1PQ5A

Trypsin at ph 5, 0.85 a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Trypsin Revisited: CRYSTALLOGRAPHY AT (SUB) ATOMIC RESOLUTION AND QUANTUM CHEMISTRY REVEALING DETAILS OF CATALYSIS.
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq5A01
3ENSB 5FAHA 1SGTA 3K6YA 3S7KB 2ZGBH 2OBOA 2BLOA 2ZFSA 2GMTB 1WSSH 1KLIH 3M35A 5AVDA 5C5OA 1FY3A 3RP2A 3RXVA 1T8NA 1EB1H 3BEUA 1ARBA 3TJVA 2BVXH 1SQTA 3RXBA 1HXFH 4SGBE 4ABHA 3KIDU 4X2YA 1GBDA 4ISIH 2D26C 3DFJA 2IJOB 1RGQA 3SGQE 2ZDKA 1O3FA 3W94A 3SOSA 4X6MA 5DP5A 3S7HB 2OC1A 1SQOA 1GI6A 1GI7B 3H7TA 1ZHRA 1HPGA 5TCCA 2OINA 3SW2B 2BY7X 1ELCA 2ZCHP 1NU9A 4NWLA 1W2KH 1Y5UT 1C1RA 1AHTH 3UY9A 1TRNA 4TYDA 1P06A 4R8TB 1EX3A 1ANEA 4JCNA 4NIWA 1ZGVA 3QTOH 1O5DH 1YPJH 2Z9LA 2FI3E 5EQSA 1MTWA 4B2CA 2F9BH 4YESB 1LPGB 1C1UH 3LPRA 3PMJA 3TJOA 4Y8ZA 1C1NA 1ESBA 3GY4A 3QGJA 1GI9B 1ORFA 1G3CA 1NM6A 2BZAA 1O3AA 3BIUH 1EZXC 3HATH 4AORA 2GCTB 4Y7AA 1HV7A 1GDUA 2ASUB 6GCHG 3VGCB 4X2WA 2G5NA 1N6XA 2CF8H 3NXPA 2WPJS 2HPPH 1BRAA 4H6SB 5E0JA 1CSOE 3BV9B 3U98H 1W10U 2TBSA 5FPSA 1UHBA 1ZMLA 1GHBG 3LJJA 1TGTA 2ZGHA 1K1NA 3RMNH 3UR9A 1OWEA 3UNQA 3SNEA 2BD2A 2HPQH 1V2OT 2QXHA 1O2QA 2G4TA 3A8BA 4B74A 1P3EA 3ZVAA 1LVBA 4JMYA 1DSTA 1TGSZ 4Y8XA 4A92A 3UIRA 4DURA 1CQQA 2Y5FA 3P8FA 3UQOA 1ELGA 1FY8E 1HIAB 3F1SB 1XUKA 1TPSA 2C8WB 4FUBA 1TNKA 1XMNB 2OC0A 3E91A 4X2VA 5A8YA 1C2MA 1RFNA 1BZXE 1GHWH 1H9HE 1V2JT 1MU6B 2PKSC 1J15A 2ZKSA 4ZH8A 1EP6A 1TFXA 1NFXA 3QLPH 3UWIA 2YNAA 4LK4A 1CA0B 2QF3A 2ALVA 2ZPQA 4OS7A 2XBYA 1C1WH 1DANH 2BHGA 2F9NA 9ESTA 2ANWA 1K1IA 1AN1E 4NA9H 3A7XA 5GWZA 1P9UA 1SHYA 4KTSA 1XVMA 2H9HA 1LCYA 3SBKA 1KXBA 1TA6A 2VIPA 1UHBB 4GHQA 2BDHA 3SJ8A 4Q7XA 3K65B 1O37A 5GCHF 4ABDA 2A7CA 1DITH 3RXQA 2A4QA 1C5UA 1F0RA 3CP7A 5E0GA 1TNIA 2WPIS 3A86A 1TONA 3SJIA 2RDLA 3VFEA 1Y3YA 5DP6A 4B76A 1FPHH 1OYTH 4AYYB 2Y7XA 1PPFE 3NK8A 3F9GA 4D76A 1HDTH 1OWHA 3AAVA 1BIOA 1OOKB 2PGBB 3KN2A 1GL0E 1ZPZA 1C5TA 1BHXF 3PV4A 2Z9IA 5E8EH 4WVPE 4Z6AH 1A5IA 4ZROA 2SNVA 2PUQH 3ZVGA 1O3HA 4MPWA 1CE5A 1B0EA 2BYAX 1K21H 5HM2A 4OS2A 2V3HH 4AN7A 5ETXA 1J9CH 3KHVA 2VH6A 3BEIB 3CENA 4O9VA 2NU1E 4ABGA 1GBLA 4HZHA 3PROA 1YM0A 4QT8C 1YC0A 2Q1JA 1KXEA 3QGNB 3ZZ4A 3K6ZA 2ZFQH 3D62A 3PLKA 3KQDA 1SGCA 3MHWU 3BIVH 3P8OA 1QNJA 4GUXA 5DKMA 2TRMA 2BX3A 4FVDA 2BZ6H 1KYNA 2FOEA 3UNRA 2CHAB 7KMEH 1SLWB 2ZFFH 5JBAS 1QB1A 1V2VT 1PQ7A 3OTJE 1CT2E 1OP8A 1P05A 1SR5C 2XC5A 3O8RA 1XVOA 3RC4A 4ZMAH 3M5NA 5J4QA 1THSH 1C1VH 2ZDLA 2XXLA 1GJ6A 1C5WB 1P2IA 1TB6H 1FLEE 1ABIH 1DVAH 3HK6B 3LKWA 1DWDH 1SLUB 3LH1A 1SGRE 4CREA 2QF0A 1IOEA 3IG6B 3VB5A 2P3FH 2QCYA 2EI6A 3KEEA 2OQUA 1PFXC 1CVWH 2AGIX 3TH3H 1G3DA 1BUIA 1XKBC 1O33A 1CA8B 3I29A 4FUIA 1TRMA 3A85A 1G3BA 1L4DA 1OWDA 2ZO3H 4DW2U 1Z6JH 2PTNA 1P8VC 2IOTA 3GDUA 1V2NT 1GHVH 1MTNB 4BNRA 2P95A 1GG6B 7LPRA 2ZHWH 1ESAA 2JETC 2GX4A 2VIWA 4RKJB 1OPHB 2AGGX 1G9IE 4NFFA 3EA7A 1K1MA 2FPZA 3PB1E 1S81A 3BSQA 1WAYB 4Q2KA 4UONA 1C1SA 1UTKA 1ZSKA 4O3UA 1IQKA 1IQJA 1VCPA 2FTLE 1ETTH 3HGPA 3D65E 1IQFA 4A1VA 2C8ZB 1UK2A 2A5IA 1W0ZU 3RXHA 1XKAC 4IN1A 2O8WA 5EPNA 5GDSH 4Y11E 4E7RG 1JBUH 2VVUA 2BY9X 3DD2H 1W11U 1VCQA 2KAIB 7GCHF 4XE4A 1ZRKA 3SNDA 3UQVA 1WYKA 4X0WU 2XBXA 1QB9A 4YLUA 1S0RA 5PTPA 1JIMA 2QY0B 3L3TA 1S5SA 1LKBA 1A1RA 1UK4A 2FS8A 2G51A 3RXAA 4AFSA 3SJKA 3BG4C 2ZNKH 1E37B 3BEFB 3MI4A 1MH0A 3ZZDA 2WV5A 4BXWA 4TY6A 1YYY1 2VB0A 1YCPH 2FYQA 1AFEH 5JB9S 3A8AA 1RTLA 3M7TA 1DE7H 3PO1B 1K22H 4XBCA 5L6NH 1TQ7B 1RJXB 5E0HA 1O2YA 3U9AH 2YNBA 1UVSH 5FPYA 1PYTD 2ZTZA 2W5EA 2BMGB 2H9TH 3K9XB 1FIWA 3ATWA 4XOJA 1GMCF 2RA3A 1SVPA 3E3TA 2D1JA 3SQEE 1O3DA 2WYJA 2ZU1A 4ABIA 1UTOA 3JZ2B 4GCHF 5FPTA 3Q3XA 4NGAH 2ZTXA 1TGBA 5EOKA 1AQ7A 2VGCC 2ZIQH 1AZ8A 2C8XB 4BAMB 5T6FA 1JOUB 1N8OC 4BAKB 1O5FH 1OWIA 4XSKU 4CR9A 4CBOA 5IYTA 2V35A 3URCA 2WPMS 1D6WA 1JXPA 1UVPA 1CU1A 1CGIE 2R9PA 2W3KA 4J1YA 1Y5AT 1EOJA 1JRTA 1YCPM 4FXGH 3ZV9A 1GI8B 1GI2A 1C4V2 2AMQA 1GI1A 1DXPA 1EPTC 5AFYH 3MNXA 3PMBB 3Q76A 3SV8A 3AAUA 4ZKOU 1GJ9B 1KDQB 1Y5BT 2Z7FE 1TMUH 1TPOA 4JK6A 2UUYA 2WPKS 2BQ6B 3EAJA 4U32A 2C3SA 2FO9A 3RXCA 4NSYA 1FAXA 1C2HA 3MH5A 3SU5A 1EZSC 1FY5A 4OGYA 8ESTE 2PKAA 1W0YH 1BTPA 1S6HA 1F0UA 3RXEA 1D3TB 4UD9H 2R3YA 1H9IE 3UWJH 4K1EA 1LVYA 4JYTA 1LKAA 1V3XA 3O8BA 3UPEA 1P2OA 2ZP0H 1ANBA 2JH5D 1O2NA 2Q6DA 2A7JA 4CH8B 4FU8A 1HJAC 3VXEH 2O8UA 3HGNA 3ZVCA 1Q31A 2GGVB 4CRAA 3EE0B 4FU9A 1C2GA 1ELBA 2GT8A 3MTYA 4VGCC 2F9OA 1C5XB 2HRVA 3BF6H 1O5GH 1LVOA 2I6QA 1J17T 4BAOB 1W7GH 1XUHA 1NC6A 5EQRA 1O35A 2HOBA 5GCHG 1VITF 3RXKA 4DT7B 1QJ6B 3RMLH 2XYAA 1SLXB 5K7RA 1EAUA 1O3LA 1CGHA 3GCTF 2PKAB 4HFPB 1GBJA 3LDXH 2Y81A 2ZDAH 1HYLA 3SORA 3STIA 2AH4X 1OSSA 1BA8B 1GJAB 3RC6A 3SNAA 1QBOA 1QQUA 1GWAA 5JDUB 3VB6A 1O3EA 3VB3A 3PLPA 1S6FA 2AYWA 1AY6H 2BXUH 1HRTH 1V2KT 3GY7A 2Z3EA 4NIYA 2BX4A 2Y6TA 5JYIA 1CHOF 2XRCA 1VCWA 4X8TH 1YP9A 1BHXB 1AZZA 1GGDC 2QGRA 1D3PB 4MVNA 4WMEA 1O38A 1A4WH 2FODA 1AKSB 1ZZZA 2P93A 3ATKA 2GD4B 1PPCE 1L1JA 1SGIB 4X1RU 3R0FA 2FP7B 3QO6A 4IC5A 2ZGXH 4LOYH 2J38A 1K1PA 2EA3A 3D23A 3ZYEA 4X1QU 4TY7A 5E2OA 4NZLA 5FBIA 3NCLA 2VNTA 5DP3A 1O2VA 3GCHB 4MDSA 4I8HA 3FZDA 5FBEA 3EGKH 4Y8YA 1MKWH 1V2PT 3GCNA 3D49H 4JZEH 1Y3WA 2P3UB 1V2UT 2BVRH 8GCHG 2W7SA 5GIBA 1AFQC 1WCZA 3UOUA 2JETB 5DG6A 1T8OA 3RXPA 1A46H 1UVOA 5JBCS 2AIQA 1W13U 1GBBA 1NU7B 1UCYK 3LC3A 2ILNA 2GTBA 4RKOB 3UFAA 2B0FA 2C8YB 3ODFA 1Z6EA 4ZXXH 2CF9H 3CS7A 1FI8A 1W8BH 5J4SA 1QA7A 3DT0H 3GICB 2R0KA 1ARCA 4WF8A 3OX7U 1JMOH 1EASA 1NPMA 1Z71A 2HALA 3S9CA 1V6DA 1D4PB 1C9PA 1XXFA 1CO7E 2FIRH 3NKKA 3PWBA 4AG1A 1AU8A 3BTWE 2BD7A 3ZV8A 3E16B 1IQIA 1IQMA 3HKJB 1MKXK 3P8NA 2IN2A 5L30H 1O2WA 2ULLA 1SG8B 3BG4B 2FS9A 1K1JA 1PQ5A 1O2GH 1HIAA 3SQHE 1PQ8A 1Y3XA 1GVZA 1OP2A 4Y71A 1SSXA 2G55A 1PPHE 3NPSA 1YPMH 2TIOA 3RXTA 1KXDA 3LGIA 3A83A 3PO1C 4CRFA 2OLGA 1AUJA 4NCYA 1DFPA 2OD3B 1DWBH 1TOMH 3SUEA 7GCHG 1EPTA 1O2ZA 1EATA 3M36A 2VIQA 1AWFH 2BXTH 2O8LA 4IC6A 5EG4A 3MO3A 1PYTC 5JBBS 2XCFA 4B2BA 5DP4A 4WXIA 2NU3E 1AGJA 1GI5A 1SBWA 4NWKA 3SI3H 5GJ4B 1FN8A 2ZG0H 4I7YH 3SZNA 3FVFB 2G8TA 1B7XB 1P02A 4B1TA 2BD9A 3SUDA 2FOMB 1UJ1A 1RS0A 2DE9A 1P01A 1T32A 2VGCB 5L2YH 1DDJA 1CT0E 1GMDG 2BDBA 3OY5U 3U1IB 1P12E 2I6SA 1MQ6A 2AS9A 2F3CE 4AZ2B 1N8OB 1UTMA 3TK6A 5HYOA 2A7HA 1BTXA 5EXNA 1TALA 4I8JA 2FESH 4A7IB 1C1TA 1GMCG 1GHAF 1BTWA 5DP7A 1O36A 1AO5A 1FY4A 3AVZA 1P3CA 5AHGH 3V3MA 2GCHF 4GCHG 5I25A 2PV9B 1AWHB 2BLWA 2FXRA 4U2WA 3GY3A 1BRUP 1EPTB 4ISOA 5B6OA 1BMMH 2A0QB 3FAOA 2UUKB 1DSUA 1MUEB 4I8GA 2FOGA 3P8GA 4BTTB 1P2QA 4ZKNU 1VZQH 2BTCE 1YCPK 3U8OH 1O2IA 5DO4H 1NO9H 1NRQH 1AE8H 1O5AB 3SU1A 1JWTA 4DY7B 3SN8A 1O34A 2TGDA 4BAHB 4DIHH 1AMHA 4CHAC 3S9BA 1LHDH 3A82A 3TIUA 2UWOA 3QK1A 1QRXA 2PLXA 2BLVA 2FLRH 2VIDA 5A8XA 2BLQA 3SNCA 4DGJA 3MFJA 1C2KA 2BDIA 2VWMA 2FI5E 4JZIA 1W14U 2OXSA 4ZHAA 1KTTB 2BY6X 3ZVDA 4AOQA 2BDGA 2Q6FA 1A3BH 3MWIU 2JKHA 5LH8A 3Q77A 3E6PH 1FMGA 1HJAB 1SL3A 3ELAH 4ZKSU 1Z8RA 1NRNH 1TBQH 1THPB 2SGDE 4UFGH 3BTEE 1O3CA 4FU7A 1HAIH 1XM1A 3ODDA 1SGFA 1UCYE 4VGCB 2ZU2A 2Z3DA 2J95A 2SGQE 1TMTH 4Y0ZE 2VVVA 1QY6A 5FCRA 1Z8GA 2AMPA 2OC8A 1CBWC 2GT7A 1DWCH 1K2I1 1A7SA 2A5KA 4RN6A 2STBE 2VIOA 1NRRH 4O3TA 4FUJA 1H4WA 3EYDA 5C5NA 3PLBA 2XNIA 3IWMA 1KXFA 3MU5A 4YOJA 3MH6A 3TH2H 3TGIE 1BTUA 4Y7BA 4GPGA 2ANYA 3PM3A 1YPHC 2F9UA 3QUMP 1MBQA 3DFLA 1QBVH 2SGEE 1YPHE 1ZYOA 1KLJH 1G2LA 3RDZA 2G81E 3A8DA 1MD8A 2FLBH 3ATIA 3QN7A 4O97A 1QQ4A 1TX7A 1TNGA 5A0CA 1TX6A 4YT6H 1SB1H 1BMLA 3M5MA 2ZU4A 5DP8A 3M7UA 1P2MA 1BBRK 2V6NA 1MMJN 2AGEX 2Y5GA 3A8CA 3S69A 5C2ZA 1P2NA 1DX5M 2QN5T 4AG2A 1F92A 1GGDB 1GI0A 1Q3XA 1SGFG 3OSYA 4HGCA 3A81A 3UUZA 3KQCA 1WV7H 4ABEA 2G4UA 2QXIA 5GXPA 2KAIA 3F68H 1GJ5H 1Y3UA 3QX5H 1T4UH 4ZAEA 1SHHB 3MMGA 1A61H 2ZDMA 1BT7A 4D7FA 2PW8H 1A0HB 3ATMA 2QC2A 5FX5A 1C2DA 1NN6A 1QRWA 1JIRA 3BTFE 3GOVB 5IDKA 2SGPE 3GCHC 3MU1A 2A4RA 1HAYB 1QB6A 2XWAA 3KF2A 2PWXA 5CHAB 5C1YA 2TGPZ 4JK5A 1XUJA 3M3TA 4DVAU 1TLDA 1ZOMA 3M3VA 3VB7A 1KXAA 1P2JA 1PPGE 2ODPA 3BTQE 2A5AA 2GZ7A 3NUMA 1JRSA 4IGDA 1O3KA 3A7ZA 1O2UA 2THFB 3GISB 5LPEA 1AFQB 3RU4D 1YF4A 3R3GB 1NY22 2ANMH 3IITA 4IW4E 1BTYA 1GCTB 2XBWA 4AFQA 4FUGA 1ZPCA 4E7NA 1H1BA 3LGVA 1A0JA 3SNBA 1SFQB 2NU2E 2J9NA 4OS5A 1PPZA 4AGKA 2A45B 3M61U 5A0BA 2BQ7B 3MO6A 4NG9H 5CE1A 1A5HA 4AYVB 1TABE 1C2EA 2R2WU 2WV4A 1B0FA 3RXDA 1O3OA 1C9TA 4MPXA 2PHBA 4ZHMU 4INLA 3SHAH 3N7OA 3L33A 3JZ1B 4JYVH 1C4Y2 2P59A 2Z94A 3O8CA 4GVUA 2A2QH 5HGGA 3M37A 2FI4E 3MO9A 3A7VA 4Y79A 4WWYA 1P0SH 1Z1IA 3B8JA 5FXLA 3VEQB 1GJBB 2R2MB 2EC9H 2TGAA 2Z6BD 2UWPA 1MCTA 1KDQA 4JYUH 5TCAA 3ZZAA 2XBVA 6GCHF 1YPLH 1RIWC 1QGFA 4KTCA 2W7UA 2Y80A 1O5BB 1GJDB 1MTUA 1MKWK 4Q7YA 3E0PB 1P03A 2LPRA 4BOHA 1LTOA 1DWEH 3OU0A 1SFIA 4CRGA 1GI3A 1ELFA 4D9QA 1DY8A 3MU8A 2JH0D 1IHSH 3T25A 1E0FD 4NIVA 5EXMA 5E2PA 3A7TA 1DOJA 1WTGH 1SMFE 1W3CA 3PTBA 2H1UA 1YGCH 1ELVA 3UR6A 1CT4E 4YZUA 3PMHB 4A6LA 3G01A 4ZXYH 1MD7A 1PPBH 2FOAA 1H8IH 4YM9A 3O8DA 3EA8A 4INHA 3U69H 3SUFA 1GJ8B 1SGQE 1QL7A 4PROA 2VH0A 3P92A 4I32A 1BJVA 4JZ1A 1TMBH 2GKVE 2BD4A 2CMYA 1FJSA 1BBRE 1F2SE 2ESTE 3A80A 3BN9A 1ID5H 4CH2B 3BTME 3H5CB 5C67A 1GBCA 2FX6A 2BY8X 3RXLA 3Q00A 5G4BA 1KXCA 2BD5A 5HM9A 3PWCA 3HPTB 1PQAA 1UO6A 1S83A 1HAOH 4GAWA 3VPKA 1SLVB 2B7DH 2HLCA 4CR5A 2ZWLH 4YO9A 1GHAG 2GVFA 2ZHFH 4OS1A 4X8SH 4YTAA 4CHAB 1MQ5A 3I77A 4K8BA 1UTQA 2GCHG 1LQDB 3P17H 3VB4A 1DXWA 4THNH 4GLYA 1O2KA 1ETSH 1KSNA 1BRCE 3E90B 4ABJA 1Y3VA 5C1XA 1FZZA 1K1OA 2CGAA 3TGJE 3EA9A 1MCVA 2P8OC 1LPZB 3RXMA 2FOBA 1V2QT 4MLFB 1NESE 2F9PA 1TPPA 1MBMA 1TBZH 1AKSA 2PFEA 1FIZA 1O30A 2G5VA 3SU4A 5HXFA 5ABWA 1Y59T 1INCA 4BTIB 1ANCA 3UTUH 4D7GA 1FN6A 5F8TA 3LU9B 4IMQA 2Z3CA 3UREA 1GCDA 1D3DB 2XTTB 3GY6A 2VWOA 4YLQH 4TPYA 1CBWB 4D8NA 1A2CH 2GDDA 1GBHA 2DUCA 1EOLA 4KELA 5C3NA 1KY9A 3TK9A 5SGAE 4MNYA 1ZJDA 4K60A 1ZPBA 1WOFA 4WXVA 1ELTA 3LGTA 4M7GA 1FY1A 1LQEA 3M7QA 5A0AE 6CHAC 2C90B 3SU6A 1O2PA 1AB9C 4HTCH 5A2MH 1SGEE 2FOHA 4B71A 1GBTA 1WBGB 1VJAU 1UTJA 4MTBA 4A1TA 1O2OA 3GYLB 1O3PB 1C2LA 1XUFA 4X6NA 3QZQA 1HJ8A 4MNVA 1TRYA 3BTGE 3KL6A 3LONA 2ZGJA 3S0NA 1F0TA 5DJ7A 3ZVFA 1O0DH 3U1JB 1QFKH 1EB2A 1PPEE 1C2FA 4NA7A 4WY3A 2ZFPH 1E34B 3RLWH 1V2LT 2F91A 4CRBA 1BDAA 1D6RA 2A4GA 1ZSLA 2BQWB 1HGTH 2DE8A 4AGJA 2WUCA 4U30A 1KTSB 3FZZA 1GBIA 2WPLS 5ESBA 1GMHF 4K5ZA 3GDVA 3V0XA 3ESTA 5CHAC 5F03A 1O3NA 5DPAA 3I78A 2K1QA 3TJUA 1SQAA 2A2XH 1GHYH 2HNTF 1P2KA 2VJ1A 3SV6A 4Q80A 1UVUH 1HAHH 1BRBE 4OS6A 3MYWA 3GYMA 1D3QB 2H9EH 5T6DA 2XWBI 1G36A 3RXGA 2GP9B 1EJAA 1GCTC 1GDNA 1GHXH 1FQ3A 1TNJA 3RM2H 2CV3A 1P10A 2ZCLP 1L1NA 1S0QA 3RU4E 4X1NU 3UOPA 4AB8A 4CBNA 3T5FH 3GY5A 2ANKH 1Z8JB 2HNTE 2ZC9H 1Z1JA 5FCKA 3FP7E 1EAIA 2SFAA 4NSVA 4Q7ZA 1GDQA 1UMAH 4ISHH 2BD8A 2Z9KA 1H9LB 3QZRA 1C5PA 1C5RA 1QCPA 5I46H 3ZVEA 1W12U 1ACBE 2OTVA 1TBRH 3LC5A 3TVJB 6ESTA 1EKBB 1HNEE 1QTFA 4DG4A 4AX9H 4E05H 2BM2A 1J8AA 5F6MA 1W7XH 4X2XA 1C5MD 1D9IA 1RRKA 1N6YA 3EDXB 3RXOA 3TGKE 1GVKB 4ABFA 2QV1A 1O39A 4TWWA 4X6OA 2J34A 1OKXA 1SI5H 1QHRB 3RXRA 3QTVH 3Q3YA 3RLYH 4ABBA 4DCDA 1ZSJA 2O9QA 2BD3A 3RMMH 2GDEH 2QYIA 3DA9B 3NZIA 4JZDH 1C5ZB 3SJOA 3URDA 1BMAA 3K2UA 3MNBA 1DT2A 2CN0H 2OP9A 1HJ9A 2O8MA 2TGTA 1XXDA 1SGNE 1YPKH 1RIWB 3SGBE 5DP9A 1ZGIA 2ALPA 4TWYA 2BOKA 5LPFA 3A87A 4E06H 1MZAA 2J4IA 2AMDA 1TGNA 3T26A 1YBWA 1ESTA 1L0ZA 4MG3A 5EU8A 3SU2A 3L6PA 3A89A 1IQHA 2F83A 1Z7KA 3RXUA 1TA2A 3KCGH 1SOTA 1F0SA 3SUGA 2FTMA 1O2HA 3BTTE 2ZFTA 2D2DA 3VXFH 3KNXA 1GBMA 3A7YA 5FHTA 3TITA 1TNHA 4X8UH 3MU0A 2B5TB 1CGJE 1VR1H 2ZHDA 4IS5A 1HBTH 1THRH 3RUOA 1ZHPA 1A5GH 1GI4A 2PSXA 1G30B 1LHFH 1TAWA 3RM0H 2H6MA 5JBTA 2Z9GA 8LPRA 1ELDE 3DHKH 1UTNA 2BDCA 4BXSA 2XW9A 1K28D 2Q6GA 5A09A 1QL8A 5JPMH 1S84A 2FX4A 3W95A 3P70B 2CJIA 5AFZH 3ZZ5A 1TNLA 1QR3E 4ZKRU 2Y7ZA 1EAWA 1ZLRA 1ZHMA 2PGQB 4BAQB 3TK5A 5EW1H 5K0HA 2P3TB 3KQEA 4WMDA 4Y0YE 1MAYA 1QL9A 1FV9A 3H7OA 3U8TH 2IPHA 2A1DB 1C5NH 1VGCB 2STAE 4WH8A 1O3BA 5T6GA 4NIXA 1F5KU 1O2RA 2B9LA 4ISNA 2HGTH 2ZFRH 1HCGA 3F9FA 3MH7A 1QA0A 1AVGH 1NS3A 3LIWA 3SO3A 3KGPA 4FUDA 1IQGA 1PJPA 4SGAE 4DOQA 1IQEA 3BG8A 4OGXA 1DS2E 2FDAA 1HAGE 5C20A 5LGOA 1C5VA 3MNSA 2J94A 1HLTH 4UFEH 4YOIA 1P09A 4GSOA 4X6PA 4K69A 3RMOH 5EW2H 1ZTKA 1ZR0A 3ZZ8A 4K8YA 2P8OB 2ZCKP 3QWCH 1IAUA 1V2RT 4KP0A 1U6QA 1EJNA 2VU8E 2ZA5A 1MU8B 3WY8A 5LPRA 2H5CA 1Z8IB 1QBNA 1LHEH 1C5LH 4F49A 4UE7H 3GDSA 4DIIH 1FUJA 3B9FH 4UEHH 2EEKA 5FX6A 1MZDA 2NU0E 1B5GH 1NZQH 3SU0A 2UUJB 3V12A 3LGUA 7ESTE 1SPJA 2H2ZA 1GHZA 2OCVB 4XBBA 1AUTC 1F7ZA 1WQSA 5C1UA 1HAXB 4X1PU 6CHAB 1ZJKA 4BANB 4I8LA 1HAPH 1AB9B 3TPIZ 1E35B 2V0BA 3LH3A 2FMJA 1NTPA 3V7TA 4YT7H 3RXSA 2ZI2H 1O31A 4H6TA 1VITG 5F8XA 1SGPE 1UCYH 1T7CA 2NU4E 1BOQA 1HB0B 3GCTG 3ZZCA 2SGAA 1C1OA 1RTKA 1YLCA 1ZTLA 2W3IA 2M5TA 2AEIH 4ZUHA 3SU3A 4X8VH 1SGYE 3MH4A 3A88A 3SV9A 2LNCA 1GBAA 2EI7A 2QAAA 1IQLA 3ITIA 1EP5A 4MQAA 5BPEA 1C1QA 1DUEA 3M5OA 4K1SA 2BVSH 1NFYA 3QDZB 4MPVA 1T31A 1CHOG 1MKXH 4NZQA 2OUAA 4D9RA 3P6ZB 8GCHF 2PSYA 4NFEA 3T29A 3HK3B 1L1GA 3ZYDA 2FM2A 3AASA 3BTKE 1QJ7B 2C4FH 5JB8S 1O3GA 1C5QA 2O8TA 1TOCB 3PMAB 3C27B 1O5CB 5F8ZA 3TNSA 3OY6U 4XFQA 3C1KA 2A4OA 1WUNH 4U01A 2ZHQH 3BTHE 1QRZA 3GCOA 1XUIA 4I33A 1BCUH 4A1XA 1J16A 1RXPA 1EJMA 5EQQA 1N1LA 1GMHG 1BJUA 3HKIB 2WUBA 3LOXA 4NA8A 1M9UA 2ZU3A 2HVXA 1TPAE 1P11E 4YOGA 4B75A 1ABJH 2GZ8A 2SGFE 3ZZ9A 1DUAA 4INKA 2GMTC 4H42U 3T28A 4ASHA 2FWWA 1O5EH 3E8LA 1NFUA 3RXIA 2ZGCA 1O2JA 4Z0KA 3RC5A 2TPIZ 3RU4T 1YPEH 6LPRA 2C93B 1ZMJA 3FFGA 5ESTE 2Y82A 1TWXB 2OQ5A 1O2MA 4X1SU 2ZTYA 1MTVA 1DY9A 2XCNA 5EGMA 1A0LA 5DK1A 5HMAA 2ZDNA 4UDWH 1IHTH 4Y76A 2FOCA 4K3JA 5A8ZA 4DJZB 3SHCH 2PUXB 3F6UH 3E0NB 1WQVH 2HWLB 1O2TA 2ZHEH 4XBDA 1NT1A 2VVCA 1EZUC 1T4VH 2BY5X 1OS8A 3ZZ6A 3SGAE 3EQ0H 1EXFA 2Y5HA 3ATLA 1FPCH 1AI8H 1XX9A 1YKTA 1QIXB 2AFQB 3MNCA 3TLOA 1C5OH 1LVMA 4R0IA 2AERH 1LMWB 3U8RH 2ZZUH 1AVWA 2OC7A 4UFDH 1TYNA 1O2SA 1AE5A 1ELAA 1O2LA 5BRRE 1C4U2 3RXJA 1GHBF 1HUTH 2VIVA 1SOZA 3FP6E 3F9HA 1BMNH 4WMFA 3PYHA 1GMDF 2H5DA 2V3OH 3DUXH 4FUEA 4RSPA 3SJ9A 1VJ9U 2SNWA 1GJ4H 2P94A 1NRPH 4GHTA 3TU7H 1TE0A 2GCTC 3ZVBA 1DPOA 2R0LA 5H4IB 4KKDA 3A84A 3VGCC 2G00A 1IQNA 5EPYA 2FOFA 1HXEH 1FXYA 1GBKA 4LZ1H 2CXVA 5EODA 1HFDA 1BITA 3OYPA 4Y10E 4ISLA 2FEQH 2J92A 1DLKB 1EQ9A 5L2ZH 4ZHLU 1WTHD 4IMZA 4XDEA 2ZDVH 1G32B 1S85A 2RCEA 2YOLA 4LXBH 1LO6A 1V2MT 1UK3A 2FZZA 1S82A 1UTLM 4FUFA 3STJA 1DM4B 5EXLA 2ODYB 3P95A 4CRCA 2FYRA 2VINA 1AVXA 4FVBA 1X7AC 2A31A 1VGCC 1ETRH 3B23B 2ZF0H 3TH4H 4BTUB 2BOHB 3TJNA 2RA0A 4MNWA 5T3HA 2QXGA 5TJXA 2VWLA 2W26A 1CA0C 2PKSB 2WYGA 2NWNA 4A5TS 1A3EH 2AIPA 2VWNA 1DLEA 3V13A 1V2ST 4CRDA 3AW0A 1BTHH 1GJCB 1BQYA 4B73A 1KLTA 3LT3A 3ZZ3A 3T62A 1OXGA 1EZQA 1P9SA 1NROH 4B2AA 1SGDE 1XUGA 1BBRH 1TGCA 4K1TA 3M5LA 1EUFA 1OWKA 1HAZB 3GY8A 3SV2H 1DICA 3M3SA 1P57B 2BB4A 2QXJA 4OS4A 1TX8A 2XC0A 1F5LA 4MNXA 1NFWA 1AIXH 4ABAA 1OWJA 1E36B 4AB9A 2A32A 4FUHA 2BDYA 2ZECA 5DGJA 3RXFA 3LGWA 1OP0A 1C2JA 4I31A 1P04A 1MAXA 1FNIA 3MU4A 1ZTJA 2B8OH 1G3EA 1BTZA 2QA9E 1HAVA 5AF9H 4AFZA 1NRSH 1QJ1B 2ODQA 1LHCH 3KQBA 4O03A 1GJ7B 1L4ZA 1Y8TA 3ZZBA 4FUCA 2XC4A 1C5SA 1O2XA 1O3JA 1YPGH 2EI8A 1E38B 1G37A 2WPHS 2Z9JA 3CS0A 1T8LA 3UNSA 2UWLA 3FANA 1GVLA 1LPKB 2GV7A 4I8KA 2UUFB 3A7WA 1OX1A 2PR3A 2ZPSA 4J2YB 4WH6A 1C1PA 1O3MA 3AW1A 1FDPA 2GZ9A 4KGAA 4Y6DA 3ZZ7A 1TIOA 3T27A 1ANDA 2RG3A 1O3IA 1T8MA 1L2EA 2ZU5A 1LHGH 1SC8U 1FONA 1TQ0B 2QIQA 5CMXH 1LDTT 2BDAA 2CHAC 1CHGA 1BB0B 1UVTH 4IBLH 4K2YA 4UFFH 4WJG2 3SV7A 1RD3B 2J2UA 3PTNA 1H8DH 1J14A 2PTCE 1HAVB 3F9EA 4KTUA 1C2IA 3GY2A 3T2NA 1EAXA 1F5RA 4JZFH 3SI4H 4TPIZ 4HI3A 5GPIB 1GPZA 2WINI 1MTSA 1OYQA 1Q2WA 1G2MA 1AD8H 9LPRA 4H4FA 1V2WT 1K1LA 1GL1A 1UTPA 2F9VA 3BTDE 1VITH 3FP8E 2ZQ1A 2D8WA 1WU1A 4LZ4B 1GBEA 3LJOA 2P16A 1MTNC 1V2TT 2GV6A 1GG6C 2OBQA 3Q3KA 2R3UA 1O32A 4AFUA 1RTFB 1C5YB 1ZRBA 1YLDA 1C1MA 2ZQ2A 3NWUA 4F4OC 1ELEE 3S9AA 2ZEBA 3MOCA 2ZPRA 2JH6D 1KIGH 3E1XB 2HNTC 2G52A 4IN2A 8KME2 4ESTE 1ZMNA 1FAKH 1GBFA 1QURH 4MPUA 1K9OE 3LGYA 3TNTA
chains in the Genus database with same CATH superfamily
5KEDA 3ENSB 3SZEA 5FAHA 1SGTA 3K6YA 3S7KB 2ZGBH 2OBOA 2BLOA 2ZFSA 2GMTB 1WSSH 1KLIH 2YMSC 3M35A 5AVDA 5C5OA 1FY3A 3RP2A 3RXVA 1T8NA 1EB1H 3BEUA 1ARBA 3TJVA 2BVXH 1SQTA 3RXBA 1HXFH 4SGBE 4ABHA 3KIDU 4X2YA 1GBDA 5KGOA 4ISIH 2D26C 3DFJA 2IJOB 3UB0A 1RGQA 3SGQE 2ZDKA 1O3FA 3W94A 2J98B 3SOSA 4X6MA 5DP5A 3S7HB 2OC1A 1SQOA 1GI6A 1GI7B 3H7TA 1ZHRA 1HPGA 5TCCA 2OINA 3SW2B 3F2HA 2BY7X 1ELCA 5EIYA 1YY3A 2ZCHP 1NU9A 3OEHD 2EY4C 4NWLA 1W2KH 1Y5UT 1C1RA 1AHTH 3UY9A 1TRNA 4TYDA 1P06A 4R8TB 1EX3A 1ANEA 4JCNA 4NIWA 1ZGVA 3QTOH 1O5DH 2IPQX 1YPJH 2Z9LA 2FI3E 5EQSA 1MTWA 4B2CA 2F9BH 2HLDD 4YESB 1LPGB 1C1UH 3LPRA 3PMJA 3TJOA 4Y8ZA 1C1NA 1ESBA 3GY4A 3QGJA 1GI9B 1ORFA 1G3CA 1NM6A 2BZAA 1O3AA 3BIUH 3VG8A 1EZXC 3HATH 4AORA 2GCTB 4Y7AA 1HV7A 1GDUA 2ASUB 6GCHG 3VGCB 4X2WA 2G5NA 1N6XA 2CF8H 3NXPA 2WPJS 2HPPH 1BRAA 4H6SB 5E0JA 1CSOE 3BV9B 3U98H 1W10U 2TBSA 5FPSA 1UHBA 1ZMLA 1GHBG 3LJJA 1TGTA 2ZGHA 1K1NA 3RMNH 3UR9A 2QE7D 1OWEA 3UNQA 3SNEA 2BD2A 2HPQH 1V2OT 2QXHA 1O2QA 2G4TA 3A8BA 4B74A 1P3EA 3ZVAA 1LVBA 4JMYA 1DSTA 1TGSZ 4Y8XA 4A92A 3UIRA 4DURA 1CQQA 2Y5FA 3P8FA 3UQOA 1ELGA 1FY8E 1HIAB 3F1SB 1XUKA 1TPSA 2C8WB 4FUBA 1TNKA 1XMNB 2OC0A 3E91A 4X2VA 5A8YA 1C2MA 1RFNA 1BZXE 4DT4A 1GHWH 1H9HE 1V2JT 1MU6B 2PKSC 1J15A 2ZKSA 4ZH8A 1EP6A 1TFXA 1NFXA 3QLPH 3UWIA 2YNAA 4LK4A 1CA0B 2QF3A 2ALVA 2ZPQA 4OS7A 2XBYA 1C1WH 1DANH 2BHGA 2F9NA 9ESTA 2ANWA 1K1IA 1AN1E 4NA9H 3A7XA 5T1VA 5GWZA 1P9UA 1SHYA 4KTSA 1XVMA 2H9HA 1LCYA 3SBKA 1KXBA 1TA6A 2VIPA 1UHBB 4GHQA 2BDHA 1BMFD 4HG6A 3SJ8A 4Q7XA 3K65B 1O37A 5GCHF 4ABDA 2A7CA 1DITH 2PP6A 3RXQA 2A4QA 1C5UA 1F0RA 3CP7A 5E0GA 1TNIA 2WPIS 3A86A 1TONA 3SJIA 2RDLA 3VFEA 1Y3YA 5DP6A 4B76A 1FPHH 1OYTH 4AYYB 2Y7XA 1PPFE 3NK8A 2LELA 3F9GA 4D76A 1HDTH 1OWHA 3AAVA 1BIOA 1OOKB 2PGBB 3KN2A 1GL0E 1ZPZA 1C5TA 4TSFD 1BHXF 3PV4A 2Z9IA 5E8EH 4WVPE 4Z6AH 1A5IA 4ZROA 2SNVA 2PUQH 3ZVGA 1O3HA 4MPWA 1CE5A 1B0EA 2KZ4A 2BYAX 1K21H 5HM2A 4OS2A 2V3HH 4AN7A 5ETXA 1J9CH 3KHVA 2VH6A 3BEIB 3CENA 4FOUC 4O9VA 2NU1E 4ABGA 1GBLA 4HZHA 2KCPA 3PROA 1YM0A 4QT8C 1YC0A 2Q1JA 1KXEA 3QGNB 3ZZ4A 3K6ZA 2ZFQH 3D62A 3PLKA 3KQDA 1SGCA 3MHWU 3BIVH 3P8OA 1QNJA 4GUXA 5DKMA 2TRMA 2BX3A 4FVDA 2BZ6H 1KYNA 2FOEA 3UNRA 2CHAB 7KMEH 1SLWB 2ZFFH 5JBAS 1QB1A 1V2VT 1PQ7A 3OTJE 1CT2E 1OP8A 1P05A 1SR5C 2XC5A 2KM0A 3O8RA 1XVOA 3RC4A 4ZMAH 3M5NA 5J4QA 1THSH 1C1VH 2ZDLA 2XXLA 1GJ6A 1C5WB 4YXWD 1P2IA 1TB6H 1FLEE 1ABIH 1DVAH 3HK6B 3LKWA 1DWDH 1SLUB 3LH1A 1SGRE 4CREA 2QF0A 1IOEA 3IG6B 3VB5A 2P3FH 2W6ID 2QCYA 2EI6A 3KEEA 2OQUA 1PFXC 1CVWH 2AGIX 3TH3H 1G3DA 1BUIA 1XKBC 1O33A 1CA8B 3I29A 4FUIA 1TRMA 3A85A 1G3BA 1L4DA 1OWDA 2ZO3H 4DW2U 3CNRA 1Z6JH 2PTNA 2K8IA 1P8VC 2IOTA 3GDUA 1V2NT 1GHVH 1MTNB 4BNRA 2P95A 1GG6B 7LPRA 2ZHWH 1ESAA 2JETC 2GX4A 2VIWA 4RKJB 1OPHB 2AGGX 1G9IE 4NFFA 3EA7A 1K1MA 2FPZA 3PB1E 1S81A 3BSQA 1WAYB 4Q2KA 4UONA 1C1SA 1UTKA 1ZSKA 4O3UA 1IQKA 1IQJA 1VCPA 2FTLE 1ETTH 3HGPA 3D65E 1IQFA 4A1VA 2C8ZB 1UK2A 2A5IA 1W0ZU 3RXHA 1XKAC 4IN1A 2YMSB 2O8WA 5EPNA 5GDSH 4Y11E 4E7RG 1JBUH 2VVUA 2BY9X 4FETA 3DD2H 1W11U 1VCQA 2KAIB 7GCHF 4XE4A 1ZRKA 3SNDA 3UQVA 1WYKA 4X0WU 2XBXA 3FO8D 1QB9A 4YLUA 1S0RA 5PTPA 1JIMA 2QY0B 3L3TA 1S5SA 1LKBA 1A1RA 1UK4A 2FS8A 2G51A 3RXAA 4AFSA 3SJKA 3BG4C 4RT0A 2ZNKH 1E37B 3BEFB 3MI4A 1MH0A 3ZZDA 2WV5A 4BXWA 4TY6A 1YYY1 2VB0A 1YCPH 2FYQA 1AFEH 5JB9S 3A8AA 1RTLA 3M7TA 1DE7H 3PO1B 1K22H 4XBCA 5L6NH 1TQ7B 1RJXB 5E0HA 1O2YA 3U9AH 1H8HD 2YNBA 1UVSH 5FPYA 1PYTD 2ZTZA 2W5EA 2BMGB 2H9TH 3K9XB 1FIWA 3ATWA 4XOJA 1GMCF 2RA3A 1SVPA 3E3TA 2D1JA 3SQEE 2F43B 1O3DA 2WYJA 2ZU1A 4ABIA 3FKSD 1UTOA 3JZ2B 4GCHF 5FPTA 3Q3XA 4NGAH 4Z1MD 2ZTXA 1TGBA 5EOKA 1AQ7A 2VGCC 2ZIQH 4RT1A 1AZ8A 2C8XB 4BAMB 5T6FA 1JOUB 1N8OC 4BAKB 1O5FH 1OWIA 4XSKU 4CR9A 4CBOA 5IYTA 2V35A 3URCA 2WPMS 1D6WA 1JXPA 1UVPA 1CU1A 1CGIE 2R9PA 2W3KA 4J1YA 1WXRA 1Y5AT 1EOJA 1JRTA 1YCPM 4FXGH 3ZV9A 1GI8B 1GI2A 1C4V2 2AMQA 1GI1A 1DXPA 1EPTC 5AFYH 3MNXA 3PMBB 3Q76A 3SV8A 3AAUA 4ZKOU 1GJ9B 2KX4A 1KDQB 1Y5BT 2Z7FE 1TMUH 1TPOA 4JK6A 2UUYA 2WPKS 2J97A 2BQ6B 3EAJA 4U32A 2C3SA 2FO9A 3RXCA 4NSYA 1FAXA 1C2HA 3MH5A 3SU5A 1EZSC 1FY5A 4OGYA 8ESTE 2PKAA 1W0YH 1BTPA 1S6HA 2AHME 1F0UA 3RXEA 1D3TB 4UD9H 3H09A 2R3YA 1H9IE 2V3MA 3UWJH 2JIZD 4K1EA 1LVYA 4JYTA 1LKAA 1V3XA 3O8BA 3UPEA 2RFKC 1P2OA 2ZP0H 1ANBA 2JH5D 2WSSD 1KMHB 3N99A 5C0TA 1O2NA 2Q6DA 2A7JA 4CH8B 4FU8A 1HJAC 3VXEH 2O8UA 3HGNA 3ZVCA 1Q31A 2GGVB 4CRAA 3EE0B 4FU9A 1C2GA 1K0HA 2XNDD 1ELBA 2GT8A 3MTYA 4VGCC 1UW7A 2F9OA 1C5XB 2HRVA 3BF6H 1O5GH 1LVOA 2I6QA 1J17T 4BAOB 1W7GH 1XUHA 1NC6A 5EQRA 1O35A 2HOBA 5GCHG 1VITF 3RXKA 4DT7B 1QJ6B 3RMLH 2XYAA 1SLXB 5K7RA 1EAUA 1O3LA 1CGHA 3GCTF 2PKAB 4HFPB 1GBJA 3LDXH 2Y81A 2ZDAH 1HYLA 3SORA 3STIA 2AH4X 1OSSA 1BA8B 1GJAB 3RC6A 3SNAA 1QBOA 1QQUA 1GWAA 5JDUB 3VB6A 1O3EA 3VB3A 3PLPA 1S6FA 2AYWA 1E79D 1AY6H 2BXUH 1HRTH 1V2KT 3GY7A 2Z3EA 4NIYA 2BX4A 2Y6TA 5JYIA 1CHOF 2XRCA 1VCWA 4X8TH 1YP9A 1BHXB 1AZZA 1GGDC 2QGRA 1D3PB 4MVNA 2JDID 4WMEA 1O38A 1A4WH 2FODA 1AKSB 1ZZZA 2P93A 3ATKA 2GD4B 1SQRA 1PPCE 1L1JA 1SGIB 4X1RU 3R0FA 2J98A 2FP7B 3QO6A 4IC5A 2ZGXH 4LOYH 2J38A 1K1PA 2EA3A 2HVYB 3D23A 3ZYEA 4X1QU 4P02A 4TY7A 5E2OA 4NZLA 5FBIA 3NCLA 2VNTA 5DP3A 1O2VA 3GCHB 4MDSA 4I8HA 3FZDA 5FBEA 2WPDD 3EGKH 4Y8YA 1MKWH 1V2PT 3GCNA 3D49H 4JZEH 1Y3WA 2P3UB 1V2UT 2BVRH 8GCHG 2JJ2D 2QF5A 5GIBA 1AFQC 1WCZA 2W7SA 3UOUA 2JETB 5DG6A 1T8OA 3RXPA 1A46H 1UVOA 3MQKC 5JBCS 2AIQA 1W13U 1GBBA 1NU7B 1UCYK 3DCLA 3LC3A 2ILNA 2GTBA 4RKOB 3UFAA 2B0FA 2C8YB 3ODFA 1Z6EA 4ZXXH 2CF9H 2WHXA 3CS7A 1FI8A 1W8BH 5J4SA 1QA7A 3DT0H 3GICB 2R0KA 1ARCA 4WF8A 5HIZA 3OX7U 1JMOH 1EASA 1NPMA 1Z71A 2HALA 3S9CA 1V6DA 1D4PB 1C9PA 1XXFA 1CO7E 2FIRH 3NKKA 3PWBA 2OK5A 4AG1A 1AU8A 3BTWE 4XRNA 2BD7A 2JJ1D 3ZV8A 3E16B 1IQIA 1IQMA 3HKJB 1MKXK 3P8NA 2IN2A 5L30H 1O2WA 2ULLA 1SG8B 3BG4B 2FS9A 3F3BA 1K1JA 1PQ5A 1O2GH 1HIAA 3SQHE 1PQ8A 1Y3XA 1GVZA 1OP2A 4Y71A 1SSXA 2G55A 1PPHE 3NPSA 1YPMH 2TIOA 3RXTA 1KXDA 3LGIA 3A83A 3PO1C 4CRFA 4B6FA 2OLGA 1AUJA 4NCYA 1DFPA 2OD3B 1DWBH 1TOMH 3SUEA 7GCHG 1EPTA 1O2ZA 1EATA 3M36A 2VIQA 1AWFH 2BXTH 2O8LA 4IC6A 5EG4A 3MO3A 1PYTC 5JBBS 2XCFA 4B2BA 5DP4A 2XOKD 4WXIA 2NU3E 1AGJA 5DN6D 1GI5A 1SBWA 1S6LA 5C0UA 4P00A 1QZ8A 4NWKA 3SI3H 5GJ4B 1FN8A 2ZG0H 4I7YH 3SZNA 3FVFB 2G8TA 1B7XB 1P02A 5HKKD 2IJD1 4B1TA 2BD9A 3SUDA 2FOMB 1UJ1A 1RS0A 2DE9A 1P01A 1T32A 2VGCB 5L2YH 1DDJA 1CT0E 1GMDG 2BDBA 3KQ5A 3OY5U 3U1IB 1P12E 2I6SA 3WWFA 1MQ6A 2AS9A 2F3CE 4AZ2B 1N8OB 1UTMA 3TK6A 3ZIAD 5HYOA 2A7HA 1BTXA 5EXNA 1TALA 4I8JA 5B6LA 2FESH 4A7IB 1C1TA 1GMCG 1GHAF 1BTWA 5DP7A 1O36A 1AO5A 1FY4A 3AVZA 1P3CA 5AHGH 3V3MA 2GCHF 4GCHG 5I25A 2PV9B 1AWHB 2BLWA 2FXRA 4U2WA 3GY3A 1BRUP 1EPTB 4ISOA 5B6OA 1BMMH 2A0QB 3FAOA 2UUKB 3GS9A 1DSUA 1MUEB 4I8GA 2FOGA 3P8GA 4BTTB 1P2QA 4ZKNU 1VZQH 2BTCE 1YCPK 3U8OH 1O2IA 5DO4H 1NO9H 1NRQH 1AE8H 1O5AB 3SU1A 1JWTA 4DY7B 2KCYA 3SN8A 1O34A 2TGDA 4BAHB 4DIHH 1AMHA 4CHAC 3S9BA 1LHDH 2K0QA 3A82A 3TIUA 2UWOA 3QK1A 1QRXA 2PLXA 2BLVA 2FLRH 2VIDA 5A8XA 2BLQA 3SNCA 4DGJA 3MFJA 1C2KA 2BDIA 2VWMA 2FI5E 4JZIA 1W14U 2OXSA 4ZHAA 1KTTB 2BY6X 3ZVDA 4AOQA 2BDGA 2Q6FA 1A3BH 3MWIU 2JKHA 5LH8A 3Q77A 3E6PH 1FMGA 1HJAB 1SL3A 3ELAH 4ZKSU 1Z8RA 1NRNH 1TBQH 1THPB 2SGDE 4UFGH 3BTEE 1O3CA 1YLNA 4FU7A 1HAIH 1XM1A 4ACAA 3ODDA 1SGFA 1UCYE 4VGCB 2ZU2A 2Z3DA 2J95A 2SGQE 1TMTH 4Y0ZE 2VVVA 4OM9A 1QY6A 5FCRA 1Z8GA 2AMPA 2OC8A 1CBWC 1MABB 2GT7A 1DWCH 1K2I1 3PV5A 1A7SA 2A5KA 4RN6A 2STBE 2VIOA 1NRRH 4O3TA 4FUJA 1H4WA 3EYDA 5C5NA 3PLBA 2XNIA 3IWMA 1KXFA 3MU5A 4YOJA 3MH6A 3TH2H 3TGIE 1BTUA 4Y7BA 4GPGA 2ANYA 3PM3A 1YPHC 2F9UA 3QUMP 1MBQA 3DFLA 1QBVH 2SGEE 1YPHE 1ZYOA 1KLJH 1G2LA 3RDZA 2G81E 3A8DA 4F55A 1MD8A 2FLBH 3ATIA 3QN7A 4O97A 1QQ4A 3WWBA 1TX7A 1TNGA 5A0CA 1TX6A 4YT6H 1SB1H 1BMLA 3M5MA 2ZU4A 5DP8A 3M7UA 1P2MA 1BBRK 2V6NA 1MMJN 2AGEX 2Y5GA 3A8CA 3S69A 5C2ZA 1P2NA 1DX5M 2QN5T 4AG2A 1F92A 5EJ1A 1GGDB 4Q4LA 1GI0A 1Q3XA 1SGFG 3OSYA 4HGCA 3A81A 3UUZA 3KQCA 1WV7H 4ABEA 2G4UA 2QXIA 5GXPA 2KAIA 3F68H 1GJ5H 1Y3UA 3QX5H 1T4UH 3DSOA 4ZAEA 3KYFA 1SHHB 3MMGA 1A61H 2ZDMA 1BT7A 4D7FA 2PW8H 3FN8A 1A0HB 3ATMA 2QC2A 5FX5A 1C2DA 1NN6A 1QRWA 1JIRA 3BTFE 3GOVB 5IDKA 2SGPE 3GCHC 3MU1A 2A4RA 1HAYB 1QB6A 2XWAA 3KF2A 2PWXA 5CHAB 5C1YA 2TGPZ 4JK5A 1XUJA 3M3TA 4DVAU 1TLDA 1ZOMA 3M3VA 3VB7A 1KXAA 1P2JA 1PPGE 2ODPA 3BTQE 2A5AA 2GZ7A 3NUMA 1JRSA 4IGDA 2KR7A 1O3KA 3A7ZA 1O2UA 2THFB 3GISB 5LPEA 1AFQB 3RU4D 1YF4A 3R3GB 1NY22 2ANMH 3IITA 4IW4E 1BTYA 1GCTB 2XBWA 4AFQA 4FUGA 1ZPCA 4E7NA 1H1BA 3LGVA 4TT3D 1A0JA 3SNBA 1SFQB 2NU2E 2J9NA 4OS5A 1PPZA 4AGKA 3OE7D 2A45B 3M61U 5A0BA 2BQ7B 3MO6A 4NG9H 5CE1A 1A5HA 4AYVB 1TABE 1C2EA 2R2WU 2WV4A 1B0FA 3RXDA 1O3OA 1C9TA 4MPXA 2PHBA 4ZHMU 4INLA 3SHAH 3N7OA 3L33A 3JZ1B 4JYVH 1C4Y2 2P59A 2Z94A 3O8CA 4GVUA 2A2QH 5HGGA 3M37A 2FI4E 3MO9A 3FOAA 3A7VA 4Y79A 2W6JD 4WWYA 1P0SH 1Z1IA 3B8JA 5FXLA 3VEQB 1GJBB 2R2MB 2EC9H 2TGAA 2Z6BD 2UWPA 3F0PA 1MCTA 1KDQA 4JYUH 5TCAA 3ZZAA 2XBVA 5C17A 1YPLH 6GCHF 1RIWC 1QGFA 4KTCA 2W7UA 2Y80A 1O5BB 1GJDB 2V7QD 1MTUA 1MKWK 4Q7YA 3E0PB 1P03A 2LPRA 4BOHA 1LTOA 1DWEH 3OU0A 5F53A 1SFIA 5C94A 4CRGA 1GI3A 1ELFA 4D9QA 1DY8A 3MU8A 2JH0D 1IHSH 3T25A 1E0FD 4NIVA 5EXMA 5E2PA 3A7TA 1DOJA 1WTGH 1SMFE 3SYJA 2L74A 1W3CA 3PTBA 2H1UA 1YGCH 1ELVA 3UR6A 1CT4E 4YZUA 3PMHB 4A6LA 3G01A 4ZXYH 1MD7A 1PPBH 2FOAA 1H8IH 4YM9A 3O8DA 3EA8A 4INHA 3U69H 3SUFA 1GJ8B 1SGQE 1QL7A 4PROA 2VH0A 3P92A 4I32A 1BJVA 4JZ1A 1TMBH 2GKVE 2BD4A 2CMYA 1FJSA 1BBRE 1F2SE 2ESTE 3A80A 3BN9A 1ID5H 3F2FA 4CH2B 3BTME 3H5CB 5C67A 1GBCA 2FX6A 2BY8X 3RXLA 3Q00A 5G4BA 1KXCA 2BD5A 5HM9A 3PWCA 3HPTB 3UAIC 1PQAA 1UO6A 1S83A 4XD7D 1HAOH 4GAWA 3VPKA 1SLVB 2B7DH 2HLCA 4CR5A 2ZWLH 4YO9A 1GHAG 2GVFA 2ZHFH 4OS1A 4X8SH 4YTAA 4CHAB 1MQ5A 3I77A 4K8BA 1UTQA 2GCHG 1LQDB 3P17H 3VB4A 1DXWA 2F4LA 4THNH 4GLYA 1O2KA 1ETSH 1KSNA 1BRCE 3E90B 4ABJA 1Y3VA 5C1XA 1FZZA 1K1OA 2CGAA 3TGJE 3EA9A 1MCVA 2P8OC 1LPZB 3RXMA 2FOBA 1V2QT 4MLFB 1NESE 2F9PA 1TPPA 5EJZA 1MBMA 1TBZH 1AKSA 2PFEA 1EFRD 1FIZA 1O30A 4Q63A 2G5VA 3SU4A 5HXFA 5ABWA 1Y59T 1INCA 4BTIB 1ANCA 3UTUH 4D7GA 1FN6A 5F8TA 3LU9B 4IMQA 2Z3CA 3UREA 1GCDA 1D3DB 2XTTB 3GY6A 2VWOA 4YLQH 4TPYA 1CBWB 4D8NA 1A2CH 2GDDA 1GBHA 2DUCA 3OFND 1EOLA 2QF4A 4KELA 5C3NA 1KY9A 3TK9A 5SGAE 4MNYA 2LP6A 1ZJDA 4K60A 1ZPBA 1WOFA 4WXVA 1ELTA 3LGTA 4M7GA 1FY1A 1LQEA 3M7QA 5A0AE 6CHAC 2C90B 3SU6A 1O2PA 1AB9C 4HTCH 5A2MH 1SGEE 2FOHA 4B71A 1GBTA 1WBGB 1VJAU 1UTJA 4MTBA 4A1TA 1O2OA 3GYLB 1O3PB 1C2LA 1XUFA 5CHBA 4X6NA 3QZQA 1HJ8A 4MNVA 1TRYA 3BTGE 3KL6A 3LONA 2ZGJA 3S0NA 1F0TA 5DJ7A 3ZVFA 1O0DH 3U1JB 1QFKH 1EB2A 1PPEE 1C2FA 4NA7A 4WY3A 2ZFPH 1E34B 3RLWH 1V2LT 2F91A 4CRBA 1BDAA 1D6RA 2A4GA 1ZSLA 2BQWB 2GJGA 1HGTH 2DE8A 4AGJA 2WUCA 3PV2A 4ASUD 4U30A 1KTSB 3FZZA 1GBIA 2WPLS 5ESBA 1GMHF 4K5ZA 3GDVA 3V0XA 3ESTA 5CHAC 5F03A 1O3NA 5DPAA 3I78A 2K1QA 3TJUA 1SQAA 2A2XH 1GHYH 2HNTF 1P2KA 2VJ1A 3SV6A 4Q80A 1UVUH 1HAHH 1BRBE 4OS6A 3MYWA 3GYMA 1D3QB 2H9EH 5T6DA 2XWBI 1G36A 3RXGA 2GP9B 1EJAA 1GCTC 1GDNA 4ACBA 1GHXH 1FQ3A 1TNJA 3RM2H 2CV3A 1P10A 2ZCLP 1L1NA 3WW7A 1S0QA 3RU4E 4X1NU 3UOPA 4AB8A 4CBNA 3T5FH 3GY5A 2ANKH 1Z8JB 2HNTE 3OAAD 2ZC9H 1Z1JA 5FCKA 3FP7E 1EAIA 4M9FA 2SFAA 4NSVA 4Q7ZA 1GDQA 1UMAH 4ISHH 2BD8A 2Z9KA 1H9LB 3QZRA 1C5PA 2KCAA 1C5RA 1QCPA 5I46H 3ZVEA 1W12U 1ACBE 2OTVA 1TBRH 3LC5A 3TVJB 6ESTA 1EKBB 1HNEE 1QTFA 4DG4A 4AX9H 4E05H 2BM2A 1J8AA 5F6MA 5KECA 1W7XH 4X2XA 1C5MD 1D9IA 1RRKA 1N6YA 3EDXB 3RXOA 3TGKE 1GVKB 4ABFA 2QV1A 1O39A 4TWWA 4X6OA 2J34A 1OKXA 1SI5H 1QHRB 3RXRA 3QTVH 3Q3YA 3RLYH 4ABBA 4DCDA 1ZSJA 2J5UA 2O9QA 2BD3A 3RMMH 2GDEH 2QYIA 3DA9B 3NZIA 4JZDH 1C5ZB 3SJOA 3URDA 1BMAA 3K2UA 3MNBA 1DT2A 2CN0H 5GNDA 2OP9A 1HJ9A 2O8MA 2TGTA 2CK3D 1XXDA 1SGNE 1YPKH 1RIWB 3SGBE 5DP9A 1ZGIA 2L6OA 2ALPA 4TWYA 2BOKA 5LPFA 3A87A 4E06H 1MZAA 2J4IA 2AMDA 1TGNA 3T26A 1YBWA 1ESTA 1L0ZA 4MG3A 5EU8A 3SU2A 3L6PA 3A89A 1IQHA 2F83A 1Z7KA 3RXUA 1TA2A 3KCGH 1SOTA 1F0SA 3SUGA 2FTMA 1O2HA 3BTTE 2ZFTA 2D2DA 3VXFH 3KNXA 1GBMA 3A7YA 5FHTA 3TITA 1TNHA 4X8UH 3MU0A 3DSPA 2B5TB 1CGJE 1VR1H 2ZHDA 4I86A 2VBCA 4IS5A 1HBTH 1THRH 3PRBA 3RUOA 1ZHPA 1A5GH 1GI4A 2PSXA 1G30B 1LHFH 1TAWA 3RM0H 2H6MA 5JBTA 2Z9GA 8LPRA 1ELDE 3DHKH 1UTNA 2BDCA 4BXSA 2XW9A 1K28D 2Q6GA 5A09A 1QL8A 5JPMH 1S84A 2FX4A 3W95A 3P70B 2CJIA 5AFZH 3ZZ5A 1TNLA 1QR3E 4ZKRU 2Y7ZA 1EAWA 1ZLRA 1ZHMA 2PGQB 4BAQB 3TK5A 5EW1H 1SKYE 5K0HA 2P3TB 1NBMD 2RDEA 3KQEA 4WMDA 4Y0YE 1MAYA 1QL9A 1FV9A 1YWUA 3H7OA 3U8TH 2IPHA 2A1DB 1C5NH 1VGCB 2STAE 4WH8A 1O3BA 5T6GA 4NIXA 1F5KU 1O2RA 2B9LA 4ISNA 2HGTH 2ZFRH 1HCGA 3F9FA 3MH7A 1QA0A 1AVGH 2WZQA 1NS3A 3N7DA 3LIWA 3SO3A 3KGPA 4FUDA 1IQGA 1PJPA 4SGAE 4DOQA 1IQEA 3BG8A 4OGXA 1DS2E 2FDAA 1HAGE 5C20A 5LGOA 1C5VA 3MNSA 2J94A 1HLTH 3PRDA 4UFEH 4YOIA 4AC9A 1P09A 3OTPA 4GSOA 4X6PA 4K69A 3RMOH 5EW2H 1ZTKA 1ZR0A 3ZZ8A 4K8YA 2P8OB 1H8ED 2ZCKP 3QWCH 1IAUA 1V2RT 4KP0A 1U6QA 1EJNA 2VU8E 2ZA5A 1MU8B 3WY8A 5LPRA 2H5CA 1Z8IB 1QBNA 1LHEH 1C5LH 4F49A 4UE7H 3GDSA 4DIIH 1FUJA 3B9FH 4UEHH 2EEKA 5FX6A 1MZDA 2NU0E 1B5GH 1NZQH 3F2GA 3SU0A 2UUJB 3V12A 3LGUA 7ESTE 1SPJA 2H2ZA 1GHZA 2OCVB 4XBBA 1AUTC 1F7ZA 1WQSA 5C1UA 1HAXB 4X1PU 6CHAB 1ZJKA 4BANB 4I8LA 1HAPH 1AB9B 3TPIZ 1E35B 2V0BA 3LH3A 2FMJA 1NTPA 3V7TA 4YT7H 3RXSA 2ZI2H 1O31A 4H6TA 1VITG 5F8XA 1SGPE 1UCYH 1T7CA 2NU4E 1BOQA 1HB0B 3GCTG 3ZZCA 2SGAA 1C1OA 1RTKA 1YLCA 1ZTLA 2W3IA 2M5TA 2AEIH 4ZUHA 3SU3A 4X8VH 1SGYE 2M2AA 3MH4A 3A88A 3SV9A 2LNCA 1GBAA 2EI7A 2QAAA 1IQLA 3ITIA 1EP5A 4MQAA 5BPEA 1C1QA 1DUEA 3M5OA 4K1SA 2BVSH 1NFYA 3QDZB 4MPVA 1T31A 1CHOG 1MKXH 4NZQA 2OUAA 4D9RA 3P6ZB 8GCHF 2PSYA 4NFEA 1E1QD 3T29A 3HK3B 1L1GA 3ZYDA 2FM2A 3AASA 3BTKE 1QJ7B 2C4FH 5JB8S 1O3GA 1C5QA 2O8TA 1TOCB 3PMAB 3C27B 1O5CB 5F8ZA 3TNSA 3OY6U 3AK5A 4XFQA 3C1KA 4B6EA 2A4OA 1WUNH 4U01A 2ZHQH 3BTHE 1QRZA 3GCOA 1XUIA 4I33A 1BCUH 4A1XA 1J16A 1RXPA 1EJMA 5EQQA 1N1LA 1GMHG 1BJUA 3HKIB 2WUBA 3LOXA 4NA8A 1M9UA 2ZU3A 2HVXA 1TPAE 1P11E 4YOGA 4B75A 1ABJH 2GZ8A 2SGFE 3ZZ9A 1DUAA 4INKA 2GMTC 4H42U 3T28A 4ASHA 2FWWA 1O5EH 1COWD 2YMSD 3E8LA 1NFUA 3RXIA 2ZGCA 1O2JA 4Z0KA 3RC5A 2TPIZ 3RU4T 1YPEH 6LPRA 2C93B 1ZMJA 3FFGA 5ESTE 2Y82A 3U28C 1TWXB 2OQ5A 1O2MA 4X1SU 2ZTYA 1MTVA 1DY9A 2XCNA 5EGMA 1A0LA 2WV9A 5DK1A 5HMAA 2ZDNA 4UDWH 1IHTH 4Y76A 2FOCA 4K3JA 5A8ZA 4DJZB 3SHCH 2PUXB 3F6UH 3E0NB 1WQVH 2HWLB 1O2TA 2ZHEH 4XBDA 1NT1A 2VVCA 1EZUC 1T4VH 2BY5X 1OS8A 3ZZ6A 3SGAE 3EQ0H 1EXFA 2Y5HA 3ATLA 1FPCH 1AI8H 1XX9A 1YKTA 1QIXB 2AFQB 3MNCA 3TLOA 1C5OH 4ZCNA 4RI0A 1LVMA 4R0IA 2AERH 1LMWB 3U8RH 2ZZUH 1AVWA 2OC7A 4UFDH 1TYNA 3KYGA 1O2SA 1AE5A 1ELAA 1O2LA 5BRRE 1C4U2 3RXJA 2KFWA 1GHBF 1HUTH 2VIVA 1SOZA 3FP6E 3F9HA 1BMNH 4WMFA 3PYHA 1GMDF 2H5DA 2V3OH 3DUXH 4FUEA 4RSPA 3SJ9A 1VJ9U 2EQNA 2SNWA 1GJ4H 2P94A 1NRPH 4GHTA 3TU7H 1TE0A 2GCTC 3ZVBA 1DPOA 2R0LA 5H4IB 4KKDA 3A84A 3VGCC 1WDIA 5EJLA 2G00A 1IQNA 5EPYA 2FOFA 1HXEH 1FXYA 1GBKA 4LZ1H 2CXVA 5EODA 2KCOA 1HFDA 1BITA 3OYPA 4Y10E 4ISLA 2FEQH 2J92A 1DLKB 1EQ9A 3N7EA 5L2ZH 3DSGA 4ZHLU 1WTHD 4IMZA 4XDEA 2ZDVH 1G32B 1S85A 2RCEA 2YOLA 4LXBH 1LO6A 1V2MT 1UK3A 2FZZA 1S82A 1UTLM 4FUFA 3STJA 1DM4B 5EXLA 2ODYB 3P95A 4CRCA 3EE7A 2FYRA 2VINA 1AVXA 4FVBA 1X7AC 2A31A 1VGCC 1ETRH 3B23B 1NBME 2ZF0H 3TH4H 4BTUB 2BOHB 3TJNA 5FL7D 2RA0A 5HIYA 4MNWA 5T3HA 2QXGA 5TJXA 2VWLA 2W26A 1CA0C 2PKSB 2WYGA 2NWNA 4A5TS 1A3EH 2AIPA 2VWNA 5DSFA 1DLEA 3V13A 1V2ST 4CRDA 3AW0A 1BTHH 1GJCB 1BQYA 4B73A 1KLTA 3LT3A 3ZZ3A 3T62A 1OXGA 5CDFE 1EZQA 1P9SA 1NROH 1W0KD 4B2AA 1SGDE 1XUGA 1BBRH 1TGCA 4K1TA 3M5LA 1EUFA 1OWKA 1HAZB 3GY8A 3SV2H 1E1RD 1DICA 3M3SA 1P57B 2BB4A 2QXJA 4OS4A 1TX8A 2XC0A 1F5LA 4MNXA 1NFWA 1AIXH 4ABAA 1OWJA 1E36B 4AB9A 2A32A 4FUHA 2BDYA 2ZECA 5DGJA 1OHHD 3RXFA 1FX0B 1OP0A 3LGWA 1C2JA 4I31A 1P04A 1MAXA 1FNIA 3MU4A 1ZTJA 2B8OH 1G3EA 1BTZA 2QA9E 1HAVA 5AF9H 4AFZA 1NRSH 1QJ1B 2ODQA 1LHCH 3KQBA 4O03A 1GJ7B 1L4ZA 1Y8TA 3ZZBA 4FUCA 2XC4A 1C5SA 1O2XA 1O3JA 1YPGH 2EI8A 1E38B 1G37A 2WPHS 2Z9JA 3CS0A 5IK2D 1T8LA 1W0JD 3UNSA 2UWLA 3FANA 1GVLA 1LPKB 2GV7A 4I8KA 2UUFB 3A7WA 1OX1A 2PR3A 2ZPSA 4J2YB 4WH6A 1C1PA 1O3MA 1VKYA 3AW1A 1FDPA 2GZ9A 4F48B 4KGAA 4Y6DA 3ZZ7A 1TIOA 3T27A 1ANDA 2RG3A 3W1EA 1O3IA 1T8MA 1L2EA 2ZU5A 1LHGH 1SC8U 1FONA 1TQ0B 2QIQA 5CMXH 1LDTT 2BDAA 2CHAC 1CHGA 1BB0B 1UVTH 4IBLH 4K2YA 3NRLA 4UFFH 4WJG2 3SV7A 1RD3B 2J2UA 3PTNA 1H8DH 1J14A 2PTCE 1HAVB 3F9EA 4KTUA 1C2IA 3GY2A 3T2NA 1EAXA 3F0OA 1F5RA 4JZFH 3SI4H 4TPIZ 4HI3A 5GPIB 1GPZA 2WINI 1MTSA 1OYQA 1Q2WA 1G2MA 1AD8H 9LPRA 4H4FA 1V2WT 1K1LA 1GL1A 1UTPA 2F9VA 3BTDE 1VITH 3FP8E 2ZQ1A 2D8WA 1WU1A 3OEED 4LZ4B 1GBEA 3LJOA 2P16A 1MTNC 1V2TT 2GV6A 1GG6C 2OBQA 3Q3KA 2R3UA 1O32A 4AFUA 1RTFB 1C5YB 1ZRBA 1YLDA 1C1MA 2ZQ2A 3NWUA 4F4OC 1ELEE 3S9AA 2ZEBA 3MOCA 2ZPRA 2JH6D 1KIGH 3E1XB 2HNTC 2G52A 4IN2A 8KME2 4ESTE 1ZMNA 1FAKH 1GBFA 1QURH 4MPUA 1K9OE 3LGYA 3TNTA
chains in the Genus database with same CATH topology
3ENSB 5FAHA 1SGTA 3K6YA 3S7KB 2ZGBH 2OBOA 2BLOA 2ZFSA 2GMTB 1WSSH 1KLIH 3M35A 5AVDA 5C5OA 1FY3A 3RP2A 3RXVA 1T8NA 1EB1H 3BEUA 1ARBA 3TJVA 2BVXH 1SQTA 3RXBA 1HXFH 4SGBE 4ABHA 3KIDU 4X2YA 1GBDA 4ISIH 2D26C 3DFJA 2IJOB 1RGQA 3SGQE 2ZDKA 1O3FA 3W94A 3SOSA 4X6MA 5DP5A 3S7HB 2OC1A 1SQOA 1GI6A 1GI7B 3H7TA 1ZHRA 1HPGA 5TCCA 2OINA 3SW2B 2BY7X 1ELCA 2ZCHP 1NU9A 4NWLA 1W2KH 1Y5UT 1C1RA 1AHTH 3UY9A 1TRNA 4TYDA 1P06A 4R8TB 1EX3A 1ANEA 4JCNA 4NIWA 1ZGVA 3QTOH 1O5DH 1YPJH 2Z9LA 2FI3E 5EQSA 1MTWA 4B2CA 2F9BH 4YESB 1LPGB 1C1UH 3LPRA 3PMJA 3TJOA 4Y8ZA 1C1NA 1ESBA 3GY4A 3QGJA 1GI9B 1ORFA 1G3CA 1NM6A 2BZAA 1O3AA 3BIUH 1EZXC 3HATH 4AORA 2GCTB 4Y7AA 1HV7A 1GDUA 2ASUB 6GCHG 3VGCB 4X2WA 2G5NA 1N6XA 2CF8H 3NXPA 2WPJS 2HPPH 1BRAA 4H6SB 5E0JA 1CSOE 3BV9B 3U98H 1W10U 2TBSA 5FPSA 1UHBA 1ZMLA 1GHBG 3LJJA 1TGTA 2ZGHA 1K1NA 3RMNH 3UR9A 1OWEA 3UNQA 3SNEA 2BD2A 2HPQH 1V2OT 2QXHA 1O2QA 2G4TA 3A8BA 4B74A 1P3EA 3ZVAA 1LVBA 4JMYA 1DSTA 1TGSZ 4Y8XA 4A92A 3UIRA 4DURA 1CQQA 2Y5FA 3P8FA 3UQOA 1ELGA 1FY8E 1HIAB 3F1SB 1XUKA 1TPSA 2C8WB 4FUBA 1TNKA 1XMNB 2OC0A 3E91A 4X2VA 5A8YA 1C2MA 1RFNA 1BZXE 1GHWH 1H9HE 1V2JT 1MU6B 2PKSC 1J15A 2ZKSA 4ZH8A 1EP6A 1TFXA 1NFXA 3QLPH 3UWIA 2YNAA 4LK4A 1CA0B 2QF3A 2ALVA 2ZPQA 4OS7A 2XBYA 1C1WH 1DANH 2BHGA 2F9NA 9ESTA 2ANWA 1K1IA 1AN1E 4NA9H 3A7XA 5GWZA 1P9UA 1SHYA 4KTSA 1XVMA 2H9HA 1LCYA 3SBKA 1KXBA 1TA6A 2VIPA 1UHBB 4GHQA 2BDHA 3SJ8A 4Q7XA 3K65B 1O37A 5GCHF 4ABDA 2A7CA 1DITH 3RXQA 2A4QA 1C5UA 1F0RA 3CP7A 5E0GA 1TNIA 2WPIS 3A86A 1TONA 3SJIA 2RDLA 3VFEA 1Y3YA 5DP6A 4B76A 1FPHH 1OYTH 4AYYB 2Y7XA 1PPFE 3NK8A 3F9GA 4D76A 1HDTH 1OWHA 3AAVA 1BIOA 1OOKB 2PGBB 3KN2A 1GL0E 1ZPZA 1C5TA 1BHXF 3PV4A 2Z9IA 5E8EH 4WVPE 4Z6AH 1A5IA 4ZROA 2SNVA 2PUQH 3ZVGA 1O3HA 4MPWA 1CE5A 1B0EA 2BYAX 1K21H 5HM2A 4OS2A 2V3HH 4AN7A 5ETXA 1J9CH 3KHVA 2VH6A 3BEIB 3CENA 4O9VA 2NU1E 4ABGA 1GBLA 4HZHA 3PROA 1YM0A 4QT8C 1YC0A 2Q1JA 1KXEA 3QGNB 3ZZ4A 3K6ZA 2ZFQH 3D62A 3PLKA 3KQDA 1SGCA 3MHWU 3BIVH 3P8OA 1QNJA 4GUXA 5DKMA 2TRMA 2BX3A 4FVDA 2BZ6H 1KYNA 2FOEA 3UNRA 2CHAB 7KMEH 1SLWB 2ZFFH 5JBAS 1QB1A 1V2VT 1PQ7A 3OTJE 1CT2E 1OP8A 1P05A 1SR5C 2XC5A 3O8RA 1XVOA 3RC4A 4ZMAH 3M5NA 5J4QA 1THSH 1C1VH 2ZDLA 2XXLA 1GJ6A 1C5WB 1P2IA 1TB6H 1FLEE 1ABIH 1DVAH 3HK6B 3LKWA 1DWDH 1SLUB 3LH1A 1SGRE 4CREA 2QF0A 1IOEA 3IG6B 3VB5A 2P3FH 2QCYA 2EI6A 3KEEA 2OQUA 1PFXC 1CVWH 2AGIX 3TH3H 1G3DA 1BUIA 1XKBC 1O33A 1CA8B 3I29A 4FUIA 1TRMA 3A85A 1G3BA 1L4DA 1OWDA 2ZO3H 4DW2U 1Z6JH 2PTNA 1P8VC 2IOTA 3GDUA 1V2NT 1GHVH 1MTNB 4BNRA 2P95A 1GG6B 7LPRA 2ZHWH 1ESAA 2JETC 2GX4A 2VIWA 4RKJB 1OPHB 2AGGX 1G9IE 4NFFA 3EA7A 1K1MA 2FPZA 3PB1E 1S81A 3BSQA 1WAYB 4Q2KA 4UONA 1C1SA 1UTKA 1ZSKA 4O3UA 1IQKA 1IQJA 1VCPA 2FTLE 1ETTH 3HGPA 3D65E 1IQFA 4A1VA 2C8ZB 1UK2A 2A5IA 1W0ZU 3RXHA 1XKAC 4IN1A 2O8WA 5EPNA 5GDSH 4Y11E 4E7RG 1JBUH 2VVUA 2BY9X 3DD2H 1W11U 1VCQA 2KAIB 7GCHF 4XE4A 1ZRKA 3SNDA 3UQVA 1WYKA 4X0WU 2XBXA 1QB9A 4YLUA 1S0RA 5PTPA 1JIMA 2QY0B 3L3TA 1S5SA 1LKBA 1A1RA 1UK4A 2FS8A 2G51A 3RXAA 4AFSA 3SJKA 3BG4C 2ZNKH 1E37B 3BEFB 3MI4A 1MH0A 3ZZDA 2WV5A 4BXWA 4TY6A 1YYY1 2VB0A 1YCPH 2FYQA 1AFEH 5JB9S 3A8AA 1RTLA 3M7TA 1DE7H 3PO1B 1K22H 4XBCA 5L6NH 1TQ7B 1RJXB 5E0HA 1O2YA 3U9AH 2YNBA 1UVSH 5FPYA 1PYTD 2ZTZA 2W5EA 2BMGB 2H9TH 3K9XB 1FIWA 3ATWA 4XOJA 1GMCF 2RA3A 1SVPA 3E3TA 2D1JA 3SQEE 1O3DA 2WYJA 2ZU1A 4ABIA 1UTOA 3JZ2B 4GCHF 5FPTA 3Q3XA 4NGAH 2ZTXA 1TGBA 5EOKA 1AQ7A 2VGCC 2ZIQH 1AZ8A 2C8XB 4BAMB 5T6FA 1JOUB 1N8OC 4BAKB 1O5FH 1OWIA 4XSKU 4CR9A 4CBOA 5IYTA 2V35A 3URCA 2WPMS 1D6WA 1JXPA 1UVPA 1CU1A 1CGIE 2R9PA 2W3KA 4J1YA 1Y5AT 1EOJA 1JRTA 1YCPM 4FXGH 3ZV9A 1GI8B 1GI2A 1C4V2 2AMQA 1GI1A 1DXPA 1EPTC 5AFYH 3MNXA 3PMBB 3Q76A 3SV8A 3AAUA 4ZKOU 1GJ9B 1KDQB 1Y5BT 2Z7FE 1TMUH 1TPOA 4JK6A 2UUYA 2WPKS 2BQ6B 3EAJA 4U32A 2C3SA 2FO9A 3RXCA 4NSYA 1FAXA 1C2HA 3MH5A 3SU5A 1EZSC 1FY5A 4OGYA 8ESTE 2PKAA 1W0YH 1BTPA 1S6HA 1F0UA 3RXEA 1D3TB 4UD9H 2R3YA 1H9IE 3UWJH 4K1EA 1LVYA 4JYTA 1LKAA 1V3XA 3O8BA 3UPEA 1P2OA 2ZP0H 1ANBA 2JH5D 1O2NA 2Q6DA 2A7JA 4CH8B 4FU8A 1HJAC 3VXEH 2O8UA 3HGNA 3ZVCA 1Q31A 2GGVB 4CRAA 3EE0B 4FU9A 1C2GA 1ELBA 2GT8A 3MTYA 4VGCC 2F9OA 1C5XB 2HRVA 3BF6H 1O5GH 1LVOA 2I6QA 1J17T 4BAOB 1W7GH 1XUHA 1NC6A 5EQRA 1O35A 2HOBA 5GCHG 1VITF 3RXKA 4DT7B 1QJ6B 3RMLH 2XYAA 1SLXB 5K7RA 1EAUA 1O3LA 1CGHA 3GCTF 2PKAB 4HFPB 1GBJA 3LDXH 2Y81A 2ZDAH 1HYLA 3SORA 3STIA 2AH4X 1OSSA 1BA8B 1GJAB 3RC6A 3SNAA 1QBOA 1QQUA 1GWAA 5JDUB 3VB6A 1O3EA 3VB3A 3PLPA 1S6FA 2AYWA 1AY6H 2BXUH 1HRTH 1V2KT 3GY7A 2Z3EA 4NIYA 2BX4A 2Y6TA 5JYIA 1CHOF 2XRCA 1VCWA 4X8TH 1YP9A 1BHXB 1AZZA 1GGDC 2QGRA 1D3PB 4MVNA 4WMEA 1O38A 1A4WH 2FODA 1AKSB 1ZZZA 2P93A 3ATKA 2GD4B 1PPCE 1L1JA 1SGIB 4X1RU 3R0FA 2FP7B 3QO6A 4IC5A 2ZGXH 4LOYH 2J38A 1K1PA 2EA3A 3D23A 3ZYEA 4X1QU 4TY7A 5E2OA 4NZLA 5FBIA 3NCLA 2VNTA 5DP3A 1O2VA 3GCHB 4MDSA 4I8HA 3FZDA 5FBEA 3EGKH 4Y8YA 1MKWH 1V2PT 3GCNA 3D49H 4JZEH 1Y3WA 2P3UB 1V2UT 2BVRH 8GCHG 2W7SA 5GIBA 1AFQC 1WCZA 3UOUA 2JETB 5DG6A 1T8OA 3RXPA 1A46H 1UVOA 5JBCS 2AIQA 1W13U 1GBBA 1NU7B 1UCYK 3LC3A 2ILNA 2GTBA 4RKOB 3UFAA 2B0FA 2C8YB 3ODFA 1Z6EA 4ZXXH 2CF9H 3CS7A 1FI8A 1W8BH 5J4SA 1QA7A 3DT0H 3GICB 2R0KA 1ARCA 4WF8A 3OX7U 1JMOH 1EASA 1NPMA 1Z71A 2HALA 3S9CA 1V6DA 1D4PB 1C9PA 1XXFA 1CO7E 2FIRH 3NKKA 3PWBA 4AG1A 1AU8A 3BTWE 2BD7A 3ZV8A 3E16B 1IQIA 1IQMA 3HKJB 1MKXK 3P8NA 2IN2A 5L30H 1O2WA 2ULLA 1SG8B 3BG4B 2FS9A 1K1JA 1PQ5A 1O2GH 1HIAA 3SQHE 1PQ8A 1Y3XA 1GVZA 1OP2A 4Y71A 1SSXA 2G55A 1PPHE 3NPSA 1YPMH 2TIOA 3RXTA 1KXDA 3LGIA 3A83A 3PO1C 4CRFA 2OLGA 1AUJA 4NCYA 1DFPA 2OD3B 1DWBH 1TOMH 3SUEA 7GCHG 1EPTA 1O2ZA 1EATA 3M36A 2VIQA 1AWFH 2BXTH 2O8LA 4IC6A 5EG4A 3MO3A 1PYTC 5JBBS 2XCFA 4B2BA 5DP4A 4WXIA 2NU3E 1AGJA 1GI5A 1SBWA 4NWKA 3SI3H 5GJ4B 1FN8A 2ZG0H 4I7YH 3SZNA 3FVFB 2G8TA 1B7XB 1P02A 4B1TA 2BD9A 3SUDA 2FOMB 1UJ1A 1RS0A 2DE9A 1P01A 1T32A 2VGCB 5L2YH 1DDJA 1CT0E 1GMDG 2BDBA 3OY5U 3U1IB 1P12E 2I6SA 1MQ6A 2AS9A 2F3CE 4AZ2B 1N8OB 1UTMA 3TK6A 5HYOA 2A7HA 1BTXA 5EXNA 1TALA 4I8JA 2FESH 4A7IB 1C1TA 1GMCG 1GHAF 1BTWA 5DP7A 1O36A 1AO5A 1FY4A 3AVZA 1P3CA 5AHGH 3V3MA 2GCHF 4GCHG 5I25A 2PV9B 1AWHB 2BLWA 2FXRA 4U2WA 3GY3A 1BRUP 1EPTB 4ISOA 5B6OA 1BMMH 2A0QB 3FAOA 2UUKB 1DSUA 1MUEB 4I8GA 2FOGA 3P8GA 4BTTB 1P2QA 4ZKNU 1VZQH 2BTCE 1YCPK 3U8OH 1O2IA 5DO4H 1NO9H 1NRQH 1AE8H 1O5AB 3SU1A 1JWTA 4DY7B 3SN8A 1O34A 2TGDA 4BAHB 4DIHH 1AMHA 4CHAC 3S9BA 1LHDH 3A82A 3TIUA 2UWOA 3QK1A 1QRXA 2PLXA 2BLVA 2FLRH 2VIDA 5A8XA 2BLQA 3SNCA 4DGJA 3MFJA 1C2KA 2BDIA 2VWMA 2FI5E 4JZIA 1W14U 2OXSA 4ZHAA 1KTTB 2BY6X 3ZVDA 4AOQA 2BDGA 2Q6FA 1A3BH 3MWIU 2JKHA 5LH8A 3Q77A 3E6PH 1FMGA 1HJAB 1SL3A 3ELAH 4ZKSU 1Z8RA 1NRNH 1TBQH 1THPB 2SGDE 4UFGH 3BTEE 1O3CA 4FU7A 1HAIH 1XM1A 3ODDA 1SGFA 1UCYE 4VGCB 2ZU2A 2Z3DA 2J95A 2SGQE 1TMTH 4Y0ZE 2VVVA 1QY6A 5FCRA 1Z8GA 2AMPA 2OC8A 1CBWC 2GT7A 1DWCH 1K2I1 1A7SA 2A5KA 4RN6A 2STBE 2VIOA 1NRRH 4O3TA 4FUJA 1H4WA 3EYDA 5C5NA 3PLBA 2XNIA 3IWMA 1KXFA 3MU5A 4YOJA 3MH6A 3TH2H 3TGIE 1BTUA 4Y7BA 4GPGA 2ANYA 3PM3A 1YPHC 2F9UA 3QUMP 1MBQA 3DFLA 1QBVH 2SGEE 1YPHE 1ZYOA 1KLJH 1G2LA 3RDZA 2G81E 3A8DA 1MD8A 2FLBH 3ATIA 3QN7A 4O97A 1QQ4A 1TX7A 1TNGA 5A0CA 1TX6A 4YT6H 1SB1H 1BMLA 3M5MA 2ZU4A 5DP8A 3M7UA 1P2MA 1BBRK 2V6NA 1MMJN 2AGEX 2Y5GA 3A8CA 3S69A 5C2ZA 1P2NA 1DX5M 2QN5T 4AG2A 1F92A 1GGDB 1GI0A 1Q3XA 1SGFG 3OSYA 4HGCA 3A81A 3UUZA 3KQCA 1WV7H 4ABEA 2G4UA 2QXIA 5GXPA 2KAIA 3F68H 1GJ5H 1Y3UA 3QX5H 1T4UH 4ZAEA 1SHHB 3MMGA 1A61H 2ZDMA 1BT7A 4D7FA 2PW8H 1A0HB 3ATMA 2QC2A 5FX5A 1C2DA 1NN6A 1QRWA 1JIRA 3BTFE 3GOVB 5IDKA 2SGPE 3GCHC 3MU1A 2A4RA 1HAYB 1QB6A 2XWAA 3KF2A 2PWXA 5CHAB 5C1YA 2TGPZ 4JK5A 1XUJA 3M3TA 4DVAU 1TLDA 1ZOMA 3M3VA 3VB7A 1KXAA 1P2JA 1PPGE 2ODPA 3BTQE 2A5AA 2GZ7A 3NUMA 1JRSA 4IGDA 1O3KA 3A7ZA 1O2UA 2THFB 3GISB 5LPEA 1AFQB 3RU4D 1YF4A 3R3GB 1NY22 2ANMH 3IITA 4IW4E 1BTYA 1GCTB 2XBWA 4AFQA 4FUGA 1ZPCA 4E7NA 1H1BA 3LGVA 1A0JA 3SNBA 1SFQB 2NU2E 2J9NA 4OS5A 1PPZA 4AGKA 2A45B 3M61U 5A0BA 2BQ7B 3MO6A 4NG9H 5CE1A 1A5HA 4AYVB 1TABE 1C2EA