLA 2CGAA 3SQEE 1CA0B 1THRH 4INLA 4O9VA 4Q80A 2V7QD 1YPHC 4WH6A 1TMBH 2QIQA 1CBWC 3K65B 2CK3D 2ZU3A 3MNXA 4K2YA 1SGCA 5DP8A 1O2TA 2G00A 2WUCA 1O3HA 1O2OA 1QR3E 3QO6A 4IW4E 2HPQH 1V2VT 2OUAA 1GHVH 1JRSA 3PTBA 2ZTXA 1AVGH 3SHAH 2YOLA 3DSOA 3UFAA 4CH8B 1O0DH 2CJIA 3PB1E 1CU1A 2QE7D 2FOEA 4Y76A 1C5OH 1S81A 1MABB 1GHAF 1Q31A 3NKKA 1V2RT 1EZQA 2JDID 1GCTB 4J2YB 4QT8C 5C67A 2A7HA 3ZYDA 1TNKA 3P8GA 3WWFA 3PLKA 3PM3A 3VFEA 3EE7A 4NA9H 1V2PT 1UTOA 2D2DA 2ZDMA 1C5YB 1V2KT 1EZSC 5LH8A 4ISLA 2VU8E 2Q1JA 4FVBA 3PO1C 1GHBG 1ZJKA 3M5NA 2YMSB 1P57B 4UDWH 2QCYA 5K7RA 1GMCF 4B2BA 4Z6AH 5HIYA 3FVFB 1A1RA 1EB2A 3MNSA 1PQ7A 3OEED 1XUGA 2ZDLA 1DFPA 1NRNH 1HB0B 1NT1A 3Q3YA 1O2HA 2G5VA 1JIRA 4GHTA 4LK4A 4RKOB 1ARCA 2PR3A 3ZIAD 1C9PA 5GDSH 4ZCNA 1GMDF 4F55A 4BAQB 3VPKA 3TNSA 4X6PA 3TK5A 4P02A 4FUBA 1AE8H 1S82A 1QA0A 1YF4A 3MO3A 1C5PA 5A2MH 4OS6A 2IJD1 4I8KA 4D7GA 5DGJA 1MAXA 3M37A 4Y7BA 3FN8A 3SNEA 4D9QA 3RU4D 2Y7ZA 1KXEA 4YT6H 5JYIA 1K1MA 2B5TB 3TH4H 1O3EA 1QJ6B 1GI6A 1LQDB 2ZU5A 1GBTA 1AZZA 1QB9A 2QAAA 2R9PA 5EQRA 1RD3B 1GBIA 1C1NA 1OX1A 1OSSA 1C1QA 1AD8H 2PV9B 1M9UA 1DOJA 1V6DA 1X7AC 1BCUH 3FKSD 3CNRA 1MTNB 1BTXA 2GKVE 5KEDA 2ZGJA 2H6MA 4AYYB 4B6EA 1BMLA 4Q7ZA 2EI6A 4TY7A 3FP8E 2OQ5A 2XW9A 2YMSC 2PWXA 3NUMA 5IYTA 4ZKNU 1Y5AT 2Q6DA 5KGOA 2VVUA 1ANDA 1J15A 2ZU4A 4XD7D 1BZXE 1EXFA 2OBOA 2C8XB 3KQ5A 3ODDA 2ZQ2A 3SNCA 1YYY1 1EP5A 3MMGA 2ZDVH 2RG3A 4X1PU 3RXQA 2Y5GA 1V2UT 2Z94A 1GWAA 3KCGH 3VXEH 3KQDA 2ULLA 2W26A 2FXRA 3AW0A 2STAE 3GICB 3M35A 1YLDA 4U30A 1DLKB 1BTWA 2WYGA 3ZZDA 1G30B 1OOKB 4Y6DA 3RXDA 1TGSZ 1HIAB 3BSQA 4ACAA 3VB4A 1KXCA 1HXEH 1BTZA 2OC7A 2P8OB 2Q6FA 1OXGA 3RXSA 2F9NA 1UTMA 3D49H 5EPYA 5DG6A 5LPFA 4TT3D 2XOKD 4B75A 1DWBH 2ASUB 1GL1A 4IC5A 3RXGA 1UO6A 2ZHEH 1MU6B 4LZ4B 2GT7A 2OP9A 5EOKA 1ESTA 1A0HB 3GYMA 3S7HB 1XXFA 2Z6BD 1MTNC 2AERH 4UD9H 1W0JD 1OWEA 2BB4A 3A89A 4YT7H 1D9IA 3NRLA 1C5QA 3MI4A 1CGHA 1C2JA 1UMAH 3MFJA 1QGFA 4WY3A 1DDJA 4HI3A 2HNTF 2Y6TA 4WF8A 3SV9A 3V7TA 1T31A 2F9BH 3SBKA 1GVKB 3NZIA 1ZGVA 3GDUA 3STIA 2ZC9H 4AZ2B 2BDGA 1TX7A 3N7OA 1GI5A 2F3CE 2A7JA 4FXGH 1TQ7B 1ELCA 1TPOA 1FPHH 1QTFA 1W12U 3D23A 1KMHB 1NN6A 2B9LA 1D6RA 2BDCA 1H9HE 1BJVA 1T32A 3F9GA 1DWEH 4ABAA 3S9AA 1K1OA 3P17H 2Y82A 4ABIA 3SQHE 4ZKSU 3U1IB 4XSKU 1CT0E 1HJ9A 4ZHMU 1P2QA 1PFXC 1XUJA 5I46H 1S84A 3H7TA 2G51A 4O03A 1V2MT 1O3JA 1PYTC 1AB9B 1FPCH 2FTLE 3CS0A 4RT1A 2A4RA 1P3EA 3RXAA 2SGQE 1C1RA 1B7XB 1HAOH 1O2KA 1F7ZA 1NRPH 1CSOE 1G9IE 2BOKA 1TABE 3GY4A 6GCHF 3O8RA 1SLXB 1TE0A 2KX4A 4A6LA 2F9VA 1YPKH 2XWBI 1P10A 1Y3WA 2V35A 4VGCB 5B6LA 1Y5BT 1TRYA 1K1PA 2WV4A 2A32A 1Y8TA 3TLOA 4UE7H 3BTDE 1MD8A 1SLVB 3HPTB 4A1XA 1D4PB 3CENA 5EQQA 3TJOA 4K8YA 2BM2A 4NIWA 5C1YA 3F9HA 1OWJA 1FDPA 2FP7B 4AOQA 1GHWH 1VJ9U 4ZHLU 1ARBA 1V3XA 3STJA 1EAUA 2C90B 5ESBA 1NFUA 5CDFE 2STBE 2NU1E 1GHXH 5IDKA 2ZCLP 1QL7A 4K8BA 1YGCH 1B0EA 4ISHH 5PTPA 3TPIZ 2BLVA 2XBVA 3MH7A 4JZFH 5B6OA 1CA8B 2GX4A 3SUFA 4YTAA 1O39A 4JYVH 1PJPA 1FAXA 4FVDA 3V3MA 3M61U 2P16A 5C5OA 1LO6A 1XUKA 5ESTE 1GHAG 1HAZB 5HYOA 4WJG2 1D3DB 2VIVA 4VGCC 1MKWK 3RP2A 1A3EH 2GV6A 4IS5A 1YBWA 1AWHB 4RI0A 2KFWA 1ZYOA 1K21H 1FV9A 1O2VA 1PPEE 3TNTA 1CO7E 1RFNA 5FX5A 4Q2KA 5EJ1A 1LKAA 3I78A 2FOBA 2H9TH 1ZPZA 2A31A 1HAGE 2ZCKP 1O5DH 4XE4A 4O3TA 1GMCG 4YOGA 3ZVGA 4THNH 4NIXA 2ZFTA 4U32A 2AHME 1AZ8A 4HTCH 1XX9A 2VVVA 3BTHE 3ZVCA 3RXHA 1GMDG 1E36B 2A5IA 2ZFFH 1O5AB 3SU0A 2EA3A 2XBYA 3BTME 1K28D 3NK8A 1BBRK 3RXLA 1WTHD 4A7IB 5EG4A 4JK6A 4X2YA 1AFQB 1BJUA 1DICA 1ESAA 1SPJA 5EODA 3U9AH 3OAAD 1C2FA 2B7DH 1A0JA 1WTGH 1Z8JB 3MH4A 1NZQH 2ZI2H 1P02A 2GZ7A 2F9UA 2AH4X 2BDBA 4B74A 1PQ5A 1KYNA 3VEQB 2SGAA 4DW2U 2WZQA 1O33A 4DJZB 3AK5A 1HXFH 2M5TA 1O3CA 1FIZA 3LC3A 1A4WH 2CF9H 1GJ8B 4BXSA 3PV5A 1ZHPA 1J17T 4CRAA 3EDXB 2VBCA 3A7WA 1HAIH 1J9CH 1GMHF 3AASA 4I32A 3A82A 1MCTA 5FPYA 3RXFA 3V12A 1AUJA 2FWWA 4MNVA 4F4OC 1UK3A 1GI3A 2FX4A 2W7UA 1TGNA 4GLYA 1CHGA 1LDTT 1P09A 2FI3E 3LGVA 1Z8RA 2PFEA 2A5AA 1HNEE 3MHWU 4IC6A 2HWLB 1SGTA 1FY8E 4HZHA 2GZ9A 1BUIA 2XTTB 5C0TA 2ZGXH 1G3BA 2UWPA 3EGKH 1GJ7B 3HK6B 1K0HA 1ZOMA 2ZA5A 3MNCA 2OD3B 3SU5A 1DVAH 1AFQC 1AKSB 3SW2B 3VB3A 3PYHA 1LPGB 1MCVA 1W8BH 3ATLA 1SOTA 1NS3A 3LH1A 2BVXH 3TJNA 3RU4T 1ZPBA 1FY5A 1C1PA 1XKAC 3KIDU 2SGDE 4FUJA 3SNDA 5C0UA 3FOAA 2FM2A 5HM2A 1GDUA 1UVUH 2A45B 1E35B 2BD4A 1ZGIA 3SNBA 1KXAA 3TITA 1O3MA 1XVMA 1BB0B 3LU9B 4ISOA 4GPGA 1BBRE 5T6FA 2AYWA 2WYJA 2NU2E 4AYVB 1TIOA 1SOZA 1EP6A 3U8TH 3P92A 4Y0ZE 1GJ9B 3LGWA 1P9SA 2P94A 1IQEA 3M36A 1WOFA 1OHHD 4B2AA 1LVYA 1SC8U 4YOIA 4NIYA 3MOCA 1HUTH 5KECA 3GCOA 3SN8A 2B8OH 3DUXH 4D7FA 2HVXA 1TYNA 4YZUA 1BMNH 3LGTA 4JZIA 1C5VA 1XUHA 5TCAA 2JH0D 2ZDAH 2EC9H 1TRMA 3A80A 3MU0A 3M7UA 2AGGX 4AG2A 2FS8A 1V2OT 4I8HA 4MNWA 3S69A 5JPMH 2PKSB 1PYTD 1MQ5A 4KTCA 1NRRH 4YESB 3ODFA 1IQIA 2W3KA 1T8MA 1OKXA 1BA8B 2P3TB 3MYWA 1DANH 1H1BA 2ZQ1A 4YXWD 4MVNA 3LT3A 3TJUA 1TQ0B 2XBXA 1ELFA 1HRTH 1C4U2 1MZAA 2ZPQA 1DPOA 3BIVH 3OU0A 4H42U 1QQUA 1Z8GA 5A0BA 4K69A 3OY5U 1GBFA 2R0LA 2PGQB 4F48B 1KY9A 2PHBA 4GHQA 4RSPA 3SHCH 1DWCH 4WMDA 1NO9H 3A8AA 1TPAE 6GCHG 2V6NA 5DKMA 5C1XA 5DK1A 2ZFRH 2O8LA 4FU9A 3ZVBA 2BOHB 1AVXA 1TX6A 2ZPSA 1ZTLA 2DE8A 1C2KA 3KQBA 4Q7YA 5BRRE 3T29A 1O3FA 1XVOA 2Y80A 3LPRA 1DXPA 1XUIA 1ZSKA 1EPTB 1O2ZA 4X0WU 5A09A 3BTGE 1O2GH 3FO8D 3RC4A 3T2NA 4CHAB 3U69H 2G55A 4AG1A 1P01A 2YNAA 2ZTYA 1YPGH 4K1EA 2XNDD 1V2WT 4XBBA 2GCTB 2FEQH 1NRSH 1QCPA 1AHTH 1YPJH 2BY6X 3DFLA 3BTEE 1AU8A 1CQQA 4R0IA 1BHXB 2HNTC 3PMJA 4Y8YA 2ANYA 3D62A 3P8FA 1QRXA 4ISIH 1HCGA 1K1IA 3C27B 2PKAB 3A88A 8ESTE 1GI4A 3KQEA 5SGAE 3QN7A 2J97A 2BMGB 1DLEA 3DFJA 2VGCB 1MBMA 3K6ZA 1GI1A 2G5NA 3GCTF 1CT2E 2R2WU 4Y10E 1BMMH 4JZEH 1T8NA 1B0FA 1GI9B 3OX7U 3FP7E 1EOJA 3ZZCA 2OC1A 2XCFA 3P8NA 1GJ4H 3AAUA 2XNIA 2AFQB 1MU8B 1F5KU 1GG6C 3F2HA 1A61H 1WBGB 3I77A 1GI0A 1DXWA 1V2QT 2G52A 4ZAEA 1O5CB 4CHAC 4FUIA 2HVYB 2QF5A 3QK1A 5GNDA 5EJLA 1MTVA 3NPSA 1WDIA 2VB0A 2GCTC 1O2JA 2G4UA 1Y3UA 4U2WA 4D9RA 1LMWB 2OCVB 2O8TA 5J4SA 3BN9A 1W14U 1DSTA 1TPSA 2O8WA 1CA0C 1L1GA 2GTBA 1WAYB 4BAMB 2GP9B 4H4FA 5E0JA 1O2XA 4X6OA 3LJOA 2BQWB 4DOQA 1NRQH 1QZ8A 2BVRH 2FI4E 1E38B 1JWTA 1WQSA 1SB1H 3G01A 4Y71A 1FQ3A 2H5CA 1A7SA 2A4OA 3KYGA 1U6QA 2BD7A 3F0OA 3BTFE 1MBQA 3BEUA 3KL6A 4NWLA 1QRZA 3N99A 5DSFA 5FL7D 5EU8A 1C5LH 1RTLA 2AGEX 4XDEA 3MU5A 2LP6A 1ZJDA 1MTSA 1BDAA 3ZZAA 1HAHH 3SU4A 1GCTC 1P2MA 3UY9A 1BRUP 3E91A 1GBDA 1FX0B 1MD7A 1C9TA 1YKTA 5HXFA 4SGAE 1AI8H 3E1XB 2ZZUH 1GMHG 1YP9A 9LPRA 5C94A 1Z6EA 1OPHB 2PW8H 1P2IA 5FBIA 4NFFA 1S5SA 1FY4A 1O5GH 1EASA 4ABGA 3RXTA 1O2UA 2JH6D 3PLPA 5LGOA 1MZDA 3GISB 2W6JD 4CRCA 1G3CA 5DPAA 1BRBE 3EQ0H 4ABBA 5L6NH 4YLQH 1TB6H 1PQAA 5FXLA 3RC6A 1BOQA 2ZKSA 5L30H 5JB8S 4MDSA 4MQAA 1JBUH 2CV3A 2EEKA 2HLDD 3SGQE 3TGJE 2TGDA 1B5GH 1K22H 4A1TA 3M3SA 1O3LA 2BDYA 2C3SA 2FESH 2RDEA 3TH2H 1KTTB 3RXVA 1F5LA 3P95A 5F8TA 4E7RG 2AIQA 5A8ZA 3JZ1B 4KTUA 4NZQA 2BQ7B 1KXFA 1LVBA 5F8XA 2J2UA 5DO4H 1A0LA 3BEIB 4A92A 5DP6A 1GL0E 4I8JA 3RC5A 3M5LA 3RM0H 1QB6A 3WW7A 4K3JA 4CBOA 3KHVA 4ACBA 4INHA 1UK2A 1IQMA 3EA8A 2FOGA 2CMYA 4UEHH 3ZZBA 5GWZA 2J95A 5FCRA 2HOBA 2DE9A 2VIPA 4CRGA 2FI5E 4IN1A 4BAHB 3OEHD 4RKJB 5EQSA 3RMOH 6CHAB 1RTFB 1GJBB 1T7CA 1P05A 1TMUH 1VJAU 1GDQA 2UUKB 4WXVA 5EPNA 4CRDA 4TPIZ 5EXMA 1LHCH 1XKBC 2WPIS 2GCHF 2JH5D 3ITIA 3LGIA 1P9UA 3LGYA 4X2WA 1GVLA 1BMFD 2Z9KA 3WWBA 4TPYA 1EJNA 1O2NA 3MH6A 2EY4C 1P04A 1QQ4A 1UTNA 2KAIA 3TJVA 1GBCA 1W7XH 3RXRA 3A81A 3AAVA 1VZQH 5A0AE 1QBVH 1G37A 2EI8A 2ZEBA 1AWFH 2P8OC 2RFKC 1UHBA 1CHOF 2VJ1A 1GJCB 3M3TA 1HAPH 1SI5H 3O8DA 1E1RD 4P00A 4Q7XA 1GJ5H 1LPKB 4XOJA 3LH3A 3SOSA 5A8YA 4Y0YE 5EGMA 1OS8A 2Y5HA 2BLOA 1K1NA 3UR6A 4NGAH 1Q3XA 2BZ6H 3OY6U 2BY5X 4JZ1A 4ZHAA 3LIWA 2IJOB 3H09A 4B6FA 5DP3A 2Z9GA 1FONA 1W0KD 1NESE 1VITH 2CHAB 4I8LA 4UFDH 4Y8ZA 5HGGA 5C1UA 2BY9X 4R8TB 1YY3A 1SGIB 1IQFA 3K9XB 2QXGA 1O3IA 2BD9A 1BHXF 3HGNA 4X8SH 1RRKA 4KP0A 1EAWA 1RIWB 2ANWA 2KCYA 3S0NA 1DY8A 2ZFQH 1V2ST 2XBWA 6CHAC 1SQAA 1KXBA 1EX3A 1G2MA 4DIHH 4DIIH 2ZO3H 4OS5A 1ANEA 1QFKH 2J98A 4FETA 3SJIA 1VCWA 3VB6A 1EAXA 1ZSJA 1MAYA 3F3BA 3RU4E 2QXJA 4BTUB 4NZLA 1D3QB 1P2OA 4BOHA 2BTCE 1C2EA 3GS9A 1ZHMA 1KXDA 2AEIH 4KGAA 3W1EA 1OP8A 3EE0B 4GUXA 3PLBA 3RUOA 1E37B 1ELGA 4KKDA 1NBMD 3MU8A 1HAVA 2FLBH 3MO9A 1QL8A 1DSUA 4OS4A 3ATIA 1C5WB 1HGTH 4FUGA 3F0PA 1XM1A 1AB9C 5HKKD 4LOYH 4GCHF 1MTWA 1YCPH 5A8XA 1O5EH 2HGTH 3MNBA 1SQRA 3GCTG 1W0ZU 1C5ZB 1FN8A 1UCYH 1W0YH 1ZZZA 4DT7B 1G36A 4O97A 3E3TA 1C5RA 5I25A 3MWIU 1ESBA 1RIWC 3B8JA 4E05H 1F0UA 1W3CA 4NFEA 1HAYB 4DVAU 1ORFA 1KLIH 2PUXB 4JK5A 4OGXA 3A7XA 4OS7A 3SGBE 5GJ4B 2QXHA 1UTLM 1DUEA 3PROA 1KTSB 5C3NA 4X2VA 1RGQA 2ZFPH 2ILNA 2SFAA 1ZHRA 5C17A 2PSYA 1OYQA 2G4TA 2BY7X 3SZEA 1GGDB 1UK4A 2ZWLH 4XRNA 1TWXB 4IN2A 5DN6D 2PUQH 1HAXB 3HKIB 7KMEH 2ZFSA 4TY6A 3PTNA 1ELAA 1SGNE 1O2QA 3HATH 1PPFE 3DCLA 1C4V2 3EYDA 1O3OA 3JZ2B 1BITA 1ELDE 2BX4A 2ALPA 3U98H 1A3BH 1K9OE 1LVOA 3M5OA 5JBCS 1ETTH 1RJXB 3A87A 3URCA 3SI4H 3DA9B 1F5RA 4MPWA 4K1SA 1BMAA 1IQNA 1T4UH 4HGCA 3M3VA 1SLWB 2AMQA 1C4Y2 3DSGA 1J8AA 3R3GB 1G2LA 1KSNA 1F0SA 3U1JB 3QZRA 2KCAA 4NIVA 2O8UA 3B23B 3F9FA 1C1VH 1SG8B 5K0HA 3FP6E 2F43B 1TMTH 1Q2WA 3ZZ3A 1ZMLA 2F4LA 3MU4A 3OFND 2YMSD 3MTYA 1DX5M 1FI8A 1G3DA 4WH8A 4Y7AA 2ZHWH 2CN0H 3P8OA 1GBJA 2VINA 2QF0A 1DWDH 3LONA 2A4QA 1EZUC 3A86A 1E79D 3PV2A 4TSFD 1GCDA 2TBSA 2Z3DA 2OC0A 4FUFA 4GVUA 1P3CA 2AMDA 2H2ZA 1BRAA 3P70B 3ZYEA 1O31A 1BRCE 4AX9H 2FOCA 1EB1H 1GGDC 1LCYA 1UCYK 2P93A 2ZHDA 3T62A 3N7DA 4M7GA 1OWIA 1YLCA 1N6XA 5E2PA 2C4FH 1TOCB 4DG4A 4XBDA 1TGCA 1GBBA 1GPZA 3A7ZA 1LHGH 1SLUB 2TRMA 1OP0A 4KTSA 3KN2A 5F53A 2ZHQH 1ZTKA 1ZRKA 1SKYE 2J9NA 5F03A 2C8ZB 2IPQX 3W95A 2W7SA 3SV2H 2K1QA 2L74A 1CGJE 2ZCHP 1C2GA 8LPRA 1HYLA 1Z71A 3RXCA 1LVMA 3ZZ6A 4WXIA 1YPHE 4CR9A 1D3TB 3T27A 2BYAX 2TGPZ 2YNBA 2KM0A 2FLRH 2BVSH 4K60A 1WUNH 2ZGCA 2R0KA 2ZP0H 1MKXH 3SV7A 5BPEA 4JZDH 1O3KA 1RTKA 3UB0A 1P2KA 3FZZA 2NWNA 1IAUA 2JIZD 5CHAB 4DT4A 5JBTA 3EA9A 1C2MA 1H4WA 4JYUH 3W94A 1V2TT 4NSYA 1UVPA 2F9PA 3LKWA 3MU1A 1ETSH 4DCDA 2H9HA 1QHRB 2HRVA 1EOLA 3IWMA 2VWNA 1UTQA 3GCHB 5GPIB 2JKHA 1UVSH 1QNJA 2GCHG 3ZVAA 1WV7H 1J16A 2A0QB 2P3FH 3RMLH 3H5CB 1NM6A 3K2UA 1SGQE 2W5EA 2K8IA 5TCCA 1ACBE 1NFWA 1TAWA 1O3GA 1C5NH 1A5HA 1H8HD 1SSXA 1CHOG 4MPXA 2ZGBH 1O38A 1FY3A 1OP2A 4I86A 1C5TA 2QC2A 3MO6A 2VVCA 2G8TA 2GVFA 3UQVA 1P11E 4I33A 1L1JA 2Z9IA 1W11U 1XMNB 2XC0A 1NY22 4ISNA 3QLPH 3E8LA 1F92A 1Y3YA 2PTNA 3PMHB 1KDQB 1EZXC 1K1JA 3I29A 2ANKH 1TA6A 3A83A 2QA9E 1SL3A 1MTUA 4INKA 5EIYA 1P2JA 2C8YB 4Z0KA 2OBQA 1O30A 1F2SE 1THSH 4M9FA 1O36A 3UNRA 1JRTA 2VWOA 2Z3EA 2QGRA 5CHBA 1DM4B 1C1OA 1RS0A 3KF2A 1MUEB 2ODYB 1TBZH 3BIUH 4Y79A 3RLYH 2VNTA 2NU4E 1BTYA 2F91A 4K1TA 2GGVB 3S9CA 1KIGH 4XFQA 3RM2H 3SYJA 4NCYA 4A1VA 4ZKRU 2SNWA 3ATKA 2PKSC 1PPBH 2KR7A 1TGTA 4XBCA 1JXPA 4K5ZA 1QL9A 2FMJA 5HMAA 1MMJN 1AGJA 5DP4A 1DUAA 3ZZ9A 3QDZB 2LPRA 4DY7B 4B71A 2FO9A 4ASHA 2AMPA 2VIWA 3HKJB 1DT2A 4AB8A 1D6WA 1AFEH 1ZSLA 2QXIA 2XXLA 2THFB 3H7OA 1FN6A 4GCHG 2WPLS 1QJ1B 2FX6A 3ELAH 2WPJS 2I6QA 4OS1A 3A84A 3SORA 2CXVA 1AO5A 3TIUA 4Q4LA 4X1RU 1GI2A 1NFYA 2BLWA 1LKBA 3GDVA 1UTKA 2IN2A 3A8BA 3F2FA 2Q6GA 1ANBA 1QIXB 2SGEE 1TNGA 2SNVA 5AF9H 1GHYH 1TRNA 4LXBH 1ANCA 1P03A 3BTKE 1IHSH 2WINI 1HDTH 2K0QA 1C5UA 1TOMH 1O34A 3NXPA 3CP7A 1NU9A 4X1QU 1AN1E 1ELBA 2XRCA 1AE5A 3T25A 5GIBA 1EPTC 2OQUA 1YC0A 2GZ8A 5E0HA 2EQNA 6ESTA 1P8VC 4FU8A 4B76A 7LPRA 1BQYA 3OE7D 3FAOA 1NTPA 1XXDA 1ZLRA 3T26A 4AORA 1GBHA 4X8VH 1GJDB 3VB5A 1Z6JH 1SQOA 4Q63A 2J94A 1BIOA 1ZTJA 4AFSA 1L2EA 4ZXYH 2Y5FA 2R3UA 5E2OA 2OINA 1Z7KA 1UVTH 4PROA 3L6PA 2ZU2A 5ETXA 3F9EA 1DY9A 3GYLB 1V2JT 4BTTB 2A2QH 1S6FA 1C5SA 1G3EA 4I31A 1E1QD 4ASUD 5CE1A 2A5KA 2PLXA 3ZZ4A 2GMTB 1T8LA 2V0BA 2J4IA 5FBEA 4UONA 5EW2H 2CF8H 1QRWA 3UAIC 2PTCE 1OWDA 3SNAA 5HIZA 1Y3VA 4E06H 1A2CH 4GSOA 3SUGA 1ABIH 2LNCA 2VGCC 2RCEA 1H9LB 2GJGA 2VWLA 2TIOA 3T5FH 3PRBA 3O8BA 1HIAA 3TK9A 2UUJB 5EJZA 3BEFB 1XUFA 5DP7A 2A1DB 2OC8A 4OS2A 5A0CA 2M2AA 5E0GA 4X8TH 1AY6H 1WU1A 3E0PB 3IG6B 1PPHE 1L0ZA 1V2NT 2J5UA 2AIPA 3QTVH 5IK2D 3SZNA 1S0RA 1QBNA 4A5TS 1HJAB 1P12E 1C1SA 4UFGH 2RDLA 4H6SB 2JETB 3UOUA 4MG3A 5G4BA 4NA8A 1O2WA 4YOJA 3SUDA 1P06A 4Z1MD 1V2LT 1MH0A 2GMTC 1O5BB 3NCLA 3A85A 3VXFH 1W2KH 3SV8A 4Y8XA 5FPTA 3K6YA 1TNHA 5JBBS 3SU1A 1C2DA 1YLNA 3WY8A 1GBMA 3KQCA 3GY8A 4B73A 2C8WB 1IQLA 1INCA 3V13A 4F49A 1COWD 1O2SA 1SGDE 1TX8A 2BLQA 5EW1H 4ABJA 1EFRD 1EKBB 3SGAE 3MQKC 3BTTE 3ZVFA 2JJ2D 3GY6A 2WPHS 2EI7A 2UUFB 1OYTH 1TALA 1TONA 3S9BA 1VR1H 3SV6A 2PP6A 3BV9B 1VITF 1Z1JA 1GDNA 3F68H 2OTVA 2ODPA 3IITA 4WMEA 3UWIA 4AB9A 2W3IA 3OTPA 1AMHA 1SBWA 1HJAC 1C1WH 1PPGE 3SI3H 4AN7A 1IQKA 2BX3A 1LHEH 3UREA 1HPGA 1QURH 2JETC 4HFPB 3Q3XA 4KELA 4X1SU 3UIRA 2WV5A 3FZDA 1WQVH 3M7QA 4WMFA 1SGRE 3URDA 3QWCH 2FYQA 5LPEA 1EUFA 2IOTA 3BF6H 1ZMNA 3F1SB 1UTJA 2TGAA 2BD2A 7GCHF 1JOUB 2I6SA 3SJ8A 2ZG0H 1BTUA 1TFXA 2HLCA 5TJXA 3TK6A 5GCHF 5AVDA 2QV1A 1VCPA 4WVPE 1C2IA 3QUMP 1GJAB 1K2I1 4AGKA 2A4GA 4X1NU 1FY1A 4AC9A 3LOXA 3UNSA 2FOHA 3TGKE 2FPZA 1JMOH 2QF3A 2TPIZ 3BTWE 1W10U 4MPVA 4J1YA 1O3AA 1Z8IB 2OK5A 2ESTE 1GBAA 1DITH 2L6OA 1P2NA 1QJ7B 2BD3A 1O3BA 5T6DA 3L33A 4Y11E 1ZR0A 3AW1A 4TWWA 1C1TA 4SGBE 1O2PA 3QGNB 1FXYA 1UTPA 1MKWH 2ZDKA 1FIWA 5GXPA 4NG9H 3RXEA 3BG4B 3SJKA 1L4ZA 2HALA 3SUEA 1CGIE 1SGYE 1H8DH 2J92A 4B1TA 7ESTE 1NFXA 2BQ6B 1O3NA 3KGPA 1AIXH 3MH5A 1F0TA 3RMMH 2Z9JA 1KLJH 3UOPA 4D8NA 1C1MA 3ESTA 3GY3A 3LGUA 2PGBB 1IQHA 4MTBA 1BTHH 1A5GH 1OWKA 3DT0H 3TH3H 1FNIA 4X8UH 4DGJA 3LC5A 2FDAA 1ZRBA 4JCNA 4HG6A 2ZTZA 3N7EA 3UPEA 3SJ9A 2D8WA 5AFYH 3PMAB 3DSPA 3AVZA 1S85A 1TGBA 1LHFH 1OWHA 1SGFA 4ZXXH 3Q00A 4TWYA 5L2ZH 3E0NB 5JB9S 3FFGA 2H5DA 1BBRH 2BD5A 2D1JA 3ZZ8A 2D26C 1UJ1A 5FAHA 1Z1IA 4X6NA 5L2YH 2KAIB 2AGIX 1GI7B 5DP9A 5FCKA 2V3MA 1ID5H 3VB7A 1SGFG 5C20A 3SU6A 1AVWA 1GJ6A 3UTUH 1YM0A 1YPLH 3TGIE 2OLGA 2ZU1A 4DURA 4FUEA 2CHAC 3KEEA 3HGPA 2P59A 2RA0A 1UHBB 2J38A 2XC5A 3BG4C 1QY6A 5DP5A 4BNRA 4E7NA 1L1NA 4FU7A 1N1LA 1NC6A 3RXMA 2R3YA 3RXPA 1TPPA 4FUCA 2O8MA 4FUHA 1SHHB 8GCHF 1LQEA 4CRBA 1H8IH 1EATA 2WHXA 2HPPH 1WSSH 1CVWH 1N8OB 3ZVDA 1GHZA 2GD4B 1WYKA 3A8DA 4X6MA 3ENSB 2QYIA 2TGTA 2WSSD 1S6LA 2ZIQH 4NA7A 1THPB 1TBRH 4TYDA 1O3DA 4O3UA 1ETRH 4RN6A 3CS7A 1ZPCA 5AHGH 2BDAA 3ATWA 1T8OA 3EA7A 3UWJH 3PRDA 1FMGA 5C5NA 3ZV8A 1O2RA 1SMFE 1ELEE 2FZZA 2J98B 4CH2B 1TA2A 3A7YA 2KZ4A 3PWCA 1JIMA 2BY8X 2Z7FE 5H4IB 1O32A 2ZDNA 3GDSA 1O2MA 2NU0E 2FODA 4GAWA 2UWOA 2H9EH 1N6YA 2ZECA 5F8ZA 5FPSA 2V3HH 2Y7XA 3SO3A 1Y59T 1GHBF 8KME2 1HAVB 1GI8B 2GDDA 1HV7A 1AKSA 2B0FA 2BHGA 3OSYA 5T3HA 5JBAS 3DHKH 3VG8A 3HK3B 3UQOA 2GT8A 2WPMS 1TNJA 1S6HA 1NROH 2VIQA 4CREA 2KCPA 4B2CA 4BAKB 4IGDA 2XWAA 1Y5UT 1N8OC 3RXUA 4I7YH 5FHTA 3ZVEA 1NU7B 4BXWA 1F0RA 4OM9A 2QN5T 1W7GH 2ALVA 1HJ8A 2BD8A 3F6UH 1TNIA 3Q77A 5T6GA 1W13U 4ABEA 5ABWA 1YCPK 2FS9A 1TLDA 2KCOA 5HM9A 1H9IE 3KNXA 2VIOA 4JYTA 5AFZH 4UFFH 2QY0B 1L4DA 1AQ7A 2F9OA 2GDEH 4ZROA 1LTOA 5EXNA 3E90B 1SVPA 2ZHFH 1J14A 1SGEE 2NU3E 9ESTA 1O2LA 2PSXA 3S7KB 2A2XH 2QF4A 3QGJA 1IHTH 3DD2H 4H6TA 3OTJE 2OXSA 4FUDA 3V0XA 4ESTE 4MNXA 3UUZA 2FIRH 3QZQA 1E34B 3RXIA 1KLTA 1GBEA 1CBWB 2GV7A 2BXUH 4MLFB 1SR5C 2ZF0H 4IMZA 1VGCB 4BAOB 4ZUHA 3RXKA 4AFZA 4NWKA 3FANA 2XYAA 3C1KA 2HNTE 1MQ6A 1SHYA 3BG8A 3RXJA 4AGJA 1ZMJA 1VITG 3GY5A 4ABDA 2WV9A 2FOMB 3QX5H 1DS2E 2VH0A 3NWUA 1DE7H 1FAKH 3SJOA 3TU7H 3D65E 3GY7A 4BTIB 1BT7A 4YLUA 2H1UA 1NBME 3LJJA 4JMYA 1YWUA 1IQGA 1KDQA 2FOAA 3OYPA 4NSVA 1AUTC 1G32B 2A7CA 2WUBA 2P3UB 1EAIA 3EAJA 1C2HA 3R0FA 1VCQA 2AS9A 3RXBA 2XCNA 1ELVA 1TBQH 2F83A 4U01A 3QTOH 1FUJA 1PQ8A 1QA7A 3E16B 4RT0A 7GCHG 2BDIA 2UUYA 2WPKS 4ZMAH 5GCHG 1WCZA 3PMBB 1EPTA 1O5FH 6LPRA 3ZZ7A 3F2GA 2C93B 1PPZA 3M7TA 1UVOA 4ZH8A 1VKYA 1HFDA 1HLTH 2ZPRA 3RLWH 1O2YA 1UCYE 1K1LA 1T4VH 1VGCC 4LZ1H 5JDUB 2RA3A 2JJ1D 1CE5A 5T1VA 1GBKA 1O37A 3A7VA 1Y3XA 2VIDA 5FX6A 1PPCE 1H8ED 1SQTA 1SFIA 2R2MB 3ZZ5A 3KYFA 3VGCB 1IQJA 3LDXH 2W6ID 1S0QA 1EJAA 1YPMH 1QB1A 1LHDH 2G81E 3L3TA 2J34A 3T28A 4AFUA 2IPHA 1A5IA 3U28C 5LPRA 2PKAA 4MNYA 3U8OH 1CT4E 3B9FH 2O9QA 2V3OH 1TNLA 3PV4A 5CHAC 4ZKOU 1EJMA 3GY2A 1HBTH 3RDZA 3ZV9A 5J4QA 1D3PB 1BTPA 2VWMA 4I8GA 3GOVB 4X2XA 5F6MA 4AFQA 2BDHA 3A8CA 2ODQA 5DJ7A 2P95A 2FTMA 3GCHC 1O2IA 5E8EH
chains in the Genus database with same CATH topology
4CRFA 4CBNA 4IMQA 3UNQA 1QBOA 2ZNKH 4CR5A 1SFQB 3U8RH 1MKXK 4BANB 1YPEH 3E6PH 3O8CA 3A7TA 4UFEH 1YCPM 2Y81A 4YM9A 1ABJH 3GCNA 3TVJB 1FZZA 2ANMH 1E0FD 2XC4A 1LPZB 2ZGHA 3PWBA 5CMXH 1P0SH 2Z3CA 4IBLH 3Q76A 5C2ZA 4ABHA 4ABFA 1GG6B 4MPUA 2BZAA 4OGYA 1FLEE 1S83A 1A46H 3VGCC 2FOFA 1ELTA 3Q3KA 2VH6A 2SGPE 3RMNH 4YO9A 2UWLA 2BXTH 1IOEA 1C1UH 4WWYA 3SU2A 3SU3A 3BTQE 3PO1B 3P6ZB 2SGFE 1C5XB 2FYRA 1GVZA 3M5MA 1RXPA 4D76A 1C5MD 1C2LA 3ATMA 1O3PB 2Z9LA 2DUCA 1NPMA 1SGPE 1EQ9A 1O35A 3UR9A 8GCHG 1FJSA 1GBLA 3RXOA 5EXLA 2CGAA 3SQEE 1CA0B 1THRH 4INLA 4O9VA 4Q80A 1YPHC 4WH6A 1TMBH 2QIQA 1CBWC 3K65B 2ZU3A 3MNXA 4K2YA 1SGCA 5DP8A 1O2TA 2G00A 2WUCA 1O3HA 1O2OA 1QR3E 3QO6A 4IW4E 2HPQH 1V2VT 2OUAA 1GHVH 1JRSA 3PTBA 2ZTXA 1AVGH 3SHAH 2YOLA 3UFAA 4CH8B 1O0DH 2CJIA 3PB1E 1CU1A 2FOEA 4Y76A 1C5OH 1S81A 1Q31A 1GHAF 3NKKA 5C67A 1V2RT 1EZQA 4J2YB 1GCTB 4QT8C 2A7HA 3ZYDA 1TNKA 3P8GA 3PLKA 3PM3A 3VFEA 4NA9H 1V2PT 1UTOA 2D2DA 2ZDMA 1C5YB 1V2KT 1EZSC 5LH8A 4ISLA 2VU8E 2Q1JA 4FVBA 3PO1C 1GHBG 1ZJKA 3M5NA 1P57B 4UDWH 2QCYA 5K7RA 1GMCF 4B2BA 4Z6AH 3FVFB 1A1RA 1EB2A 3MNSA 1PQ7A 1XUGA 2ZDLA 1DFPA 1NRNH 1HB0B 1NT1A 3Q3YA 1O2HA 2G5VA 1JIRA 4GHTA 4LK4A 4RKOB 1ARCA 2PR3A 1C9PA 5GDSH 1GMDF 4BAQB 3VPKA 3TNSA 4X6PA 3TK5A 4FUBA 1AE8H 1S82A 1QA0A 1YF4A 3MO3A 1C5PA 5A2MH 4OS6A 4I8KA 4D7GA 5DGJA 1MAXA 3M37A 4Y7BA 3SNEA 4D9QA 3RU4D 2Y7ZA 1KXEA 4YT6H 5JYIA 1K1MA 2B5TB 3TH4H 1O3EA 1QJ6B 1GI6A 1LQDB 2ZU5A 1GBTA 1AZZA 1QB9A 2QAAA 2R9PA 5EQRA 1RD3B 1GBIA 1C1NA 1OX1A 1OSSA 1C1QA 1AD8H 2PV9B 1M9UA 1DOJA 1V6DA 1X7AC 1BCUH 1MTNB 1BTXA 2GKVE 2ZGJA 2H6MA 4AYYB 1BMLA 4Q7ZA 2EI6A 4TY7A 3FP8E 2OQ5A 2XW9A 3NUMA 2PWXA 5IYTA 4ZKNU 1Y5AT 2Q6DA 2VVUA 1ANDA 1J15A 2ZU4A 1BZXE 1EXFA 2OBOA 2C8XB 3ODDA 2ZQ2A 3SNCA 1YYY1 1EP5A 3MMGA 2ZDVH 2RG3A 4X1PU 3RXQA 2Y5GA 1V2UT 2Z94A 1GWAA 3KCGH 3VXEH 3KQDA 2ULLA 2W26A 2FXRA 3AW0A 2STAE 3GICB 3M35A 1YLDA 4U30A 1DLKB 1BTWA 2WYGA 3ZZDA 1G30B 1OOKB 4Y6DA 3RXDA 1TGSZ 1HIAB 3BSQA 3VB4A 1KXCA 1HXEH 1BTZA 2OC7A 2P8OB 2Q6FA 1OXGA 3RXSA 2F9NA 1UTMA 3D49H 5EPYA 5DG6A 5LPFA 4B75A 1DWBH 2ASUB 1GL1A 4IC5A 3RXGA 1UO6A 2ZHEH 1MU6B 4LZ4B 2GT7A 2OP9A 5EOKA 1ESTA 1A0HB 3GYMA 3S7HB 1XXFA 2Z6BD 1MTNC 2AERH 4UD9H 1OWEA 2BB4A 3A89A 4YT7H 1D9IA 1C5QA 3MI4A 1CGHA 1C2JA 1UMAH 3MFJA 1QGFA 4WY3A 1DDJA 4HI3A 2HNTF 2Y6TA 4WF8A 3SV9A 3V7TA 1T31A 2F9BH 3SBKA 1GVKB 3NZIA 1ZGVA 3GDUA 3STIA 2ZC9H 4AZ2B 2BDGA 1TX7A 3N7OA 1GI5A 2F3CE 2A7JA 4FXGH 1TQ7B 1ELCA 1TPOA 1FPHH 1QTFA 1W12U 3D23A 1NN6A 2B9LA 1D6RA 2BDCA 1H9HE 1BJVA 1T32A 3F9GA 1DWEH 4ABAA 3S9AA 1K1OA 3P17H 2Y82A 4ABIA 3SQHE 4ZKSU 3U1IB 4XSKU 1CT0E 1HJ9A 4ZHMU 1P2QA 1PFXC 1XUJA 5I46H 1S84A 3H7TA 2G51A 4O03A 1V2MT 1O3JA 1PYTC 1AB9B 1FPCH 2FTLE 3CS0A 2A4RA 1P3EA 3RXAA 2SGQE 1C1RA 1B7XB 1HAOH 1O2KA 1F7ZA 1NRPH 1CSOE 1G9IE 2BOKA 1TABE 3GY4A 6GCHF 3O8RA 1SLXB 1TE0A 4A6LA 2F9VA 1YPKH 2XWBI 1P10A 1Y3WA 2V35A 4VGCB 1Y5BT 1TRYA 1K1PA 2WV4A 2A32A 1Y8TA 3TLOA 4UE7H 3BTDE 1MD8A 1SLVB 3HPTB 4A1XA 1D4PB 3CENA 5EQQA 3TJOA 4K8YA 2BM2A 4NIWA 5C1YA 3F9HA 1OWJA 1FDPA 2FP7B 4AOQA 1GHWH 1VJ9U 4ZHLU 1ARBA 1V3XA 3STJA 1EAUA 2C90B 5ESBA 1NFUA 2STBE 2NU1E 1GHXH 5IDKA 2ZCLP 1QL7A 4K8BA 1YGCH 1B0EA 4ISHH 5PTPA 3TPIZ 2BLVA 2XBVA 3MH7A 4JZFH 5B6OA 1CA8B 2GX4A 3SUFA 4YTAA 1O39A 4JYVH 1PJPA 1FAXA 4FVDA 3V3MA 3M61U 2P16A 5C5OA 1LO6A 1XUKA 5ESTE 1GHAG 1HAZB 5HYOA 4WJG2 1D3DB 2VIVA 4VGCC 1MKWK 3RP2A 1A3EH 2GV6A 4IS5A 1YBWA 1AWHB 1ZYOA 1K21H 1FV9A 1O2VA 1PPEE 3TNTA 1CO7E 1RFNA 5FX5A 4Q2KA 1LKAA 3I78A 2FOBA 2H9TH 1ZPZA 2A31A 1HAGE 2ZCKP 1O5DH 4XE4A 4O3TA 1GMCG 4YOGA 3ZVGA 4THNH 4NIXA 2ZFTA 4U32A 1AZ8A 4HTCH 1XX9A 2VVVA 3BTHE 3ZVCA 3RXHA 1GMDG 1E36B 2A5IA 2ZFFH 1O5AB 3SU0A 2EA3A 2XBYA 3BTME 1K28D 3NK8A 1BBRK 3RXLA 1WTHD 4A7IB 5EG4A 4JK6A 4X2YA 1AFQB 1BJUA 1DICA 1ESAA 1SPJA 5EODA 3U9AH 1C2FA 2B7DH 1A0JA 1WTGH 1Z8JB 3MH4A 1NZQH 2ZI2H 1P02A 2GZ7A 2F9UA 2AH4X 2BDBA 4B74A 1PQ5A 1KYNA 3VEQB 2SGAA 4DW2U 1O33A 4DJZB 1HXFH 2M5TA 1O3CA 1FIZA 3LC3A 1A4WH 2CF9H 1GJ8B 4BXSA 1ZHPA 1J17T 4CRAA 3EDXB 3A7WA 1HAIH 1J9CH 1GMHF 3AASA 4I32A 3A82A 1MCTA 5FPYA 3RXFA 3V12A 1AUJA 2FWWA 4MNVA 4F4OC 1UK3A 1GI3A 2FX4A 2W7UA 1TGNA 4GLYA 1CHGA 1LDTT 1P09A 2FI3E 3LGVA 1Z8RA 2PFEA 2A5AA 1HNEE 3MHWU 4IC6A 2HWLB 1SGTA 1FY8E 4HZHA 2GZ9A 1BUIA 2XTTB 2ZGXH 1G3BA 2UWPA 3EGKH 1GJ7B 3HK6B 1ZOMA 2ZA5A 3MNCA 2OD3B 3SU5A 1DVAH 1AFQC 1AKSB 3SW2B 3VB3A 3PYHA 1LPGB 1MCVA 1W8BH 3ATLA 1SOTA 1NS3A 3LH1A 2BVXH 3TJNA 3RU4T 1ZPBA 1FY5A 1C1PA 1XKAC 3KIDU 2SGDE 4FUJA 3SNDA 2FM2A 5HM2A 1GDUA 1UVUH 2A45B 1E35B 2BD4A 1ZGIA 3SNBA 1KXAA 3TITA 1O3MA 1XVMA 1BB0B 3LU9B 4ISOA 4GPGA 1BBRE 5T6FA 2AYWA 2WYJA 2NU2E 4AYVB 1TIOA 1SOZA 1EP6A 3U8TH 3P92A 4Y0ZE 1GJ9B 3LGWA 1P9SA 2P94A 1IQEA 3M36A 1WOFA 4B2AA 1LVYA 1SC8U 4YOIA 4NIYA 3MOCA 1HUTH 3GCOA 3SN8A 2B8OH 3DUXH 4D7FA 2HVXA 1TYNA 4YZUA 1BMNH 3LGTA 4JZIA 1C5VA 1XUHA 5TCAA 2JH0D 2ZDAH 2EC9H 1TRMA 3A80A 3MU0A 3M7UA 2AGGX 4AG2A 2FS8A 1V2OT 4I8HA 4MNWA 3S69A 5JPMH 2PKSB 1PYTD 1MQ5A 4KTCA 1NRRH 4YESB 3ODFA 1IQIA 2W3KA 1T8MA 1OKXA 1BA8B 2P3TB 3MYWA 1DANH 1H1BA 2ZQ1A 4MVNA 3LT3A 3TJUA 1TQ0B 2XBXA 1ELFA 1HRTH 1C4U2 1MZAA 2ZPQA 1DPOA 3BIVH 3OU0A 4H42U 1QQUA 1Z8GA 5A0BA 4K69A 3OY5U 1GBFA 2R0LA 2PGQB 1KY9A 2PHBA 4GHQA 4RSPA 3SHCH 1DWCH 4WMDA 1NO9H 3A8AA 1TPAE 6GCHG 2V6NA 5DKMA 5C1XA 5DK1A 2ZFRH 2O8LA 4FU9A 3ZVBA 2BOHB 1AVXA 1TX6A 2ZPSA 1ZTLA 2DE8A 1C2KA 3KQBA 4Q7YA 5BRRE 3T29A 1O3FA 1XVOA 2Y80A 3LPRA 1DXPA 1XUIA 1ZSKA 1EPTB 1O2ZA 4X0WU 5A09A 3BTGE 1O2GH 3RC4A 3T2NA 4CHAB 3U69H 2G55A 4AG1A 1P01A 2YNAA 2ZTYA 1YPGH 4K1EA 1V2WT 4XBBA 2GCTB 2FEQH 1NRSH 1QCPA 1AHTH 1YPJH 2BY6X 3DFLA 3BTEE 1AU8A 1CQQA 4R0IA 1BHXB 2HNTC 3PMJA 4Y8YA 2ANYA 3D62A 3P8FA 1QRXA 4ISIH 1HCGA 1K1IA 3C27B 2PKAB 3A88A 8ESTE 1GI4A 3KQEA 5SGAE 3QN7A 2BMGB 1DLEA 3DFJA 2VGCB 1MBMA 3K6ZA 1GI1A 2G5NA 3GCTF 1CT2E 2R2WU 4Y10E 1BMMH 4JZEH 1T8NA 1B0FA 1GI9B 3OX7U 3FP7E 1EOJA 3ZZCA 2OC1A 2XCFA 3P8NA 1GJ4H 3AAUA 2XNIA 2AFQB 1MU8B 1F5KU 1GG6C 1A61H 1WBGB 3I77A 1GI0A 1DXWA 1V2QT 2G52A 4ZAEA 1O5CB 4CHAC 4FUIA 3QK1A 1MTVA 3NPSA 2VB0A 2GCTC 1O2JA 2G4UA 1Y3UA 4U2WA 4D9RA 1LMWB 2OCVB 2O8TA 5J4SA 3BN9A 1W14U 1DSTA 1TPSA 2O8WA 1CA0C 1L1GA 2GTBA 1WAYB 4BAMB 2GP9B 4H4FA 5E0JA 1O2XA 4X6OA 3LJOA 2BQWB 4DOQA 1NRQH 2BVRH 2FI4E 1E38B 1JWTA 1WQSA 1SB1H 3G01A 4Y71A 1FQ3A 2H5CA 1A7SA 2A4OA 1U6QA 2BD7A 3BTFE 1MBQA 3BEUA 3KL6A 4NWLA 1QRZA 5EU8A 1C5LH 1RTLA 2AGEX 4XDEA 3MU5A 1ZJDA 1MTSA 1BDAA 3ZZAA 1HAHH 3SU4A 1GCTC 1P2MA 3UY9A 1BRUP 3E91A 1GBDA 1MD7A 1C9TA 1YKTA 5HXFA 4SGAE 1AI8H 3E1XB 2ZZUH 1GMHG 1YP9A 9LPRA 1Z6EA 1OPHB 2PW8H 1P2IA 5FBIA 4NFFA 1S5SA 1FY4A 1O5GH 1EASA 4ABGA 3RXTA 1O2UA 2JH6D 3PLPA 5LGOA 1MZDA 3GISB 4CRCA 1G3CA 5DPAA 1BRBE 3EQ0H 4ABBA 5L6NH 4YLQH 1TB6H 1PQAA 5FXLA 3RC6A 1BOQA 2ZKSA 5L30H 5JB8S 4MDSA 4MQAA 1JBUH 2CV3A 2EEKA 3SGQE 3TGJE 2TGDA 1B5GH 1K22H 4A1TA 3M3SA 1O3LA 2BDYA 2C3SA 2FESH 3TH2H 1KTTB 3RXVA 1F5LA 3P95A 5F8TA 4E7RG 2AIQA 5A8ZA 3JZ1B 4KTUA 4NZQA 2BQ7B 1KXFA 1LVBA 5F8XA 2J2UA 5DO4H 1A0LA 3BEIB 4A92A 5DP6A 1GL0E 4I8JA 3RC5A 3M5LA 3RM0H 1QB6A 4K3JA 4CBOA 3KHVA 4INHA 1UK2A 1IQMA 3EA8A 2FOGA 2CMYA 4UEHH 3ZZBA 5GWZA 2J95A 5FCRA 2HOBA 2DE9A 2VIPA 4CRGA 2FI5E 4IN1A 4BAHB 5EQSA 4RKJB 3RMOH 6CHAB 1RTFB 1GJBB 1T7CA 1P05A 1TMUH 1VJAU 1GDQA 2UUKB 4WXVA 5EPNA 4CRDA 4TPIZ 5EXMA 1LHCH 1XKBC 2WPIS 2GCHF 2JH5D 3ITIA 3LGIA 1P9UA 3LGYA 4X2WA 1GVLA 2Z9KA 4TPYA 1EJNA 1O2NA 3MH6A 1P04A 1QQ4A 1UTNA 2KAIA 3TJVA 1GBCA 1W7XH 3RXRA 3A81A 3AAVA 1VZQH 5A0AE 1QBVH 1G37A 2EI8A 2ZEBA 1AWFH 2P8OC 1UHBA 1CHOF 2VJ1A 1GJCB 3M3TA 1HAPH 1SI5H 3O8DA 4Q7XA 1GJ5H 1LPKB 4XOJA 3LH3A 3SOSA 5A8YA 4Y0YE 5EGMA 1OS8A 2Y5HA 2BLOA 1K1NA 3UR6A 4NGAH 1Q3XA 2BZ6H 3OY6U 2BY5X 4JZ1A 4ZHAA 3LIWA 2IJOB 5DP3A 2Z9GA 1FONA 1NESE 1VITH 2CHAB 4I8LA 4UFDH 4Y8ZA 5HGGA 5C1UA 2BY9X 4R8TB 1SGIB 1IQFA 3K9XB 2QXGA 1O3IA 2BD9A 1BHXF 3HGNA 4X8SH 1RRKA 4KP0A 1EAWA 1RIWB 2ANWA 3S0NA 1DY8A 2ZFQH 1V2ST 2XBWA 6CHAC 1SQAA 1KXBA 1EX3A 1G2MA 4DIHH 4DIIH 2ZO3H