1PQ5A

Trypsin at ph 5, 0.85 a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trypsin Revisited: CRYSTALLOGRAPHY AT (SUB) ATOMIC RESOLUTION AND QUANTUM CHEMISTRY REVEALING DETAILS OF CATALYSIS.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Trypsin
total genus 57
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq5A01
2RG3A 1SL3A 1EX3A 4AG1A 1OWHA 1RXPA 3K6YA 1TX8A 2KAIA 3RC6A 3VB6A 1DSUA 3QGJA 3FP8E 4WF8A 5E2PA 1C1QA 4HGCA 2FODA 1NFWA 1KSNA 3ZVGA 5G4BA 1EZXC 2ZWLH 3SNDA 1IAUA 3ZZ9A 3JZ2B 1YPHE 2YNBA 2FOAA 3UOPA 1L4ZA 4YZUA 4Y11E 1W3CA 3A7TA 2H6MA 2BYAX 1Z6JH 1P03A 1GVKB 4NWLA 1F5RA 1TPOA 1QJ6B 3RXLA 3T25A 1UTMA 1GJ4H 1SGQE 2AMQA 1ELAA 3EDXB 3SUEA 4RN6A 2G00A 1KXEA 1GMDF 1KY9A 4O97A 2OQ5A 2O8LA 1A5GH 1ZMJA 2CV3A 4CRAA 1QR3E 1QGFA 3P8OA 1T32A 1XUKA 2J34A 3RXPA 3ZVDA 1AZ8A 3CS0A 4ZKOU 1YPKH 4X8TH 1SI5H 3TNSA 2HNTC 3MH4A 2GDEH 5PTPA 4IN2A 3UREA 2ESTE 1LVOA 3HATH 3UNSA 1O2MA 1IQIA 1XMNB 1HJAC 2ZHEH 4BANB 2ZGBH 3SI3H 2LPRA 1GDQA 2AERH 4CRCA 3HKJB 2ZCLP 3HK3B 2XCNA 4ZKSU 1VITG 2BZ6H 2QAAA 1HRTH 1GHAG 2SGEE 5A0AE 1P2NA 3S7KB 1NRSH 4XBCA 2GCTC 2ZGXH 1HBTH 3ZZ4A 1LTOA 5JB9S 4MNYA 2C8YB 1P8VC 1O0DH 1O33A 1O3MA 3VXFH 2HLCA 1UTJA 1MQ6A 3JZ1B 1UCYK 1Z1IA 4K3JA 2FOMB 2FI4E 3GY5A 4YLUA 1GI9B 1V2WT 5GXPA 4JYVH 3CP7A 2FOEA 1OP2A 3ZZCA 1S0QA 1T8NA 1DWDH 3V0XA 1CA0B 2FOFA 2V6NA 4NSVA 1PQ7A 1DXWA 2G8TA 3BG8A 1Y3YA 1BUIA 3TJVA 2C93B 1H1BA 1UVPA 1C2GA 2ZPRA 1CQQA 1G36A 3A7XA 3F9HA 5BPEA 1CT4E 2JH0D 3UR6A 2BD8A 3UWIA 2P8OC 3A85A 2O9QA 1PPEE 4BTUB 3Q77A 4WMDA 1AVWA 4I8KA 2NU2E 1PQAA 1O3OA 3PWCA 1F5KU 2JETC 1PPFE 1P57B 2WPKS 5C5OA 2A4RA 2ZP0H 2PKSC 1S0RA 3A86A 5EXNA 1S6FA 3RXJA 3PO1B 1PJPA 1W7GH 1QBOA 1V2OT 4B2BA 5FBIA 4FU8A 2CHAB 3RMOH 3MTYA 4NIXA 1CSOE 1S82A 2PKAA 1KXFA 2A4GA 4NA7A 5L2YH 1C1WH 3F9GA 3EE0B 1BJVA 1NFYA 3RXSA 3QWCH 1H9HE 3OU0A 4H6SB 2ZEBA 1DY9A 2FYQA 4GHTA 4KTCA 1IOEA 2WPMS 1SLWB 2D26C 2HNTE 3MNXA 2F9UA 1P10A 1Z8JB 3LC5A 1JIMA 1P2QA 4FUEA 1BT7A 1FZZA 1MTWA 1HJ9A 1EB2A 3BG4C 2WINI 3TJOA 4Y71A 3UFAA 1BIOA 1A1RA 3GCNA 2PFEA 5C20A 1YPLH 3RMLH 3MO9A 1UTPA 1CE5A 1YGCH 2ZDVH 1HV7A 4PROA 2UUFB 5CHAC 4A7IB 2VB0A 5LPRA 2QF3A 3M35A 1SGTA 3SGBE 4YM9A 2SGFE 1V2ST 1NU9A 2W7SA 1O2RA 4I7YH 3KEEA 2PR3A 4OS1A 3TU7H 1HPGA 2J92A 3PMHB 1GCTB 2W7UA 1C5NH 3LJOA 1O30A 3B9FH 5EXMA 2BY8X 3K2UA 1C5VA 1B5GH 1D3PB 3SU0A 5C3NA 3S9BA 1C2FA 4E7RG 1O5FH 2ODYB 1CGHA 3KGPA 1WU1A 3U1JB 1BA8B 3BIVH 1CBWC 1LHCH 2K1QA 1JMOH 2WPIS 3IITA 4D7GA 2QGRA 1A2CH 3VEQB 3SJ8A 2O8UA 1JRTA 1HB0B 3MNCA 4IMZA 1TALA 1AMHA 3I29A 2VNTA 4ABHA 4HTCH 3RXMA 3S69A 1EP5A 1JWTA 2G55A 1OWDA 1TNGA 3L6PA 4IC6A 2XXLA 4X8VH 3SJIA 1SLVB 1D6RA 1LHFH 1SGEE 2Q1JA 4Y8XA 3PMAB 1GBCA 4FUFA 2FOBA 3LGTA 4KTSA 2EA3A 1L1JA 1BB0B 2GX4A 7GCHG 1HAVA 5F8XA 3HK6B 2SGAA 2CF9H 1TQ0B 4RKOB 4KELA 1UJ1A 3MH6A 5L30H 4AYYB 1AIXH 5A0CA 3RXKA 1Z71A 4AB8A 2IJOB 1S5SA 3MU5A 4NWKA 1MTNC 3T62A 1O2VA 4I8JA 1GMCG 2OC0A 1H8DH 4JYTA 1DWCH 2FS8A 1GI0A 2G5VA 4UE7H 1MZDA 2XCFA 1Q31A 4WVPE 1O5EH 4HFPB 1QJ7B 1VJAU 1PPCE 2BMGB 3D62A 1SB1H 1AB9C 4BTTB 1F2SE 3PO1C 1BITA 1C1PA 1WAYB 3UPEA 1GJ7B 1O5BB 1IQJA 2B8OH 4Z6AH 1P02A 1QTFA 1DFPA 1D9IA 2PW8H 1BHXF 4K2YA 3KL6A 2BD5A 4RKJB 3MO6A 2J95A 3STIA 1V2UT 1H8IH 2ZHDA 5DG6A 4LOYH 1QBNA 3LGUA 2ZGCA 1XXFA 1V2RT 2ZA5A 1H9LB 1T8LA 1SQAA 1O37A 1YPJH 4CR9A 4ABAA 1LVMA 1PPBH 1QL9A 1O3AA 2H9TH 2HRVA 2WUBA 4ZHAA 2R2MB 1C5YB 5JDUB 9LPRA 3SW2B 4B75A 2JH6D 1TABE 5ESBA 1NTPA 1HAXB 3M7UA 4X6OA 1N6YA 3EA7A 5J4SA 2STAE 1O2UA 1FY8E 3DHKH 2VU8E 1G32B 2FXRA 4AGJA 4DURA 1HJAB 4M7GA 3MHWU 1SSXA 1WTGH 3Q76A 4WH8A 3SJ9A 1THPB 2V0BA 2J38A 4TY7A 1KXCA 2TIOA 1ETSH 4Y79A 3ZYEA 2BVSH 1C5XB 1C5MD 1GBHA 4Y7AA 1GDNA 1K2I1 3E0PB 3W95A 1MAYA 4GSOA 1EAUA 2ZTZA 2THFB 1DWEH 1VZQH 2GGVB 4YO9A 2J94A 2WYGA 1J16A 1NRNH 4Z0KA 1HAPH 4KKDA 2VIQA 3A7YA 3SV6A 4E05H 1EPTB 4ABEA 3MU0A 3TJUA 4GPGA 1TOMH 4UFDH 4UD9H 2QV1A 1GI2A 1BBRH 4B71A 4X6MA 4INKA 3M3TA 1HIAB 4A6LA 2BVRH 2A1DB 1AY6H 1EXFA 1AFEH 2NWNA 5A8ZA 3SHAH 2P3FH 3I77A 1F5LA 1ZHMA 4AORA 1FI8A 4DGJA 3UTUH 7GCHF 1ZGIA 1O3LA 1ELFA 2XTTB 3TIUA 2H5CA 3TH4H 1ZJDA 1C5OH 1P04A 5HMAA 3RXHA 1HXFH 2VGCC 1UK2A 4H6TA 1GGDB 3SQEE 2B9LA 1BTXA 1GJ8B 2Z3DA 3RDZA 4CR5A 1Z6EA 1LKAA 1OWKA 3CENA 2ZTXA 4JK6A 1TMBH 4ZHLU 2XBYA 4CRGA 1SFIA 5GIBA 1O2IA 1YF4A 3SU2A 1BBRE 1O2LA 1TAWA 2F91A 1ETRH 1GBLA 1F0SA 2P59A 2VJ1A 4FUIA 3P8FA 4D9QA 1GBBA 1Q3XA 1O3EA 3TPIZ 3NWUA 3LONA 3A7WA 1YCPH 2ODPA 4AB9A 3QGNB 2GMTC 2KAIB 4JK5A 1Y5UT 1N6XA 1SLXB 3STJA 2G4TA 4U2WA 3KCGH 1L1NA 4Y0ZE 5EOKA 4Q7XA 1FONA 3BTWE 1ZSLA 2BY9X 1TX7A 1A3EH 4FU9A 4X0WU 1O3CA 2H9HA 3MWIU 1CGJE 1ZSJA 2ZDLA 3SNAA 1TA2A 4GHQA 2Q6DA 3U69H 1K1LA 4Y76A 1XUIA 2V3OH 2BM2A 2PWXA 2ZI2H 3GYMA 5JPMH 1T4VH 4XSKU 2AMPA 1EJNA 3ATKA 5AFYH 2ZGJA 3E8LA 4K1EA 1FY1A 1A3BH 1E0FD 1SGDE 3A8DA 2ZU1A 4HZHA 3W94A 3LGIA 1Y3XA 5EPYA 2ALPA 3FP6E 3U1IB 1AKSA 5DKMA 1NPMA 4LZ4B 1FY5A 1QNJA 4NFFA 4MTBA 2PKSB 1TNJA 1NRPH 3TK9A 1AB9B 2BDGA 3B8JA 4K8BA 1HAGE 1SMFE 1N8OB 2ZDMA 1TGTA 4BAMB 4DJZB 1EATA 1M9UA 2C8ZB 1UMAH 2FI5E 2ZC9H 1WQSA 1UO6A 3C27B 1C4Y2 1DVAH 3OTJE 2UUKB 3ELAH 4YESB 2QXHA 1Z8IB 1P2KA 4MDSA 1CT2E 1BTZA 1EUFA 1RTFB 4UFEH 1V6DA 2BLQA 5EW2H 4ABJA 1TRMA 2OINA 1GWAA 1GCDA 2BOKA 4XDEA 3SJKA 1LCYA 3MMGA 1BRUP 3VXEH 3R3GB 2XC5A 2VIWA 4WWYA 3PB1E 1YLCA 1UVUH 2QC2A 5GWZA 5FX5A 3IWMA 2R3UA 3CS7A 4MPUA 1KLTA 3U9AH 2BLVA 1JXPA 1EOLA 1V2NT 3WY8A 2QXJA 2AGIX 1ZGVA 4X1SU 1DT2A 5C5NA 4U32A 2A32A 5LH8A 4KTUA 3FP7E 2BDBA 3ENSB 4NGAH 1F0TA 1MU6B 1SPJA 1E35B 1P01A 2A7HA 1B0FA 1TLDA 1ZRBA 4UDWH 2AMDA 1TGBA 1C2EA 3Q3YA 2VIVA 3F6UH 1QCPA 1DXPA 1TE0A 3BTHE 1HAZB 1GI3A 3TGIE 1SGFG 4U30A 4YLQH 1K1IA 1TRNA 4FXGH 3RXIA 5EODA 1FAKH 3RM0H 2VWLA 1QIXB 2OC7A 1IQLA 1O36A 4ABGA 2OUAA 2TGDA 4WMEA 1ABJH 1NFUA 2IN2A 1C1OA 1VR1H 4MG3A 1AKSB 4DW2U 6GCHG 1J15A 3K9XB 2AFQB 1OPHB 2GD4B 4R0IA 5GCHG 2BZAA 3RXUA 4DT7B 1GHXH 2OC8A 2DE8A 1O5DH 1DPOA 3ODDA 1ZMLA 1ZTJA 2AS9A 2H9EH 1O5GH 2O8WA 4ZKNU 4Y7BA 1C1NA 3MH5A 3V3MA 2STBE 3BN9A 2BXTH 1P9SA 2A7JA 2C3SA 4Q7YA 1WSSH 3ZZ3A 1WQVH 2PLXA 1C2KA 1GHZA 1DITH 5HGGA 4SGBE 4Y6DA 1YPMH 4UEHH 1ZHPA 1VITH 3KHVA 1A5HA 1B0EA 3TK6A 2CHAC 3LGWA 2O8MA 2ZFPH 1FLEE 1MMJN 4INHA 1OX1A 3RXCA 2ZECA 5A8XA 3A89A 3T27A 1LVYA 2FLBH 1BCUH 1TNIA 3V13A 3U8TH 1O3JA 1HDTH 1O3DA 5DP4A 5AHGH 1XXDA 4D76A 2UUJB 1ZOMA 1C5WB 3UWJH 4XBBA 1CGIE 1LO6A 3S9AA 3HPTB 3MH7A 2R3YA 1J14A 4X2XA 1O3KA 4JCNA 4XE4A 8KME2 1HNEE 1OYQA 2ZGHA 1HIAA 3LC3A 2FZZA 1TNKA 3UQVA 2F9BH 1TPAE 1EJAA 1BBRK 3GDSA 3SOSA 3SV8A 2GTBA 5LGOA 2Z9GA 3KQBA 2VIPA 1D4PB 1NFXA 4LK4A 1AE8H 2NU1E 3GCOA 1EASA 1GMHF 4XOJA 2TRMA 3E90B 1GBAA 3I78A 2HGTH 4ISIH 1G3BA 3S9CA 1V2KT 1K9OE 2DUCA 4X1PU 2FI3E 1W0YH 4MNVA 4B2AA 2Y80A 1UTOA 1EPTA 1AU8A 8GCHG 1Y3UA 2YNAA 1ESAA 2SGQE 2QA9E 3PM3A 1FN6A 1GMCF 4FUBA 1P2MA 4WJG2 1GHAF 1GHBF 1XX9A 2ZU4A 3PLBA 2G4UA 5LPFA 4MPXA 1CU1A 3MU8A 5DP9A 1ELTA 3UR9A 4F4OC 1D3QB 2ZU5A 4H4FA 1C1UH 3ZVFA 2EI8A 1EPTC 3SUDA 2HOBA 1NN6A 1ZTLA 2C90B 5F03A 3A80A 5JYIA 1NY22 2BTCE 3AAVA 3A7ZA 2H1UA 2W3IA 1E37B 1HAIH 1Q2WA 2G5NA 1Y8TA 2WPLS 4NA9H 1UTQA 5GJ4B 5A09A 2JKHA 4KP0A 5JBAS 2W26A 1A61H 2VIDA 3GOVB 3FANA 1TBRH 1MD8A 3URCA 1PPZA 3VB3A 5FX6A 4BAHB 1O3GA 4J2YB 2ZIQH 1YYY1 4AGKA 3ZZ6A 2R9PA 2ULLA 2WPHS 1O2WA 3D23A 1SQTA 1C5TA 3A8CA 6GCHF 4JZDH 1ELDE 2FMJA 2QYIA 2BD2A 2ZNKH 3ZZAA 1ZPBA 4ZROA 2PUXB 5C1YA 1C5QA 3MFJA 6CHAC 4B2CA 1MKWH 2Y6TA 3SU5A 2Z6BD 4TPIZ 2FX4A 5SGAE 4O03A 5H4IB 1O31A 3UY9A 1BJUA 1UTLM 2P16A 3LOXA 4AX9H 2UWLA 2PSYA 2AGEX 2ANWA 3H7TA 3C1KA 4YT6H 2CN0H 1EJMA 1AN1E 3M3VA 2Y82A 1ABIH 1V2MT 1QRWA 1GBIA 5AFZH 2XRCA 5DP5A 2PTNA 1GBKA 1SFQB 1YPGH 1NZQH 2BD3A 2RDLA 2Y7XA 3BTEE 4OS7A 1OWJA 4KGAA 4YTAA 1FIZA 5E8EH 1YM0A 4ABFA 1P05A 2F83A 1KXBA 3AW1A 1RGQA 1GL1A 1FNIA 2JETB 5JBBS 4FUJA 2B5TB 5F8ZA 4GUXA 4ISLA 4A1TA 2RA3A 3SV2H 1P3CA 3BTQE 2ODQA 1VCWA 2A31A 4Y10E 1TNLA 1OS8A 3SNBA 1EAWA 8LPRA 4UONA 2G52A 2EI6A 4CRBA 1ZRKA 1K22H 2UWPA 1MBMA 3UIRA 1FUJA 1ACBE 3E91A 3RXOA 3EGKH 3NK8A 5T3HA 1C5SA 4X2WA 4DCDA 3OY6U 3NCLA 2ZCKP 2FM2A 3TGJE 2B7DH 2VWMA 3VGCC 4OGXA 1FDPA 1NRRH 5F6MA 3A88A 2GV7A 5L2ZH 1P0SH 1OXGA 1S85A 2FDAA 2F3CE 1GBDA 3G01A 1EOJA 3PTBA 4AYVB 1V2JT 4MNXA 2AIPA 2RA0A 3GDUA 1CHGA 1GBMA 1SOZA 3RXVA 4AZ2B 3V12A 2BXUH 1IQEA 2ASUB 1GI4A 1BRAA 5C67A 2O8TA 3NPSA 2AH4X 5L6NH 1O2HA 5K0HA 7ESTE 2PV9B 5FAHA 4JZ1A 3M37A 2BQWB 1ZJKA 1NC6A 1G9IE 1DSTA 3ODFA 2QIQA 1A0LA 4I33A 1HFDA 1C1SA 4THNH 1T4UH 2C8XB 1AZZA 4BOHA 1NROH 2BY7X 1G2LA 4WY3A 3MU1A 1MCVA 1BMAA 1GJCB 2GCHF 2GP9B 4OS5A 2GCHG 2BDYA 2BB4A 2ZF0H 3D49H 1EKBB 1P3EA 1BMNH 1B7XB 6ESTA 3FZZA 1A5IA 2ZZUH 1TA6A 5EQRA 1MQ5A 1ZHRA 1UTNA 3KNXA 2FTLE 2I6QA 1O2GH 3MOCA 4B1TA 3ZZ8A 4FU7A 1E38B 3LJJA 1TX6A 1JOUB 1W8BH 3EQ0H 2ZKSA 1C5UA 4YOIA 1DWBH 4FUCA 1YBWA 2ALVA 2VIOA 2ZU3A 5HXFA 3SU6A 1AO5A 5EQQA 1IQNA 1QQUA 1K28D 5EPNA 1MUEB 3LIWA 4ZXYH 5JB8S 2ZFRH 4I31A 2FEQH 1P2JA 1OWIA 3RU4D 1O2JA 2R2WU 1IHSH 1SC8U 2CGAA 1GGDC 2PHBA 2GMTB 2HALA 2A2QH 1OYTH 2ZFFH 2ZFQH 2TGTA 1XUFA 2FIRH 3AAUA 3SV9A 4BTIB 2WUCA 1DM4B 1HJ8A 4IMQA 1QFKH 1Y59T 4WMFA 3E0NB 1H9IE 2EI7A 2HNTF 4I8LA 1SBWA 1LDTT 2J9NA 2BY6X 3DT0H 3ZZ5A 1G3DA 2YOLA 3P17H 2Z9KA 1O2XA 4K1SA 3BTME 3F1SB 1T7CA 4OS6A 4ESTE 4X6PA 2B0FA 2P93A 1KDQA 4CH2B 1K1MA 3QZRA 1O2PA 1W13U 3M5LA 3RXQA 1EP6A 1DLEA 3LPRA 4Y8YA 4WXIA 4U01A 1KTSB 1LPGB 3QK1A 3EA8A 1NS3A 3KIDU 1WCZA 2TGPZ 1GBFA 4X1QU 3NKKA 1E34B 3UNQA 1QJ1B 2A5KA 2FOGA 1FV9A 2ZFSA 3N7OA 1O3FA 1QL7A 1MKWK 1K1NA 1UCYH 2PGBB 3SU3A 4AFZA 1ANCA 4CBOA 5FPYA 2XBXA 2P8OB 2Z9IA 2TBSA 2CXVA 2H5DA 1BTYA 1RS0A 1MKXH 1A0JA 3L33A 1TMTH 5DJ7A 2F9NA 4GAWA 3RXRA 3SN8A 1GI7B 3LU9B 1BTUA 1MH0A 3AVZA 4SGAE 4NCYA 1O5AB 1FY3A 2BVXH 4NSYA 1NRQH 1MBQA 2XNIA 3HGNA 3DFLA 5DP8A 1BMMH 5C1UA 5FCKA 3KQEA 1OP0A 4X8SH 1IQHA 2VH6A 4A1XA 1E36B 2OLGA 1S6HA 2WV4A 4ISOA 4AFUA 1MAXA 5ABWA 1F0RA 3U98H 3DD2H 1O3IA 1KLJH 1BTWA 4IW4E 4AOQA 3PWBA 4FVBA 5EXLA 4RSPA 1FAXA 1U6QA 2CJIA 4VGCB 1GL0E 3ZZ7A 3O8BA 4JZFH 5AF9H 4B73A 3BTFE 1C5ZB 1DOJA 3QO6A 1WBGB 1AVXA 1C9PA 1YLDA 1TIOA 4A1VA 4Q7ZA 1VGCC 3T28A 1BZXE 1T31A 3SJOA 1ORFA 3SUFA 4BAOB 1QY6A 1G3CA 1UVSH 2NU0E 1A0HB 1AQ7A 4IGDA 1X7AC 3T26A 3GY6A 8ESTE 4OGYA 1BTPA 1Z7KA 1SVPA 7LPRA 3RU4T 1GHVH 2QXIA 2A4OA 4ZH8A 1CBWB 3RLYH 1ZMNA 4TWYA 5IYTA 2BOHB 2AYWA 3KQCA 2GZ7A 2GCTB 3S0NA 1CT0E 3VFEA 1KLIH 2FS9A 1IQKA 3S7HB 3SU1A 1PYTD 3FZDA 4K1TA 4NIVA 2IOTA 4X2YA 2CF8H 2OD3B 3OY5U 1IQGA 3ZYDA 4NZQA 3SZNA 1TYNA 1C4V2 2VWNA 3F68H 3T2NA 1GJ5H 1AUTC 1S83A 2Y7ZA 2VVVA 4LXBH 1EAXA 1EZQA 1W14U 1MTSA 3IG6B 4AG2A 3TGKE 2P94A 2QN5T 4ZUHA 3GCTG 1RFNA 2ANYA 1W7XH 1LHGH 3Q3KA 1K1JA 3M5MA 1NO9H 1L0ZA 3RXBA 3E3TA 3LH3A 3TH3H 3LGVA 3GCTF 1O5CB 1ZSKA 2FO9A 5A0BA 3PTNA 3BEFB 1O35A 2XWBI 2A7CA 1V2VT 5JBCS 2SNVA 1VCPA 4NFEA 2BDCA 1MU8B 3GDVA 3LKWA 1GHYH 1LVBA 4ZKRU 3BTKE 2XBVA 4WXVA 1Z8RA 3D65E 4A5TS 3UUZA 2NU4E 4AFSA 4CRFA 4X8UH 2FX6A 1MZAA 1ANEA 4B74A 4IC5A 1O2KA 1GVZA 4OS2A 2EEKA 1SOTA 5ETXA 2P3UB 1HAHH 3RXGA 3QX5H 1KTTB 2BD4A 2A2XH 1ELCA 2OC1A 3DA9B 4GVUA 4JZEH 1BOQA 9ESTA 5CMXH 2XW9A 3M5OA 1THRH 1T8MA 3KF2A 1GG6C 2GT7A 3EYDA 1L2EA 3EAJA 2Q6GA 1P2OA 1YKTA 3MI4A 3KQDA 1O32A 4X1RU 4O3UA 1ZLRA 4CH8B 2OBOA 5C2ZA 3GY4A 3GCHC 3BTDE 2G51A 1C5LH 1RIWB 1DS2E 1WYKA 1LKBA 5E2OA 3K65B 1TNHA 1XVMA 2ZPQA 2HPQH 2GZ9A 5DO4H 1JRSA 2AGGX 2ZTYA 3A84A 1FY4A 2OQUA 1TGCA 5JBTA 1G2MA 1LQEA 1XKBC 2SGPE 1P9UA 2BD9A 1XUGA 3A82A 3MO3A 1PFXC 1ESBA 3TLOA 4BAQB 1V2LT 1ELBA 3ZZDA 1GJBB 1GI6A 5IDKA 1ANDA 3P95A 3GY8A 1DUAA 3LT3A 3RP2A 4HI3A 1GJDB 3Q3XA 1UVOA 5AVDA 1W2KH 2AIQA 3M7TA 5T6DA 5DPAA 4ZHMU 3PLPA 4O3TA 3E16B 1RTLA 1BRCE 1C2JA 1QB9A 3MNSA 4MQAA 1SGYE 1UTKA 1P11E 1P06A 4UFGH 1BDAA 2Z3CA 4DIHH 1KXAA 5FHTA 1O2QA 3TJNA 1SG8B 3QN7A 1SLUB 3BG4B 1O2SA 2ZU2A 1YC0A 1ELGA 1BTHH 3O8CA 3AW0A 4MVNA 3UOUA 1ZPCA 3H7OA 1QB1A 2SGDE 3L3TA 2V3HH 1SQOA 1TPPA 3ITIA 3M3SA 1SHHB 5FPTA 1O2TA 1AUJA 2D8WA 3FFGA 1TWXB 2A5IA 1JIRA 1AFQB 5TJXA 2FESH 4DY7B 2P3TB 2UWOA 3U8OH 1TOCB 1XUHA 2HVXA 1C5PA 1GCTC 2A0QB 4GCHG 2V35A 1HLTH 3T5FH 4TPYA 2GKVE 1UHBB 1Y3VA 1OP8A 2C8WB 4CHAB 4CHAC 4Y0YE 1GJ9B 3GYLB 1C5RA 4FUHA 1CVWH 2Y5GA 1AI8H 1TGSZ 2F9PA 4Q80A 3QDZB 3BSQA 3SORA 2FP7B 3ZV9A 3ATLA 3B23B 3SV7A 2VINA 1C2MA 3UNRA 3BV9B 4ABIA 3RC4A 1AFQC 4ISNA 5B6OA 1QA0A 2H2ZA 3BEUA 1D3DB 1XM1A 3ATWA 5A8YA 4NIWA 4I8GA 4BXSA 1FQ3A 2W3KA 2QF0A 1TBZH 3BTTE 1QA7A 5GPIB 3VGCB 5EGMA 4NIYA 4BNRA 3R0FA 2R0LA 3SU4A 2ZDNA 5DP7A 4X2VA 3ZVAA 3NZIA 1CHOG 2Z9JA 2ZFTA 1C1TA 2NU3E 1TBQH 3HGPA 5EG4A 2QCYA 3ZZBA 1BQYA 1K1PA 4JZIA 2XYAA 1GMDG 1SR5C 1FJSA 1SGNE 3QLPH 5K7RA 1O3NA 2ZDAH 1ARBA 3E1XB 8GCHF 1F0UA 1CO7E 1GDUA 1PQ5A 1V2TT 3M36A 2FPZA 1GJ6A 1ZR0A 2UUYA 2Z9LA 3ZVCA 1O3BA 1WV7H 2TPIZ 4BAKB 5I25A 3GY3A 1ELEE 1TFXA 2W5EA 1LHEH 4K8YA 1PQ8A 5J4QA 1TQ7B 1NM6A 3SGQE 1ZYOA 2XC0A 1CA8B 5CE1A 4K69A 2I6SA 1YP9A 1O34A 1G37A 1RIWC 4Y8ZA 3TITA 1TONA 2M5TA 2ZHFH 3OX7U 5BRRE 1L4DA 3SHCH 1W0ZU 2OCVB 2QXGA 3Q00A 1BMLA 3VB4A 2A5AA 4X1NU 4OS4A 1A7SA 1KXDA 4AFQA 3VPKA 2VVCA 3RXAA 1NESE 2IPHA 2XC4A 1OWEA 2P95A 2PUQH 2FYRA 3PMBB 4CREA 3TH2H 1AHTH 1IQMA 3GICB 1THSH 3QTVH 1MTUA 3RXTA 2BX4A 4INLA 3H5CB 5FXLA 2LNCA 1Z1JA 1FPCH 2GDDA 5GCHF 1HAOH 3E6PH 1GBJA 1C2LA 1LHDH 3VB5A 4ZAEA 1HCGA 2J4IA 1KYNA 1ANBA 1VGCB 5HM9A 3AASA 1G30B 4GCHF 4DIIH 3M7QA 5DP3A 4BXWA 3P8NA 1QBVH 3P92A 1O2NA 3PYHA 3SQHE 2XBWA 2ILNA 2HPPH 1AWHB 4UFFH 4AN7A 1SHYA 1QQ4A 2VVUA 1UK3A 2RCEA 4JMYA 1ZZZA 2D2DA 3QUMP 1P09A 4D8NA 1OKXA 1BRBE 1HAVB 3NXPA 4ASHA 1SGFA 4YOJA 1V2QT 1XUJA 1D3TB 2Q6FA 2QY0B 1W12U 1IQFA 1ETTH 1C1RA 5LPEA 1S84A 3ZV8A 3PROA 4E06H 1GPZA 3RMNH 1NU7B 1FMGA 1RD3B 4NZLA 1SGIB 3LGYA 1CHOF 1FXYA 2JH5D 1C2HA 2BLOA 2Z3EA 3BEIB 3TNTA 2BQ7B 2CMYA 3TK5A 1LQDB 4YT7H 4D7FA 1ELVA 2BX3A 3SBKA 1H4WA 1QURH 3RMMH 3A83A 1GBTA 4QT8C 5F8TA 1J17T 2G81E 1HXEH 1UK4A 1GMHG 5FPSA 3K6ZA 3P8GA 1XVOA 3RC5A 4IBLH 1DY8A 2BDAA 1O39A 2F9VA 1Z8GA 2XWAA 3DFJA 3FAOA 3SO3A 3PV4A 7KMEH 3ATMA 2ZDKA 1P2IA 2VH0A 1GHBG 3FVFB 3DUXH 1KDQB 4FVDA 1FN8A 1EQ9A 2F9OA 2PSXA 4R8TB 1D6WA 4MNWA 2A45B 1LMWB 1INCA 1O38A 2DE9A 4IN1A 4CRDA 1UVTH 2GV6A 3A8BA 4D9RA 6LPRA 1SGCA 1ZTKA 1AWFH 1F7ZA 5I46H 2HWLB 1HYLA 3SNCA 3RXEA 1KIGH 4J1YA 2OP9A 3QZQA 4XBDA 4XFQA 1J9CH 1TB6H 2C4FH 2WV5A 3MNBA 5DGJA 1HAYB 1G3EA 1QRXA 2A4QA 2ZCHP 1LPKB 4O9VA 1K1OA 4LZ1H 1W11U 3A81A 4MPVA 1MCTA 1DE7H 1AVGH 5EW1H 1Y3WA 5A2MH 4MPWA 2ANMH 2Y5HA 5EU8A 2BDHA 4GLYA 1MD7A 1C2DA 1J8AA 1Y5AT 2WPJS 1N8OC 2ZQ1A 3P70B 2BY5X 1A4WH 3SI4H 2PTCE 2PGQB 4ZMAH 3BIUH 2BLWA 3BTGE 2BD7A 1O2OA 1QHRB 1C2IA 1P12E 4VGCC 1RTKA 4K60A 4ISHH 2OXSA 3A87A 1UHBA 4I8HA 1ZPZA 1SGRE 1T8OA 1MKXK 3HKIB 4F49A 4MLFB 3RXDA 3KN2A 1JBUH 4TYDA 3VB7A 1BHXB 3GY2A 3M61U 5C1XA 5CHAB 3RLWH 3RU4E 1EZSC 5E0HA 3OSYA 1GI8B 2ZHWH 1UCYE 1WUNH 2Z7FE 1QB6A 5DP6A 5ESTE 4DVAU 4NG9H 3T29A 3O8RA 3LDXH 5HM2A 4DG4A 2ZO3H 1QRZA 5GDSH 1C1MA 1FPHH 3MYWA 1F92A 2BDIA 2Y5FA 1DICA 2R0KA 5E0JA 2OBQA 1DDJA 2D1JA 2ZPSA 5FCRA 5HYOA 1TMUH 1EAIA 1TGNA 3OYPA 3U8RH 1DANH 4YOGA 2Z94A 4X6NA 5T6GA 5E0GA 3PMJA 1GVLA 1GI5A 2OTVA 1K21H 1YPHC 5TCAA 2WYJA 1YCPK 4FUDA 1DX5M 1GI1A 2AEIH 1OOKB 4TWWA 4WH6A 1MTVA 2FLRH 1YPEH 2BQ6B 3P6ZB 1HGTH 1N1LA 6CHAB 2ZHQH 1WTHD 1EB1H 1O2YA 1RRKA 3O8DA 1LPZB 3SGAE 4JYUH 1O3PB 3A8AA 2VGCB 1VJ9U 5FBEA 4IS5A 3RUOA 1RJXB 1CA0C 3UQOA 2GT8A 3A7VA 1V2PT 3QTOH 3F9EA 1AE5A 2FOCA 3EA9A 4K5ZA 1VITF 1IHTH 3MU4A 1MTNB 4ABDA 3GCHB 2ZQ2A 1OSSA 2GVFA 3ATIA 2TGAA 2BHGA 3URDA 4CBNA 4H42U 1A46H 1YCPM 1AD8H 2FWWA 3NUMA 2GZ8A 1QL8A 1TPSA 1TRYA 4B76A 3LH1A 1L1GA 1C4U2 4Q2KA 2SNWA 1W10U 1AGJA 1GBEA 2EC9H 1PPGE 4DOQA 3RM2H 4ABBA 2ZG0H 2VWOA 5T6FA 1ID5H 3ESTA 1PPHE 2ANKH 1VCQA 1XKAC 1GHWH 1S81A 1WOFA 1O2ZA 1V3XA 3M5NA 5DK1A 4TY6A 4A92A 1HUTH 1DLKB 4I32A 3ZVEA 3PLKA 1ARCA 3RXFA 1C9TA 2J2UA 1GJAB 4ZXXH 1Y5BT 1O3HA 1GG6B 2SFAA 3GY7A 5EQSA 2PKAB 3SNEA 3BF6H 2Y81A 1FIWA 2FOHA 1ESTA 1NT1A 1C1VH 3ZVBA 5TCCA 3V7TA 3SUGA 1DUEA 3TVJB 1SGPE 4FUGA 4E7NA 4NA8A 1EZUC 2FTMA 1PYTC 3GISB 3F9FA
chains in the Genus database with same CATH superfamily
2RG3A 1SL3A 1EX3A 2JJ1D 3N7DA 4AG1A 1OWHA 1RXPA 3K6YA 1TX8A 2KAIA 3RC6A 4I86A 3VB6A 1DSUA 3QGJA 3FP8E 4WF8A 5E2PA 1C1QA 4HGCA 2QE7D 2FODA 1NFWA 1KSNA 3ZVGA 5G4BA 1EZXC 2ZWLH 3SNDA 1IAUA 3ZZ9A 3JZ2B 1YPHE 2YNBA 2FOAA 2EQNA 1L4ZA 3UOPA 4YZUA 4Y11E 1W3CA 3A7TA 2H6MA 2BYAX 1Z6JH 1P03A 1GVKB 4NWLA 2KCOA 1F5RA 1TPOA 1QJ6B 2RFKC 1NBMD 3RXLA 3T25A 1UTMA 1GJ4H 1SGQE 2AMQA 1ELAA 3EDXB 3SUEA 4RN6A 2G00A 1KXEA 1GMDF 1KY9A 3NRLA 4O97A 2OQ5A 2O8LA 1A5GH 1ZMJA 4TSFD 2CV3A 4CRAA 1QR3E 1QGFA 3P8OA 1T32A 1XUKA 2J34A 3RXPA 3ZVDA 1AZ8A 1H8ED 2WZQA 3CS0A 4ZKOU 1YPKH 4X8TH 1SI5H 3TNSA 1SQRA 2HNTC 3MH4A 2GDEH 5PTPA 2KFWA 3DSGA 4IN2A 3UREA 2ESTE 1LVOA 3HATH 3UNSA 1O2MA 1IQIA 1XMNB 1HJAC 2ZHEH 4BANB 2ZGBH 3SI3H 5EIYA 2LPRA 1GDQA 2AERH 4CRCA 3HKJB 2ZCLP 3HK3B 2XCNA 4ZKSU 1VITG 2BZ6H 2QAAA 1HRTH 1GHAG 2SGEE 5A0AE 1P2NA 3S7KB 1NRSH 4XBCA 2GCTC 2ZGXH 1HBTH 3ZZ4A 1LTOA 5JB9S 4MNYA 2C8YB 2KCPA 1P8VC 1O0DH 1O33A 1O3MA 3VXFH 2HLCA 1UTJA 1MQ6A 3JZ1B 1UCYK 1Z1IA 4K3JA 2FOMB 2FI4E 3GY5A 4YLUA 1GI9B 1V2WT 5GXPA 4JYVH 3CP7A 2FOEA 1OP2A 3ZZCA 1S0QA 4OM9A 1T8NA 1DWDH 3V0XA 1CA0B 2FOFA 2V6NA 4NSVA 1PQ7A 1DXWA 2G8TA 3BG8A 1Y3YA 1BUIA 3TJVA 2C93B 1H1BA 1UVPA 2J97A 1C2GA 2ZPRA 1CQQA 1G36A 3A7XA 3F9HA 4AC9A 5BPEA 1H8HD 1CT4E 2JH0D 3UR6A 2BD8A 5KEDA 3UWIA 2P8OC 3A85A 2O9QA 1PPEE 4BTUB 3Q77A 4WMDA 1AVWA 4I8KA 2NU2E 1PQAA 1O3OA 3PWCA 1F5KU 2JETC 1PPFE 1P57B 2WPKS 5C5OA 2A4RA 2ZP0H 3PRDA 2PKSC 1S0RA 3A86A 5EXNA 1S6FA 3RXJA 3PO1B 1PJPA 1W7GH 1QBOA 1NBME 1V2OT 4B2BA 5FBIA 4FU8A 2CHAB 3RMOH 3MTYA 4NIXA 1CSOE 1S82A 3FO8D 2PKAA 1KXFA 2A4GA 3OTPA 4NA7A 5L2YH 1C1WH 3F9GA 3EE0B 4TT3D 1BJVA 1NFYA 4Q63A 3RXSA 3QWCH 1H9HE 3OU0A 4H6SB 2ZEBA 1DY9A 2FYQA 4GHTA 4KTCA 5CDFE 1IOEA 2WPMS 1SLWB 2D26C 2HNTE 3MNXA 2F9UA 1P10A 1Z8JB 3LC5A 1JIMA 1P2QA 4FUEA 1BT7A 1FZZA 1MTWA 1HJ9A 1EB2A 3BG4C 2WINI 3TJOA 4Y71A 3UFAA 1BIOA 1A1RA 3GCNA 2PFEA 5C20A 1YPLH 3RMLH 3MO9A 1UTPA 1CE5A 1YGCH 2ZDVH 1HV7A 4PROA 2UUFB 5CHAC 4A7IB 2VB0A 5LPRA 2QF3A 3M35A 1SGTA 3SGBE 4YM9A 2SGFE 1V2ST 1NU9A 2W7SA 1O2RA 4I7YH 3KEEA 2F4LA 2PR3A 4OS1A 5B6LA 3TU7H 1HPGA 2J92A 3PMHB 1GCTB 2W7UA 1C5NH 3LJOA 1O30A 3B9FH 5EXMA 2BY8X 3K2UA 1C5VA 4B6FA 1B5GH 1D3PB 3SU0A 5C3NA 3S9BA 1FX0B 5C0TA 1C2FA 3W1EA 4E7RG 1O5FH 2WHXA 2ODYB 1CGHA 3F3BA 3KGPA 2KM0A 1WU1A 3U1JB 1BA8B 3BIVH 1CBWC 1LHCH 2K1QA 1JMOH 2WPIS 3IITA 4D7GA 2QGRA 1A2CH 3VEQB 3SJ8A 2O8UA 1JRTA 1HB0B 3MNCA 4IMZA 1TALA 3DCLA 1AMHA 3I29A 2VNTA 4ABHA 4HTCH 3RXMA 3S69A 1EP5A 1JWTA 5DSFA 2G55A 1OWDA 1TNGA 3L6PA 4IC6A 2XXLA 4X8VH 3SJIA 1SLVB 1D6RA 1LHFH 1SGEE 2Q1JA 1VKYA 4Y8XA 3PMAB 1GBCA 4FUFA 2FOBA 3LGTA 4KTSA 2EA3A 1L1JA 1BB0B 2GX4A 7GCHG 1HAVA 5F8XA 3HK6B 2SGAA 2CF9H 3AK5A 1TQ0B 4RKOB 4KELA 1UJ1A 3MH6A 3WWBA 5L30H 4AYYB 1AIXH 5A0CA 3RXKA 1Z71A 4AB8A 2IJOB 1S5SA 3MU5A 4NWKA 1MTNC 3T62A 1O2VA 4I8JA 1GMCG 2OC0A 1H8DH 4JYTA 1DWCH 2FS8A 3MQKC 1GI0A 2G5VA 4UE7H 1MZDA 2XCFA 1Q31A 4WVPE 1O5EH 4HFPB 1QJ7B 1VJAU 1PPCE 2BMGB 3D62A 1SB1H 1AB9C 4BTTB 1F2SE 3PO1C 1BITA 1C1PA 1WAYB 2M2AA 3UPEA 1GJ7B 1O5BB 1IQJA 5C17A 2B8OH 4Z6AH 1P02A 1QTFA 1DFPA 1D9IA 2PW8H 1BHXF 4K2YA 3KL6A 2BD5A 4RKJB 3MO6A 2J95A 3STIA 1V2UT 1H8IH 2ZHDA 5DG6A 4LOYH 1WXRA 1MABB 3OEED 1QBNA 3LGUA 2ZGCA 1XXFA 1V2RT 2ZA5A 1H9LB 1T8LA 1SQAA 1O37A 1YPJH 4CR9A 4ABAA 1LVMA 2LELA 1PPBH 1QL9A 2OK5A 1O3AA 2H9TH 2HRVA 2WUBA 4ZHAA 2R2MB 1C5YB 1COWD 5JDUB 9LPRA 3SW2B 4B75A 2JH6D 1TABE 5ESBA 1NTPA 1HAXB 3M7UA 4X6OA 1N6YA 3EA7A 5J4SA 2STAE 1O2UA 1FY8E 3DHKH 2VU8E 1G32B 2FXRA 4AGJA 4DURA 1HJAB 4M7GA 3MHWU 1SSXA 1WTGH 3Q76A 4WH8A 3SJ9A 1THPB 2V0BA 2J38A 4TY7A 1KXCA 2TIOA 1ETSH 4Y79A 3ZYEA 2BVSH 1C5XB 1C5MD 1GBHA 4Y7AA 1GDNA 1K2I1 3E0PB 3W95A 1MAYA 4GSOA 1EAUA 2ZTZA 2THFB 1DWEH 1VZQH 2GGVB 4YO9A 2J94A 2WYGA 1J16A 1NRNH 4Z0KA 1HAPH 4KKDA 2VIQA 3A7YA 3SV6A 4E05H 1EPTB 4ABEA 3MU0A 3TJUA 4GPGA 1TOMH 4UFDH 4UD9H 2QV1A 1GI2A 1BBRH 2HLDD 4B71A 4X6MA 4INKA 3M3TA 1HIAB 4A6LA 3WWFA 2BVRH 3N99A 2A1DB 1AY6H 1EXFA 1AFEH 2NWNA 5A8ZA 3SHAH 2P3FH 3I77A 1F5LA 1ZHMA 4AORA 1FI8A 4DGJA 3N7EA 3UTUH 7GCHF 1ZGIA 2V7QD 1O3LA 1ELFA 2XTTB 3TIUA 2H5CA 3TH4H 1ZJDA 1C5OH 1P04A 5HMAA 3RXHA 1HXFH 2VGCC 3SYJA 1UK2A 4H6TA 1GGDB 3SQEE 2B9LA 1BTXA 1GJ8B 2Z3DA 3RDZA 4CR5A 1Z6EA 1LKAA 1OWKA 3CENA 2ZTXA 4JK6A 1TMBH 4ZHLU 2XBYA 4CRGA 1SFIA 5GIBA 1O2IA 1YF4A 3SU2A 1BBRE 1O2LA 1TAWA 2F91A 1ETRH 1GBLA 1F0SA 2P59A 4P00A 2VJ1A 4FUIA 3P8FA 3ZIAD 4D9QA 1GBBA 1Q3XA 1O3EA 3TPIZ 3NWUA 3LONA 3A7WA 1YCPH 2ODPA 4AB9A 3QGNB 2GMTC 2KAIB 4JK5A 1Y5UT 1N6XA 1SLXB 3STJA 2G4TA 4U2WA 3KCGH 1L1NA 4Y0ZE 5EOKA 4Q7XA 1FONA 3BTWE 1ZSLA 2BY9X 2WV9A 1TX7A 1A3EH 4FU9A 4X0WU 1O3CA 2H9HA 3MWIU 1CGJE 1ZSJA 2ZDLA 3SNAA 1TA2A 4GHQA 2Q6DA 3U69H 1K1LA 4Y76A 1XUIA 2V3OH 2BM2A 2PWXA 2ZI2H 3GYMA 5JPMH 1T4VH 4XSKU 2AMPA 3FOAA 1EJNA 3ATKA 5AFYH 2ZGJA 3E8LA 4K1EA 1FY1A 1A3BH 1E0FD 1SGDE 3A8DA 2ZU1A 4HZHA 3W94A 3LGIA 2RDEA 1Y3XA 5EPYA 2ALPA 3FP6E 3U1IB 1AKSA 5DKMA 1NPMA 4LZ4B 1FY5A 1QNJA 4NFFA 4MTBA 2PKSB 1TNJA 1NRPH 3TK9A 1AB9B 2BDGA 3B8JA 4K8BA 1HAGE 1SMFE 1N8OB 2ZDMA 1TGTA 4BAMB 4DJZB 1EATA 1M9UA 2C8ZB 1UMAH 2FI5E 2ZC9H 1WQSA 1UO6A 3C27B 1C4Y2 1DVAH 3OTJE 2UUKB 3ELAH 4YESB 2QXHA 1Z8IB 1P2KA 4MDSA 1CT2E 3WW7A 1BTZA 1EUFA 1RTFB 4UFEH 1UW7A 1V6DA 2BLQA 5EW2H 4ABJA 1TRMA 2OINA 1GWAA 1GCDA 2BOKA 5HIZA 4XDEA 3SJKA 1LCYA 3MMGA 1BRUP 3VXEH 3R3GB 2XC5A 2VIWA 4WWYA 3PB1E 2WPDD 1YLCA 2XOKD 1UVUH 2QC2A 3FN8A 5T1VA 5GWZA 5FX5A 3IWMA 3EE7A 2R3UA 3CS7A 4MPUA 1KLTA 3U9AH 2BLVA 1JXPA 1EOLA 1V2NT 3WY8A 2QXJA 2AGIX 1ZGVA 4X1SU 1DT2A 5C5NA 4U32A 2A32A 5LH8A 4KTUA 3FP7E 2BDBA 3ENSB 4NGAH 1F0TA 1MU6B 1SPJA 1E35B 1P01A 2A7HA 1B0FA 1OHHD 1TLDA 1ZRBA 3DSPA 2AMDA 4UDWH 1TGBA 1C2EA 3Q3YA 2VIVA 3F6UH 1QCPA 1DXPA 1TE0A 3BTHE 1HAZB 1GI3A 3TGIE 4RI0A 1SGFG 4U30A 4YLQH 1K1IA 1TRNA 4FXGH 3RXIA 5EODA 1FAKH 3RM0H 2VWLA 1QIXB 2OC7A 2F43B 1IQLA 1O36A 4ABGA 2OUAA 2TGDA 4WMEA 1ABJH 1NFUA 2IN2A 1C1OA 1VR1H 4MG3A 1AKSB 4DW2U 6GCHG 1J15A 3K9XB 2AFQB 1OPHB 2GD4B 4R0IA 5GCHG 2BZAA 3RXUA 4DT7B 1GHXH 2OC8A 2DE8A 1O5DH 1DPOA 3ODDA 1ZMLA 1ZTJA 2AS9A 2H9EH 1O5GH 2O8WA 4ZKNU 4Y7BA 4F48B 1C1NA 3PV5A 3MH5A 3V3MA 2STBE 3BN9A 2BXTH 1P9SA 2A7JA 2C3SA 4Q7YA 1WSSH 3ZZ3A 1WQVH 2PLXA 1C2KA 5EJ1A 1GHZA 1DITH 5HGGA 4SGBE 5HKKD 4Y6DA 1YPMH 4UEHH 1ZHPA 1VITH 3KHVA 1A5HA 1B0EA 3TK6A 2CHAC 3LGWA 2O8MA 2ZFPH 1FLEE 1MMJN 4INHA 5FL7D 1OX1A 3RXCA 2ZECA 5A8XA 3A89A 3T27A 1EFRD 1LVYA 2FLBH 1BCUH 1TNIA 3V13A 3U8TH 1O3JA 1HDTH 1O3DA 5DP4A 5AHGH 1XXDA 4D76A 2J98A 2UUJB 1ZOMA 1C5WB 3UWJH 4XBBA 1CGIE 1LO6A 3S9AA 3HPTB 3MH7A 2R3YA 1J14A 4X2XA 1O3KA 3F2FA 4JCNA 4XE4A 8KME2 1HNEE 1OYQA 2ZGHA 1HIAA 3LC3A 2FZZA 1TNKA 3UQVA 2F9BH 1TPAE 1EJAA 1BBRK 3GDSA 3SOSA 3SV8A 2GTBA 5LGOA 2Z9GA 3KQBA 2VIPA 1D4PB 1NFXA 4LK4A 1AE8H 2NU1E 3GCOA 1EASA 1GMHF 4XOJA 2TRMA 3E90B 1GBAA 3I78A 2HGTH 4ISIH 1G3BA 3S9CA 1V2KT 4FETA 1K9OE 2DUCA 4X1PU 2FI3E 1W0YH 4MNVA 4B2AA 2Y80A 1UTOA 1EPTA 1AU8A 8GCHG 1Y3UA 5EJZA 2YNAA 1ESAA 2SGQE 2QA9E 3PM3A 1FN6A 5DN6D 1GMCF 4FUBA 1P2MA 4WJG2 1GHAF 1GHBF 1XX9A 2ZU4A 3PLBA 2G4UA 5CHBA 5LPFA 4MPXA 1CU1A 3MU8A 5DP9A 1ELTA 3UR9A 4F4OC 1D3QB 2ZU5A 4H4FA 1C1UH 3ZVFA 2EI8A 1EPTC 3SUDA 2HOBA 1NN6A 1ZTLA 2C90B 5F03A 3A80A 5JYIA 1NY22 2BTCE 3AAVA 3A7ZA 2H1UA 2W3IA 1E37B 1HAIH 1Q2WA 2G5NA 1Y8TA 2WPLS 4NA9H 1UTQA 5GJ4B 5A09A 2JKHA 4KP0A 5JBAS 2W26A 1A61H 2VIDA 3GOVB 3FANA 1TBRH 1MD8A 3URCA 1PPZA 3VB3A 5FX6A 4BAHB 1O3GA 4J2YB 2ZIQH 3CNRA 1YYY1 2XNDD 3ZZ6A 2R9PA 4AGKA 2ULLA 2WPHS 1O2WA 3D23A 1SQTA 1C5TA 3A8CA 6GCHF 4JZDH 1ELDE 2FMJA 2QYIA 2BD2A 2ZNKH 3ZZAA 1ZPBA 4ZROA 2PUXB 5C1YA 1C5QA 3MFJA 6CHAC 4B2CA 1MKWH 2Y6TA 3SU5A 2Z6BD 4TPIZ 2FX4A 5SGAE 4O03A 5H4IB 1O31A 3UY9A 1BJUA 1UTLM 2P16A 3LOXA 4AX9H 2UWLA 2PSYA 2AGEX 2ANWA 3H7TA 2W6ID 2VBCA 3C1KA 4YT6H 2CN0H 1EJMA 1AN1E 3M3VA 2Y82A 1ABIH 1V2MT 1QRWA 1GBIA 5AFZH 2XRCA 5DP5A 2PTNA 1GBKA 1SFQB 1YPGH 2KR7A 1NZQH 2BD3A 2RDLA 2Y7XA 3BTEE 4OS7A 1OWJA 4KGAA 4YTAA 1FIZA 5E8EH 1YM0A 4ABFA 1P05A 2F83A 1KXBA 3AW1A 1RGQA 1GL1A 1FNIA 2HVYB 2JETB 5JBBS 4FUJA 3SZEA 2B5TB 5F8ZA 4GUXA 2L6OA 4ISLA 4A1TA 2RA3A 3SV2H 1P3CA 3BTQE 2ODQA 1VCWA 2A31A 4Y10E 1TNLA 1OS8A 3SNBA 1EAWA 8LPRA 4DT4A 4UONA 2G52A 2EI6A 4CRBA 1ZRKA 1K22H 2UWPA 1MBMA 3UIRA 1FUJA 1ACBE 3E91A 3PV2A 3RXOA 3EGKH 3NK8A 5T3HA 1C5SA 4X2WA 4DCDA 3OY6U 3NCLA 2ZCKP 2FM2A 3TGJE 2B7DH 2VWMA 3VGCC 4OGXA 1FDPA 1NRRH 5F6MA 3A88A 2GV7A 5L2ZH 1P0SH 1OXGA 1S85A 2FDAA 2F3CE 1GBDA 4ASUD 3G01A 1EOJA 3PTBA 4AYVB 3UB0A 1V2JT 4MNXA 2AIPA 2RA0A 3GDUA 1CHGA 1GBMA 1SOZA 3RXVA 4AZ2B 3V12A 2BXUH 1IQEA 2ASUB 1GI4A 1BRAA 2KCAA 5C67A 2O8TA 3NPSA 2AH4X 5L6NH 1O2HA 5K0HA 7ESTE 2PV9B 5FAHA 4JZ1A 3M37A 3OAAD 2BQWB 1ZJKA 1NC6A 1G9IE 1DSTA 3ODFA 2QIQA 2L74A 1A0LA 4I33A 1HFDA 3F2HA 1C1SA 4THNH 1T4UH 2C8XB 1AZZA 1QZ8A 4BOHA 1NROH 2BY7X 1G2LA 4WY3A 3MU1A 1E79D 1MCVA 1BMAA 1GJCB 2GCHF 2QF4A 1E1RD 2GP9B 3FKSD 4OS5A 2GCHG 2YMSD 2BDYA 2BB4A 2ZF0H 3D49H 1EKBB 1P3EA 1BMNH 1B7XB 6ESTA 3FZZA 1A5IA 2ZZUH 1TA6A 3OEHD 5EQRA 1MQ5A 1ZHRA 1UTNA 3KNXA 2FTLE 2I6QA 1O2GH 3MOCA 3VG8A 4B1TA 3ZZ8A 4FU7A 1E38B 3LJJA 1TX6A 1JOUB 1W8BH 3EQ0H 2ZKSA 1C5UA 4YOIA 1DWBH 4FUCA 1YBWA 2ALVA 2VIOA 2ZU3A 5HXFA 3SU6A 1AO5A 5EQQA 1IQNA 1QQUA 1K28D 5EPNA 1MUEB 3LIWA 4ZXYH 5JB8S 2ZFRH 4I31A 2FEQH 1P2JA 1OWIA 3RU4D 1O2JA 2R2WU 1IHSH 1SC8U 2CGAA 1GGDC 2PHBA 2GMTB 2HALA 2A2QH 1OYTH 2ZFFH 2ZFQH 2TGTA 1XUFA 2FIRH 3AAUA 4F55A 2IJD1 3SV9A 4BTIB 2EY4C 2WUCA 1DM4B 1HJ8A 4IMQA 1QFKH 1Y59T 4WMFA 3E0NB 2QF5A 1H9IE 2EI7A 2HNTF 4I8LA 1SBWA 1LDTT 2J9NA 2BY6X 3DT0H 3ZZ5A 1G3DA 2YOLA 3P17H 2Z9KA 1O2XA 4K1SA 3BTME 3F1SB 1T7CA 4OS6A 4ESTE 4X6PA 2B0FA 2P93A 1KDQA 4CH2B 1K1MA 3QZRA 1O2PA 1W13U 3M5LA 3RXQA 1EP6A 1DLEA 3LPRA 4Y8YA 4WXIA 4U01A 1KTSB 1LPGB 3QK1A 3EA8A 1NS3A 3KIDU 1WCZA 2TGPZ 1GBFA 5GNDA 4X1QU 3NKKA 1E34B 3UNQA 1QJ1B 2A5KA 2FOGA 1FV9A 2ZFSA 3N7OA 1O3FA 1QL7A 1MKWK 1K1NA 1UCYH 2PGBB 3SU3A 4AFZA 1ANCA 4CBOA 5FPYA 2XBXA 2P8OB 2Z9IA 2TBSA 2CXVA 2H5DA 2KCYA 1BTYA 1RS0A 1MKXH 1A0JA 3L33A 1TMTH 5DJ7A 2F9NA 4GAWA 3RXRA 3SN8A 1GI7B 4XRNA 3LU9B 1BTUA 1MH0A 3AVZA 4SGAE 4NCYA 1O5AB 1FY3A 2BVXH 4NSYA 1NRQH 1MBQA 2XNIA 3HGNA 3DFLA 5DP8A 1BMMH 5C1UA 5FCKA 3KQEA 1OP0A 4X8SH 1IQHA 2VH6A 4A1XA 1E36B 5C0UA 2OLGA 1S6HA 2WV4A 4ISOA 4AFUA 1MAXA 5ABWA 1F0RA 3U98H 3DD2H 1O3IA 1KLJH 1BTWA 4IW4E 4AOQA 3PWBA 4FVBA 5EXLA 4RSPA 1FAXA 1U6QA 2CJIA 2K8IA 2W6JD 4VGCB 1GL0E 3ZZ7A 3O8BA 4JZFH 5AF9H 4B73A 5C94A 3BTFE 1C5ZB 1DOJA 3QO6A 2YMSB 1WBGB 1AVXA 1C9PA 1YLDA 1TIOA 1S6LA 4A1VA 4Q7ZA 1VGCC 3T28A 4ACAA 1BZXE 1T31A 3SJOA 1ORFA 3SUFA 4BAOB 1QY6A 1G3CA 1UVSH 2NU0E 1A0HB 1AQ7A 4IGDA 1X7AC 3T26A 3GY6A 8ESTE 4OGYA 1BTPA 1Z7KA 1SVPA 7LPRA 3RU4T 1GHVH 2QXIA 2A4OA 4ZH8A 1CBWB 3RLYH 1ZMNA 2GJGA 4TWYA 5IYTA 4ZCNA 2BOHB 2AYWA 3KQCA 2GZ7A 2GCTB 5IK2D 3S0NA 1CT0E 3VFEA 1KLIH 2FS9A 1IQKA 3S7HB 3SU1A 1PYTD 3FZDA 4K1TA 4NIVA 2IOTA 4X2YA 2CF8H 2OD3B 3OY5U 1IQGA 3ZYDA 4NZQA 3SZNA 1TYNA 1C4V2 2VWNA 3F68H 3T2NA 1GJ5H 1AUTC 1S83A 2Y7ZA 2VVVA 4LXBH 1EAXA 1EZQA 1W14U 1MTSA 3IG6B 4AG2A 3TGKE 2P94A 2QN5T 4ZUHA 3GCTG 1RFNA 2ANYA 1W7XH 1LHGH 3Q3KA 1K1JA 3M5MA 1NO9H 1L0ZA 3RXBA 3E3TA 3LH3A 3TH3H 3LGVA 3GCTF 1O5CB 1ZSKA 2FO9A 5A0BA 3PTNA 3BEFB 1O35A 2XWBI 2A7CA 1V2VT 5JBCS 2SNVA 1VCPA 4NFEA 2BDCA 1MU8B 3GDVA 3LKWA 1GHYH 1LVBA 5KECA 4ZKRU 3BTKE 2XBVA 4WXVA 1Z8RA 3D65E 4A5TS 3UUZA 2NU4E 4AFSA 4CRFA 4X8UH 2FX6A 1MZAA 1ANEA 4B74A 4IC5A 1O2KA 1GVZA 4OS2A 2EEKA 1SOTA 5ETXA 2P3UB 1HAHH 3RXGA 3QX5H 1KTTB 2BD4A 2A2XH 1ELCA 2OC1A 3DA9B 3DSOA 4GVUA 4JZEH 1BOQA 9ESTA 5CMXH 2XW9A 3M5OA 1THRH 2J5UA 1T8MA 3KF2A 1GG6C 2GT7A 3KQ5A 3EYDA 1L2EA 3EAJA 2Q6GA 1P2OA 1YKTA 3MI4A 3KQDA 1O32A 4X1RU 4O3UA 1ZLRA 4CH8B 2OBOA 5C2ZA 3GY4A 3GCHC 3BTDE 2G51A 1C5LH 1RIWB 1DS2E 1WYKA 1LKBA 5E2OA 3K65B 1TNHA 1XVMA 3GS9A 2ZPQA 2HPQH 2GZ9A 2YMSC 5DO4H 1JRSA 2AGGX 4Q4LA 2ZTYA 3A84A 1FY4A 2OQUA 1TGCA 5JBTA 1G2MA 1LQEA 1XKBC 2SGPE 1P9UA 2BD9A 1XUGA 3A82A 3MO3A 1PFXC 1ESBA 3TLOA 4BAQB 1V2LT 1ELBA 3ZZDA 1GJBB 1GI6A 5IDKA 1ANDA 3P95A 3GY8A 1DUAA 3LT3A 3RP2A 4HI3A 1GJDB 3Q3XA 1UVOA 5AVDA 1W2KH 2AIQA 3M7TA 5T6DA 5DPAA 4ZHMU 3PLPA 4O3TA 3E16B 1RTLA 1BRCE 1C2JA 1QB9A 3MNSA 4MQAA 4RT1A 1SGYE 1UTKA 1YLNA 1P11E 1P06A 4UFGH 1BDAA 2Z3CA 4DIHH 1KXAA 5FHTA 1O2QA 3TJNA 3UAIC 1SG8B 3QN7A 3U28C 1SLUB 3BG4B 1O2SA 2ZU2A 1YC0A 1ELGA 1BTHH 3O8CA 1K0HA 3AW0A 4MVNA 3UOUA 1ZPCA 3H7OA 1QB1A 2SGDE 3L3TA 2V3HH 1SQOA 1TPPA 3ITIA 3M3SA 1SHHB 5FPTA 1O2TA 1AUJA 2D8WA 2V3MA 3FFGA 1TWXB 2A5IA 1JIRA 1AFQB 5TJXA 2FESH 4DY7B 2P3TB 2UWOA 3U8OH 1TOCB 1XUHA 2HVXA 1C5PA 1GCTC 2A0QB 4GCHG 2V35A 1HLTH 3T5FH 4TPYA 2GKVE 1UHBB 1Y3VA 1OP8A 2C8WB 3PRBA 4CHAB 4CHAC 4Y0YE 1GJ9B 3GYLB 1C5RA 4FUHA 1CVWH 2Y5GA 1AI8H 1TGSZ 2F9PA 4Q80A 3QDZB 3BSQA 3SORA 2FP7B 3ZV9A 3ATLA 4YXWD 3B23B 3SV7A 2VINA 1C2MA 3UNRA 3BV9B 4ABIA 3RC4A 1AFQC 4ISNA 5B6OA 1QA0A 2H2ZA 3BEUA 1D3DB 1XM1A 3ATWA 5A8YA 4NIWA 4I8GA 4BXSA 1FQ3A 2W3KA 2QF0A 1TBZH 3BTTE 1QA7A 5GPIB 1YWUA 3VGCB 5EGMA 4NIYA 4BNRA 3R0FA 2R0LA 3SU4A 2ZDNA 1E1QD 5DP7A 4X2VA 3ZVAA 3NZIA 1CHOG 2Z9JA 2ZFTA 1C1TA 2NU3E 1TBQH 3H09A 3HGPA 5EG4A 2QCYA 3ZZBA 1BQYA 1K1PA 4JZIA 2XYAA 1GMDG 2J98B 1SR5C 1FJSA 1SGNE 3QLPH 5K7RA 1O3NA 2ZDAH 1ARBA 3E1XB 8GCHF 1F0UA 1CO7E 1GDUA 1PQ5A 1V2TT 3M36A 4P02A 2FPZA 1GJ6A 1ZR0A 2UUYA 2Z9LA 3ZVCA 1O3BA 1WV7H 2TPIZ 4BAKB 5I25A 2JJ2D 3GY3A 1ELEE 1TFXA 2W5EA 1LHEH 2WSSD 4K8YA 3KYGA 1PQ8A 5J4QA 1TQ7B 1NM6A 3SGQE 1ZYOA 2XC0A 1CA8B 5F53A 5CE1A 4K69A 2I6SA 1YP9A 1O34A 1G37A 1RIWC 4Y8ZA 3TITA 1TONA 2M5TA 2ZHFH 3OX7U 5BRRE 1L4DA 3SHCH 1W0ZU 2OCVB 2QXGA 3Q00A 1BMLA 3VB4A 2A5AA 4X1NU 4OS4A 1A7SA 1KXDA 4AFQA 3VPKA 2VVCA 3RXAA 1NESE 2IPHA 2XC4A 1OWEA 2P95A 2PUQH 3F0OA 2FYRA 3PMBB 4CREA 3TH2H 1AHTH 1IQMA 3GICB 1THSH 3QTVH 1MTUA 3RXTA 2BX4A 4INLA 3H5CB 5FXLA 2LNCA 1Z1JA 1FPCH 2GDDA 5GCHF 1HAOH 3E6PH 1GBJA 1C2LA 1LHDH 3VB5A 4ZAEA 1HCGA 2J4IA 1KYNA 1ANBA 1VGCB 1SKYE 5HM9A 3AASA 1G30B 4GCHF 2JIZD 4DIIH 3M7QA 5DP3A 4BXWA 3P8NA 1QBVH 3P92A 1O2NA 3PYHA 3SQHE 2XBWA 2ILNA 2HPPH 1AWHB 4UFFH 4AN7A 1SHYA 1QQ4A 2VVUA 1UK3A 2RCEA 4JMYA 1ZZZA 2D2DA 3QUMP 1P09A 4D8NA 1OKXA 1BRBE 1HAVB 3NXPA 4ASHA 1SGFA 4YOJA 1V2QT 1XUJA 1D3TB 2Q6FA 2QY0B 1W12U 1IQFA 1ETTH 1C1RA 5LPEA 1S84A 3ZV8A 1YY3A 3PROA 4E06H 1GPZA 3RMNH 1NU7B 1FMGA 1RD3B 4NZLA 1SGIB 3LGYA 1CHOF 1FXYA 2JH5D 4FOUC 1C2HA 2BLOA 2Z3EA 3BEIB 3TNTA 2BQ7B 2CMYA 3TK5A 1LQDB 4YT7H 4D7FA 4XD7D 1ELVA 2BX3A 3SBKA 1H4WA 1QURH 3RMMH 3A83A 1GBTA 4QT8C 5F8TA 1J17T 2G81E 1HXEH 1UK4A 1GMHG 5FPSA 3K6ZA 1W0JD 3P8GA 1XVOA 3F2GA 3RC5A 4IBLH 1DY8A 2BDAA 1O39A 2F9VA 1Z8GA 2XWAA 3DFJA 3FAOA 3SO3A 3PV4A 7KMEH 3ATMA 2ZDKA 2K0QA 1P2IA 2VH0A 1WDIA 1GHBG 3FVFB 3DUXH 1KDQB 2KZ4A 4FVDA 4Z1MD 1FN8A 1EQ9A 2F9OA 2PSXA 4R8TB 3KYFA 1D6WA 4MNWA 2A45B 1LMWB 1INCA 1O38A 2DE9A 4IN1A 4CRDA 1UVTH 2GV6A 3A8BA 4D9RA 6LPRA 1SGCA 1ZTKA 1KMHB 1AWFH 1F7ZA 5I46H 2HWLB 1HYLA 3SNCA 3RXEA 2CK3D 1KIGH 4J1YA 2OP9A 3QZQA 4XBDA 4XFQA 1J9CH 1TB6H 2C4FH 2WV5A 3MNBA 5DGJA 1HAYB 1G3EA 1QRXA 2A4QA 2ZCHP 1LPKB 4O9VA 1K1OA 1W0KD 4LZ1H 1W11U 3OE7D 3A81A 4MPVA 1MCTA 1DE7H 1AVGH 5EW1H 1Y3WA 4RT0A 5A2MH 4MPWA 2ANMH 2Y5HA 5EU8A 2BDHA 4GLYA 1MD7A 1C2DA 1J8AA 1Y5AT 2WPJS 1N8OC 2ZQ1A 3P70B 2BY5X 1A4WH 3SI4H 2PTCE 2PGQB 4ZMAH 3BIUH 2BLWA 3BTGE 2BD7A 1O2OA 1QHRB 1C2IA 1P12E 4VGCC 1RTKA 4K60A 4ISHH 2OXSA 3A87A 1UHBA 4I8HA 1ZPZA 1SGRE 1T8OA 1MKXK 3HKIB 4F49A 4MLFB 3RXDA 3KN2A 1JBUH 4TYDA 3VB7A 1BHXB 3GY2A 2KX4A 4HG6A 3M61U 5C1XA 5CHAB 3RLWH 3RU4E 1EZSC 5E0HA 3OSYA 1GI8B 2ZHWH 1UCYE 2PP6A 1WUNH 2Z7FE 1QB6A 5DP6A 5ESTE 4DVAU 4NG9H 3T29A 3O8RA 3LDXH 5HM2A 4DG4A 2ZO3H 1QRZA 5GDSH 1C1MA 1FPHH 3MYWA 1F92A 2BDIA 2Y5FA 1DICA 2R0KA 5E0JA 2OBQA 1DDJA 2D1JA 2ZPSA 5FCRA 5HYOA 1TMUH 1EAIA 1TGNA 3OYPA 3U8RH 1DANH 4YOGA 2Z94A 4X6NA 5T6GA 5E0GA 3PMJA 1GVLA 1GI5A 2OTVA 1K21H 1YPHC 5TCAA 2WYJA 1YCPK 4FUDA 3OFND 1DX5M 1GI1A 2AEIH 1OOKB 4TWWA 4WH6A 1MTVA 2FLRH 1YPEH 2BQ6B 3P6ZB 1HGTH 1N1LA 6CHAB 2ZHQH 1WTHD 1EB1H 1O2YA 1RRKA 3O8DA 1LPZB 3SGAE 4JYUH 1O3PB 3A8AA 2VGCB 1VJ9U 5FBEA 2LP6A 4IS5A 3RUOA 5HIYA 1RJXB 1CA0C 3UQOA 1BMFD 2GT8A 3A7VA 1V2PT 3QTOH 3F9EA 1AE5A 2FOCA 3EA9A 4K5ZA 1VITF 1IHTH 3MU4A 1MTNB 4ABDA 3GCHB 2ZQ2A 1OSSA 2GVFA 3ATIA 2TGAA 2BHGA 3URDA 2JDID 4CBNA 4H42U 1A46H 1YCPM 1AD8H 2FWWA 3NUMA 2GZ8A 5EJLA 1QL8A 1TPSA 1TRYA 4B76A 3LH1A 1L1GA 1C4U2 4Q2KA 2SNWA 1W10U 1AGJA 1GBEA 2EC9H 3F0PA 1PPGE 4DOQA 3RM2H 4ACBA 4ABBA 2ZG0H 2AHME 2VWOA 1ID5H 5T6FA 3ESTA 1PPHE 2ANKH 1VCQA 1XKAC 1GHWH 1S81A 1WOFA 1O2ZA 1V3XA 3M5NA 5DK1A 4TY6A 5KGOA 4A92A 1HUTH 1DLKB 4I32A 3ZVEA 3PLKA 1ARCA 3RXFA 1C9TA 2J2UA 1GJAB 4ZXXH 1Y5BT 1O3HA 1GG6B 2SFAA 3GY7A 5EQSA 2IPQX 2PKAB 3BF6H 3SNEA 2Y81A 1FIWA 2FOHA 4M9FA 1ESTA 1NT1A 1C1VH 3ZVBA 5TCCA 3V7TA 4B6EA 3SUGA 1DUEA 3TVJB 1SGPE 4FUGA 4E7NA 4NA8A 1EZUC 2FTMA 1PYTC 3GISB 3F9FA
chains in the Genus database with same CATH topology
2RG3A 1SL3A 1EX3A 4AG1A 1OWHA 1RXPA 3K6YA 1TX8A 2KAIA 3RC6A 3VB6A 1DSUA 3QGJA 3FP8E 4WF8A 5E2PA 1C1QA 4HGCA 2FODA 1NFWA 1KSNA 3ZVGA 5G4BA 1EZXC 2ZWLH 3SNDA 1IAUA 3ZZ9A 3JZ2B 1YPHE 2YNBA 2FOAA 3UOPA 1L4ZA 4YZUA 4Y11E 1W3CA 3A7TA 2H6MA 2BYAX 1Z6JH 1P03A 1GVKB 4NWLA 1F5RA 1TPOA 1QJ6B 3RXLA 3T25A 1UTMA 1GJ4H 1SGQE 2AMQA 1ELAA 3EDXB 3SUEA 4RN6A 2G00A 1KXEA 1GMDF 1KY9A 4O97A 2OQ5A 2O8LA 1A5GH 1ZMJA 2CV3A 4CRAA 1QR3E 1QGFA 3P8OA 1T32A 1XUKA 2J34A 3RXPA 3ZVDA 1AZ8A 3CS0A 4ZKOU 1YPKH 4X8TH 1SI5H 3TNSA 2HNTC 3MH4A 2GDEH 5PTPA 4IN2A 3UREA 2ESTE 1LVOA 3HATH 3UNSA 1O2MA 1IQIA 1XMNB 1HJAC 2ZHEH 4BANB 2ZGBH 3SI3H 2LPRA 1GDQA 2AERH 4CRCA 3HKJB 2ZCLP 3HK3B 2XCNA 4ZKSU 1VITG 2BZ6H 2QAAA 1HRTH 1GHAG 2SGEE 5A0AE 1P2NA 3S7KB 1NRSH 4XBCA 2GCTC 2ZGXH 1HBTH 3ZZ4A 1LTOA 5JB9S 4MNYA 2C8YB 1P8VC 1O0DH 1O33A 1O3MA 3VXFH 2HLCA 1UTJA 1MQ6A 3JZ1B 1UCYK 1Z1IA 4K3JA 2FOMB 2FI4E 3GY5A 4YLUA 1GI9B 1V2WT 5GXPA 4JYVH 3CP7A 2FOEA 1OP2A 3ZZCA 1S0QA 1T8NA 1DWDH 3V0XA 1CA0B 2FOFA 2V6NA 4NSVA 1PQ7A 1DXWA 2G8TA 3BG8A 1Y3YA 1BUIA 3TJVA 2C93B 1H1BA 1UVPA 1C2GA 2ZPRA 1CQQA 1G36A 3A7XA 3F9HA 5BPEA 1CT4E 2JH0D 3UR6A 2BD8A 3UWIA 2P8OC 3A85A 2O9QA 1PPEE 4BTUB 3Q77A 4WMDA 1AVWA 4I8KA 2NU2E 1PQAA 1O3OA 3PWCA 1F5KU 2JETC 1PPFE 1P57B 2WPKS 5C5OA 2A4RA 2ZP0H 2PKSC 1S0RA 3A86A 5EXNA 1S6FA 3RXJA 3PO1B 1PJPA 1W7GH 1QBOA 1V2OT 4B2BA 5FBIA 4FU8A 2CHAB 3RMOH 3MTYA 4NIXA 1CSOE 1S82A 2PKAA 1KXFA 2A4GA 4NA7A 5L2YH 1C1WH 3F9GA 3EE0B 1BJVA 1NFYA 3RXSA 3QWCH 1H9HE 3OU0A 4H6SB 2ZEBA 1DY9A 2FYQA 4GHTA 4KTCA 1IOEA 2WPMS 1SLWB 2D26C 2HNTE 3MNXA 2F9UA 1P10A 1Z8JB 3LC5A 1JIMA 1P2QA 4FUEA 1BT7A 1FZZA 1MTWA 1HJ9A 1EB2A 3BG4C 2WINI 3TJOA 4Y71A 3UFAA 1BIOA 1A1RA 3GCNA 2PFEA 5C20A 1YPLH 3RMLH 3MO9A 1UTPA 1CE5A 1YGCH 2ZDVH 1HV7A 4PROA 2UUFB 5CHAC 4A7IB 2VB0A 5LPRA 2QF3A 3M35A 1SGTA 3SGBE 4YM9A 2SGFE 1V2ST 1NU9A 2W7SA 1O2RA 4I7YH 3KEEA 2PR3A 4OS1A 3TU7H 1HPGA 2J92A 3PMHB 1GCTB 2W7UA 1C5NH 3LJOA 1O30A 3B9FH 5EXMA 2BY8X 3K2UA 1C5VA 1B5GH 1D3PB 3SU0A 5C3NA 3S9BA 1C2FA 4E7RG 1O5FH 2ODYB 1CGHA 3KGPA 1WU1A 3U1JB 1BA8B 3BIVH 1CBWC 1LHCH 2K1QA 1JMOH 2WPIS 3IITA 4D7GA 2QGRA 1A2CH 3VEQB 3SJ8A 2O8UA 1JRTA 1HB0B 3MNCA 4IMZA 1TALA 1AMHA 3I29A 2VNTA 4ABHA 4HTCH 3RXMA 3S69A 1EP5A 1JWTA 2G55A 1OWDA 1TNGA 3L6PA 4IC6A 2XXLA 4X8VH 3SJIA 1SLVB 1D6RA 1LHFH 1SGEE 2Q1JA 4Y8XA 3PMAB 1GBCA 4FUFA 2FOBA 3LGTA 4KTSA 2EA3A 1L1JA 1BB0B 2GX4A 7GCHG 1HAVA 5F8XA 3HK6B 2SGAA 2CF9H 1TQ0B 4RKOB 4KELA 1UJ1A 3MH6A 5L30H 4AYYB 1AIXH 5A0CA 3RXKA 1Z71A 4AB8A 2IJOB 1S5SA 3MU5A 4NWKA 1MTNC 3T62A 1O2VA 4I8JA 1GMCG 2OC0A 1H8DH 4JYTA 1DWCH 2FS8A 1GI0A 2G5VA 4UE7H 1MZDA 2XCFA 1Q31A 4WVPE 1O5EH 4HFPB 1QJ7B 1VJAU 1PPCE 2BMGB 3D62A 1SB1H 1AB9C 4BTTB 1F2SE 3PO1C 1BITA 1C1PA 1WAYB 3UPEA 1GJ7B 1O5BB 1IQJA 2B8OH 4Z6AH 1P02A 1QTFA 1DFPA 1D9IA 2PW8H 1BHXF 4K2YA 3KL6A 2BD5A 4RKJB 3MO6A 2J95A 3STIA 1V2UT 1H8IH 2ZHDA 5DG6A 4LOYH 1QBNA 3LGUA 2ZGCA 1XXFA 1V2RT 2ZA5A 1H9LB 1T8LA 1SQAA 1O37A 1YPJH 4CR9A 4ABAA 1LVMA 1PPBH 1QL9A 1O3AA 2H9TH 2HRVA 2WUBA 4ZHAA 2R2MB 1C5YB 5JDUB 9LPRA 3SW2B 4B75A 2JH6D 1TABE 5ESBA 1NTPA 1HAXB 3M7UA 4X6OA 1N6YA 3EA7A 5J4SA 2STAE 1O2UA 1FY8E 3DHKH 2VU8E 1G32B 2FXRA 4AGJA 4DURA 1HJAB 4M7GA 3MHWU 1SSXA 1WTGH 3Q76A 4WH8A 3SJ9A 1THPB 2V0BA 2J38A 4TY7A 1KXCA 2TIOA 1ETSH 4Y79A 3ZYEA 2BVSH 1C5XB 1C5MD 1GBHA 4Y7AA 1GDNA 1K2I1 3E0PB 3W95A 1MAYA 4GSOA 1EAUA 2ZTZA 2THFB 1DWEH 1VZQH 2GGVB 4YO9A 2J94A 2WYGA 1J16A 1NRNH 4Z0KA 1HAPH 4KKDA 2VIQA 3A7YA 3SV6A 4E05H 1EPTB 4ABEA 3MU0A 3TJUA 4GPGA 1TOMH 4UFDH 4UD9H 2QV1A 1GI2A 1BBRH 4B71A 4X6MA 4INKA 3M3TA 1HIAB 4A6LA 2BVRH 2A1DB 1AY6H 1EXFA 1AFEH 2NWNA 5A8ZA 3SHAH 2P3FH 3I77A 1F5LA 1ZHMA 4AORA 1FI8A 4DGJA 3UTUH 7GCHF 1ZGIA 1O3LA 1ELFA 2XTTB 3TIUA 2H5CA 3TH4H 1ZJDA 1C5OH 1P04A 5HMAA 3RXHA 1HXFH 2VGCC 1UK2A 4H6TA 1GGDB 3SQEE 2B9LA 1BTXA 1GJ8B 2Z3DA 3RDZA 4CR5A 1Z6EA 1LKAA 1OWKA 3CENA 2ZTXA 4JK6A 1TMBH 4ZHLU 2XBYA 4CRGA 1SFIA 5GIBA 1O2IA 1YF4A 3SU2A 1BBRE 1O2LA 1TAWA 2F91A 1ETRH 1GBLA 1F0SA 2P59A 2VJ1A 4FUIA 3P8FA 4D9QA 1GBBA 1Q3XA 1O3EA 3TPIZ 3NWUA 3LONA 3A7WA 1YCPH 2ODPA 4AB9A 3QGNB 2GMTC 2KAIB 4JK5A 1Y5UT 1N6XA 1SLXB 3STJA 2G4TA 4U2WA 3KCGH 1L1NA 4Y0ZE 5EOKA 4Q7XA 1FONA 3BTWE 1ZSLA 2BY9X 1TX7A 1A3EH 4FU9A 4X0WU 1O3CA 2H9HA 3MWIU 1CGJE 1ZSJA 2ZDLA 3SNAA 1TA2A 4GHQA 2Q6DA 3U69H 1K1LA 4Y76A 1XUIA 2V3OH 2BM2A 2PWXA 2ZI2H 3GYMA 5JPMH 1T4VH 4XSKU 2AMPA 1EJNA 3ATKA 5AFYH 2ZGJA 3E8LA 4K1EA 1FY1A 1A3BH 1E0FD 1SGDE 3A8DA 2ZU1A 4HZHA 3W94A 3LGIA 1Y3XA 5EPYA 2ALPA 3FP6E 3U1IB 1AKSA 5DKMA 1NPMA 4LZ4B 1FY5A 1QNJA 4NFFA 4MTBA 2PKSB 1TNJA 1NRPH 3TK9A 1AB9B 2BDGA 3B8JA 4K8BA 1HAGE 1SMFE 1N8OB 2ZDMA 1TGTA 4BAMB 4DJZB 1EATA 1M9UA 2C8ZB 1UMAH 2FI5E 2ZC9H 1WQSA 1UO6A 3C27B 1C4Y2 1DVAH 3OTJE 2UUKB 3ELAH 4YESB 2QXHA 1Z8IB 1P2KA 4MDSA 1CT2E 1BTZA 1EUFA 1RTFB 4UFEH 1V6DA 2BLQA 5EW2H 4ABJA 1TRMA 2OINA 1GWAA 1GCDA 2BOKA 4XDEA 3SJKA 1LCYA 3MMGA 1BRUP 3VXEH 3R3GB 2XC5A 2VIWA 4WWYA 3PB1E 1YLCA 1UVUH 2QC2A 5GWZA 5FX5A 3IWMA 2R3UA 3CS7A 4MPUA 1KLTA 3U9AH 2BLVA 1JXPA 1EOLA 1V2NT 3WY8A 2QXJA 2AGIX 1ZGVA 4X1SU 1DT2A 5C5NA 4U32A 2A32A 5LH8A 4KTUA 3FP7E 2BDBA 3ENSB 4NGAH 1F0TA 1MU6B 1SPJA 1E35B 1P01A 2A7HA 1B0FA 1TLDA 1ZRBA 4UDWH 2AMDA 1TGBA 1C2EA 3Q3YA 2VIVA 3F6UH 1QCPA 1DXPA 1TE0A 3BTHE 1HAZB 1GI3A 3TGIE 1SGFG 4U30A 4YLQH 1K1IA 1TRNA 4FXGH 3RXIA 5EODA 1FAKH 3RM0H 2VWLA 1QIXB 2OC7A 1IQLA 1O36A 4ABGA 2OUAA 2TGDA 4WMEA 1ABJH 1NFUA 2IN2A 1C1OA 1VR1H 4MG3A 1AKSB 4DW2U 6GCHG 1J15A 3K9XB 2AFQB 1OPHB 2GD4B 4R0IA 5GCHG 2BZAA 3RXUA 4DT7B 1GHXH 2OC8A 2DE8A 1O5DH 1DPOA 3ODDA 1ZMLA 1ZTJA 2AS9A 2H9EH 1O5GH 2O8WA 4ZKNU 4Y7BA 1C1NA 3MH5A 3V3MA 2STBE 3BN9A 2BXTH 1P9SA 2A7JA 2C3SA 4Q7YA 1WSSH 3ZZ3A 1WQVH 2PLXA 1C2KA 1GHZA 1DITH 5HGGA 4SGBE 4Y6DA 1YPMH 4UEHH 1ZHPA 1VITH 3KHVA 1A5HA 1B0EA 3TK6A 2CHAC 3LGWA 2O8MA 2ZFPH 1FLEE 1MMJN 4INHA 1OX1A 3RXCA 2ZECA 5A8XA 3A89A 3T27A 1LVYA 2FLBH 1BCUH 1TNIA 3V13A 3U8TH 1O3JA 1HDTH 1O3DA 5DP4A 5AHGH 1XXDA 4D76A 2UUJB 1ZOMA 1C5WB 3UWJH 4XBBA 1CGIE 1LO6A 3S9AA 3HPTB 3MH7A 2R3YA 1J14A 4X2XA 1O3KA 4JCNA 4XE4A 8KME2 1HNEE 1OYQA 2ZGHA 1HIAA 3LC3A 2FZZA 1TNKA 3UQVA 2F9BH 1TPAE 1EJAA 1BBRK 3GDSA 3SOSA 3SV8A 2GTBA 5LGOA 2Z9GA 3KQBA 2VIPA 1D4PB 1NFXA 4LK4A 1AE8H 2NU1E 3GCOA 1EASA 1GMHF 4XOJA 2TRMA 3E90B 1GBAA 3I78A 2HGTH 4ISIH 1G3BA 3S9CA 1V2KT 1K9OE 2DUCA 4X1PU 2FI3E 1W0YH 4MNVA 4B2AA 2Y80A 1UTOA 1EPTA 1AU8A 8GCHG 1Y3UA 2YNAA 1ESAA 2SGQE 2QA9E 3PM3A 1FN6A 1GMCF 4FUBA 1P2MA 4WJG2 1GHAF 1GHBF 1XX9A 2ZU4A 3PLBA 2G4UA 5LPFA 4MPXA 1CU1A 3MU8A 5DP9A 1ELTA 3UR9A 4F4OC 1D3QB 2ZU5A 4H4FA 1C1UH 3ZVFA 2EI8A 1EPTC 3SUDA 2HOBA 1NN6A 1ZTLA 2C90B 5F03A 3A80A 5JYIA 1NY22 2BTCE 3AAVA 3A7ZA 2H1UA 2W3IA 1E37B 1HAIH 1Q2WA 2G5NA 1Y8TA 2WPLS 4NA9H 1UTQA 5GJ4B 5A09A 2JKHA 4KP0A 5JBAS 2W26A 1A61H 2VIDA 3GOVB 3FANA 1TBRH 1MD8A 3URCA 1PPZA 3VB3A 5FX6A 4BAHB 1O3GA 4J2YB 2ZIQH 1YYY1 4AGKA 3ZZ6A 2R9PA 2ULLA 2WPHS 1O2WA 3D23A 1SQTA 1C5TA 3A8CA 6GCHF 4JZDH 1ELDE 2FMJA 2QYIA 2BD2A 2ZNKH 3ZZAA 1ZPBA 4ZROA 2PUXB 5C1YA 1C5QA 3MFJA 6CHAC 4B2CA 1MKWH 2Y6TA 3SU5A 2Z6BD 4TPIZ 2FX4A 5SGAE 4O03A 5H4IB 1O31A 3UY9A 1BJUA 1UTLM 2P16A 3LOXA 4AX9H 2UWLA 2PSYA 2AGEX 2ANWA 3H7TA 3C1KA 4YT6H 2CN0H 1EJMA 1AN1E 3M3VA 2Y82A 1ABIH 1V2MT 1QRWA 1GBIA 5AFZH 2XRCA 5DP5A 2PTNA 1GBKA 1SFQB 1YPGH 1NZQH 2BD3A 2RDLA 2Y7XA 3BTEE 4OS7A 1OWJA 4KGAA 4YTAA 1FIZA 5E8EH 1YM0A 4ABFA 1P05A 2F83A 1KXBA 3AW1A 1RGQA 1GL1A 1FNIA 2JETB 5JBBS 4FUJA 2B5TB 5F8ZA 4GUXA 4ISLA 4A1TA 2RA3A 3SV2H 1P3CA 3BTQE 2ODQA 1VCWA 2A31A 4Y10E 1TNLA 1OS8A 3SNBA 1EAWA 8LPRA 4UONA 2G52A 2EI6A 4CRBA 1ZRKA 1K22H 2UWPA 1MBMA 3UIRA 1FUJA 1ACBE 3E91A 3RXOA 3EGKH 3NK8A 5T3HA 1C5SA 4X2WA 4DCDA 3OY6U 3NCLA 2ZCKP 2FM2A 3TGJE 2B7DH 2VWMA 3VGCC 4OGXA 1FDPA 1NRRH 5F6MA 3A88A 2GV7A 5L2ZH 1P0SH 1OXGA 1S85A 2FDAA 2F3CE 1GBDA 3G01A 1EOJA 3PTBA 4AYVB 1V2JT 4MNXA 2AIPA 2RA0A 3GDUA 1CHGA 1GBMA 1SOZA 3RXVA 4AZ2B 3V12A 2BXUH 1IQEA 2ASUB 1GI4A 1BRAA 5C67A 2O8TA 3NPSA 2AH4X 5L6NH 1O2HA 5K0HA 7ESTE<