1PQ4A

Crystal structure of znua
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
289
structure length
255
Chain Sequence
DAMDITVSIPPQQYFLEKIGGDLVRVSVLVPGNNDPHTYEPKPQQLAALSEAEAYVLIGLGFEQPWLEKLKAANANMKLIDSAQGITPLEMEKMVADPHIWLSPTLVKRQATTIAKELAELDPDNRDQYEANLAAFLAELERLNQELGQILQPLPQRKFIVFHPSWAYFARDYNLVQIPIEVEGQEPSAQELKQLIDTAKENNLTMVFGETQFSTKSSEAIAAEIGAGVELLDPLAADWSSNLKAVAQKIANANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of Metal Specificity in the Zinc Transport Protein ZnuA from Synechocystis 6803.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Metal binding protein
molecule keywords periplasmic binding protein component of an ABC type zinc up
total genus 92
structure length 255
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1pq4A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1pq4A02
4M7OA 2OV3A 3AESB 4DBLE 2AFIA 3PDIB 4IRMA 4HMOA 3MD9A 1N4DA 5GGXA 2OV1A 1M1NB 4BBPA 4UDNA 5B58T 1KARA 4K3VA 1PQ4A 4WESB 1KAEA 1M34B 4NNOA 4MDYA 4MO9A 4ND8A 4INOA 2AFHA 3AERB 3PSAA 4MLZA 3TLKA 2QI9F 1KAHA 4TKUA 2WHYA 3AEKA 3AESA 2OGWA 3R5SA 4FKMA 2WI8A 3PDIA 1FP4B 1G21B 3G9QA 4HMPA 5BVHA 2ETVA 5JPDA 3LI2A 5M2QA 5JOQA 1G20B 1K7SN 5CX1A 3ZTTA 4WESA 1TOAA 3MINA 3NU1A 3ZK9A 1M1YA 3AETA 4UTPA 4ND8B 3K1AB 3AEQB 4XPIB 3BE5A 5CR9A 2R7AA 2YNMD 1QH8A 4H0FA 2PHZA 5FLYA 2MINA 5M3BA 4TKVA 3TNYA 2AFHB 3AERA 5KHLB 3MWGA 5HX7A 2R79A 1QGUB 4PAGA 1M1YB 4WZAB 5HDQA 5BVHB 4H59A 5KOHB 3HJTA 4G09A 1N4AA 1L5HA 2PS3A 1K2VN 4OXQA 5CX1B 2XH8A 2RG7A 5BVGA 5M34A 1N2CB 3EIXA 3PSHA 4LS3A 5KOJA 4WN9A 3GI1A 3K1AA 4XPIA 1QH1B 3EIWA 2AFIB 3U7QA 3AEUB 1QGUA 4PM4A 4G07A 4TKUB 4B8YA 1H1LB 3AEKB 4WZBA 5KOHA 2PRSA 2XDQA 4N01A 4NNPA 2PS9A 2XV1A 2X4LA 3CX3A 4HMQA 1MIOB 2OSVA 1N2CA 3MINB 2O1EA 4MX8A 4FNAA 3AEQA 3AEUA 1H1LA 4WZBB 3HXPA 2XUZA 2YNMC 1G20A 5BVGB 1K75A 5JG7A 3UJPA 1XVLA 4WN9B 3R5TA 3AETB 4WNAB 3ZK8A 2M6KA 5AFSA 4INPA 1PSZA 1EFDN 1FP4A 5M29A 3HH8A 3ZK7A 3MFQA 4OVKA 3MWFA 3ZKAA 2MINB 3TEFA 4FI3F 3BE6A 4TKVB 1K0FA 2XQVA 2Q8PA 3LHSA 2PS0A 2Q8QA 4WZAA 5GGYA 1M34A 5KOJB 2XY4A 2M6LA 4UTOA 3U7QB 1L5HB 4HN9A 4OXRA 1QH8B 1N2ZA 1M1NA 1ESZA 1G21A 2XDQB 4FILA 4CL2A 4UDOA 5I4KA 5JJ5A 4GICA 4WNAA 4LJSA 1QH1A 1MIOA
chains in the Genus database with same CATH superfamily
3RTEA 4XB6B 3KIPA 2RHRA 1XZDA 3DOHA 2R8RA 1P2VA 1VIDA 2QIPA 1SMKA 4QTXA 2DUUA 2XQIA 1ESMA 3B9BA 4QOHA 3SU8A 1P5HA 2IFTA 2NZWA 3PNPA 2IVZA 4DIMA 4BLVA 2ZSUA 3KTOA 4J3NA 2Q9CA 2Z2YA 4IOLA 4JXZA 4HADA 3DO8A 1T2DA 1UL1X 3TJZA 3W5SA 1AA9A 3LPDA 1N1MA 3QPUA 4MR8A 5IC6A 2VNHA 3AG6A 3L43A 2ZB2A 1BQ3A 5K8CA 2XIJA 2B37A 4WD3A 1Z74A 4YP9A 5AXBA 1S2MA 1K7SN 4PCLA 1PCXA 3P0FA 1E6KA 2FWAA 2QE7A 3ET5A 4EFNA 2HEGA 2YH2A 2RG1A 2FNAA 4ZREA 3WL6A 1QPBA 2XYVA 5CR9A 3H2BA 3EXIB 4FYMA 2AV6A 2YWRA 3JRXA 4H4CA 5AKGA 3NNNA 5DTQA 3QG1A 2O07A 1J99A 3M34A 1MX5A 3R0QA 5KNDH 3MF4A 1T3ZA 3KE9A 4J7AA 4XYMA 3PWZA 1RAIA 3PICA 3JAWB 1XK7A 3AERA 5BN5B 4CKEB 1KOLA 2B8TA 1TYEB 3EWNA 4QYWA 5KOHB 3W90A 3NAGA 4XA8A 4D82A 1JILA 1M10A 2CMGA 1LV8A 3GUCA 5ESWA 1PT8A 1D2MA 1KBOA 4CI9A 3MRTA 4MMYB 1KZ4A 2WHEA 1MXHA 1Y3HA 4ZVRA 5A5EA 3WV5A 1EFPB 2EU8A 5EJ9A 4JP1A 3X1KA 2WAAA 4F2WA 1SIOA 1TM5E 5E9WA 1REQA 3RW9A 3AR8A 1YS1X 2ID4A 2O1XA 3A6HA 2X8AA 1NBEA 3H4VA 1ABFA 4LMPA 4LOKA 1C3VA 4NF2A 4ITRC 3T5BA 4B4UA 4ALNA 3G9TA 5KJEA 1FUEA 2QYTA 3NHWA 5LBUA 1G38A 2CNLA 4ZODA 5JSZA 1EQ2A 1RM3A 1UJNA 3IB6A 2GJKA 3PE4A 1EEXB 4HRXA 4Z9FA 3EWSA 4BMSA 1VSVA 3LT1A 3HFSA 1OX4B 3MM4A 4R51A 5D85A 4RSHA 3FDZB 2DE0X 3FFXA 3I2YX 2XUFA 5FI3A 2R8XA 4WUVA 1YFKA 1BN7A 4WXYB 2BW0A 1Z2EA 3L84A 3LUFA 3P9CA 3VGPA 4TT8A 3SYKA 1EXVA 3EDCA 5BSKA 5GOZA 3CZPA 2WD7A 1ECFA 2PKCA 2B5OA 2QI9C 3L1JA 4RF2A 2HMYB 3EPLA 1C4XA 2VCHA 3AKDA 1U65A 3LT5A 4D46A 1KDVA 721PA 4UUQA 1W4ZA 1ISFA 5DVZA 1ICIA 2Y4NA 3C5WP 1FP4A 4GYWA 4A8PA 3BA6A 3DV2A 1NM5C 1QV6A 4DDTA 4MLCA 5FPTA 1TIBA 3CV3A 2OGTA 1NXTA 4I08A 2ZT6A 3EZFA 3RJ5A 4PONA 3SJ7A 1DPGA 3ZNQA 3F3KA 5BN3B 4QG7A 3FFBA 3AZQA 4CG3A 4EDFA 1CXZA 2YJ3A 3A4TA 2AFHE 3O84A 4GEKA 1EUZA 4FU0A 3ZE9A 4I4TB 3U44B 1YR3A 3SYLA 2MYTA 3V80A 3TN7A 1KJZA 2IS1A 2F64A 4GICA 1EEHA 1UK9A 4AO6A 1LTQA 3MB5A 1VXOA 3S44A 4EB6A 2JGIA 3QKIA 4D4MA 5D5QA 3O5AA 4BNLA 2WF5A 5JNWA 4IRMA 5TNXA 5CB4F 1G8FA 3KBOA 2GXAA 3EXIA 2JFPA 2JJ1A 4KH0A 4LI3X 1CLEA 3GFBA 4R8SA 4OQEA 1SQGA 3EVAA 3C14C 1LLDA 1RPZA 4BE9A 1E6LA 1E98A 1PZHA 4II2A 3I5AA 3OA2A 2C07A 5DHPA 5JCOC 4HX2A 4H7JA 5ENVA 4EX7A 3G9QA 5ALXA 4QTYA 1AZTA 2D0OB 4X6YA 1Z7BA 3PVZA 2ZG6A 4P4TA 2CLLB 3LK7A 2Y71A 4OHFA 2E4AA 4OSOA 2C61A 3SXPA 4B45A 2FUEA 1PT6A 4JLDA 5CX1A 4CM5A 3GD5A 5C34B 1C9DB 4XI9A 4CMJA 1J2EA 3ZY5A 2UVPB 3FSJX 5IBRA 2AXQA 1CFJA 1Z5WA 3A14A 3FTDA 3LUAA 5HUJA 2QLJA 5JV5A 5JMOA 4B40A 4L4SA 5C8ZA 4DLAA 4OL0A 4U1RA 5L8VA 4JYBA 4HB0A 3SC2A 1JT9A 1RBMA 4P33A 5AI0A 2Q46A 1A4UA 3W6ZA 2IF0A 2XVYA 3EGDA 1SCQA 3O1HB 3PK0A 3P4YA 1SJ9A 1X1TA 3O91A 3PE6A 4LZWA 3DVAB 2REXB 2DB3A 2E5WA 1KQNA 2JHAA 2H18A 1QQTA 4FYIA 4L5JA 1DXQA 4OG2A 3TLGB 4EB3A 4EYKA 2J3HA 4LG1A 2ERCA 1TTQB 4P4LA 4G9EA 4PXAA 4TUYA 2SCUA 2XMPA 1X7GA 4BIMA 3PFWO 4LK2A 4CTNA 5IC4A 2FPLA 3CR3C 5MN4A 1U7WA 1Y4SA 2UZ4A 3ADPA 2PNJA 5EC8A 5D87A 1JDZA 4W7HA 2GXUA 2O0JA 1FIUA 2YJ4A 2FHPA 4JZYA 5JCPA 5HKKD 3TVDA 1MVOA 3I0NA 3K8YA 4U3JA 3FCEA 4B6QA 5K99A 4TV9A 4QT4A 3TB4A 4RPLA 5LR6A 4X71A 4I4IA 2WF8A 5IWCA 1Y9ZA 2JGDA 3QY9A 1T2CA 2W58A 5E2AA 4U2EA 5L6MB 3TCKA 4GXNA 4M3NA 2J3IA 1SVIA 5ERGB 4V0NA 3R8FA 3ITKA 4K26A 5CNMA 3UA4A 2R84A 2WHXA 5D51S 5DNVA 1VPVA 5HCNA 1H2RS 2FUKA 1ETHA 3JQFC 3UJCA 5E95A 4OIFA 4XD2A 2B4TO 2ORYA 2QT1A 1QIJA 2B3TA 3UA3A 2F00A 4X7RA 1QGED 1ZMTA 2GH1A 2ZE6A 3H75A 4R2HA 1TGVA 4FOOA 2YXBA 4UBNA 4QUBA 2YWEA 2IL1A 4PHFA 3H2IA 1KC1A 2NO6A 4NFHA 4WACA 2VDWB 3OE7D 4PVDA 1IK6A 1JPJA 1QLJA 1D0VA 2X6TA 4L76A 4Y9UA 1T6NA 3RTGA 3WE7A 5A9SB 4GLOA 2JIOA 3FX2A 4AJ9A 3ZIUA 4XJVA 1ISIA 3IT0A 2QAJA 2RCNA 2VHTA 3EQ7A 1NULA 5LWHA 1TK2A 4PG6A 2E4XA 4M21A 3DFIA 1X7WB 5C4GB 2YJ5A 4B48A 1LQTA 3CINA 4QUKA 2ZQZA 4HN4B 3FZGA 1ZM2A 1TQ4A 1KSJA 5LZ7A 4FMCB 4LFBB 4NZPA 1G42A 1VYUA 5LA6B 1MQ9A 1IHUA 4OM8A 3ETGA 4YJDA 1PT5A 1GNPA 4IJ6A 4BYGA 2H48A 1SWWA 3B3AA 3DYIA 1XWWA 3GLFB 1H94A 1HT1E 1RJWA 2GYWA 3NV7A 1FP1D 1MTZA 1OC4A 2BBOA 2BF7A 4J1SA 1RQRA 1G7TA 3VZRA 3WQHA 3ZY6A 4Z2AA 1FXWA 4QBFA 2C2ZA 1QUFA 4NOLA 3MBKA 2GEJA 4LQCA 2HR1A 2CNBA 3HUEA 2Q5CA 4PC7A 1OLSA 2KS6A 3LBNA 1BVYF 1WEKA 4EW6A 3KSAC 4M1EA 2F3QA 2WVGA 1NR5A 2WHQA 4HDCA 1N34B 2O8NA 1YQQA 4B3TB 1VHLA 1Z06A 1VJGA 4TTAA 2ZRMA 4UD2A 3RKRA 4OJTA 1YT5A 4BFWA 2BGIA 2Q1XA 2QN1A 2F90A 5G1NA 1Z73A 1H8HD 3BGOS 4IWNA 4AJ1A 2CYCA 3NKFA 2VTKA 3ANSA 3JATB 4CCYA 4IL5A 2DTDA 3STTA 2BZ1A 5ESXA 1P1RA 4NR0A 4YCAA 4DSZA 1FTWA 2HHCA 4WKNA 3W5UA 3B1VA 3RHSA 1S2NA 3R3WA 1EGQA 3NDPA 4RVUA 3V8RA 3ZBQA 5EHXA 4MR7A 4WCFC 3TINA 4MK4A 4UU1A 3QWIA 2IEYA 2JANA 4JQSA 5F73A 4CHTA 4FGUA 3BD6A 2O3JA 2HNBA 1V4BA 1YASA 3KPJA 3KQYA 4QGAA 2XZTA 1O2DA 5JVDF 4BPBA 3K70C 2XUOA 3L6DA 3SY8A 5I48A 2QTVB 1NW6A 4H7HA 1VGRA 4UAJA 3ZX4A 1Q21A 4TT3D 5HSGA 5JEDA 4GZ5A 4PM4A 4PX3A 2BBSA 4WZBA 3WKEA 1JTVA 1UXHA 3IPXA 2OE2A 1ZUD1 3NHZA 4GXRA 1JDJA 2DTXA 2XOKA 3WLSA 4QSHA 3O1LA 1IIRA 1IY0A 3LIIA 1L4EA 1KEVA 1RXYA 3QX3A 1BNCA 4BQIA 2Q3MA 2EERA 4CQJA 1EJBA 4GH5A 5AKEA 4EJ2A 4Q9KA 2ASVA 1JEAA 3T5AA 2GPSA 3ZW7A 1XVAA 4JHXA 4BIIA 2P9EA 4Q9JA 2VSNA 1JMVA 4M9RA 3RSQA 2J85A 1A76A 1WXDA 1CY1A 3UJ8A 1E2LA 2AXEA 4R3UC 1IPFA 3KZOA 4JL8A 1B3BA 2FN7A 4RDXA 1U1CA 4MLPA 3KVRA 1PK7A 1A9TA 4AM8A 2RH5A 1N1GA 3U17A 4OVKA 3DYVA 3W77A 3NBZC 3W3ZB 4Q6WA 2HWYA 2W48A 3DZDA 1I14A 4IWYA 2Q5OA 2JG3A 2QN2A 5F3WB 5ICSA 1L7RA 3G0HA 2WDPA 4AMGA 4G5QA 5K6RA 2IH2A 4I50A 2ZBDA 4PICA 4C4RA 1NZJA 1WXEA 4HVCA 1D07A 2VLIA 1VCMA 3P2IA 5AUQA 3T52A 5IZCA 1JI0A 1DX6A 2WJHA 4LNAA 3VR4H 4BVEA 2FHSA 2O5CA 3B9QA 4BBAA 3ZVNA 4RVDA 1P19A 1J2RA 1L5QA 4IYRA 4BC0A 4NFLA 1QIIA 3AR5A 5AHRA 3EVNA 3K20A 3ZZ1A 1ZL0A 2LVBA 4P4SB 1I4OA 5D3MB 4QEKA 3N9IA 1MOQA 2WWGA 5BPHA 3O3NB 4C6SA 4CN9A 3GAZA 4QFBA 2YKGA 4TXLA 1X1RA 4AZ0A 3DNPA 3FGNA 2OV1A 3ENQA 1SBNE 3IOBA 3IUSA 2XJ4A 4C2AA 1PQ4A 4CFYA 4CKWB 2RDMA 1V37A 1YRBA 3N0XA 3NM4A 4KIWA 4QDUA 4WA7A 3H1BA 1A77A 1VRWA 5GY7A 4GOOD 2JD2A 4RC9A 5HKOA 3QE9Y 2FV8A 3C8ZA 4KO1S 2ZT8A 1X8JA 1Y48E 4JUFA 3MQ2A 4RHCA 1WULS 1DKRA 4FI3C 2XA9A 4DRXB 3TEMA 2IE0A 1KWGA 2V4ZA 1KIAA 4C3VA 1D1SA 2B1GA 2HWUA 1N3BA 1A9SA 1QGOA 1G98A 3KZXA 3LT2A 1B73A 3VNRA 1OGJA 1ZN8A 2ZJ2A 1D0SA 3CMMA 1YRQA 4LE1A 1I01A 4UTPA 3FAZA 1N5MA 2DMRA 3SMVA 1PTKA 1GGNA 1MC4A 2A59A 3E2MA 3MT0A 3MS4A 3VVCA 4I55B 2PXAA 4NP6A 3DDWA 3JWHA 3NRCA 1V47A 5DTIA 4R1MA 2O0HA 1XDGA 5LMZA 1SHUX 3QOXA 3LY5A 5KX5F 4QTZA 3C6YA 4XCXA 4PRZA 5HF6A 1QZXA 2WUVA 3HNRA 5LXTF 1W36C 2GRUA 3WGHA 3KZNA 1X9GA 3F6YA 2VTBA 3U1TA 3Q1KA 5JZMA 3RDPA 1N3YA 4M1OA 2WPNA 1KQPA 3BXEA 2YZGA 1EA5A 1G9TA 4M1QA 1CV2A 1ICEA 4RQAA 1V48A 5CX1B 2BTQA 3OESA 3TYXA 3ACBA 3KU1A 2XZOA 4HN2A 5F5NA 4WXPA 3TW8A 4G56A 4RHUA 1ZMRA 2QQEA 2CK3D 2PV0A 5FA8A 2IQIA 3E48A 4K1LA 4RNCA 1NP6A 1JG7A 2PQMA 1T8YA 3BAZA 2R00C 3DTTA 3H4IA 5J5VA 3I9LA 1OYVA 5CA0F 3DCYA 2H2FA 3DVLA 3C7CB 2XVAA 3EFBA 4DQUA 4MJ3A 1XTUA 3Q8XB 4YWHA 1NVXQ 3TZEA 3BXGA 2PH3A 3UB4A 2QTMA 2QG6A 1T6ZA 1I51A 2ZAOA 2JKVA 3OQBA 4OMFG 4NWIA 3T3GA 4EKYA 5IVPA 4XOIA 4YP0A 4W5OA 5A71A 2PYIA 2BWJA 3NCHA 2GZHA 2HFKA 4I1IA 3GRYA 5GIOE 3FTEA 3C5HA 1GAQA 4I36A 2CCKA 3R7LA 2ECQA 1MIHA 2CLFB 3BAFA 1V8PA 2C9DA 4X3OA 1GQ2A 4AZ0B 1LJLA 4P84A 2XMCA 1M6HA 2AW5A 3KJXA 2IPMA 1Z0IA 3MJVA 3ITNA 5LP6F 4ZOCA 5B12A 3KDSE 3QTTA 4J7UA 2J7PD 2GO1A 3SQDA 3T5TA 3C5VA 4D43A 4DG5A 3JZDA 4YUXA 3U7QB 2O8BB 4K28A 2WVHA 3ZVRA 3DZGA 4B3SB 3GQBB 1YJAA 3L05A 4BRWA 2CWDA 2B1QA 1HL7A 4CV1A 4R16A 2WFMA 4BO7A 5A0TA 1MJGM 5JJKA 4NBLA 2FMXA 4M0UA 4EG3A 1KPGA 4XKJA 2QD2A 5K7SA 1HPLA 2ECPA 2XNDD 5AI6A 4PG8A 3LK6A 2P91A 3E7PA 5J2TF 1GSHA 3UMFA 3C15C 1H0HA 4DPLA 1PJ2A 1WQ1R 2IBSA 3GW8A 4OKNA 4TMFA 2VAVA 2X13A 4IGEA 4OK6A 3CBGA 1DEOA 3JD1A 3NC1C 3MRXA 4R81A 4QO7A 4AB1A 3CNBA 4ND2A 3RJMA 4P34A 4BV8A 1AT1A 4U8HA 4WGFA 2V8OA 1PL6A 2ZBEA 4JROA 1LB1B 2AFRA 1AV6A 2NACA 4TQUS 3PNYA 5KQLA 4OH1A 4CDGA 5DYTA 2I2DA 3IPYA 1KRXA 3ILXA 1SXJA 5DCUA 4J94A 3QP9A 1EMDA 2R7AA 5KTYA 3RUHA 1T5IA 3BB3A 3M5WA 2V98A 4ITUA 4MW7A 4OOEA 3TL6A 3ZXUB 4ZMBA 5A9RA 2XCTB 5DGIA 3VSDA 4F04A 1GTSA 4UEJA 4RULA 3K31A 5T41A 5CGQB 2AMJA 5KS2A 1NFQA 1YGPA 4QDTA 4ZO7A 1O3YA 2OXIA 5TT0A 4KAJA 5D01A 4PC6A 2PKWA 3RS8A 3BERA 4FQ5A 3T35A 5C8XA 2ZUEA 1BTOA 4XB2A 2QN9A 3ZY2A 1ZONA 4ZEVA 4G2NA 5J5AA 2Y92A 4Z1MD 4C0KA 2EBUA 1ONSA 3E7XA 4H3VA 2VWQA 1N5IA 1X7YB 1YDGA 2WQZA 3ECCA 3SEFA 5FCDA 2ZR0A 2VO1A 4HFNA 1EM8A 4MV9A 2FDXA 4X8OA 2ACWA 2C3YA 2P1DA 3IQGX 4IF6A 2XODA 2EKQA 5EAIA 2HPAA 2GBFA 1QIFA 3JZAA 5LOVB 3OBIA 3OQIB 2PMCA 2HN9A 1EHIA 1PBNA 3RF6A 1NXWA 3MMXA 2W8BB 4ZVSA 1T36A 2H17A 3K1TA 1V6CA 3I5YA 1R1DA 2B92A 4OREX 3WBBA 1RI1A 1D4ZA 1G4HA 4O1IA 1FA9A 1JQDA 3ANNA 2VSFA 3FWYA 3I45A 3VC1A 3I1FA 4E21A 5I9SA 1NW8A 3CRVA 5KAMA 3TUJC 3V4LA 2ZE5A 1FJHA 1FMLA 2PSJA 1S3SA 4B09A 3U40A 4QVIA 2ICAA 1N2IA 3QX8A 1JZSA 2OCYC 2IHVA 5BOSA 5BT8A 1FW6A 4CM8A 2YW9A 1P74A 2DJ5A 1NW5A 2FB9A 5TGZA 3VBCA 3RWBA 5EMHA 3JAKB 4Q01A 4FGSA 1SB8A 1VHWA 3HBAA 3HEAA 1TUBA 2FW7A 2GPTA 4PTLA 3KXPA 3O0TA 2O2HA 4S1PA 5AM1A 3SDBA 4EELA 4R3NA 2GCOB 5KSZA 2YJGA 4X92A 1XHLA 1Y6GA 3NOVA 3F67A 2OYRA 2QX7A 2GQ0A 1TDJA 1P9RA 2P2GA 2QV0A 1M83A 3D2CA 3PYLA 3ROMA 2NV2B 5E7MA 5HK9A 5JNSA 1P45A 2ZJAA 4Q4AB 5KYWA 3I6MA 1A9OA 2YZ7A 5FOTA 1Y9DA 1YQWA 4JGBA 3OWHA 2WJ4A 4LOIA 2QL7A 1ULBA 4UCQA 3ONEA 1L1QA 3JQ7A 4LIPD 2D7CA 1AKNA 1X92A 1PQUA 3EGCA 4Z8XA 3T7AA 2FDRA 1BJKA 4CM1A 2O2SA 3SSMA 3E15A 3P9SA 4GMFA 2IWRA 6GPBA 5FOSA 2PUDA 2SECE 4O2BA 4WSOA 2JLVA 4R31A 2BKEA 1Z8NA 4IDEA 3AI1A 3WQSB 2QX6A 2REQA 2Q45A 4Y9SA 1XTJA 1SQ5A 4UC0A 3PVSA 5IPFA 3GRZA 4U2GA 5G0SA 1NN1A 1JDSA 3F5SA 4I1YA 4ZDKA 1T2FA 2HO5A 3EEOA 4UARA 3KT3A 3PFNA 1OW3B 1U81A 1XZQA 4KZKA 4Q02A 5B3KA 5EMJA 2WWRA 3PQ7A 3K0FA 4C87A 1Y8RB 4YJHB 2RK3A 1CEXA 2VP9A 3ELYA 2HSDA 3CWZA 3GLHA 3L3BA 1W0KA 3SLKA 4QJBA 2A14A 3GK3A 3RVSA 3Q5GA 3KXIA 1M1UA 3BCUA 1RQPA 2RHHA 3AONB 3A3KA 5H3CA 4PLGA 3A32A 2QAIA 3HSSA 1J2TA 1A8HA 1NI4A 1TLLA 4J0IA 3T38A 1Z62A 1EINA 2RGWA 5JAMA 2Y1CA 5L7WA 2O05A 2YXDA 3PWTA 2YWCA 3A7EA 4EY7A 4JWKA 4YGXB 4JIMA 1MUUA 4QUAA 2HBZA 4JGGA 3T1NA 5JI2E 1LBEA 5KEIA 2Q1SA 2O3UA 3E0XA 3KQLA 4PX2A 4K81B 3TLBA 1G8PA 1IN7A 1G7SA 1XD8A 4BUCA 2JC3A 4FX2A 3RCBA 4CHGA 3A4IA 4PN3A 5IAGA 3JQPA 3FNBA 4FOPA 4F4IA 2B8WA 2NUTA 1JU4A 4J29A 4D3XA 1ZISA 2WYIA 2F3TA 3OTGA 2B5WA 3HV0A 2DUWA 2YXLA 2NO4A 4U5QA 5K1ZA 5HIIA 5EE0A 1G16A 1HORA 1MORA 2YHSA 1G8GA 3PQCA 3FETA 1ADCA 5FBQB 2NU9B 3FUVA 3H04A 4P3XA 1C9YA 5L45A 2IEDA 2ENWA 1QBGA 5A5GA 1PJCA 3PHBE 2XUHA 3F6RA 4J0QA 4CVNA 2V5AA 1XCBA 1KPIA 2XQGA 3NIFB 4RM3A 1PGOA 4FW9A 4ECAA 4LWZA 5EP3A 3LU1A 1K86A 1A7KA 3KQWA 1N9GA 5ANRB 2PGJA 3T99A 1VL0A 4BJ1A 3OD5A 5FT9A 1DFIA 1UBJS 3M3HA 2XMSA 3H9EO 5KHAA 5TGTA 5EMLA 3RF7A 5LU9A 1QR2A 1OT5A 3JQ9A 1QF9A 1UJ5A 2GFIA 3HA2A 3IT2A 2EZ9A 1OCEA 2J0VA 4YRKA 1OXVA 2HA4A 1EDBA 4WLFA 1AUXA 4F0JA 3ESDA 4BQQA 2HMAA 1SU4A 2YHIA 3CJRA 3I64A 3FPBA 3K0EA 1D2AA 3HKBB 2W6ZA 2P62A 1CHDA 1GLVA 1H23A 3BVPA 1EWQA 4W63A 1JIIA 2MIIA 4IG4A 4TV8F 4YROA 1RKBA 4LW8A 2SNIE 1LJ8A 3A1WA 1T9HA 2PX0A 2WD9A 2XQVA 2YRWA 3HRKA 4ZK6A 5H9VA 3DZBA 3IVXA 3JS5A 3RVKA 2R6ZA 4QDKA 2ABWA 4CEHB 1EFVB 3E9RA 3HFGA 4PNHA 5IM4F 3OX1A 4E5DA 4KN8A 4GD3Q 3IJEB 2ONZA 1AXGA 2HSZA 5C8YA 4EYSA 3I2KA 2FPRA 3RGGA 2HQOA 2QVBA 4R1UA 3ZZ0A 1I2AA 4US1R 1ISGA 4NZZA 4P5PA 3WY9A 3V00A 1WUIS 3EGOA 1VCIA 2NADA 1EGHA 2F1HA 2KBEA 3NBXX 2O3RA 3OP1A 5CLLA 5ER6A 1PO7A 5AK5A 3SZ3A 4B79A 4OO3A 4B73A 4D98A 2FG6C 5JVDA 4S04A 2QTNA 4QG3A 4GQIA 1JZQA 3SSOA 2IGTA 9ABPA 3J81A 5EINA 1V8ZA 2FFAA 1E5DA 3WQQA 5C46F 3K71B 1HR0B 1XTTA 2HHHB 5DHFA 2FPKA 2V6GA 2V9PA 4W8HA 1NDUA 4YAUA 2R2GA 2J4CA 2X42A 1Z7YA 3FPEA 1DJNA 2YFKA 1KJWA 3JQAD 2YV1A 5E2BA 3R9IA 4IKPA 3X1MA 4J75A 4BO2A 4AG6A 1CFZA 1OZFA 1DKOA 5CG1A 2JGRA 4MROA 3V1MA 1CR2A 3CQ9A 5BV8A 1ZH2A 1NXSA 4IJWA 1GPDG 2QN8A 4KR6A 1ZWLA 1J0CA 3R0XA 5KVCA 3LKVA 4Y9RA 1JF8A 4GZ3A 3UO8B 1CJUC 3WLIA 3IOCA 5B3AA 5C3UA 3VU8A 4CR6A 1DTWA 1BOFA 1PYGA 4DR5B 4ZT4A 1E5XA 1ZD2P 3HGTA 4URYR 4PANA 1FYWA 4JUDX 1WXGA 5FP0A 4O4JB 4XX0A 4KNYA 1SQFA 3AI2A 3FAKA 3DMDA 5FX2A 5L6LB 1OVMA 1LY1A 2D5BA 1A5SB 2IEAA 2IW1A 4YAFA 5HMLA 3RUPA 4A0GA 3D4NA 5B1EA 1Z47A 3KAKA 3U0VA 2N1MA 2PJDA 1H4VB 1TQHA 3BE8A 1JJAA 6ABPA 1Q12A 4DQKA 4PXYA 2QUHA 1CERA 1XXHB 2GJAA 1PS8A 1Q3HA 1XA3A 3PD7A 3RI3A 4F3CA 2QPTA 3IAHA 5JS8A 2D0DA 2I33A 3PJGA 1I0ZA 5JS2A 1TNDA 3C41J 3T3IA 5CEJA 1EFRD 4OMDA 2ZDGA 2JJ8A 1ZSNA 3VI4B 5BW6B 4HH0A 4K6GA 4TVSA 1XUOA 4CI0B 1M8FA 1ZJWA 4IV5A 2EJCA 2ZOSA 3CZ5A 2GYUA 4RPHA 1RWQA 4C03A 5HE8A 5CLFA 2ZVPX 4YDQA 3ZXSA 3EUWA 3K73O 5JYDA 4F4CA 1ZD5A 3DVAA 1Z2AA 3B7GA 3UTCA 1DDGA 2IDZA 2EWVA 2WU8A 3CSSA 1ODLA 4M7RA 5CFOA 3R9XA 3C6XA 5IKXA 4F96A 3V1NA 3UAVA 1W4CA 3HA3A 3ZDXB 5HQ3B 1P4RA 4KUHA 3ND8A 3E4DA 1F9EA 5TQ0B 2F1IA 4RH3A 2UZAA 3Q9UA 1GA6A 3T3NA 1EVIA 1PJBA 1RYYA 1U4OA 3GVXA 2BLNA 2G6TA 3A4NA 3UAOA 4P35A 2Q9BA 2VUTA 2QGNA 3R41A 3AF5A 4NMWA 4P9NA 3FDXA 1TCAA 3WGIA 2AYYA 2C2OA 5B57C 2H3EA 1QHEA 4DR1B 4MB6A 3K96A 1A1VA 1MX3A 4RY8A 1TAQA 4BN0A 2NG1A 1LV7A 3U1BA 1SG9A 2YVUA 2OBMA 2JI8A 4L8VA 3OFNA 1GXSB 4RADA 2FR8A 2W90A 2N42A 2F9LA 3HYNA 4CMGA 1SBTA 3F7OA 5CDFA 1F0KA 2Q0SA 2DH5A 3BZUA 1MB3A 3WMWA 4CG2A 2YRXA 4J6EA 4HPWA 3UT5B 4LAFA 4UJ5A 2BGKA 4N8EA 3A4YA 1H0SA 3IT1A 2Z6UA 4OXYA 5EJAA 3CSUA 1QYDA 4C7BA 2X8LA 1BVHA 5AHKA 1FNBA 2YHUA 1Y9JA 3CZAA 3LZ6A 3PNMA 4LOAA 4V1CB 5HRAA 5A3VA 3WYAA 4MQ6A 1PYOA 4J16C 5AK4A 2RK4A 2Y2UA 3RD5A 3T41A 3VSCA 2ZXEA 5JZSA 4KP7A 4UPEA 3U3DA 4BJ3A 2JH8A 2HMTA 4LC1A 2O8CB 1RWXA 4HDNB 1ZNYA 2XPCA 2ENUA 3L6UA 1N78A 3FBGA 2QGFA 2ZT5A 5FOXA 4YEDA 4AUKA 3E23A 5CTJA 3VOBA 4JBYA 1E2GA 3LYAA 4OHCA 1YE8A 2ZBVA 2GCNA 5JY1A 3NXSA 4ZYVA 3TCNA 4COKA 1JEJA 2XGSA 3AHJA 4L9SA 4V0MA 4YWJA 2OCAA 4IHQA 1NJFA 1HI9A 3CEAA 3DOOA 1I8TA 1GZVA 3DUFA 3ZD8A 3DW3X 5JZOA 1YVEI 1B43A 5IWAB 2XD9A 2K7ZA 5JRDS 5FUXA 1ILWA 5B1YA 5DM70 1YS9A 2QZSA 3CN9A 3OEHA 3TWOA 1Q19A 1Y8ZA 2FN4A 2VPZA 3PNKA 3F4KA 2UYQA 3NEPX 1WXIA 1M2FA 4HGRA 3RUEA 1ZYUA 3HYTA 3HJTA 3OI7A 1JVBA 4BAUA 1DIRA 5EWLB 1U98A 2A5DA 3C48A 2VJQA 4NTZA 4RFSB 2VDVE 2OHHA 3ESRA 1XCOA 2R5WA 2IBTA 4E94A 1XNQB 2B94A 3RB8A 3E05A 4Y0NA 5L3SB 1H6DA 2Q3DA 3VA7A 3FJYA 3HS3A 1XX6A 4KFUA 4CG0A 1S7CA 3VC3A 1G5RA 2JFWA 5T67A 5FBVB 3C5CA 1CDZA 2LBPA 1DX4A 1J5XA 3CONA 2OHJA 1V7QA 4D9FA 3V3TA 3FCUB 3BKWA 1JNXX 2GR9A 4PFSA 3AYXB 1U7TA 3PC7A 3ZUPA 1IXKA 2ZVJA 4GZ6A 2H3HA 4P92A 5CFPA 3QV1A 2PKEA 1MEEA 1N0UA 3R5FA 2EQAA 5AM3A 2OXCA 5REQA 3AVPA 1UZUA 1TIKA 4JOSA 2A1UB 1UWVA 4L02A 5K3BA 1LI7A 1NP7A 3IURA 3B53X 4H6VA 4E03A 4EHDA 1T1RA 2AJ8A 4ER5A 4WOCA 3KVNA 2PKYX 1CQPA 1OZ0A 3AL2A 4H7IA 1UP6A 2E87A 4G86A 2GDJA 1EYZA 1E2QA 4QJ4A 5DGDA 2J67A 3HBNA 3IP8A 1C1XB 3OBBA 5AUNB 3N2GA 5KVVA 4IDNA 2P5SA 4J0FA 1TTTA 3IIJA 1M7GA 2PT7A 1KETA 3QUAA 3HU5A 5BY2A 3ZKAA 2DVMA 5FWYA 2QJWA 3PHGA 4KZPA 2H2DA 5EA2A 4I6GA 4A10A 5GV7A 3GT4A 2QJTA 2OHXA 4ROSA 4AKTA 1Q20A 4FT2A 1XEAA 3TLGA 1E1LA 1Z25A 3RU7A 4FHCA 4O3MA 2ZIAA 3FVVA 4ZQBA 2NAFA 2RJNA 1JHQA 3U3OA 3NTVA 4KBGA 3JQBA 1ORHA 1F0YA 2ZI6A 2IPLA 2H9YA 2I2FA 3LHFA 5FAXA 3SQLA 2EOAA 2JAPA 4EY6A 1Z0DA 3HYCA 2H11A 1GUAA 1WP9A 4LHWA 4MQFA 3SC4A 1AGNA 3MIIA 4WLNA 3QWHA 1O95D 3NHJA 2Z5GA 4B83A 1B6SA 4I4TA 4DC0A 2YJZA 1UPXA 3CRRA 4MGEA 1BH6A 1SA0B 2FP4B 2MR6A 1GSAA 3OOWA 5E7IA 5EUCA 1NYRA 2AGVA 2RGUA 3KYDA 4NNOA 4RD2A 5F7JA 4AECA 2R2AA 3P19A 5ELLA 4D57A 3JZIA 5AD1A 4R2XA 6REQB 5JMWA 6Q21A 3DKVA 1F5SA 2MYPA 1KRWA 3NS7A 4MJ7A 3TSWA 4N76A 1X1AA 4LDZA 3GU3A 4D0SA 2WPDD 1O6CA 2QK4A 4KH1A 4OHUA 1MR3F 5CYOA 2IC5A 2Z09A 3KJFA 5DBHX 5DGTA 4CKZA 4XR9A 1X77A 3K30A 2O7RA 1GM5A 1W2WB 2QQ5A 3BHJA 4CMEA 1V4NA 2H92A 3KETA 2GA9A 1E1QD 2G0AA 1XQYA 2DM6A 2OFOA 3BYZA 1YACA 4Q37A 2IDJA 4R6WA 4URXR 4PLFA 2FN3A 5KQPA 3D8TA 2WKRA 4JKOA 3NV9A 4HEA1 2VPXA 2WC1A 4B87A 4UXIA 1QS0A 3KKLA 4HXGA 3HI4A 4A2WA 1GFIA 3SF8B 2AC4A 1KYYA 2GN0A 4PLHA 2EKBA 4F72A 5HWSA 5KC8A 3BCHA 1PFKA 1E2NA 3R3SA 1BFUA 3A70A 5IH7A 1M2EA 1UK6A 4QNMA 1K98A 3GGDA 2YOGA 4DUZB 3IIMA 1TD9A 3DXYA 1NUUA 3GGOA 2C3PA 3K8OE 1UXJA 4ZGBA 3IA2A 2OUIA 4N5DA 4C43A 1SY7A 4NK5A 2IUYA 2PBRA 2CXNA 3OPYI 3NOXA 1OAAA 2ADFA 2XDQA 3WGMA 3I9V1 2D2IA 3PLNA 3DTVA 4V0ME 3R7NA 2GHIA 4X3CA 3RIEA 3ZWAA 4ZPJA 5JCJD 3QVVA 1P2DA 1J07A 4AULA 3OQNA 3WWEA 2RJ3A 3LKBA 1RS0A 2A7XA 4PX5A 4TPKA 1PL0A 4CMCA 3NTQA 2W98A 4OQFA 4MHOA 1HETA 4CKEA 4DR7B 3QKTA 1UFOA 1P91A 1XAHA 3EDYA 3SHOA 4V2IA 4ZVNA 3TD2A 4HWRA 1E58A 3V6MA 2GNPA 2CLCX 3U4AA 2EWMA 2OHGA 4K9MA 1XEXA 3LDAA 4ZOEA 4BNFA 4ENSA 1NPDA 2NQ8A 2P4UA 3ZCTA 4BN4A 4YJ3B 5AVZA 4LTNA 4KXFB 1FDOA 1T0HB 3IEIA 3T5CA 1Z4JA 2Y6VA 4YCBA 2C31A 4TRJA 3BTOA 3U7JA 3X3HA 2CL7X 2FQ1A 2BV3A 3IOEA 1CUSA 4EHNA 1XP5A 2ZIWB 4W5HA 4YJGA 1LRLA 3JATA 4E2XA 2C78A 3PX3A 2C4WA 1SKAA 1MPXA 1L8OA 4GGMX 2PGNA 5DHAA 3ZYCA 4UNNA 5HF5A 3EFOA 2AUMA 4ONEA 4UAGA 4UNRA 5AW3A 4Y1RB 5FLEX 5LKAA 5ULLA 4IH4A 1DQYA 1RTKA 1U1EA 4LYYA 3W5VA 5KO2A 4UMFA 3OPQA 1D5WA 1KYZA 5LBIA 2CMDA 3KEQA 4LZNA 2VT2A 4RJIA 3A2NA 1VL2A 3A6JA 1PZNA 4P98A 2ZEJA 5LLSA 4BO4A 1PSDA 1PS9A 2ODAA 3P2EA 1C0PA 2JGMA 3PPXA 2NT3A 4MRPA 2QTVA 3E35A 3ULKA 2HJRA 4KMRA 2YZMA 1N25A 5HK8A 4QXMA 2D8MA 3OAAD 5FFNA 3M6VA 4WXMA 5KYWB 2FPSA 4JVNA 1AURA 3FVRA 3GFRA 3ZQKA 4YONB 2QRNA 1G3UA 4FGWA 5AR1A 4E5YA 1WPQA 3VO8A 1DBSA 1UOQA 1VA4A 1JDTA 3T34A 4HVAA 5G0TA 2GKOA 3TQOA 1FLAA 1MAAA 1O89A 1GV0A 2G08A 4IDQA 3P27A 4QRHA 3MRVA 1NBMD 3A36A 1U6IA 5FBWB 5BSRA 1CUWA 4L8GA 3TSCA 4KYUA 1UBMS 2HXGA 2ZBGA 4LJ4A 3TPZA 4HNVA 5JS7A 3F2IA 5ARDA 4IZIA 5TX7A 1TYCA 3KUUA 3AEQB 1NF9A 3ZDEA 4E11A 3C1UA 3KM0A 4I5DA 3TIVA 3KD3A 1JH8A 4EWLA 4TL7A 3OCYA 1ZO8A 5HJ5A 1JJ7A 1RAFA 1FYDA 2C5AA 2PKQO 1ZC4A 3G82C 4JVMA 4RKEA 4WLVA 1M6NA 1SHKA 2NUBA 5EG5A 1G2PA 1QIKA 3KALA 3LQ4A 4QBGB 3CNNA 3IB3A 1O0SA 1W76A 1Z56C 4HBZA 4WKOA 2FOLA 4UULA 1A8PA 4MUHA 4EW1A 2DPXA 3UUFA 3A1DA 2J3EA 3NASA 4EYOA 2GZDA 1CNEA 5EIAA 4CIDA 3U61B 3UIEA 1F06A 5ALEA 1RM4A 2QAGC 1DAKA 1Z6YA 3LCRA 3D6MA 1I33A 1TC2A 3GEPA 3MLBA 4PLTA 5GOTA 3IEMA 1F0PA 1EWTA 5CIWA 3EF1A 4BRUA 1H05A 3GYGA 3NORA 2C9BA 3N0VA 1M8PA 2A67A 5F5LA 1CUVA 2KLBA 4N5HX 1H1LB 4RXTA 4JJKA 1KMHB 5B5SA 4HKTA 1EXDA 1AGRA 3H2JA 2AUTA 1NN5A 3N58A 2TMYA 4HNAB 2JLQA 4L9AA 3AP1A 4MGZR 4O33A 3QW2A 4MUMA 2WJIA 1J06A 1SUFA 4PSVA 5I45A 1A8SA 1U8UA 1ZK0A 5E7JA 4DYHA 2J41A 1JA0A 3COYA 4KNVA 4XYGA 3HNPA 1TAUA 1M6WA 1P4HA 1U3CA 3BXFA 2HU8A 5BQOA 5EWMB 3FFTA 2JFZA 1ZM7A 2VCEA 2XZDA 3LC2O 4KCGA 1I4DD 2UUAB 5CVJA 3H1PA 3H8WA 3PI7A 4F3TA 4WN9B 3ZJYA 3LZDA 1VJDA 4HEJA 2R6AA 3H18A 1NQUA 4LFCB 4R84A 1H8EA 3PC3A 1F5NA 1U5CA 4EF4A 1IQPA 3OFKA 5FL7A 4CJXA 1OLXA 5CT9A 4GZMA 5GM2A 1YS4A 1JAYA 4IIJF 2UZ0A 1DWPA 1XCLA 1VHJA 4TKVB 3MJCA 4F5DA 1J5PA 3SEAA 3VDRA 3HBJA 4TV9B 2LV8A 4HDAA 5ALZA 1WBJB 4MB0A 1NNLA 1UFQA 3P97A 2I2AA 4CNQA 3HVKA 3IAS1 1B15A 2YWHA 3SN6A 4EZBA 4ISCA 1SUBA 1PJAA 1YR9A 121PA 4BO8A 5JRZA 5E3HA 2WJZB 4FKBA 1AF4A 3NMUF 3BIFA 1J90A 3LW7A 3SEQA 5AM5A 4GLBA 4MS1B 3R7FA 4Q7MB 1XPJA 4GNKA 3A1TA 1OB5A 1S5PA 3TD9A 3W3AD 5FTLA 2AN4A 3OKPA 4RHEA 3UOAB 2VJLA 3U26A 1IWOA 3MJ4A 5K4HA 2EJBA 3JQAB 1TD1A 1USIA 4MKHA 2O8DB 1ZNZA 1TIPA 1GRCA 3AY7A 4CTKA 3F97A 2QR5A 2Z8YA 4CCWA 4U02A 2FUCA 1LW7A 2ZXFA 3H6HA 3DWFA 1R0KA 2UXCB 1ZS9A 1YQDA 1OTHA 2QQGA 4D0NA 4ND8A 1CJCA 5K0ZA 3G0BA 1C1DA 4I1RA 4NJEA 4RIGA 5EEHA 1XTQA 3ND7A 3LP5A 3EIEA 5IAKA 1KDPA 5KNCA 4KBYA 3EXG2 5AK6A 3UATA 5HQTA 2AEMA 1L7NA 3C97A 3JQ7B 1NSFA 4KLRA 1JKXA 4K6FA 1OI4A 1ZLXA 1UDWA 4UVHA 1G8AA 3NVAA 3LC1O 1GQOA 5EHQA 4RV4A 2WFLA 1SXHA 1YAJA 1NVKA 3PPIA 1NURA 1U94A 5FTWA 4AP9A 1RYDA 2V4UA 2LWIA 2ZR7A 3I37X 1TZJA 2J31A 3OZBA 1NMZA 1UP7A 4DSTA 4FCTA 1QONA 4AJLA 2H54A 4AQDA 3KQUA 2WP8J 4RHYA 4CKBA 2DULA 4NLLA 2OORC 1NKVA 4MAFA 4HNTA 1KTVA 2VJMB 6REQA 4YRSA 1M1YB 4K0RA 3E81A 1WKBA 1Z82A 5D2CA 3ADKA 2QVXX 4EA6A 5LPNA 1DLJA 2E48A 3N6RA 2G72A 2QRZA 1PNTA 3Q41A 5LOVF 3WIEA 2Z98A 2C20A 2EKPA 4LBYA 4AC9A 3K05A 5A62A 3C16C 3ZS9A 4PZLA 3S2ZA 4M83A 3DV0A 3EIFA 3C3BA 1JECA 2FLWA 1ND6A 2DG2A 4IKOA 3ED5A 5LQMA 4QULA 5J40A 3TI9A 4FYWA 4EHLA 1MEJA 3AP2A 1ZMBA 3WNVA 5B4VA 3UG6A 1EBUA 2GFHA 3S8EA 2P2YA 1EK1A 3C24A 3KYCB 4M0FA 2GF2A 4HRYA 4PLPA 3IKJA 3LD9A 4GLFA 2EJTA 3UJDA 4B31A 1RQLA 1Q44A 3CKKA 4C01A 1AF7A 4XEUA 4MIOA 5AKZA 2GYVA 3MQ4A 3RRNA 3BJZA 4GIBA 4U2DA 4Z0NA 5TF0A 3I3SR 4DSNA 5AOVA 3HXPA 5KDOA 5H59A 5KWIA 1ELOA 3GJZA 3N39C 5EIBC 4AZWA 3IUNA 4U63A 2Z57A 2VDLB 4HQLA 1M7BA 1XKQA 2JH3A 2VYVD 5EKTA 2GARA 3DH0A 3S4YA 5HW0A 1E7MA 4RPIA 4GC9A 3H1GA 3U7GA 2IT1A 4OX9B 3GLGB 1U0HC 1V5WA 4UJ3A 5BYJA 4YUVA 4TYNA 4JQZA 4G5SA 1R8SA 1W581 3AJAA 4V3CA 1D0IA 1PSZA 1XV5A 2QYSA 2V7EA 4CU2A 2NQTA 4AUEA 4FGZA 4UHJA 3D8SA 4C4TA 1FUKA 1Z8DA 3GNQA 5LP6A 4KDRA 4JX8A 3G6KA 4BGVA 2J9ZB 1D4FA 2MMCA 2J9GA 2QW0X 2RHLA 1N7IA 4PGGA 4Q3BA 5BWNA 1Q57A 3RYTC 1Y4ZA 3OCXA 1CUJA 1NRWA 1PQYA 1Z88A 4H0NA 5E6UB 5GTDA 3OEEA 4OXNA 3TNLA 1ZBDA 5JCXA 1AKEA 5DTMA 1KK2A 4UCFA 4BMPB 1T1EA 1JBKA 3D6TB 2CVFA 4NECA 2BP7B 4UBLA 4DY6A 3FMIA 1K7CA 2R1VB 1PX2A 3AIOA 1UFRA 2XBUA 1QK5A 1TVMA 4RIEA 3C5EA 1TCBA 4MIYA 4YFYA 4JA0A 5BRNA 4Q4DA 2EX1A 2AF3C 2WG0A 3F5FA 1YMQA 4JJGA 1SO8A 3JD3A 4U7WA 1MC1A 4RSGA 4EVQA 3K16A 3AWDA 3MS2A 3UNXA 5HIAA 3F3SA 1M5RA 1YKSA 3SFTA 3RIXA 3KE8A 3O1JC 1BU5A 4ARSA 5DSXA 2Q5JA 3LWNA 2NUAA 3DJFA 3VNSA 1FJXA 2C2MA 5D84A 2I54A 2IZOA 1KQOA 1E3WB 5EYPB 5AQ1A 1F2VA 5EHZA 1CIPA 3MOSA 4C6TA 4D6XA 1T15A 3LOQA 3T1VA 4YAGA 5EEGA 4W9MC 4J03A 4ZOBA 1BQ4A 1L5KA 2OOSA 3IDSA 4U7JA 4I5EA 4NKRA 3FNFA 4URWR 4R7GA 5E6RB 2H1IA 4UOEA 2NPIA 1NT4A 3REQA 1CNMA 1Y82A 4R41A 1W4AA 2F8LA 3BDAA 3NBUA 1MAUA 1UXGA 2CXSA 4N82A 4BJ5A 1USVA 3AGQA 5F35A 1E7SA 4A15A 4GPEA 2ZRDA 1LLCA 1USKA 2D1SA 3L0ZA 3CUWA 1FFXA 4MR9A 3P2OA 4YTEA 4HZUB 4AO7A 3DE2X 1WCYA 3VJKA 5EFOA 4BFSA 4Q93A 4RSMA 5JDCA 5ALPA 1R0BA 2QX8A 4K9NA 5I9BA 3H86A 4Y6GB 1JR4A 1BYUA 5GVRA 4DV7B 4NBKA 1VC2A 3C7TA 4NOJA 2F9MA 3KB1A 2CSXA 2FF7A 3FXAA 4IKEA 4RY9A 2SKEA 1X87A 1FRQA 3KL4A 4F85A 5C35A 1QVAA 2BSXA 3BS4A 4GU5A 4JENA 3Q5DA 1DE0A 5PGMA 5BR4A 1GCUA 2PX2A 4K9SA 4M53A 1A95A 4DNFA 1YUMA 5C8VA 2O3TA 1D09A 1K6IA 3GDWA 2CE7A 3FNEA 1W5SA 1P9OA 4KDCA 5KINB 4LY3A 3BEOA 1KZ1A 2OFXA 1F48A 3BG5A 2HLHA 3EPPA 3OVMA 3KP1A 3SBXA 3UM9A 2RHOA 5IN5A 2HIAA 4YRFA 5LXTB 3PNLA 3TTWA 4TXNA 3HUUA 2E4UA 3V2GA 4B6FA 1F2UB 2WWFA 2O1EA 4R2JA 2LXNA 5ERYA 2GF0A 3JVVA 3THYA 2LDXA 3MBIA 4BX0A 4DSOA 4IAOA 4WA8A 2XVXA 4AS3A 4M54A 1ZZGA 1QNFA 2JIPA 2ECOA 3A9TA 1GNVA 4G67A 1F6BA 1BD3A 1U5AA 4IIUA 5K6TA 4DXDA 4F56A 3ORRA 3OD1A 3CRQA 4NAVA 2GZRA 2FW6A 4D4KA 3LH5A 4I99A 4JC0A 2NLOA 5H9WA 4XM1A 1L5WA 2C2BA 1Z2NX 2FQQA 3HJAA 1QG4A 3MWFA 4DMLA 1WPRA 4JJIA 2OKGA 3GZ4A 5JQGB 3HXLA 3JWEA 3TAXA 5KWVA 1WDLA 2JIQA 5FDFA 5G0UA 2YIDA 4OU5A 4BQEA 5A6SA 1TEHA 2Z1NA 4WZAA 4DG9A 1ENOA 1AKVA 2IXTA 1Z18A 2WHRA 4K0KB 1HDEA 1E4OA 2V6JA 3TQTA 2CJWA 4X85A 2R65A 4IVRA 1PX0A 3QBDA 4GECA 4D4HA 2FSGA 2NZUG 2YV4A 3HP4A 3KLOA 4F6CA 5FUQA 5BV2P 5G4LA 2QL6A 1X94A 4ZPXA 4QU9A 4RACA 2DKOA 5AI4A 1YZQA 2UAGA 4GOJA 4HRVA 3WIVA 1NXPA 3A9RA 4AD8A 2J9RA 2H2HA 4I2NA 5AM0A 3FDZA 1OZGA 1M73E 1SC1A 3IOYA 4TTIA 2NV6A 4DB2A 4P3KA 2D5CA 1ZNWA 2EKDA 3EA4A 3C3XA 2BM1A 3K2EA 3W2IA 2ZSFA 4PIMA 1Y8CA 3EXEB 4X64B 3DP7A 3C8UA 3QVGB 3MTIA 4M0PA 4WH0A 3FYUB 5FQNA 2GBCA 4Q4CA 1KS2A 3AJ8A 4K46A 4DMCA 2FWNA 1HM5A 1REQB 2X76A 3LDGA 1NW9B 1IDN1 4KXYA 2OV2A 4LYGA 5AO9A 4BTVA 5DN6A 4EY5A 4AMBA 4Y2QA 1RXCA 3LFUA 2Z6QA 2OXFA 2C7VA 4JLSA 2D5AA 4XWYA 4HGOA 3LVRE 4ES6A 2I76A 3LUDA 3JV7A 2FCAA 3S99A 4CM9A 1MP0A 1U0NA 2CLMB 1TA0A 4L4RA 1UDRA 3JTMA 2YV2A 2WWYA 4Y2PA 1J8VA 1DX9A 4Z9AA 1PRYA 1RQXA 1I36A 1B16A 1S9HA 3D6VA 3L0DA 3LO5A 3NP7A 1IN1A 1BQEA 4KMOA 3AC0A 5LD2C 1FRZA 1PTJA 2P3QA 5T3UA 5HOQA 3CGGA 1ZIYA 3DAOA 4BOYA 4C4OA 5DGHA 3AW8A 4O5OA 3P2JA 2FI1A 3TRDA 5K6AC 2PR2A 2HNKA 1NIJA 2K5UA 5CDSA 5D7NA 1L7MA 2Q5EA 5EKDA 4BASA 3KR2A 2HYDA 3H1AA 1JVNA 5IHPA 4XJTA 1OAOA 2HADA 2HWKA 4EHIA 4PVCA 5LM3A 1BN6A 2Z9DA 3G7SA 4AMZA 4REMA 4BVKA 2P0EA 2IUEA 2X9LA 1FXWF 2ZBFA 1DAPA 1YJCA 3EY4A 3IKVA 3QPDA 4HAWA 3O8QA 3TIIA 5JVDB 4EI7A 1XR3A 1YB7A 1C8KA 5HTKA 3W1VA 2GLUA 2OTCA 3E1KA 1U11A 3GZNA 3DZJA 1Y5NA 3IDFA 4YRBA 1H6CA 3LCMA 1Z5ZA 1C3LA 1ZI9A 4G5XA 1R88A 1Z07A 5ESRA 5AW8A 1RZRD 2MTBA 4DLSA 4TN5A 5CXSA 1EE1A 3V7WA 3SD7A 3E8SA 3DLIA 2PY6A 1JU9A 2QZZA 3KYBA 4UBOA 1YDHA 1Z4QA 3CEHA 4W82A 4QIHA 3MERA 2CLKB 2IA5A 3PFBA 4JJFA 1GHTA 2FPGB 5ARBA 2IS2A 2O0MA 3IELA 3O03A 4L0QA 3AY6A 4X41A 1U0SY 4ZI2A 1HG1A 5BV1A 4HD8A 1S8OA 2F17A 2XMGA 3QF7A 4MWOA 4XX1A 3REGA 4G5GA 5JJBA 2G9RA 2X5XA 3WV4A 4CTMA 5BRAA 4IUBS 4IS3A 3IX7A 2ES4A 1IFXA 2ZBQA 4MRAA 1F1BA 3GLRA 1HNXB 3P7MA 3K9HA 4JI3B 1DAHA 2RAUA 5EWJB 5C1PA 1G8YA 3ENZA 2BMEA 4HH3C 4LWQA 3COSA 2I7VA 2YS7A 4WRRA 4Q1CA 4OSEA 4TMYA 1FTNA 5IZCC 6NULA 1ZI8A 3PEUA 2X15A 4US2R 3W7AA 4XIGS 2C94A 4IVPA 4MUXA 1DFHA 4JLNA 4HJXA 3T06B 4E5KA 3FUXA 4JL5A 4ABTA 4AS2A 1T9KA 2CXTA 3NBYC 5BSMA 3A8TA 3TCXB 5TC4A 2H4XA 4M7OA 2AR9A 1L4GA 4BO1A 4ZQEA 2VDQB 2VJAA 1E18A 3FDIA 3JW8A 2JGEA 2PGIA 1IOVA 1N6LA 4WK0B 4Z9YA 3X1ZA 5G2OA 4Y1GA 1TLFA 1KFEB 2W6JD 2WF9A 1SKYB 3WG9A 1NBOA 1GPWB 2QS9A 4D42A 1EGAA 4MHSA 4G85A 3Q8WA 2F3PA 2QOEA 4TKUA 1VB3A 1GTRA 2IUFA 4NSNA 4KMSA 2B20A 5BR7A 3CLUC 4S1NA 3GT3A 3ZV7A 2FRDA 3LI2A 2I4OA 1SVMA 1E2EA 5TQ2A 1R8YA 1G66A 2WJPA 1T91A 1E0AA 3GJ8A 3LQ1A 3BREA 4Y30A 2BJHA 5IJAA 4RH0A 5I8ZA 4MUJA 3RTDA 2WZQA 1IN6A 1MRZA 5JY6A 3JARA 3WGOA 4WAUA 1EVQA 1O8BA 2VSYA 4LJYA 3NG1A 4WUTA 4KQWA 4Q9AA 3ZXYA 3BA1A 4C76A 3NI2A 2VDWA 1YQXA 3OCJA 4EO7A 1PF7E 2RH4A 1FMFA 1CB7A 1LSJA 1VSBA 2O8FA 2ZUBA 2G9UA 2AXNA 4DWWA 1NA5A 2HF9A 4D9CA 1MFZA 3OU2A 1O9GA 1QK3A 1FK8A 4D9NA 1C1YA 3C87A 4HAYA 4ZCIA 3CVXA 4XVHA 1BCRB 1E6WA 2QSJA 4F1WA 2YICA 4ESOA 2E82A 3W6UA 1X7HA 1E1QA 4KFTA 5KB3A 4IMPA 2ZRPA 1TU3A 3COZA 3WLOA 3RUFA 1WTAA 1EJ6A 2ST1A 1BOOA 2ACVA 3LL7A 1MH9A 5H1YA 5E4YA 5IFKA 1GSIA 2PLNA 2QAGB 1JALA 3UV6A 1DJMA 2PSHA 2ZCUA 3IP3A 5JAZA 2GZ1A 1ZK1A 3AHIA 3OMXA 4S1OA 2HOQA 4U0JA 5FTKA 3C3YA 3VHQA 2AI1A 3X2EA 1NI4B 5IJWA 1H1TA 5JRJA 3H6GA 4C4ZA 4WJLA 1TM3E 2FY8A 5KOHA 2Z2XA 1FDSA 4RTKA 5C1BA 4YUWA 3LDFA 2F43A 3VGJA 4HNGA 4QLOA 4JI7B 2XDAA 3IAM1 3W1EA 3GX1A 2BISA 1L7QA 2GN2A 2IEGA 2ZIXB 3A3NA 2CKMA 4GI2A 4RO0A 1HOTA 4JOCA 4JC8A 4KIFA 1GVHA 4ZV9A 3W5IA 1PJTA 1EPUA 1J9GA 2FZKA 3FCOA 1HT0A 3JYOA 3V32A 4EQZA 4MKXA 3QBTA 2FSPA 4ETMA 3PEWA 2A3NA 1NTRA 2OG2A 4ZVMA 1XB2A 3L5KA 3Q1LA 4P4NA 3LRPA 1FP6A 2XUZA 4CM4B 2AH5A 4KQEA 1P9LA 1JA1A 5I7VA 1XALA 4Z3KA 3ESQA 1G55A 2B2CA 4F3NA 1T5TA 1GN9A 4EA7A 3T7EA 3AVOA 4RJ2A 2ZYUX 2HQRA 4CM7A 5BUCA 1E1MA 1EUDB 3ONVA 3VPXA 4A23A 4YMHA 4Z4QA 1RDFA 2P9ZA 4TSRA 1A1SA 3I61A 3L7IA 3OEED 3VO9A 5JNTA 1VHTA 5GM1A 1OLSB 2ATCA 4TLCA 4D02A 2NZ8A 1KBZA 1JKMA 2VS1A 3ELUA 2VL7A 1EK6A 3I9KA 5B7PA 1IM8A 2JHPA 4A91A 2PUEA 4PPNA 1QCZA 1A2KC 1E2IA 3DZKA 3F5QA 3PC2A 4S1WA 2O6LA 3CLRD 5F64A 3JYLA 2P3OA 1L5HB 4LJAA 4AS1A 1GUDA 1E79A 2OZPA 3H2HA 5T6BA 4CL2A 2I6GA 3HWSA 3U4QA 4TMZA 2FMUA 3EN0A 3QIVA 2SCUB 4TMKA 1TO6A 2IELA 4QC2A 5DE3A 1KP2A 4LJSA 4ZEXA 4LPSA 3E3MA 3EISA 1Z29A 2QMUA 1I3OA 3ZBPA 5J4LA 3OKAA 1B8OA 3UJ6A 2O8BA 1WZUA 4KVGA 4TS3A 3EW9A 2B0JA 2RBKA 2DFNA 1XXLA 1RW4A 5DCWA 4GSLA 5F2OA 5FPQA 5G4KB 1UJMA 2ZUWA 3SNHA 3FFAA 5SZIA 1OFTA 2PL9A 3WLTA 4B3DA 5IDVA 3PD0A 1ML4A 4QHSA 1M34E 4WOJA 3L40A 4BE7B 1VSUA 2GNAA 3WYNA 3ER6A 3PGLA 3QE4A 3G7NA 4KMMA 4LY0A 3KT8A 4BMZA 4HWTA 2O4CA 1XRLA 2CLSA 4EEZA 1E61A 4DG8A 1FNMA 2GJ8A 2IS6A 4C04A 2VYCA 4JZKA 3WGQA 1M6VB 4CTJA 1KVSA 2GSDA 3I6YA 2JLBA 4X5OA 4KOAA 3F49S 3AXSA 4N41A 3DE1X 3E03A 4I1PA 3PFKA 4B4WA 3GJ0A 1NJGA 2GBLC 4M9QA 3TUIC 2C4MA 4R8MA 1FJGB 1HNWB 4KQ9A 3ETLA 1PR3A 3CUUA 3QNUA 3DAHA 1ZD9A 4MMZB 3OQHA 4NPCA 1QR6A 4HK4A 4NS1A 4UQPA 3MPOA 3LT4A 4IIEA 5HX7A 2ODEA 2ZQ5A 5A4DA 1QYRA 1VE1A 3M6WA 1ONOA 3B6EA 3LGSA 1TX4B 5A3QA 4H1VA 4DBLC 4RTNA 2A9OA 2X2EA 4URUR 3SE0A 1AHIA 2PU7A 3VTFA 4A1OA 2RAFA 4LJLA 5KWJA 5COQA 3UMSA 3ZIAD 3P9PA 1AB5A 2HRCA 2I2XB 4CUKA 1ZD1A 1SCKA 3U16A 3PJDA 5KOJA 2BMVA 2NU6B 1G5PA 2AFIB 2AYXA 4R9SA 4MRRA 4RWEA 3GIDA 4MRNA 3ICVA 4B7ZA 4MQBA 1JAIA 4LJ5A 1GQRA 3ENNA 4NXMB 3WIBA 3PKIA 1PE0A 3MJRA 5J5CA 2JEOA 3CU5A 1CDEA 5IXJA 4BVAA 1I6KA 3PCXA 3NM5A 3S28A 3W8DA 1ZJZA 2VK4A 1AGYA 1HFKA 4TM7A 4JY7A 1EM8B 1WW2A 2PUTA 1ZRNA 5MFPA 4HHEA 3UHAA 3U09A 4O4IB 2N3ZA 2VSOA 3I4CA 1V1RA 2W37A 3G17A 4M0KA 3ZKWA 1Y3FE 2C7PA 1E6UA 1N5RA 4NULA 4B5LA 1EH5A 1FTGA 3UXHA 3F7MA 1T5DX 5BNWA 2M6SA 5A9TA 5T4FA 1H2XA 3MAGA 3P9KA 4U3JB 4XJSA 3R7WA 2CVPA 1W1IA 4RE6A 1SCUA 3K5PA 3AR4A 3UN1A 1L4LA 5KTPA 4GXTA 1VG8A 1WEHA 2BEVA 2WEKA 2C03A 3DWEX 4L0CA 4I3HA 1HEUA 1QDLB 4BBZA 3R3HA 1FZQA 4D0GA 4Q1AA 3NFYA 1Q0SA 2G1UA 3HXTA 2FOXA 1QIGA 3B36A 5EIWA 1YQTA 1C4KA 5FXMA 1IOWA 5A4FS 3GLIB 4TV8A 1U3UA 1V1JA 3TBFA 4CEIB 3GGGA 4KR9A 1SHTX 3NH9A 1V5EA 3NOOA 2NVWA 2UZ1B 4U7GA 4W99A 3RYHB 4K6OA 5DZSA 1E2JA 1RRVA 2AK3A 4GR5A 4NYMR 4LXUA 5BO5A 4EPTA 4XIFA 3PQ4A 1EVEA 4LHSA 1DC3A 5FEUA 4B33A 1YBVA 3WDSA 4DCSA 1BJRE 2EJWA 2SKCA 1HC7A 3LG2A 4OL9A 3OEYA 1V7CA 5HJEA 3Q72A 1EUYA 1JT2A 4JLJA 4BAZA 5CRIA 3CTPA 4ZT5A 4IIHA 4PG7A 2IZ7A 1Q0RA 3EXHC 4LGMA 1A4IA 4IJQA 1UBTS 4D6PA 3FUUA 3VFDA 4DLVA 1W8IA 2CFSA 2H0AA 2FMKA 2W00A 2ZJ8A 5J43A 2DF8A 4IO0A 2YDXA 2C2KA 3H2ZA 4MI3A 4Q00A 3DLAA 3SOPA 3TX2A 5AJZA 1Y9EA 5KYYB 4GKJB 2LDBA 2ZRIA 4P86A 4OOFA 3D9QX 1F8YA 2I34A 2CKDA 2WTNA 4L6AA 1IIBA 3FJOA 1R6AA 4Y9TA 1Q7GA 2J08A 1IZYA 5FL3A 5DYGA 5BNTA 1FVHA 3L5OA 3L0SA 4R8KA 1POWA 3BZWA 3DP9A 2IH5A 4QGHA 1IG3A 1MOSA 2HQ1A 1NSTA 2YS6A 2GS9A 4RTQA 2X5OA 3CC8A 1Q0UA 1QQ6A 3C45A 3JWPA 4HGQA 1NG1A 4FWIB 3RS0A 1BRMA 2OM6A 5J3JA 4JBLA 3AFGA 3C70A 4XGNA 4CETA 4RKFA 4NCBA 3KJGA 3FI0A 1RBQA 3EGXA 1HLFA 2L17A 3LA8A 2P6MA 5A4AA 2O8CA 1M66A 3U39A 3BOSA 2EF1A 1RWMA 1ORWA 2C42A 2YCLA 3V8EA 2W2XA 4QJ3A 1VZ2A 3LY7A 1ZN7A 3LPCA 4I19A 4MEAA 5H02A 4HGYA 3RRMA 3UT0A 3QHPA 3VO2A 4CW7A 3BB4A 2DWOA 1BEZA 2NYRA 3ED1A 5CA0A 1U1GA 2WSSD 1NVDA 4MA0A 2OP0A 1NMSA 3IAEA 4YJKA 3L4BC 4UM5A 4N6OA 2DUMA 1TM1E 4FZRA 1GPJA 3D6FA 1QHXA 2MSDB 2QD3A 1JXOA 2AOVA 5GADl 1AQNA 4C0AC 1MF7A 4KACA 1SXJD 1URPA 3R1IA 1HO3A 4JS0A 4MR7B 4PYRA 2D2VA 5DWVA 2CUKA 4QUGA 4X94A 5FPYA 1TUGA 4MWDA 4OPMA 1KQFA 2QTBA 2PS9A 4UPDA 5KNBH 4CKBB 3PPYA 4IXWA 1YDEA 1YI0A 2BFFA 3NRBA 1IAVA 3SS7X 4BQRA 3KXKA 4L3OA 2XT9A 4Q7QA 3MWDA 3GDHA 1V1MA 4LY9A 4UNSA 10MHA 4MRSA 2XMBA 2K2QB 3O3MB 4I5FA 2H8GA 1Z26A 3QMVA 4N3CA 4OQMA 3THSA 3LXRA 2AX4A 1DBIA 3DPUA 3LHKA 1I1QB 4LK3A 4WZBB 1EIWA 3UCEA 3UPUA 2PX3A 4MCHA 1GRRA 1DV2A 1EA7A 2DHRA 2RC6A 2KX7A 3MWEA 4MGYR 4UEKA 5DNCA 2Z5FA 4O08A 5BW5A 4J1TA 5IBQA 2OFWA 4TTTS 3FGPA 4BLTA 1O4VA 3NETA 4BWGA 2H0RA 3GH3A 2FPUA 4ZO6A 1HNZB 2C95A 4UAVA 1DXOA 2QUKA 5DI3A 4B80A 4R6XA 2Z43A 1RZUA 2FZVA 2CFOA 1QCYA 2COKA 3WGKA 3BF8A 3EXAA 5GGYA 3DMHA 1WHTB 3S7ZA 5CVUA 4EKDA 3JYPA 5DXJA 4KSCA 2OQVA 2GHRA 5ICMA 3FRIA 4RMNA 2DFKB 4O0MA 1SELA 1GZUA 1XZHA 4FFBA 3UK0A 4YUYA 5DT9A 3W5JA 1WMBA 3DF7A 3DHEA 2BSQA 1YHYA 1ZX1A 4Q7LA 3ZQ4A 3NB0A 1C1XA 1EVJA 4NZMA 3ZTWA 1EP2B 1JDNA 1RPNA 2WF6A 4EF5A 7REQB 3S0JA 3G1WA 5LQUA 1HE4A 2W6PA 2XRYA 3LWZA 4RV5A 4BNHA 3LV8A 3TQRA 1EP3B 4UNIA 1UKEA 4YJ3F 3UMYA 1GA4A 1KP3A 1LX6A 5E0KB 4FCVA 2DSTA 4GKKB 1UANA 2TRSB 1DO0A 3P9ZA 1T9CA 2YN4A 3ZDQA 1VG0B 1V8BA 1P33A 1WMDA 2QI9F 2C4TA 2C92A 3FY4A 3PX2A 4JWTA 1EXMA 3VOAA 1G3MA 2FEPA 5AVWA 5JYCA 3SG0A 4G41A 1P1FA 2BFEA 1MAWA 3OOHA 4XTRA 4B81A 3KKQA 2G17A 2WJGA 1E2KA 1QJCA 2N75A 2PVSA 4NY1A 4X1YB 3UHFA 4DMFA 2A9KA 3TSZA 1U8XX 4KFRA 4D8XA 3FYUA 1FUUA 2KHZA 3RRBA 4FFPA 4FHDA 3A7DA 2P0AA 2Y1KA 3AK4A 2R44A 4QNRA 4JI4B 1Q14A 1ZEMA 2YNMD 3DBRA 2CJXA 4MZXA 3R3UA 3DOJA 4KQ6A 1XTVA 2XWSA 3E9EA 3L0CA 1TF5A 3GRVA 2VZ9A 5FOVA 4LRUA 3HJFA 3PDHA 4RVSA 4BYMA 1CYDA 5A06A 4L07A 1CZUA 3DAGA 1BW9A 1GKUB 3BCSA 3H42B 5HDQA 5JMPA 4U2KA 3PFGA 3DKIA 5G1PA 3TLCA 3AY3A 1XRMA 5L3VA 2ZSJA 3C6MA 3RFFA 4ZC1A 1RWPA 2H57A 2V7VA 4I1UA 4C89A 1W47A 2XLCA 2C5FA 1F51E 5KTKA 4O4JA 4XX0B 1V71A 3REQB 4NATA 1Q77A 2M32A 5AK0A 3R0ZA 3SQNA 3TR0A 3R74A 4LOJA 2X8JB 3OIGA 3BULA 1HYEA 4I9UA 5IVDA 1M75A 4NCAA 5C9ZA 1JEQA 4B8YA 1UK7A 5I5GA 1BGVA 2PA0A 3A9CA 5DV9A 1U7DA 4P38A 1W5AA 1SNYA 1XQ9A 1EDOA 1GO2A 2JCYA 1KJNA 4EITA 1EB9A 4MVJP 3CSDA 3G79A 4CLXA 2NZJA 5F3DA 2FMHA 2GILA 4WY5A 5AW6A 2QZ4A 1Z39A 4L4ZA 4CV3A 1O0CA 1T2AA 4B3BA 1UM8A 2OECA 5SZHB 1JIUA 1L5MA 2I3ZA 1U7HA 1POXA 2UZ3A 3PGKA 4YXWA 3X2SA 4J16A 4M2LA 1AUVA 1IPEA 4MX8A 4EKNB 1WVGA 2WY2D 2DEUA 4K9DA 3GUYA 3X44A 1PZGA 4XFJA 1XCMA 1MJ5A 3FTPA 5C4MA 1X2EA 3G2OA 5BVGB 1RABA 3ND6A 3DE4X 5CFRA 2O5RA 3SZLA 4A8TA 4Q4JA 1FVFA 3ND5A 4TWRA 1XZJA 1Q17A 4UBMA 4X6UA 5DEOA 1OXXK 1ZK4A 3HY6A 1ISRA 2CL0X 4P93A 1X7DA 2QUJA 3N07A 4IHJA 4ZMSA 1Z3IX 3X0DA 1VL8A 1RYZA 3P9XA 4KIJA 5A4MS 4EF6A 1T8SA 2FX2A 4ZQHA 2PLRA 2ATEA 3EGDB 1B8VA 4HTFA 1GV1A 3ILVA 3GGPA 2YBDA 3W78A 4L5YA 1JLHA 2IYUA 4Q1VA 5HBRA 4FNMA 1NNEA 1TVKB 5G41A 1OBVA 1RYEA 3GY0A 1XEWY 3N0RA 4LMBA 4YJHA 4MICA 2QTAA 1EK2A 2Y76A 2PUBA 2FWMX 2CZQA 1XHFA 5JPIA 2P5TB 2XEXA 3KVOA 4IILA 3TW0A 1I6LA 1C9EA 1IBCA 5D86A 3SK0A 2YW2A 3VNQA 3U3ZA 2ASEA 3RJ9A 3V9PA 1JI3A 5GJBA 1NSYA 4GOMD 2BCGY 1P5JA 2R7NA 2ZRKA 5LZ9A 1M76A 3J81k 3DOFA 3FTCA 1FFBA 3MGCA 3KB2A 1E89A 4FBGA 5L3QB 1GAEO 4PPGA 2BFPA 2MSEB 1QCDA 4RZ3A 1B6TA 2H4JA 2X4GA 3BIJA 4ENTA 3OF5A 4Y1EA 1DCKA 1JRLA 4FKMA 4R54A 5THQA 4RZQA 4FE4A 4JB0A 3RFTA 3VBEA 4BZWA 1Y42X 4XQ0A 4CBVA 3SGLA 3B5JA 3QVXA 1YKFA 2W9XA 3E84A 5FYDA 3WDKA 3RADC 1NU6A 3OHPA 4OY3A 5DX0A 3RVLA 1HQKA 5BSWA 4REOA 4PO8A 3NGMA 4BLRA 2J3JA 4KO8A 3HEBA 5BPFA 2Y1OA 4G8BA 4FJ0A 3OIVA 3PA6A 5EZSA 3Q7SA 1DC6A 4RCVA 2QNIA 4LNHA 4W9NA 5DBOA 5ECGC 3EE6A 1ZG3A 5HFAA 4W5QA 4F97A 3BM5A 3RGWS 4BGUA 1UAYA 3O38A 4HAVA 2POQX 2RGBA 1BCSB 4BJHB 3OIYA 4AJOA 2YJNA 1XPOA 1ZK2A 1NE7A 3DM5A 3GQVA 3DYBA 5DB4A 4QREA 4WZZA 4C7MA 1VMAA 3U9SA 1RADA 1YB5A 2QMQA 3L7AA 3PX7A 1UFKA 3U37A 2B25A 2ODTX 2PANA 2R1TB 1Q0ZA 3HN6A 1KWKA 1D1PA 1RKVA 1K68A 3B9PA 1G0OA 1EFRA 3NBQA 3PRKE 3UF0A 4UEWA 1IRXA 2QENA 2ZJ4A 3DD1A 3SBOA 4MV0A 5CYPA 2X3FA 3I52A 4WCVA 3EW7A 4J0CA 4RFSA 1YONA 3IAM6 4ZICA 5DLEA 1CYEA 2OQRA 4I0WB 2PLAA 1QE3A 3E27A 5DHTA 2W2LD 3EH2A 1U0EA 3AEUA 2DFPA 2WIAA 5TGDA 2EFHB 3DOIA 3V8NA 2UKDA 4HZIA 3MAJA 2Y66A 1EJ0A 5A4JA 2D1YA 1ZSVA 2R68A 2Q2NA 2VZ8A 1TCVA 1UDCA 4NBTA 4CF4A 5FWDA 3PC6A 2ZI9A 4WNCA 4CN8A 4OBXA 5AUPB 3V7UA 2LP4Y 4TSFD 2OZKA 4PSUA 1OJ7A 4W9RA 2AG0A 1USUA 1XNHA 4FJ1A 3ZDBA 2CFIA 5HZHA 2HRZA 1E69A 1SHZA 3GFSA 4LZLA 4RHFA 4CT0A 3AJEA 2JPDA 4IICA 2I1QA 3LHSA 1HE2A 5IX8A 4QTUB 5LN1A 4YASA 1Z83A 1IB6A 1UBUS 2BKXA 4FONA 1E59A 2BPOA 4ZAZA 1XVUA 4MW5A 1CD5A 3ZDDA 4OHOA 3MAAC 4Y6SA 4PBTA 4GX2A 4WE3A 2FKNA 1I9GA 4CPDA 4DEVA 1PNOA 2B5VA 5TS3A 3EFEA 1XD2A 3HDJA 1L5NA 2HNAA 3QVUA 5LVAA 3L7JA 2ZXUA 4YMTA 1C8BA 2DY0A 2VK2A 1XZLA 3NHMA 4DCMA 4KGVA 5BUQA 4BMDA 1F8XA 5K3OA 5ESDA 4V0LA 1UPFA 1NL3A 3MGBA 4AMUA 2XOXA 3OCVA 4GLLA 2E85A 2G28A 4MOWA 3BTSA 4BNNA 4Y2JA 4JITA 1Z4PX 1M33A 5EXTA 2Q5HA 2QTTA 3FJ1A 2GJSA 1F6DA 4K3VA 3VUFA 5EJ7A 1IBSA 1WCXA 4JI5B 3VPBA 3UMJA 3WMRA 2ZYGA 4DILA 2VBIA 4YHHB 4CGYA 4BNGA 1U1IA 4HATA 4Z0HO 3WSWA 2QY6A 4KQHA 3RV3A 4HTAA 3WLJA 3N2KB 1MO6A 4WDRA 3GDFA 1XPUA 1F3OA 5AW7A 1Z2CA 2EEPA 2R62A 2QN3A 3HO8A 3FRJA 4W7IA 1T1JA 2VQSA 2W2KB 3GNSA 3QMPA 4ZCMA 1MNAA 3TUZC 1PEKE 2JLUA 1Q1BA 2XYHA 1GU0A 1O94D 1I3NA 1F8GA 2WRZA 2QJOA 3UJ7A 1WP4A 1LS6A 2DT8A 2OCGA 2YY7A 3BH7A 3NPMA 4OYYA 4PG4A 4YDSA 3SI7A 4EGSA 2ROQA 4PYMA 2HF7A 2DBZA 2JIBA 4EZEA 1AXRA 5CDTA 1NUTA 2DETA 1DIAA 1PW5A 5CFNA 4FEEA 4PC2A 1XG5A 1P60A 1KJ9A 5K0LA 2I7CA 3BRCA 3M70A 4JCCA 2ONKA 4ZEOA 2HK7A 3CF4G 1AK2A 2OMKA 3IKTA 5IT5A 2DR2A 1PJSA 1G60A 1FVXA 1S8FA 1KP9A 3UGKA 4QU0A 5CCEA 1GADO 2O2XA 3K1AA 2P2NA 4FYJA 2YUTA 2O3SA 2PSSA 4MWBA 4PPFA 4OLBA 1MMFB 2I03A 4ZAXA 5BRJA 3DBRB 1MVLA 4HB2A 4OFWA 4V1CI 1Z6PA 1H65A 5HYVA 3DKKA 3RKUA 2Z2JA 1DSSG 1XZPA 2HEIA 2ZJOA 4RA9A 5AI8A 1YVUA 1GZ3A 3WAGA 1A9RA 1CQWA 3GO4A 2JFHA 1AK9A 3GG2A 3KKMA 7AT1A 3GR6A 3LNCA 2XA1A 4FGKA 1I4TD 4CQMA 3EQ9A 5IT0A 3SLRA 2PL1A 2QUIA 4MKGA 2PUWA 5FNVB 5HJ7A 4NCNA 2JBAA 3PQ3A 5CLIA 1XMQB 3CXUA 4JQCA 1J0BA 2FX5A 1UKAA 2K6GA 4R71A 3ZZMA 3BFPA 5SYMA 1D6JA 3DO5A 4MI9A 4NU6A 5CPFA 3UV3A 3D5TA 4LNUA 3S55A 1JEYA 2JJ1D 4BUZA 2AMYA 2Z4TA 2EBHX 4FN4A 4EUKA 2GM3A 4TXHA 5IAOA 3FDJA 1DRKA 1YULA 4JLMA 5A04A 4YJFB 4JJ6A 4KQ1A 1NX6A 1XLVA 1V41E 5FD8A 1UBRS 2PO5A 1W46A 1JLMA 1WSDA 2B8JA 4D7AA 5DF1A 1LF0A 2EQ5A 4PZCA 4P08A 2P5YA 5CXXA 2QD5A 4Y2YA 2XYGA 1UH5A 3D7KA 1I0IA 1PJQA 4WASA 3LF1A 1T2UA 1XAJA 3DQPA 1Z7EA 2BUCA 2WYOA 4CXMA 3WB0A 2CXQA 4RGVA 2GSWA 1D8TA 2FQXA 2IDMA 3D6JA 5B1HA 1JPUA 2ODQA 1ZXLA 2ZPAA 4CQNA 4OLAA 4B3XA 2YC4C 3GOQA 3DB2A 4OHKA 3ZV6A 1K06A 4AZSA 2HA7A 1KGDA 5A3JA 3ZU5A 1YAHA 4RZUA 1S6YA 1BE8A 2BOVA 2HU7A 1FPQA 1ACMA 1C7ZA 2QTFA 2YXNA 4P58A 5EN4A 1YS2X 3PR3A 2YASA 1IYZA 1JLSA 4MULA 3OJLA 5FHQA 3UQYS 4ZCTA 5HVNA 3KSBC 1QVWA 3LA6A 3CLSD 1F4VA 3N8HA 3OQMA 1T35A 1MO5A 3ADOA 3BIWA 3HFJA 4KLZA 4XRRA 3BGWA 4L15A 1GG8A 3UTDA 3SXUA 1ENPA 1FFAA 3NJ8A 4K6CA 5K0GA 4URVR 4LDQA 1AX9A 3Q11A 3QYJA 2Y1XA 4G01B 3NUQA 3EG5A 4G5FA 1K3FA 2JZOA 3QXSA 2FPIA 3OPNA 1HYGA 2C9YA 5L9AA 1G20B 5GONA 1YF3A 3CT4A 3EVCA 4KXNA 1R8QA 3K94A 3E9QA 4HYEA 5I9IA 2Z9CA 5A1TA 5LCXA 3ER8A 4A6EA 2VUIB 1CK4A 1AVTA 4F60A 1QLHA 3MZ0A 3PVCA 4K86A 4DNOA 1PN3A 4HWKA 1FRNA 3IQDB 2RGEA 2PKRA 3DCIA 4KYVA 3IR5A 4LDNA 3QVJA 4Q24A 1Z5UA 2C1ZA 2XCIA 3PUXA 4ENPA 5JAHA 5EXPA 1NRIA 2R6GA 5CT6A 1RZRA 2GCIA 2VR1A 3EIQA 4TKZA 3KEGA 1KH2A 1MRSA 2XAUA 3ZZTA 1JQLB 3DGEC 1EZ1A 5D5HA 1U0OC 3GA0A 3NTXA 2WB2A 4MQFB 2GZ3A 1EUCB 2R6HA 4CM9D 3NWOA 2Q2VA 4OHMA 1QV9A 5JH7B 3OQ6A 4JSYA 4E1VA 1BEUB 2CVQA 4UUAA 2J3QA 2VZEA 3AMVA 4AZ3B 1LS1A 1DINA 2O1SA 2Y1DA 3N6VA 2HPHA 4F4FA 4AKHA 2ONJA 2ZUVA 2ZWOA 4YJ2F 1TADA 1TA9A 3M5PA 4OMUA 1QO9A 4RKQA 2ZWAA 3HWX1 5EE9A 4AYWA 1U28C 5ALYA 1NUAA 4JKIA 3EVGA 2BI4A 2OLKA 1A5ZA 4NE2A 3X1YA 1G59A 1ZXBA 4D9BA 1M7HA 1W44A 4Z0TA 2X5NA 4N40A 2GAAA 2PZKA 1CUAA 1SULA 2E18A 1U9ZA 1JIVA 1XZMA 2EC5A 1RIFA 3KSUA 3FROA 1XTZA 3KV3O 3L1VA 4HPXB 4L4YA 1HYQA 5I5EA 1U8AA 4HQOA 4LUCA 1UXOA 3UAZA 2KB0A 4BB9A 1Y81A 3ASZA 3CTMA 2OBNA 3MGGA 4XLLA 4EMBA 1WHSA 2PWYA 4LGYA 1IQ0A 2V7PA 3M6IA 3I6IA 1Y3DE 4B7AA 3RAJA 3CR7A 3FOWA 2JFNA 1CZOA 4B3IA 3Q9NA 1YB6A 2QRJA 3U48A 3MWDB 1CRZA 3ZDZB 3CW2A 5JD4A 3FCCA 3K0FB 2D4HA 1Y8RA 4G5OA 4HDSB 2IYEA 5F33A 1OWPA 2BMDA 3FPSA 4YV2A 5CD1A 1KO8A 2VVTA 3ABRB 3NCTA 4GI3A 1ULTA 4PNZA 9GPBA 2EW1A 2HUNA 3T4PA 4Y6RA 4F2DA 3U6KA 4OKSA 3W8EA 3DMGA 1RJFA 3I5XA 2JB9A 5A2GA 3N2ZB 1ATIA 1KY2A 1TAGA 2SKDA 1IL0A 3K35A 1GJRA 1IBMB 1JE0A 3U5ZB 5F1KA 4ND7A 4E5VA 5TPWB 1DRUA 2HRDA 3ETDA 4S35A 3VU0A 1IZZA 5JISA 4BV9A 4YPFA 2P7IA 4ZXFA 1JWAB 2BEVB 5K8JB 4EGAA 2FK8A 4KHPB 3SJZA 3Q8MA 4RLQA 2HCFA 1HMYA 3FSGA 1KKUA 1KY5A 3RSZA 5JZ9A 1E5TA 4LRTB 1DAGA 4BKMA 1LWOA 4BCCA 2H5EA 4NU8X 4P8RA 2YWDA 1LRJA 2WVAA 3L1KA 3TD6A 3VJMA 1G5HA 1JTEA 3DXXA 9MHTA 3I6BA 5EL0A 5B6JA 1X1SA 5B53A 3QSYA 3JQAA 1AS3A 4EYEA 2DH6A 2MSLA 3PXCX 1YA4A 1C8LA 3F8SA 4RZXA 2G76A 3C3CA 1JG6A 5H0IA 1U4NA 2HYIC 4RTMA 2IIPA 2OCPA 2AC7A 4KW7A 2HA5A 5ICEA 2HDNB 2IOQA 1YA8A 2IRWA 1ZY2A 1DEKA 3KT6A 4I50B 4KVZA 5FI5A 1ID1A 4RY0A 1WSAA 3ODPA 4WJZA 3S7TA