1PQ5A

Trypsin at ph 5, 0.85 a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Trypsin Revisited: CRYSTALLOGRAPHY AT (SUB) ATOMIC RESOLUTION AND QUANTUM CHEMISTRY REVEALING DETAILS OF CATALYSIS.
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq5A01
3GY5A 2FYRA 1L1GA 1Y3WA 1UTOA 2BLVA 4O03A 3ZZ9A 4ABHA 1HIAA 3D23A 3Q3YA 4YESB 1BT7A 5T3HA 1OYTH 1FY5A 3RMLH 4NIYA 1GBJA 1C2HA 4MNWA 1NFWA 2PTCE 5EW2H 3EAJA 2C8XB 4JZDH 2FIRH 9ESTA 2ANYA 2XBXA 3ZZCA 1AQ7A 3GCNA 4X8UH 4U30A 1TYNA 1UTQA 3M5OA 1Y3UA 1DY8A 4BAQB 3RU4E 1O2TA 1WYKA 5CE1A 1SGTA 1YLCA 3PMJA 2ZHDA 4B2BA 2QAAA 5F03A 1AVGH 3UPEA 1YGCH 2ZCLP 1ESBA 2PW8H 3DHKH 4R0IA 2VNTA 3BIUH 4MQAA 1QURH 1GCDA 1V2OT 2OUAA 4LXBH 1BCUH 1BQYA 1GMCF 1M9UA 4ZKSU 1JRSA 4O9VA 1OP2A 1EZSC 3F6UH 2ZU4A 1UVOA 3M7UA 4I31A 1EJMA 1QRZA 1AZZA 3C1KA 2AERH 3K6ZA 4XBCA 4XDEA 1UCYK 3S69A 3UR9A 1O2SA 1LHFH 1QL9A 2EEKA 3RLWH 2FDAA 1ARBA 5FAHA 3A83A 1F5LA 1SVPA 4X1RU 1GDUA 2ZWLH 2A5AA 3RP2A 4A92A 2J94A 1W13U 3DA9B 3P92A 4Z6AH 2OC0A 1HAPH 2GMTC 5DO4H 1NC6A 2QYIA 2H9TH 2PKSB 2J9NA 5JBTA 2A7JA 5L2YH 3VB5A 1PQ5A 1WTHD 3PTNA 1AVWA 2Z9LA 4JZEH 3M61U 4K1EA 1PPCE 1PFXC 1GVKB 3UNSA 1UK4A 2BMGB 4VGCC 4FU7A 4YT7H 4I8GA 3SUDA 1C5YB 2I6QA 4I8JA 3SZNA 2WPKS 2NU4E 1BRBE 2VH0A 5EG4A 1HXFH 2H9HA 1K1LA 2GCHG 2BX4A 3OYPA 1T32A 4ZXYH 1LVOA 1K21H 1W12U 1TIOA 1G36A 2UWOA 3RXFA 2ZC9H 2ZDMA 3SU5A 5AF9H 1L4ZA 2ZFQH 1L2EA 4CR9A 3RXMA 3M5MA 5DJ7A 1V2VT 4TY6A 1V2PT 2BM2A 3MO3A 3ZZ7A 2BOKA 4OGYA 1CA0B 5FPSA 2TGPZ 1O5CB 5A2MH 3RXQA 1KSNA 2V35A 2XYAA 1YP9A 4GHQA 3KHVA 4IBLH 2BLQA 1KLTA 1SGFA 2QY0B 1UTJA 1GJ9B 5DP4A 4X2WA 5EQQA 1ELAA 4X6NA 1WSSH 1BMNH 2C3SA 3IWMA 4MPXA 1O2VA 1WOFA 4X1QU 4B73A 3TK9A 1TRYA 2FOGA 1C1VH 1JMOH 2JH0D 1CGHA 5A0BA 3PLBA 3ZVDA 2R2MB 3PROA 1PPHE 5EXNA 4JMYA 1BMMH 3SJKA 2OP9A 1GJ6A 1LVMA 1TQ7B 1GMDG 3HGNA 4E7RG 4WH6A 1RTFB 1AIXH 5TCAA 3BTDE 1BJUA 1YYY1 1Z1IA 1XX9A 2W7SA 2PKSC 4OS6A 3KL6A 3K6YA 2HWLB 3P8FA 1O2GH 2BB4A 4XOJA 1GBLA 3Q76A 4AGJA 2CF8H 3S7KB 1SGDE 3D65E 2FS9A 1Y5BT 1ORFA 2QCYA 2ZGHA 1NZQH 1E34B 4JYUH 1P06A 3UIRA 1RD3B 2BX3A 3PLKA 4ABEA 5EW1H 1HCGA 4A1VA 4OS4A 1HB0B 4ABFA 4OGXA 4Y8XA 3STJA 1L1NA 1OX1A 4CRFA 4MDSA 4ZKRU 3ZVEA 3PB1E 1NRRH 3U8RH 4F4OC 3PMBB 4BOHA 4WH8A 2J34A 5FBIA 1T8MA 4AB9A 2CV3A 1MQ6A 1KXFA 3T2NA 2BZ6H 1A61H 1NRNH 3TJNA 2AFQB 1BTYA 3P17H 2GTBA 1F0UA 3ATLA 2SGQE 3RXDA 2C93B 4NIXA 3MU8A 1QBOA 1AUJA 1GBEA 3RXIA 3OX7U 3QZQA 3LKWA 4JZFH 4CRCA 1CA0C 1VJ9U 2VINA 4NCYA 1SHHB 4Y7BA 1O2YA 3S9BA 1CGJE 1W0ZU 1FQ3A 1MUEB 2ZDLA 3BV9B 3DUXH 4I8KA 4MPUA 2AMPA 5F8TA 1QJ7B 4X8TH 1ZTJA 1DY9A 4UE7H 2OC7A 1SLVB 3QTOH 3E90B 4HTCH 3P95A 3VB4A 1HJ9A 4YOJA 1EZQA 1P9SA 1XUGA 2PSYA 5C5OA 1OPHB 1TQ0B 2VWMA 3BTKE 1ZMLA 4X2XA 1WQSA 2EI6A 2Z94A 3GY6A 1O2ZA 3QK1A 4NSVA 1QHRB 1DT2A 1HV7A 3Q3XA 3SHAH 3M3TA 4XE4A 1OWIA 3LPRA 2FOCA 1GMDF 2FS8A 2PWXA 1C1NA 1VJAU 3A89A 1A0HB 3QX5H 2AEIH 3GOVB 1HAGE 2V6NA 3RXLA 1G3CA 3M3SA 3EGKH 1C1WH 1LHCH 3E1XB 2TPIZ 2ZFTA 3OU0A 1OP8A 2OQUA 1SFQB 5HM9A 1XUIA 4BXWA 2UUYA 1BRAA 1E38B 3V3MA 1B0EA 1G30B 3L3TA 4ASHA 1EX3A 1TLDA 2ZEBA 2AMQA 3B23B 3GY4A 5LH8A 3MNSA 4E7NA 2IJOB 2UWPA 5FBEA 2BD9A 1DM4B 1AWFH 2HNTC 1S82A 1UK3A 1V6DA 2Z3EA 4BTIB 2PGQB 1ANEA 1SPJA 2YNBA 3A87A 4X6PA 1YC0A 3EA9A 4KP0A 1GJDB 2VIVA 1LCYA 2VGCB 1D6WA 3SJ9A 1P2JA 1Z1JA 4INKA 1CHGA 4AG2A 4AORA 2WV4A 4GCHG 4I33A 2ZQ2A 1FPHH 1JIMA 1WU1A 2O9QA 3P8OA 3VB7A 3U69H 2P59A 3MFJA 3GCTG 1TX8A 4Y11E 1HAVB 2XW9A 1A7SA 3KIDU 4TPIZ 1QJ1B 3VFEA 4FUGA 3SU3A 3RU4D 1IHSH 3SGQE 3ZZ6A 2BD3A 4B2CA 3E16B 4KKDA 2GDDA 1IHTH 1K28D 5C5NA 4WWYA 3RXUA 1WBGB 1J8AA 5EQRA 1PPZA 4WMDA 2WPJS 1P57B 4CH2B 3GY3A 1MBMA 3ZZDA 2FX4A 4FUEA 5E0HA 4OS5A 1TA6A 1DS2E 2AYWA 4H6SB 1S6HA 1O2HA 5GXPA 3SNCA 4JK5A 1A3BH 1PPBH 1O2UA 1IOEA 1NRPH 4UONA 1SGRE 1XVMA 1ZRBA 1C1UH 2ZDNA 4DJZB 5DP7A 3STIA 1GL1A 1GDNA 3EA7A 5DP5A 4KTUA 4CBOA 1E37B 1IQEA 1O2NA 2A7CA 1T4UH 2C90B 1UK2A 4CREA 1D3TB 4DG4A 2Q6GA 5JPMH 2VIQA 2JH5D 3FZZA 2ZGBH 3TJUA 3ZZ3A 4ISOA 1AE8H 2ZTXA 3B8JA 4WVPE 1O2RA 4XFQA 5SGAE 2AGIX 1C2DA 1FONA 1S5SA 3URCA 3O8CA 1O38A 2QIQA 4WF8A 4B2AA 1C5SA 3TIUA 2QF0A 2ZO3H 1GJCB 1SI5H 2VWLA 3O8RA 4JZIA 4Q7XA 5E0JA 4GCHF 1GG6B 2A5IA 3NZIA 7GCHG 3HKJB 2WYJA 2THFB 2Z3DA 1BHXF 3NWUA 3CS0A 4K8BA 2VGCC 1OOKB 1MAYA 1EOLA 3A86A 3LGTA 1MD8A 4TY7A 4D8NA 3JZ2B 3SJIA 2HLCA 3QDZB 3H5CB 2P16A 3VGCB 4B75A 1S0RA 2JH6D 2VIWA 3RXKA 1ESAA 1QQ4A 1OS8A 3TH2H 3MNBA 2XBYA 4O3UA 1IQHA 2AGEX 2H9EH 2VWNA 3LJOA 1P12E 2CMYA 1TGCA 2ZU1A 1NN6A 2SGFE 1G37A 3ITIA 4JCNA 1K1OA 1Q31A 1JXPA 1TBQH 5H4IB 2CN0H 4YO9A 3E3TA 2ZP0H 2B0FA 4H4FA 1EZXC 2B9LA 3NK8A 1ZSJA 2BY9X 4UD9H 3RXEA 3I29A 4X1PU 1LQEA 2Y6TA 3RLYH 1YPGH 1K9OE 4AX9H 4DIIH 1O3CA 4DT7B 3M37A 4DURA 1SC8U 1GL0E 1LHDH 2PUXB 3V12A 3EQ0H 4FUJA 1GVZA 4BAHB 4U2WA 3UWJH 1G2MA 3PTBA 3RXVA 1V2MT 1QBVH 5A0CA 1C2JA 2PKAB 3SV8A 3ATIA 5FHTA 1BRCE 1C5RA 3D62A 4Y7AA 1V2KT 1ZMJA 1SLUB 3NPSA 1HXEH 2EA3A 2PSXA 1YPKH 3I77A 3SO3A 2GZ9A 3DFLA 2ODYB 4WXVA 2XBVA 2OBOA 4FU9A 3LJJA 4WMFA 2ESTE 5EXLA 1QY6A 2XTTB 1YPHC 4B76A 1BB0B 1ESTA 1GBKA 1ZPCA 2I6SA 3ZZAA 4K1TA 3RXHA 1ZGVA 1A5HA 2G51A 4ABIA 1C1TA 3AW0A 4ZMAH 7GCHF 4CRDA 2W5EA 3H7TA 5A09A 1YPJH 2G8TA 3ATKA 2RG3A 2FZZA 1BA8B 2R3UA 3M5LA 1TGBA 4B1TA 1ZLRA 1C1OA 1BIOA 1GG6C 2DE9A 2SNWA 2GT8A 5LPEA 2R3YA 3GDVA 1N6XA 1V2RT 2A2XH 1HPGA 1AFQC 1ZOMA 2A4RA 2XWBI 1D4PB 1A5GH 1MD7A 1ZYOA 1OWDA 1YLDA 2HPPH 2KAIA 1XUJA 2D8WA 5FX5A 1F0TA 3BG8A 4DOQA 1SQAA 3VGCC 5IYTA 1ETSH 1KYNA 4BAOB 2DE8A 3OTJE 1B5GH 1HAHH 2BDBA 4IW4E 1IQNA 1KXBA 4TPYA 3UOUA 4I7YH 1VCPA 2ZHFH 5A8XA 1IAUA 3BTWE 3PMAB 5GJ4B 1HUTH 4NIVA 1SFIA 4D76A 1BMAA 4J2YB 3NKKA 2ZFFH 2ANKH 1H4WA 3M5NA 4Y76A 1TFXA 4INLA 2O8LA 3LC3A 5DK1A 3GICB 2D2DA 2Y7ZA 3ESTA 4AN7A 4NGAH 3ZZBA 2C8YB 3RXPA 3A8DA 1ELTA 1GHWH 2R0KA 2G4TA 1MH0A 2BQ6B 1KXAA 4H42U 1FY3A 1ZSLA 8GCHG 2OXSA 2PHBA 1P2KA 2J4IA 3BG4B 3T28A 1V2NT 4YT6H 1Y5UT 3ODDA 3RXSA 3LH1A 1TOMH 4Y8YA 4I8HA 3BTFE 4Y0ZE 1YPEH 3SN8A 2XXLA 3TNTA 3T26A 1HBTH 1TNKA 2Y81A 1A2CH 3U98H 5K7RA 1LVBA 2RA0A 2ZQ1A 1MKWK 2HNTE 1C5OH 1EP6A 5B6OA 3V7TA 1O3DA 4JZ1A 2A7HA 3TK6A 2FOEA 1SMFE 3EYDA 5DP8A 1KDQA 1P3EA 5FCRA 4Q7ZA 1MAXA 4IGDA 3SNDA 3WY8A 4A6LA 3V13A 4HI3A 1F92A 6LPRA 1NM6A 1CVWH 2A45B 4AFQA 1K2I1 3QN7A 1GI0A 1D6RA 1XUFA 2BY7X 1BTXA 2FODA 2OQ5A 3ATMA 2A2QH 5EPYA 2Q6FA 4D9QA 1CGIE 2FTMA 1S0QA 1NU9A 4K60A 3GISB 2F83A 1LMWB 1A4WH 4AFUA 5BRRE 2BXTH 2ZZUH 2FP7B 1BOQA 1KTTB 5FX6A 2ZKSA 1GHZA 1FIWA 4THNH 3VB3A 3MU4A 3Q3KA 3LGUA 1HAZB 1TNIA 4NWKA 3VB6A 2ZTYA 2Y5HA 2ZA5A 3SU6A 1J15A 2PV9B 2QF3A 2HVXA 2GCTB 1DX5M 3RMMH 1S81A 2WYGA 1TAWA 2XC5A 2R9PA 3RC4A 1O3LA 2BVXH 1GHVH 4FVBA 1G3EA 1WUNH 5HM2A 1P2OA 1TPSA 4X8VH 2PTNA 1LO6A 2A5KA 1QL7A 1C2MA 1ETRH 1ANDA 3MH7A 2M5TA 8GCHF 1C5QA 2VB0A 2V0BA 5I46H 3BEUA 1AN1E 2UUKB 1YCPH 3E0PB 1QB1A 2IPHA 1UVPA 3BG4C 3SQHE 2CF9H 1J14A 1AWHB 3TK5A 2FOAA 1NROH 1P0SH 4FUCA 1AE5A 2BVRH 1Q2WA 3MO9A 1UTKA 3ZVGA 2HNTF 1TONA 2ZGJA 4K1SA 1GBFA 3SUGA 2GD4B 2PGBB 1EJNA 5LPFA 3SJOA 4K69A 5DG6A 1EKBB 4ZHAA 1HFDA 2H5CA 2BVSH 4UFFH 5HXFA 4X6OA 3CS7A 1FPCH 4LZ4B 4TYDA 3RUOA 2QXHA 3GCHB 4ISLA 1ABJH 1ETTH 1NTPA 2AMDA 3GY8A 3ZVFA 1GJAB 1P04A 1C1SA 2BDYA 4ZH8A 1P2QA 4YTAA 1VGCB 1Z6JH 1NESE 1OWHA 2D26C 4U32A 2AGGX 1W10U 5EGMA 2C4FH 1O5DH 1VZQH 4Y6DA 1CT2E 2XBWA 1GBAA 1ANBA 1SQTA 1IQIA 2ZPSA 1C5MD 4YLQH 1G32B 1DITH 1O2JA 1PYTC 3K2UA 5EPNA 3LDXH 1LTOA 1C5VA 1GI7B 4Q7YA 3PWCA 1C1QA 1V2ST 1HRTH 1MMJN 3SU1A 4X2VA 3W94A 1ANCA 3ENSB 2FESH 2SGEE 1IQJA 3A85A 1EXFA 5IDKA 4GSOA 3NCLA 2P3UB 1GBHA 1UO6A 2GCTC 2F3CE 1BTZA 1P09A 5DKMA 3SV2H 2ALVA 4NZLA 4NFFA 4U01A 4K2YA 3OSYA 2G5VA 1QR3E 2O8WA 1TNLA 4FUBA 1LHEH 1N8OB 1IQKA 1SOTA 1H1BA 4Y8ZA 3AASA 3UY9A 4K3JA 5HMAA 1CT0E 5JBBS 3KNXA 1C2IA 1ZJDA 1F2SE 1GHBG 1KY9A 2J2UA 1O32A 2ZCKP 1MKWH 2ZU3A 1O31A 1C4V2 2W3KA 3TH3H 3LGWA 2QC2A 3MWIU 2BHGA 4DCDA 3RC5A 3FP8E 3A7ZA 4Z0KA 1UJ1A 3S9AA 2OTVA 1YPHE 2SNVA 7KMEH 1Z8GA 1P8VC 1TPOA 2ZDVH 1YPMH 5EODA 1IQMA 5C2ZA 5FPTA 1S6FA 1GJ5H 1FJSA 3MMGA 4X1NU 3QZRA 2FX6A 3SUFA 1G3BA 4D7FA 4OS2A 1QQUA 1WQVH 1XXFA 3L33A 4GUXA 4D7GA 2Y82A 3QTVH 1DVAH 2FLRH 1P3CA 1OYQA 2IOTA 1GI3A 1MKXH 1QFKH 3GCHC 1IQLA 1EPTB 1DOJA 1THRH 1V2WT 2ZDAH 1DPOA 5AHGH 1RTKA 5CHAB 1EB2A 2ULLA 3GDUA 2BY8X 4NWLA 4ZUHA 1VGCC 2XRCA 2AIPA 4BXSA 2ZI2H 1V2UT 1V2JT 3KQDA 2ZDKA 1K1MA 1UTNA 1G9IE 5FPYA 3O8DA 2PFEA 1Y59T 1NRSH 2F9BH 1W11U 2FTLE 1FAXA 1O2IA 1ZHRA 1TALA 2DUCA 3A80A 4A5TS 1L0ZA 4SGAE 3TJOA 1ELVA 1RIWB 2V3OH 3R3GB 4MNVA 1BUIA 5C1YA 4BTUB 3MO6A 3P70B 1RS0A 2WPHS 1CO7E 5F8XA 1OXGA 1GJ7B 1O5EH 1K1IA 1CHOG 1TBRH 1ZPBA 3RMOH 1SG8B 3URDA 1C5UA 1PPFE 1GHBF 1EOJA 4RKJB 1N8OC 1UMAH 2ZGXH 3A84A 4ZKNU 2D1JA 1C5WB 5GWZA 1J17T 3LH3A 1SGEE 2B8OH 1S85A 5DP9A 2GZ7A 1NFYA 2OBQA 1P2IA 3KEEA 4TWYA 3ZYEA 1SGCA 3ZVBA 4B74A 3ODFA 5CMXH 4ZAEA 1LDTT 1O3JA 3FZDA 4ISIH 5TCCA 4ZHLU 1H9IE 4IN1A 3ZZ5A 2BDAA 4AZ2B 2P3TB 1MU6B 3E6PH 5E2OA 1GMHG 1DDJA 4MPWA 1T8NA 3FANA 2OCVB 3SNAA 1Y3YA 5G4BA 3RXOA 1PPGE 1QRXA 4Q2KA 3SGAE 4BANB 4J1YA 1GI4A 3U9AH 4BAMB 2JETB 6GCHG 1FAKH 1C1RA 3SV9A 1W2KH 1DICA 3GY7A 1OWJA 1CSOE 4X0WU 1O39A 3VXEH 5DPAA 1DANH 1GWAA 4ZROA 1YBWA 2XC4A 1E35B 1X7AC 5JB9S 3CENA 3SU4A 1UTPA 1V2QT 1EPTC 3PMHB 1Z8JB 3A7YA 2WUCA 4K5ZA 4CH8B 5CHAC 1C1PA 2BLOA 2PKAA 1ZZZA 1AB9B 2ZU2A 3BEIB 1SGPE 2BD8A 2SGDE 3UREA 4LK4A 2ZHWH 3M7QA 4CRBA 4SGBE 1K1NA 1RGQA 2P93A 2BZAA 2FOHA 1PJPA 1VITH 1P02A 3BTGE 1SLXB 1D9IA 3HATH 5AVDA 3SV7A 3VEQB 6CHAB 1ZGIA 5JYIA 1MTUA 1RIWC 4X1SU 1CHOF 2CJIA 1VCQA 1LKAA 1GCTB 3TPIZ 1FXYA 1Z8IB 4ABGA 1V2TT 3ATWA 3A82A 4F49A 1KXEA 2QXGA 3GY2A 2UWLA 1IQFA 1AZ8A 4FXGH 3U1IB 3LGVA 2FXRA 2V3HH 3FP7E 5T6GA 1LPZB 1A5IA 1MBQA 1KXDA 1KLIH 1OWKA 1XMNB 2JKHA 1ELBA 1GBIA 5A8ZA 5K0HA 1CU1A 1JRTA 2BDIA 1Y3VA 4UFGH 1O3HA 1FY8E 1GMHF 2Q1JA 1CQQA 1JBUH 1QNJA 4AYVB 1SGIB 1NFXA 1DLKB 1SGYE 3MH4A 4O97A 4YZUA 1MZAA 1QB6A 4IMQA 1HGTH 1UVSH 4CHAB 1O3IA 3UFAA 1BBRH 3UOPA 2CGAA 2W26A 1GI8B 3M3VA 1GHYH 2OC8A 6GCHF 2BQWB 2GGVB 1TBZH 1P11E 1U6QA 1QL8A 2A4OA 1W7XH 1ABIH 4JYTA 1C2KA 5EXMA 1AY6H 3RXTA 1AKSB 1SB1H 1T8OA 2BTCE 3IG6B 4YOGA 4KTCA 3BIVH 1EZUC 5ESTE 2Y7XA 2JETC 3SV6A 3ZZ4A 2AS9A 3QGNB 3TU7H 3MU0A 3PYHA 4Q80A 3KF2A 1TRMA 1TB6H 4FUDA 4AYYB 3RXBA 1RFNA 2P8OB 1ELGA 2AIQA 2ZF0H 2BY6X 3MNCA 2A1DB 2Y5FA 1QIXB 3F9GA 3SUEA 3SORA 2G00A 2NU3E 2ODQA 3LOXA 3O8BA 4NG9H 2WINI 1YCPK 1XUHA 3KQBA 1AB9C 1HLTH 3RMNH 2GZ8A 2R0LA 5C67A 1WTGH 3SI4H 4B71A 1O33A 5F6MA 1DXPA 3E8LA 3MI4A 1ZHPA 2FWWA 3MU1A 2BOHB 2SGAA 2WPLS 3OY5U 3MU5A 5T6FA 2ZG0H 2G5NA 6CHAC 1O5BB 1SBWA 2NU0E 2FPZA 3HPTB 1FZZA 4Y79A 3GDSA 5PTPA 4O3TA 1O30A 2BXUH 2VU8E 4X2YA 1MU8B 2VIDA 4BNRA 1G2LA 1LKBA 1Y3XA 1CBWB 1C9TA 3N7OA 2A31A 2W3IA 1SL3A 1NPMA 4AFSA 1DFPA 1NY22 1SR5C 1HJAB 1XXDA 1RXPA 1C2FA 1S84A 4CBNA 4OS7A 3BTEE 3SU0A 2G52A 1GGDB 4LZ1H 4NZQA 2VVVA 1AFEH 4AB8A 4ABJA 2H2ZA 2OD3B 3A7TA 5BPEA 3I78A 4UFDH 4CHAC 3TGJE 4NFEA 1LHGH 3SNEA 4IS5A 2J92A 3AVZA 2Y5GA 5GCHG 2PUQH 2FYQA 5F8ZA 1MZDA 2HRVA 3RXGA 3S7HB 3RM2H 1K1JA 1P03A 2FLBH 5E0GA 1V3XA 2CXVA 3TJVA 7ESTE 1C4Y2 4H6TA 1B0FA 1KXCA 4UEHH 1UHBB 3A81A 3TVJB 1FLEE 1C5NH 2W7UA 5HGGA 1TNHA 1TE0A 2BDHA 2P8OC 1SSXA 1BRUP 1A1RA 2TGDA 1SQOA 3SOSA 3LONA 8KME2 2BD2A 3DT0H 3PWBA 1O3KA 2Z9JA 3T5FH 2FI5E 1UTMA 2H5DA 2FOMB 1QBNA 1HNEE 2XCFA 3ZVAA 1UVUH 3QUMP 1TGSZ 2UUJB 3MYWA 4ZKOU 2F9VA 1MTNB 3FVFB 4CRGA 4RKOB 4NA8A 1NRQH 3R0FA 4TWWA 2KAIB 4AFZA 5E2PA 2BDGA 3KQCA 1MQ5A 1E0FD 4X8SH 1EAWA 1UVTH 1QCPA 1XUKA 4NIWA 2P94A 2ALPA 1MKXK 3FP6E 5FCKA 1HIAB 4DY7B 3F68H 3U8OH 4HGCA 2Z3CA 2LNCA 1CBWC 1C9PA 1OSSA 3F9FA 3W95A 5HYOA 1EAIA 1E36B 1UTLM 3PM3A 1TWXB 2ODPA 2A4GA 1HJAC 4GAWA 1VCWA 5J4SA 3ZVCA 1AU8A 1PQ8A 1TX7A 5DGJA 1SGFG 5ETXA 2ILNA 1ACBE 5JB8S 2LPRA 1A3EH 5JBCS 1GGDC 1KTSB 2WPIS 1O3EA 2Z6BD 4MTBA 5EQSA 5GCHF 2B7DH 1FMGA 2ZIQH 2HPQH 4INHA 1WAYB 1O2KA 1Z6EA 3H7OA 5GIBA 1NU7B 1ZHMA 3Q00A 2EI8A 1ZMNA 1P9UA 3D49H 3UWIA 4DIHH 4XBDA 1GJ4H 1A0LA 3SU2A 2FO9A 1B7XB 1EAUA 1O3BA 1GBTA 3SHCH 1ZJKA 1P10A 2F9OA 3M7TA 3TH4H 4FUHA 2ZNKH 1KIGH 1FN6A 1HAXB 5ESBA 1BDAA 3RXCA 3QO6A 4MPVA 5EU8A 1TA2A 2VVCA 1NT1A 4IC5A 3BN9A 1VITG 5L6NH 4XBBA 2SGPE 2TRMA 1D3DB 3T62A 3PLPA 3BTQE 3SI3H 2O8UA 1O5GH 4WMEA 3DFJA 2SFAA 1QB9A 4AOQA 1YCPM 3BF6H 3KCGH 2B5TB 1KDQB 4GPGA 1NS3A 2ANMH 2J38A 1O5AB 1W8BH 1LQDB 3RXJA 1L1JA 3LU9B 1DSTA 2BD5A 3OY6U 5C1UA 5J4QA 1TX6A 3MNXA 1C2LA 4KELA 1GHAG 1MTNC 3Q77A 2GP9B 1EAXA 2A32A 3LIWA 3MH6A 4KGAA 2FM2A 3M36A 4ISHH 1TRNA 7LPRA 1F5RA 4CRAA 3L6PA 4IMZA 2Y80A 1BBRE 1K1PA 3P8GA 1EASA 1GDQA 1DE7H 4UDWH 3VXFH 1C2GA 1DWEH 2NWNA 1EUFA 2G81E 2TIOA 1O35A 3FFGA 1DWBH 2BY5X 2A0QB 4M7GA 1EPTA 1H8DH 2P95A 4ISNA 1KLJH 1C4U2 1AD8H 2IN2A 3A8BA 4GVUA 3AW1A 3FAOA 2UUFB 1BJVA 1EATA 2GCHF 1BTHH 1J9CH 3S0NA 1SHYA 3GYMA 5AFYH 3BSQA 1INCA 3ZZ8A 1QJ6B 2G4UA 4AGKA 2FOFA 1H8IH 1T7CA 4I32A 1WCZA 1HYLA 2ASUB 2G55A 1P01A 2HOBA 3A8AA 3U8TH 8LPRA 1N1LA 4YLUA 1FIZA 2F91A 1TGNA 2AH4X 1TPAE 5EOKA 1SGQE 2EI7A 2RA3A 1OWEA 4D9RA 1AO5A 2OC1A 2YNAA 1NFUA 1O0DH 1THSH 2Z7FE 1BZXE 3AAVA 1IQGA 1F5KU 3IITA 1VITF 2BQ7B 1GPZA 3SQEE 2Z9KA 1HAVA 2FI4E 2ZTZA 3GCOA 1RTLA 1ARCA 4XSKU 1NO9H 2Q6DA 1W0YH 1TMTH 3ELAH 2WUBA 1BTPA 1C5TA 2CHAB 1O5FH 1UCYH 3UR6A 1FDPA 2C8ZB 2ZPQA 2BD7A 2QGRA 4RSPA 2STAE 3P8NA 1C2EA 1QRWA 1GBMA 2GV7A 1QA7A 2QXIA 2R2WU 4NA9H 3LC5A 1DLEA 1PYTD 3GYLB 1BBRK 8ESTE 1GHAF 1C5LH 1CT4E 3T29A 1DUAA 3B9FH 1DWCH 4E06H 5E8EH 6ESTA 4ABAA 1H9HE 5GPIB 3T27A 3RXAA 1VR1H 3E91A 3LGYA 1TNJA 2XWAA 2HALA 3EE0B 3K65B 4OS1A 1JOUB 2A4QA 4A7IB 3NXPA 3RM0H 1Z8RA 3KQEA 2YOLA 5FXLA 1MCTA 1C1MA 4A1XA 4DVAU 3EA8A 1DUEA 1TMBH 2J95A 3SBKA 2GX4A 4GLYA 3BTTE 3LT3A 1W14U 2O8TA 1OP0A 2ZFRH 4LOYH 4X6MA 4IC6A 1O2WA 3JZ1B 1LVYA 1GBCA 2VIPA 3P6ZB 1AVXA 2QA9E 2PLXA 2RDLA 4A1TA 1XM1A 4AG1A 1O3NA 1TOCB 1YKTA 1AHTH 2ZECA 4ZXXH 1L4DA 4UFEH 1O2LA 1O2PA 1FY4A 5A8YA 1WV7H 5ABWA 5L2ZH 2ANWA 3SNBA 2VWOA 3BTME 1LPGB 1O2MA 3TGIE 3C27B 1C5XB 2VH6A 4BTTB 4YM9A 1TPPA 3HK3B 1ZTKA 3PO1B 3UNQA 1O2QA 1PQ7A 1HAIH 4WJG2 4PROA 3U1JB 3M35A 4Y71A 1H9LB 1AMHA 1BTWA 3BEFB 1HAOH 1HAYB 2O8MA 3AAUA 2ZGCA 2VIOA 2ZFSA 3EDXB 1C5ZB 1ELCA 4WXIA 1V2LT 4WY3A 1ELEE 5DP3A 1O3PB 1EJAA 3SGBE 1AI8H 1XKAC 1C5PA 3TITA 1ZSKA 2CHAC 4ABDA 2C8WB 2Z9IA 2EC9H 3HK6B 4FUFA 3UTUH 1YPLH 1LPKB 1QA0A 3ZV9A 2OINA 3HKIB 1O2XA 5LPRA 1SOZA 5I25A 2K1QA 4E05H 1JWTA 1D3QB 2QN5T 3K9XB 5A0AE 5C3NA 1W7GH 3VPKA 3V0XA 1EB1H 3CP7A 1T8LA 1TABE 1QGFA 1RRKA 1SLWB 1O3FA 1AKSA 1GBBA 4FVDA 4YOIA 4DW2U 4NA7A 1F0SA 1J16A 1GI9B 3HGPA 1RJXB 1GI2A 1ID5H 1GI5A 1FUJA 1O37A 1YF4A 4BAKB 3QWCH 1PQAA 1FN8A 1MCVA 3TGKE 1O2OA 1MTWA 4CR5A 2RCEA 1P2NA 5AFZH 1P2MA 3UQOA 2F9UA 1BTUA 1GVLA 3KN2A 2BDCA 3ZYDA 3A7VA 3UUZA 4JK6A 1ZPZA 2H1UA 1O3GA 1HJ8A 1Y8TA 1O3AA 2GV6A 4K8YA 4IN2A 1O34A 3KGPA 2F9PA 3TLOA 5L30H 5GDSH 1F0RA 4Y10E 2WV5A 3E0NB 1XVOA 1AFQB 1GBDA 3G01A 2TBSA 3RDZA 3A7WA 2XCNA 2P3FH 3GCTF 3UNRA 2QV1A 2ZCHP 5C20A 3MTYA 1Z71A 2BLWA 1Z7KA 1AUTC 5TJXA 4DGJA 1PPEE 1P05A 1HDTH 2XNIA 2ZHEH 4JYVH 1ZTLA 1Q3XA 3PO1C 5JBAS 3NUMA 1GJ8B 2ZHQH 4HFPB 4QT8C 1N6YA 4KTSA 2BD4A 5C1XA 5LGOA 1BMLA 1TNGA 4MLFB 3UQVA 1D3PB 4NSYA 1ELDE 3LGIA 4ABBA 1F7ZA 3RC6A 3ZV8A 1ELFA 1EP5A 2H6MA 3F9HA 1BHXB 4MNXA 3A7XA 3SW2B 1FI8A 1ZR0A 1Y5AT 1SGNE 1FV9A 4GHTA 3SJ8A 2VJ1A 1K22H 2PR3A 2GDEH 1YM0A 2BYAX 1QTFA 2FOBA 4MNYA 1FY1A 2QXJA 4R8TB 2HGTH 1A0JA 3MH5A 3F9EA 1DSUA 2NU1E 2ZU5A 1O36A 1TGTA 2ZFPH 3A88A 2WPMS 1FNIA 4I8LA 1EQ9A 2F9NA 2FI3E 4MG3A 4ESTE 3QLPH 3T25A 2NU2E 1UHBA 1TMUH 1GMCG 9LPRA 2FEQH 1G3DA 1CE5A 1XKBC 3BTHE 2OLGA 2ZPRA 1GI1A 3TNSA 1S83A 1DXWA 1GHXH 2GT7A 1O3MA 2VVUA 3PV4A 2STBE 2TGAA 2GKVE 1W3CA 1BITA 2GVFA 1MTVA 2TGTA 1JIRA 5DP6A 1GI6A 4RN6A 3MHWU 4ZHMU 1GCTC 4FUIA 3A8CA 2GMTB 2Z9GA 3RXRA 5JDUB 1ZRKA 3DD2H 1UCYE 4FU8A 1OKXA 3MOCA 1O3OA 3F1SB 1AGJA 1A46H 4MVNA 1CA8B 2FMJA 5T6DA 3RU4T 4VGCB 3S9CA 4Y0YE 1T31A 2XC0A 1GJBB 1MTSA 4HZHA 1T4VH 1DWDH 1THPB 3QGJA
chains in the Genus database with same CATH superfamily
3GY5A 2FYRA 1L1GA 1Y3WA 1UTOA 2BLVA 4O03A 3ZZ9A 4ABHA 1HIAA 3D23A 3Q3YA 4YESB 1BT7A 5T3HA 1OYTH 1FY5A 3RMLH 4NIYA 1GBJA 1C2HA 4MNWA 1NFWA 2PTCE 5EW2H 3EAJA 2C8XB 4JZDH 2FIRH 9ESTA 2ANYA 2XBXA 3ZZCA 1AQ7A 3GCNA 4X8UH 4U30A 1TYNA 1UTQA 3M5OA 1Y3UA 1DY8A 4BAQB 3RU4E 3EE7A 1O2TA 1WYKA 5CE1A 1SGTA 1YLCA 3PMJA 2ZHDA 4B2BA 2QAAA 3F2GA 1AVGH 5F03A 3UPEA 1YGCH 2ZCLP 1ESBA 2PW8H 3DHKH 4R0IA 2VNTA 3BIUH 4MQAA 1QURH 1GCDA 1V2OT 2OUAA 4LXBH 1BCUH 1BQYA 1GMCF 1M9UA 4ZKSU 1JRSA 4O9VA 1OP2A 2KCAA 1EZSC 3F6UH 2ZU4A 1UVOA 3M7UA 4I31A 1EJMA 1QRZA 1AZZA 5HIYA 3C1KA 2AERH 3K6ZA 4XBCA 4XDEA 1UCYK 3S69A 3UR9A 1O2SA 1LHFH 1QL9A 2EEKA 3F3BA 3RLWH 2FDAA 1ARBA 5FAHA 3A83A 3OE7D 1F5LA 1SVPA 4X1RU 1GDUA 2WZQA 2ZWLH 2A5AA 3RP2A 4A92A 2J94A 1W13U 3DA9B 2YMSC 3P92A 4Z6AH 2OC0A 1HAPH 2GMTC 5DO4H 1NC6A 2QYIA 2H9TH 2PKSB 2J9NA 5JBTA 2A7JA 5L2YH 3VB5A 3WWBA 1PQ5A 1WTHD 3PTNA 1AVWA 2Z9LA 4JZEH 3M61U 4K1EA 1PPCE 1PFXC 1GVKB 3UNSA 1UK4A 2BMGB 4VGCC 4FU7A 3OAAD 4YT7H 4I8GA 3SUDA 1C5YB 2I6QA 4I8JA 3SZNA 2WPKS 2NU4E 1BRBE 2VH0A 5EG4A 1HXFH 2H9HA 3DCLA 2LELA 1K1LA 2GCHG 2BX4A 3OYPA 1T32A 4ZXYH 1LVOA 1K21H 1W12U 1TIOA 1G36A 2UWOA 3RXFA 2ZC9H 2ZDMA 3SU5A 5AF9H 1L4ZA 2ZFQH 1L2EA 4CR9A 3RXMA 3M5MA 5DJ7A 1V2VT 4TY6A 1V2PT 2BM2A 3MO3A 3ZZ7A 2BOKA 4OGYA 1CA0B 4Q63A 5FPSA 3PV2A 2TGPZ 1O5CB 3KYFA 5A2MH 3RXQA 1KSNA 2V35A 2XYAA 1YP9A 2QF4A 4GHQA 3KHVA 4IBLH 2BLQA 3KYGA 1KLTA 1SGFA 2KCOA 1W0KD 2QY0B 1UTJA 1GJ9B 5DP4A 4X2WA 5EQQA 1ELAA 4X6NA 1WSSH 1BMNH 2C3SA 3IWMA 4MPXA 1O2VA 1WOFA 4X1QU 4B73A 3TK9A 1TRYA 2FOGA 1C1VH 1E1RD 1JMOH 1QZ8A 2JH0D 1CGHA 5A0BA 3PLBA 3ZVDA 2R2MB 3PROA 1PPHE 5EXNA 4JMYA 1BMMH 3SJKA 2OP9A 1GJ6A 1LVMA 2OK5A 1TQ7B 1GMDG 3HGNA 4E7RG 4WH6A 1RTFB 1AIXH 5TCAA 2M2AA 1BJUA 3BTDE 1YYY1 1Z1IA 1XX9A 2W7SA 2PKSC 4OS6A 3KL6A 3FN8A 3K6YA 2HWLB 4F55A 3P8FA 1O2GH 2BB4A 4XOJA 1GBLA 3Q76A 4AGJA 2CF8H 3S7KB 1SGDE 3D65E 2FS9A 2W6ID 1Y5BT 1ORFA 2QCYA 5C17A 2ZGHA 1NZQH 1E34B 4JYUH 1P06A 2J97A 2KCPA 3UIRA 1RD3B 2BX3A 3PLKA 4ABEA 5EW1H 2KX4A 1HCGA 4A1VA 4OS4A 1HB0B 4ABFA 4OGXA 4Y8XA 3STJA 1L1NA 1OX1A 4CRFA 5FL7D 4MDSA 4ZKRU 3ZVEA 3PB1E 1NRRH 3U8RH 1SQRA 3PMBB 4BOHA 4F4OC 4WH8A 2J34A 5FBIA 1T8MA 4AB9A 2J98B 2CV3A 1MQ6A 1KXFA 3T2NA 2BZ6H 1A61H 1NRNH 3TJNA 2AFQB 2CK3D 1BTYA 3P17H 2GTBA 1F0UA 3ATLA 2SGQE 3RXDA 2C93B 4NIXA 3MU8A 1QBOA 1AUJA 1GBEA 3RXIA 3OX7U 3QZQA 3LKWA 4JZFH 4CRCA 1CA0C 1VJ9U 2VINA 4NCYA 1SHHB 4Y7BA 1O2YA 3S9BA 1CGJE 1W0ZU 1FQ3A 1MUEB 2ZDLA 3BV9B 3DUXH 4I8KA 4MPUA 2AMPA 5F8TA 1QJ7B 4X8TH 1ZTJA 1DY9A 4UE7H 2OC7A 1SLVB 3PV5A 3QTOH 3E90B 4HTCH 3P95A 3VB4A 1HJ9A 4YOJA 1EZQA 1P9SA 1XUGA 2PSYA 5C5OA 1OPHB 1TQ0B 2VWMA 3BTKE 1ZMLA 3NRLA 4X2XA 1WQSA 2EI6A 2Z94A 3GY6A 1O2ZA 3QK1A 4NSVA 1QHRB 1DT2A 1HV7A 3Q3XA 3SHAH 3M3TA 4XE4A 1OWIA 3LPRA 2FOCA 1GMDF 3F0PA 2FS8A 2PWXA 1C1NA 1K0HA 1VJAU 3A89A 1A0HB 3QX5H 2AEIH 3GOVB 4ACBA 1HAGE 2V6NA 3RXLA 1G3CA 3M3SA 3EGKH 1C1WH 1LHCH 3E1XB 2TPIZ 2ZFTA 3OU0A 1OP8A 2OQUA 1SFQB 5HM9A 1XUIA 4BXWA 2UUYA 1BRAA 1E38B 3V3MA 1B0EA 1G30B 3L3TA 4ASHA 1EX3A 1TLDA 2ZEBA 2AMQA 3B23B 3GY4A 5T1VA 3MNSA 4E7NA 2IJOB 2UWPA 5FBEA 5LH8A 2BD9A 1DM4B 1AWFH 1E79D 2HNTC 1OHHD 1S82A 1UK3A 1V6DA 2Z3EA 4BTIB 2PGQB 1ANEA 1SPJA 2YNBA 3A87A 4X6PA 1YC0A 3EA9A 3PRDA 4KP0A 1GJDB 2VIVA 1LCYA 3OFND 2KR7A 2VGCB 3SYJA 1D6WA 3SJ9A 1P2JA 1Z1JA 4RI0A 4INKA 1CHGA 5EJZA 4AG2A 4AORA 2WV4A 4GCHG 4I33A 2ZQ2A 1FPHH 1JIMA 1WU1A 2O9QA 3P8OA 3VB7A 3U69H 2P59A 3MFJA 3DSGA 3GCTG 1TX8A 4Y11E 1HAVB 2XW9A 1A7SA 3KIDU 4TPIZ 1QJ1B 3VFEA 4FUGA 3SU3A 3RU4D 1IHSH 3SGQE 3ZZ6A 3FKSD 2BD3A 4B2CA 3E16B 4KKDA 2GDDA 1IHTH 1K28D 5C5NA 4WWYA 3RXUA 1WBGB 1J8AA 5EQRA 4TT3D 3UAIC 1PPZA 4WMDA 2WPJS 1P57B 4CH2B 3GY3A 1MBMA 3OEHD 3ZZDA 2FX4A 4FUEA 5E0HA 3N99A 1TA6A 1DS2E 2AYWA 2QF5A 1S6HA 4H6SB 4OS5A 3WW7A 1O2HA 5GXPA 3SNCA 4JK5A 1A3BH 1PPBH 1O2UA 4RT0A 1IOEA 1NRPH 4UONA 1SGRE 1XVMA 1ZRBA 1C1UH 2ZDNA 4DJZB 5DP7A 3STIA 1GL1A 1GDNA 3EA7A 5DP5A 4KTUA 4CBOA 1E37B 1IQEA 1O2NA 2A7CA 1T4UH 2C90B 1UK2A 4CREA 1D3TB 4DG4A 2Q6GA 2WV9A 3F2HA 5JPMH 2VIQA 2JH5D 3FZZA 2ZGBH 3TJUA 3ZZ3A 4ISOA 1AE8H 2ZTXA 3B8JA 4WVPE 1O2RA 4XFQA 5SGAE 2AGIX 1C2DA 1FONA 1S5SA 3URCA 3O8CA 1O38A 2RFKC 2QIQA 4WF8A 4B2AA 1C5SA 3TIUA 2QF0A 2ZO3H 1GJCB 1SI5H 2VWLA 3O8RA 4JZIA 4Q7XA 5E0JA 4GCHF 1GG6B 2A5IA 3NZIA 7GCHG 3HKJB 2WYJA 2THFB 2Z3DA 1BHXF 3NWUA 3CS0A 4K8BA 2VGCC 1OOKB 1MAYA 1EOLA 3A86A 3LGTA 1MD8A 4TY7A 4D8NA 3JZ2B 3SJIA 3H09A 2HLCA 3QDZB 3H5CB 2P16A 1E1QD 3VGCB 4B75A 1S0RA 2JIZD 2JH6D 2VIWA 1YY3A 3RXKA 1ESAA 1QQ4A 1OS8A 3TH2H 3MNBA 2XBYA 4O3UA 1IQHA 2AGEX 2H9EH 2VWNA 3LJOA 1P12E 2CMYA 1TGCA 2ZU1A 1NN6A 2SGFE 1G37A 3ITIA 4JCNA 1K1OA 3N7EA 1Q31A 1JXPA 1TBQH 5H4IB 2CN0H 4YO9A 3E3TA 2ZP0H 2B0FA 4H4FA 1EZXC 2B9LA 3NK8A 1ZSJA 2BY9X 4UD9H 3RXEA 3I29A 4X1PU 1LQEA 2Y6TA 3RLYH 1YPGH 1K9OE 4AX9H 4DIIH 1O3CA 4DT7B 3M37A 4DURA 1SC8U 1GL0E 1LHDH 2PUXB 3V12A 3EQ0H 1BMFD 4FUJA 4FETA 1GVZA 4BAHB 4U2WA 3UWJH 1G2MA 3PTBA 3RXVA 1V2MT 1QBVH 5A0CA 1C2JA 2PKAB 3SV8A 3ATIA 5FHTA 1BRCE 1C5RA 3D62A 4Y7AA 1V2KT 1ZMJA 1SLUB 3NPSA 1HXEH 2EA3A 2PSXA 1YPKH 3I77A 3SO3A 2GZ9A 3DFLA 2ODYB 4WXVA 2XBVA 2OBOA 4FU9A 3LJJA 4WMFA 2ESTE 5EXLA 1QY6A 2XTTB 1YPHC 4B76A 1BB0B 1ESTA 1GBKA 1ZPCA 2I6SA 3ZZAA 4K1TA 3AK5A 1YLNA 3RXHA 1ZGVA 1A5HA 2G51A 5IK2D 4ABIA 1C1TA 3AW0A 4ZMAH 7GCHF 4CRDA 2W5EA 3H7TA 5A09A 1YPJH 2G8TA 3ATKA 2RG3A 2FZZA 1BA8B 2R3UA 3M5LA 1TGBA 4B1TA 1ZLRA 1C1OA 1BIOA 1GG6C 2DE9A 2SNWA 2GT8A 5LPEA 2R3YA 3GDVA 1N6XA 1V2RT 2A2XH 1HPGA 1AFQC 1ZOMA 2A4RA 2XWBI 1D4PB 1A5GH 1MD7A 1ZYOA 1OWDA 1YLDA 2HPPH 2KAIA 5HIZA 1XUJA 2D8WA 5FX5A 1F0TA 3BG8A 4DOQA 1SQAA 3VGCC 1EFRD 5IYTA 1ETSH 1KYNA 4BAOB 2DE8A 3OTJE 1B5GH 1HAHH 2JDID 5C0TA 2BDBA 4IW4E 1IQNA 1KXBA 4TPYA 3UOUA 4I7YH 3OEED 1VCPA 2ZHFH 5A8XA 1IAUA 3BTWE 3PMAB 5GJ4B 1HUTH 4Z1MD 4NIVA 1SFIA 4D76A 1BMAA 4J2YB 3NKKA 2ZFFH 2ANKH 4OM9A 2F43B 1H4WA 3M5NA 5C0UA 4Y76A 1TFXA 4INLA 2O8LA 3LC3A 5DK1A 3GICB 2D2DA 2AHME 2Y7ZA 3ESTA 4AN7A 4NGAH 3ZZBA 2C8YB 3RXPA 3A8DA 1ELTA 1GHWH 2R0KA 2G4TA 1MH0A 2BQ6B 1KXAA 4H42U 1FY3A 1ZSLA 8GCHG 2OXSA 2PHBA 1P2KA 2J4IA 3BG4B 3T28A 1V2NT 2IJD1 1Y5UT 3ODDA 4YT6H 3RXSA 3LH1A 1TOMH 4Y8YA 4I8HA 3BTFE 4Y0ZE 1YPEH 3SN8A 2XXLA 3TNTA 3T26A 1HBTH 1TNKA 2Y81A 1A2CH 3U98H 5K7RA 1LVBA 2RA0A 2ZQ1A 1MKWK 2HNTE 1C5OH 1EP6A 5B6OA 3V7TA 1O3DA 4JZ1A 2A7HA 3TK6A 2FOEA 1SMFE 3EYDA 5DP8A 1KDQA 1P3EA 5FCRA 4Q7ZA 1MAXA 4IGDA 3SNDA 3WY8A 4A6LA 3V13A 4HI3A 1F92A 6LPRA 1NM6A 1CVWH 2A45B 4AFQA 1K2I1 3QN7A 1GI0A 1D6RA 1XUFA 2BY7X 1BTXA 2FODA 2OQ5A 3ATMA 2A2QH 5EPYA 2Q6FA 4D9QA 1CGIE 2FTMA 1S0QA 1NBME 2VBCA 1NU9A 4K60A 3GISB 2F83A 1LMWB 1A4WH 4AFUA 5BRRE 2BXTH 2ZZUH 2FP7B 1BOQA 1KTTB 5FX6A 2ZKSA 1GHZA 1FIWA 4THNH 3VB3A 3MU4A 3Q3KA 3LGUA 1HAZB 1TNIA 2KM0A 4NWKA 3VB6A 2ZTYA 2Y5HA 2ZA5A 3SU6A 1J15A 2PV9B 2QF3A 2HVXA 2GCTB 1DX5M 3RMMH 1S81A 2WYGA 1TAWA 2XC5A 5EJLA 2R9PA 3RC4A 1O3LA 2BVXH 1GHVH 4FVBA 1G3EA 1WUNH 5HM2A 1P2OA 1TPSA 4X8VH 2PTNA 1LO6A 2A5KA 1QL7A 1C2MA 1ETRH 2PP6A 1ANDA 3MH7A 2M5TA 8GCHF 1C5QA 2VB0A 2QE7D 2V0BA 5I46H 2YMSD 3BEUA 1AN1E 2UUKB 1YCPH 3E0PB 1QB1A 2IPHA 1UVPA 3BG4C 3SQHE 2CF9H 1J14A 1AWHB 3TK5A 2FOAA 1H8ED 1NROH 1P0SH 4FUCA 1AE5A 2BVRH 1Q2WA 3MO9A 1UTKA 3ZVGA 2HNTF 1TONA 2ZGJA 4K1SA 1GBFA 3SUGA 2GD4B 2PGBB 1EJNA 5LPFA 3SJOA 4K69A 5DG6A 1EKBB 4ZHAA 1HFDA 2H5CA 2BVSH 4UFFH 5HXFA 4X6OA 3CS7A 1FPCH 4LZ4B 4TYDA 3RUOA 2QXHA 3GCHB 4ISLA 1ABJH 1ETTH 1NTPA 2AMDA 3GY8A 3ZVFA 1GJAB 1P04A 1C1SA 2BDYA 4ZH8A 1P2QA 3PRBA 4YTAA 1VGCB 3N7DA 1Z6JH 1NESE 1OWHA 2D26C 4U32A 2AGGX 1W10U 5EGMA 2C4FH 1O5DH 1VZQH 4Y6DA 1CT2E 2XBWA 1GBAA 1ANBA 1SQTA 1IQIA 2ZPSA 1C5MD 4YLQH 1G32B 1DITH 1O2JA 1PYTC 3K2UA 5EPNA 3LDXH 1LTOA 1C5VA 1GI7B 4Q7YA 3PWCA 1C1QA 1V2ST 1HRTH 1MMJN 3SU1A 4X2VA 3W94A 1ANCA 4ACAA 3ENSB 2FESH 2SGEE 1IQJA 3A85A 1EXFA 5IDKA 4GSOA 3NCLA 2P3UB 5CHBA 1GBHA 1UO6A 5KGOA 2GCTC 2F3CE 1BTZA 1P09A 5DKMA 3SV2H 2ALVA 4NZLA 4NFFA 4U01A 4K2YA 3OSYA 2G5VA 1QR3E 2O8WA 1TNLA 3F0OA 4FUBA 1LHEH 1N8OB 1IQKA 1SOTA 1H1BA 4Y8ZA 2L74A 3AASA 3UY9A 3DSPA 4K3JA 5HMAA 1CT0E 5JBBS 3KNXA 1C2IA 1ZJDA 1F2SE 1GHBG 1KY9A 2J2UA 1O32A 2ZCKP 3F2FA 1MKWH 2ZU3A 1O31A 1C4V2 2W3KA 3TH3H 3LGWA 2QC2A 3MWIU 2BHGA 4DCDA 3FO8D 3RC5A 3FP8E 3A7ZA 4Z0KA 1UJ1A 3S9AA 2OTVA 1YPHE 2SNVA 7KMEH 2GJGA 1Z8GA 1P8VC 1TPOA 2ZDVH 1YPMH 5EODA 1IQMA 5C2ZA 5FPTA 1S6FA 1GJ5H 1FJSA 3MMGA 4X1NU 3QZRA 2FX6A 3SUFA 1G3BA 4D7FA 4OS2A 1QQUA 1WQVH 1XXFA 3L33A 4GUXA 4D7GA 2Y82A 3QTVH 1DVAH 2FLRH 1P3CA 1OYQA 2IOTA 1GI3A 1MKXH 1QFKH 3GCHC 1IQLA 1WDIA 1EPTB 1DOJA 1THRH 1V2WT 2ZDAH 1DPOA 5AHGH 1RTKA 5CHAB 1EB2A 2ULLA 3GDUA 2BY8X 4B6EA 4NWLA 4ZUHA 1VGCC 2XRCA 2AIPA 4BXSA 2ZI2H 1V2UT 1V2JT 3KQDA 2ZDKA 1K1MA 1UTNA 4P02A 1G9IE 1MABB 5FPYA 3O8DA 2PFEA 1Y59T 1NRSH 1UW7A 2F9BH 1W11U 2FTLE 1FAXA 1O2IA 1ZHRA 1TALA 2DUCA 3A80A 4A5TS 1L0ZA 4SGAE 3TJOA 1ELVA 1RIWB 2V3OH 3R3GB 4MNVA 1BUIA 5C1YA 4BTUB 3MO6A 3P70B 1RS0A 2WPHS 1CO7E 5F8XA 1OXGA 1GJ7B 1O5EH 1K1IA 1CHOG 1TBRH 1ZPBA 3RMOH 1SG8B 3URDA 1C5UA 1PPFE 1GHBF 1EOJA 4RKJB 1N8OC 3KQ5A 1UMAH 2ZGXH 3A84A 4ZKNU 2D1JA 1C5WB 5GWZA 1J17T 3LH3A 1SGEE 2B8OH 1S85A 5DP9A 2GZ7A 1NFYA 2OBQA 1P2IA 3KEEA 4TWYA 3W1EA 3ZYEA 1SGCA 3ZVBA 4B74A 3ODFA 5CMXH 4ZAEA 1LDTT 1O3JA 3FZDA 4ISIH 5TCCA 4ZHLU 1H9IE 4IN1A 3ZZ5A 2BDAA 4AZ2B 2P3TB 1MU6B 2J5UA 2JJ2D 1GMHG 3E6PH 5E2OA 1DDJA 4MPWA 1T8NA 3FANA 2OCVB 3SNAA 1Y3YA 5G4BA 3RXOA 4ZCNA 1PPGE 1QRXA 4Q2KA 3SGAE 4BANB 4J1YA 1GI4A 3U9AH 4BAMB 2JETB 6GCHG 1FAKH 1C1RA 3SV9A 1W2KH 1DICA 3GY7A 1OWJA 1CSOE 4X0WU 1O39A 3VXEH 5DPAA 1DANH 1GWAA 4ZROA 1YBWA 2XC4A 1E35B 5GNDA 1X7AC 5JB9S 3CENA 3SU4A 1UTPA 1V2QT 1EPTC 3PMHB 1Z8JB 3A7YA 2WUCA 4K5ZA 4CH8B 5CHAC 1C1PA 2BLOA 2PKAA 1ZZZA 1AB9B 1NBMD 2ZU2A 3BEIB 1SGPE 2BD8A 2SGDE 3UREA 2V7QD 4LK4A 2ZHWH 3M7QA 4CRBA 4SGBE 1K1NA 1RGQA 2P93A 2BZAA 2FOHA 1PJPA 1VITH 1P02A 3BTGE 1SLXB 1D9IA 3HATH 5AVDA 3SV7A 3VEQB 6CHAB 1ZGIA 5JYIA 1MTUA 1RIWC 4X1SU 1CHOF 2CJIA 1VCQA 4FOUC 1LKAA 1GCTB 3TPIZ 1FXYA 1Z8IB 4ABGA 1V2TT 3ATWA 3A82A 4F49A 5DSFA 2L6OA 1KXEA 2QXGA 3GY2A 2UWLA 1IQFA 1AZ8A 4FXGH 3U1IB 3LGVA 2FXRA 2V3HH 3FP7E 5T6GA 1LPZB 1A5IA 1MBQA 1KXDA 1KLIH 1OWKA 1XMNB 2JKHA 1ELBA 1GBIA 5A8ZA 5K0HA 1CU1A 1JRTA 2BDIA 1Y3VA 4UFGH 1O3HA 1FY8E 1GMHF 2Q1JA 1CQQA 1JBUH 1QNJA 4AYVB 1SGIB 1NFXA 1DLKB 1SGYE 3MH4A 5C94A 4O97A 4YZUA 1MZAA 1QB6A 4IMQA 1HGTH 1UVSH 4CHAB 1O3IA 4XD7D 3UFAA 1BBRH 3UOPA 2CGAA 2W26A 1GI8B 3M3VA 1GHYH 2OC8A 6GCHF 2BQWB 2GGVB 1TBZH 1P11E 1U6QA 1QL8A 2A4OA 1W7XH 1ABIH 4JYTA 1C2KA 5EXMA 1AY6H 3RXTA 1AKSB 1SB1H 1T8OA 2BTCE 3IG6B 4YOGA 4KTCA 3BIVH 1EZUC 5ESTE 1WXRA 5DN6D 2Y7XA 2JETC 3SV6A 3ZZ4A 2AS9A 3QGNB 3TU7H 3MU0A 3PYHA 4Q80A 3KF2A 4XRNA 1TRMA 1TB6H 4FUDA 4AYYB 3FOAA 2EY4C 3RXBA 1RFNA 2P8OB 1ELGA 2AIQA 2ZF0H 2BY6X 3MNCA 2A1DB 2Y5FA 1QIXB 3F9GA 3SUEA 3SORA 2G00A 2NU3E 2ODQA 3LOXA 3O8BA 4NG9H 2IPQX 2WINI 4YXWD 1YCPK 1XUHA 3KQBA 1AB9C 1HLTH 2XOKD 3RMNH 2GZ8A 2R0LA 5C67A 1WTGH 2JJ1D 3SI4H 1O33A 4B71A 5F6MA 1DXPA 3E8LA 3MI4A 1ZHPA 2FWWA 3MU1A 2BOHB 2SGAA 2WPLS 3OY5U 3MU5A 5T6FA 2ZG0H 2G5NA 6CHAC 1O5BB 1SBWA 2NU0E 2FPZA 3HPTB 1FZZA 4Y79A 3GDSA 5PTPA 4O3TA 1O30A 2BXUH 2VU8E 4X2YA 1MU8B 2VIDA 4BNRA 1G2LA 1LKBA 1Y3XA 3WWFA 1CBWB 1C9TA 3N7OA 2A31A 2W3IA 1SL3A 1NPMA 4AFSA 1DFPA 1NY22 1SR5C 1HJAB 1XXDA 1RXPA 1C2FA 1S84A 4CBNA 4OS7A 3BTEE 3SU0A 2G52A 1GGDB 4LZ1H 4NZQA 2VVVA 1AFEH 4AB8A 4ABJA 2H2ZA 2OD3B 3A7TA 5BPEA 3I78A 4UFDH 4CHAC 3TGJE 4NFEA 1LHGH 3SNEA 4IS5A 2J92A 3AVZA 2Y5GA 5GCHG 2PUQH 2FYQA 5F8ZA 2V3MA 1MZDA 2W6JD 2HRVA 3RXGA 3S7HB 3RM2H 1K1JA 1P03A 2FLBH 5E0GA 1V3XA 2CXVA 3TJVA 7ESTE 1C4Y2 4H6TA 1B0FA 1KXCA 4UEHH 1UHBB 3A81A 3TVJB 1FLEE 1C5NH 2W7UA 5HGGA 1TNHA 1TE0A 2BDHA 5HKKD 2P8OC 1SSXA 4M9FA 1BRUP 1A1RA 2TGDA 1SQOA 3SOSA 3OTPA 3LONA 8KME2 2BD2A 3DT0H 3PWBA 1O3KA 2Z9JA 3T5FH 2FI5E 2RDEA 1UTMA 2H5DA 2FOMB 1QBNA 2HLDD 1HNEE 2XCFA 3ZVAA 1UVUH 3QUMP 1TGSZ 2UUJB 3MYWA 4TSFD 4ZKOU 2F9VA 1MTNB 3FVFB 4CRGA 4RKOB 4NA8A 1NRQH 3R0FA 4TWWA 2KAIB 4AFZA 5E2PA 2BDGA 3KQCA 1MQ5A 1E0FD 4X8SH 1EAWA 1UVTH 2LP6A 1QCPA 1XUKA 4NIWA 2P94A 2ALPA 1MKXK 3FP6E 5FCKA 1HIAB 4DY7B 5F53A 2KFWA 3F68H 3U8OH 4HGCA 2Z3CA 1CBWC 1OSSA 1C9PA 2LNCA 3F9FA 3W95A 5HYOA 1EAIA 1E36B 1UTLM 3PM3A 1TWXB 2ODPA 2A4GA 1HJAC 4GAWA 1VCWA 5J4SA 3ZVCA 1AU8A 1PQ8A 1TX7A 5DGJA 1SGFG 5ETXA 1KMHB 2ILNA 1ACBE 5JB8S 1A3EH 2LPRA 5JBCS 1GGDC 1KTSB 2WPIS 1O3EA 2Z6BD 4MTBA 5EQSA 5GCHF 2B7DH 1FMGA 2ZIQH 2HPQH 4INHA 1WAYB 1O2KA 1Z6EA 3H7OA 5GIBA 1NU7B 1SKYE 1ZHMA 3Q00A 2EI8A 2F4LA 1ZMNA 1P9UA 3D49H 3UWIA 4DIHH 4XBDA 1GJ4H 1A0LA 3SU2A 2J98A 2FO9A 1B7XB 1EAUA 1O3BA 1GBTA 3SHCH 1ZJKA 1P10A 2F9OA 3M7TA 3TH4H 1YWUA 4FUHA 2ZNKH 1KIGH 1FN6A 1HAXB 2K0QA 5ESBA 1BDAA 3RXCA 3QO6A 4MPVA 5EU8A 1TA2A 2VVCA 1NT1A 4IC5A 3BN9A 1VITG 5L6NH 4XBBA 2SGPE 2TRMA 1D3DB 3T62A 3PLPA 3BTQE 3SI3H 2O8UA 1O5GH 4WMEA 3DFJA 2SFAA 1QB9A 4AOQA 1YCPM 3BF6H 3KCGH 2B5TB 5KEDA 1KDQB 4RT1A 4GPGA 1NS3A 2ANMH 2J38A 1O5AB 1W8BH 1LQDB 3RXJA 1L1JA 2XNDD 3LU9B 1DSTA 2BD5A 3OY6U 5C1UA 5J4QA 1TX6A 4F48B 3MNXA 1C2LA 4KELA 1H8HD 1GHAG 1MTNC 3Q77A 2GP9B 1EAXA 2A32A 3LIWA 3MH6A 4KGAA 2FM2A 3M36A 4ISHH 1TRNA 7LPRA 1F5RA 4CRAA 3L6PA 2WPDD 4IMZA 2Y80A 1BBRE 1K1PA 3P8GA 1EASA 1GDQA 1DE7H 4UDWH 3VXFH 1FX0B 1C2GA 1DWEH 2NWNA 1EUFA 2G81E 2TIOA 2KZ4A 1O35A 3FFGA 1DWBH 2BY5X 2A0QB 4M7GA 1EPTA 1H8DH 2P95A 4ISNA 1KLJH 1C4U2 1AD8H 2IN2A 3A8BA 4GVUA 3AW1A 3ZIAD 3FAOA 2UUFB 1BJVA 1EATA 2GCHF 1BTHH 1J9CH 3S0NA 1SHYA 3GYMA 5AFYH 3BSQA 1INCA 3ZZ8A 1QJ6B 2G4UA 4AGKA 2FOFA 1H8IH 1W0JD 1T7CA 4I32A 1WCZA 1HYLA 2ASUB 5EIYA 2G55A 1P01A 2HOBA 3A8AA 3U8TH 8LPRA 1N1LA 2KCYA 4YLUA 3UB0A 1FIZA 2F91A 1TGNA 2AH4X 1TPAE 5EOKA 1SGQE 2EI7A 2EQNA 2RA3A 1OWEA 4D9RA 1AO5A 2OC1A 2YNAA 1NFUA 1O0DH 1THSH 2Z7FE 1BZXE 3AAVA 1IQGA 1F5KU 3IITA 1VITF 2BQ7B 1GPZA 3SQEE 2Z9KA 1HAVA 2FI4E 4I86A 2ZTZA 3GCOA 1RTLA 1ARCA 4XSKU 1NO9H 2Q6DA 1W0YH 1TMTH 3CNRA 3ELAH 2WUBA 1BTPA 1C5TA 2CHAB 1O5FH 1UCYH 3UR6A 5EJ1A 1FDPA 2C8ZB 2ZPQA 2BD7A 2QGRA 4RSPA 2STAE 3P8NA 1C2EA 1QRWA 5CDFE 1GBMA 2GV7A 1QA7A 2QXIA 2R2WU 4NA9H 3LC5A 1DLEA 1PYTD 3GYLB 1BBRK 8ESTE 1GHAF 1C5LH 1CT4E 3T29A 1DUAA 3B9FH 1DWCH 4E06H 5E8EH 6ESTA 4ABAA 1H9HE 5GPIB 3T27A 3RXAA 1VR1H 3E91A 3LGYA 1TNJA 2XWAA 2HALA 3EE0B 2HVYB 3K65B 4OS1A 1JOUB 2A4QA 4A7IB 3NXPA 3RM0H 1Z8RA 3KQEA 2YOLA 5FXLA 1MCTA 1C1MA 4A1XA 4DVAU 3EA8A 1DUEA 1TMBH 2J95A 3SBKA 2GX4A 2WHXA 4GLYA 3BTTE 3LT3A 1W14U 2O8TA 1OP0A 2ZFRH 4LOYH 4X6MA 4IC6A 2WSSD 1O2WA 3JZ1B 3VG8A 1LVYA 1GBCA 2VIPA 3P6ZB 1AVXA 2QA9E 2PLXA 2RDLA 4Q4LA 4A1TA 1XM1A 4AG1A 1O3NA 1TOCB 1YKTA 1AHTH 2ZECA 4ZXXH 1L4DA 4UFEH 1O2LA 1O2PA 1FY4A 5A8YA 1WV7H 5ABWA 5L2ZH 2ANWA 3SNBA 2VWOA 3BTME 1LPGB 1O2MA 3TGIE 3C27B 1C5XB 2VH6A 4BTTB 4YM9A 1TPPA 3HK3B 1ZTKA 3PO1B 3UNQA 1O2QA 1PQ7A 1HAIH 4P00A 4WJG2 4PROA 3U1JB 3M35A 4Y71A 4B6FA 2K8IA 1H9LB 1AMHA 1BTWA 3BEFB 1S6LA 1HAOH 1HAYB 2O8MA 3AAUA 2ZGCA 2VIOA 2ZFSA 3EDXB 1C5ZB 1ELCA 4HG6A 4WXIA 1V2LT 4WY3A 1ELEE 5DP3A 1O3PB 1EJAA 3SGBE 1AI8H 1XKAC 1C5PA 3TITA 1ZSKA 2CHAC 4ABDA 2C8WB 2Z9IA 2EC9H 3HK6B 4FUFA 3UTUH 1YPLH 1LPKB 1QA0A 3ZV9A 2OINA 3MQKC 3HKIB 1O2XA 5LPRA 1SOZA 5I25A 2K1QA 4E05H 1JWTA 1D3QB 2QN5T 3K9XB 5A0AE 5C3NA 1W7GH 3VPKA 3V0XA 1EB1H 3CP7A 1T8LA 1TABE 1QGFA 1RRKA 1SLWB 1O3FA 1AKSA 1GBBA 4FVDA 4YOIA 4DW2U 4NA7A 1F0SA 1J16A 1GI9B 3HGPA 1RJXB 1GI2A 1ID5H 1GI5A 1FUJA 1O37A 1YF4A 4BAKB 3QWCH 1PQAA 5B6LA 1FN8A 1MCVA 3TGKE 1O2OA 1MTWA 4CR5A 2RCEA 1P2NA 5AFZH 1P2MA 3UQOA 2F9UA 1BTUA 1GVLA 3KN2A 2BDCA 3ZYDA 3A7VA 3UUZA 4DT4A 4JK6A 4ASUD 1ZPZA 2H1UA 1O3GA 1HJ8A 1Y8TA 1O3AA 2GV6A 4K8YA 4IN2A 1O34A 3KGPA 2F9PA 3TLOA 5L30H 5GDSH 1F0RA 4Y10E 3DSOA 2WV5A 3E0NB 1XVOA 1AFQB 1GBDA 3G01A 5KECA 2TBSA 3RDZA 3A7WA 2XCNA 2P3FH 3GCTF 3UNRA 2QV1A 2ZCHP 5C20A 3MTYA 1Z71A 2BLWA 1Z7KA 1AUTC 5TJXA 4DGJA 1PPEE 1P05A 1HDTH 2XNIA 2ZHEH 4JYVH 1ZTLA 1Q3XA 3PO1C 5JBAS 3NUMA 1GJ8B 2ZHQH 4HFPB 4QT8C 1N6YA 4KTSA 2BD4A 5C1XA 5LGOA 1BMLA 1TNGA 4MLFB 3UQVA 1D3PB 4NSYA 1ELDE 3LGIA 4ABBA 1F7ZA 3RC6A 3ZV8A 1ELFA 1EP5A 2H6MA 3F9HA 1BHXB 4MNXA 3A7XA 3SW2B 1FI8A 1ZR0A 1Y5AT 1SGNE 1FV9A 4GHTA 3SJ8A 2VJ1A 1K22H 2PR3A 2GDEH 1YM0A 2BYAX 1QTFA 2FOBA 4MNYA 1FY1A 2QXJA 4R8TB 2HGTH 1A0JA 3MH5A 3F9EA 1DSUA 2NU1E 2ZU5A 1O36A 1TGTA 2ZFPH 3A88A 2WPMS 1FNIA 4I8LA 1EQ9A 1VKYA 2F9NA 2FI3E 4MG3A 4ESTE 3QLPH 3GS9A 3T25A 2NU2E 1UHBA 1TMUH 1GMCG 9LPRA 2FEQH 1G3DA 1CE5A 1XKBC 3BTHE 2OLGA 2ZPRA 1GI1A 3TNSA 1S83A 3SZEA 1DXWA 3U28C 1GHXH 2GT7A 1O3MA 2VVUA 3PV4A 2STBE 2TGAA 2GKVE 4AC9A 1W3CA 1BITA 2GVFA 1MTVA 2TGTA 1JIRA 5DP6A 2YMSB 1GI6A 4RN6A 3MHWU 4ZHMU 1GCTC 4FUIA 3A8CA 2GMTB 2Z9GA 3RXRA 5JDUB 1ZRKA 3DD2H 1UCYE 4FU8A 1OKXA 3MOCA 1O3OA 3F1SB 1AGJA 1A46H 1COWD 4MVNA 1CA8B 2FMJA 5T6DA 3RU4T 4VGCB 3S9CA 4Y0YE 1T31A 2XC0A 1GJBB 1MTSA 4HZHA 1T4VH 1DWDH 1THPB 3QGJA
chains in the Genus database with same CATH topology
3GY5A 2FYRA 1L1GA 1Y3WA 1UTOA 2BLVA 4O03A 3ZZ9A 4ABHA 1HIAA 3D23A 3Q3YA 4YESB 1BT7A 5T3HA 1OYTH 1FY5A 3RMLH 4NIYA 1GBJA 1C2HA 4MNWA 1NFWA 2PTCE 5EW2H 3EAJA 2C8XB 4JZDH 2FIRH 9ESTA 2ANYA 2XBXA 3ZZCA 1AQ7A 3GCNA 4X8UH 4U30A 1TYNA 1UTQA 3M5OA 1Y3UA 1DY8A 4BAQB 3RU4E 1O2TA 1WYKA 5CE1A 1SGTA 1YLCA 3PMJA 2ZHDA 4B2BA 2QAAA 5F03A 1AVGH 3UPEA 1YGCH 2ZCLP 1ESBA 2PW8H 3DHKH 4R0IA 2VNTA 3BIUH 4MQAA 1QURH 1GCDA 1V2OT 2OUAA 4LXBH 1BCUH 1BQYA 1GMCF 1M9UA 4ZKSU 1JRSA 4O9VA 1OP2A 1EZSC 3F6UH 2ZU4A 1UVOA 3M7UA 4I31A 1EJMA 1QRZA 1AZZA 3C1KA 2AERH 3K6ZA 4XBCA 4XDEA 1UCYK 3S69A 3UR9A 1O2SA 1LHFH 1QL9A 2EEKA 3RLWH 2FDAA 1ARBA 5FAHA 3A83A 1F5LA 1SVPA 4X1RU 1GDUA 2ZWLH 2A5AA 3RP2A 4A92A 2J94A 1W13U 3DA9B 3P92A 4Z6AH 2OC0A 1HAPH 2GMTC 5DO4H 1NC6A 2QYIA 2H9TH 2PKSB 2J9NA 5JBTA 2A7JA 5L2YH 3VB5A 1PQ5A 1WTHD 3PTNA 1AVWA 2Z9LA 4JZEH 3M61U 4K1EA 1PPCE 1PFXC 1GVKB 3UNSA 1UK4A 2BMGB 4VGCC 4FU7A 4YT7H 4I8GA 3SUDA 1C5YB 2I6QA 4I8JA 3SZNA 2WPKS 2NU4E 1BRBE 2VH0A 5EG4A 1HXFH 2H9HA 1K1LA 2GCHG 2BX4A 3OYPA 1T32A 4ZXYH 1LVOA 1K21H 1W12U 1TIOA 1G36A 2UWOA 3RXFA 2ZC9H 2ZDMA 3SU5A 5AF9H 1L4ZA 2ZFQH 1L2EA 4CR9A 3RXMA 3M5MA 5DJ7A 1V2VT 4TY6A 1V2PT 2BM2A 3MO3A 3ZZ7A 2BOKA 4OGYA 1CA0B 5FPSA 2TGPZ 1O5CB 5A2MH 3RXQA 1KSNA 2V35A 2XYAA 1YP9A 4GHQA 3KHVA 4IBLH 2BLQA 1KLTA 1SGFA 2QY0B 1UTJA 1GJ9B 5DP4A 4X2WA 5EQQA 1ELAA 4X6NA 1WSSH 1BMNH 2C3SA 3IWMA 4MPXA 1O2VA 1WOFA 4X1QU 4B73A 3TK9A 1TRYA 2FOGA 1C1VH 1JMOH 2JH0D 1CGHA 5A0BA 3PLBA 3ZVDA 2R2MB 3PROA 1PPHE 5EXNA 4JMYA 1BMMH 3SJKA 2OP9A 1GJ6A 1LVMA 1TQ7B 1GMDG 3HGNA 4E7RG 4WH6A 1RTFB 1AIXH 5TCAA 3BTDE 1BJUA 1YYY1 1Z1IA 1XX9A 2W7SA 2PKSC 4OS6A 3KL6A 3K6YA 2HWLB 3P8FA 1O2GH 2BB4A 4XOJA 1GBLA 3Q76A 4AGJA 2CF8H 3S7KB 1SGDE 3D65E 2FS9A 1Y5BT 1ORFA 2QCYA 2ZGHA 1NZQH 1E34B 4JYUH 1P06A 3UIRA 1RD3B 2BX3A 3PLKA 4ABEA 5EW1H 1HCGA 4A1VA 4OS4A 1HB0B 4ABFA 4OGXA 4Y8XA 3STJA 1L1NA 1OX1A 4CRFA 4MDSA 4ZKRU 3ZVEA 3PB1E 1NRRH 3U8RH 4F4OC 3PMBB 4BOHA 4WH8A 2J34A 5FBIA 1T8MA 4AB9A 2CV3A 1MQ6A 1KXFA 3T2NA 2BZ6H 1A61H 1NRNH 3TJNA 2AFQB 1BTYA 3P17H 2GTBA 1F0UA 3ATLA 2SGQE 3RXDA 2C93B 4NIXA 3MU8A 1QBOA 1AUJA 1GBEA 3RXIA 3OX7U 3QZQA 3LKWA 4JZFH 4CRCA 1CA0C 1VJ9U 2VINA 4NCYA 1SHHB 4Y7BA 1O2YA 3S9BA 1CGJE 1W0ZU 1FQ3A 1MUEB 2ZDLA 3BV9B 3DUXH 4I8KA 4MPUA 2AMPA 5F8TA 1QJ7B 4X8TH 1ZTJA 1DY9A 4UE7H 2OC7A 1SLVB 3QTOH 3E90B 4HTCH 3P95A 3VB4A 1HJ9A 4YOJA 1EZQA 1P9SA 1XUGA 2PSYA 5C5OA 1OPHB 1TQ0B 2VWMA 3BTKE 1ZMLA 4X2XA 1WQSA 2EI6A 2Z94A 3GY6A 1O2ZA 3QK1A 4NSVA 1QHRB 1DT2A 1HV7A 3Q3XA 3SHAH 3M3TA 4XE4A 1OWIA 3LPRA 2FOCA 1GMDF 2FS8A 2PWXA 1C1NA 1VJAU 3A89A 1A0HB 3QX5H 2AEIH 3GOVB 1HAGE 2V6NA 3RXLA 1G3CA 3M3SA 3EGKH 1C1WH 1LHCH 3E1XB 2TPIZ 2ZFTA 3OU0A 1OP8A 2OQUA 1SFQB 5HM9A 1XUIA 4BXWA 2UUYA 1BRAA 1E38B 3V3MA 1B0EA 1G30B 3L3TA 4ASHA 1EX3A 1TLDA 2ZEBA 2AMQA 3B23B 3GY4A 5LH8A 3MNSA 4E7NA 2IJOB 2UWPA 5FBEA 2BD9A 1DM4B 1AWFH 2HNTC 1S82A 1UK3A 1V6DA 2Z3EA 4BTIB 2PGQB 1ANEA 1SPJA 2YNBA 3A87A 4X6PA 1YC0A 3EA9A 4KP0A 1GJDB 2VIVA 1LCYA 2VGCB 1D6WA 3SJ9A 1P2JA 1Z1JA 4INKA 1CHGA 4AG2A 4AORA 2WV4A 4GCHG 4I33A 2ZQ2A 1FPHH 1JIMA 1WU1A 2O9QA 3P8OA 3VB7A 3U69H 2P59A 3MFJA 3GCTG 1TX8A 4Y11E 1HAVB 2XW9A 1A7SA 3KIDU 4TPIZ 1QJ1B 3VFEA 4FUGA 3SU3A 3RU4D 1IHSH 3SGQE 3ZZ6A 2BD3A 4B2CA 3E16B 4KKDA 2GDDA 1IHTH 1K28D 5C5NA 4WWYA 3RXUA 1WBGB 1J8AA 5EQRA 1PPZA 4WMDA 2WPJS 1P57B 4CH2B 3GY3A 1MBMA 3ZZDA 2FX4A 4FUEA 5E0HA 4OS5A 1TA6A 1DS2E 2AYWA 4H6SB 1S6HA 1O2HA 5GXPA 3SNCA 4JK5A 1A3BH 1PPBH 1O2UA 1IOEA 1NRPH 4UONA 1SGRE 1XVMA 1ZRBA 1C1UH 2ZDNA 4DJZB 5DP7A 3STIA 1GL1A 1GDNA 3EA7A 5DP5A 4KTUA 4CBOA 1E37B 1IQEA 1O2NA 2A7CA 1T4UH 2C90B 1UK2A 4CREA 1D3TB 4DG4A 2Q6GA 5JPMH 2VIQA 2JH5D 3FZZA 2ZGBH 3TJUA 3ZZ3A 4ISOA 1AE8H 2ZTXA 3B8JA 4WVPE 1O2RA 4XFQA 5SGAE 2AGIX 1C2DA 1FONA 1S5SA 3URCA 3O8CA 1O38A 2QIQA 4WF8A 4B2AA 1C5SA 3TIUA 2QF0A 2ZO3H 1GJCB 1SI5H 2VWLA 3O8RA 4JZIA 4Q7XA 5E0JA 4GCHF 1GG6B 2A5IA 3NZIA 7GCHG 3HKJB 2WYJA 2THFB 2Z3DA 1BHXF 3NWUA 3CS0A 4K8BA 2VGCC 1OOKB 1MAYA 1EOLA 3A86A 3LGTA 1MD8A 4TY7A 4D8NA 3JZ2B 3SJIA 2HLCA 3QDZB 3H5CB 2P16A 3VGCB 4B75A 1S0RA 2JH6D 2VIWA 3RXKA 1ESAA 1QQ4A 1OS8A 3TH2H 3MNBA 2XBYA 4O3UA 1IQHA 2AGEX 2H9EH 2VWNA 3LJOA 1P12E 2CMYA 1TGCA 2ZU1A 1NN6A 2SGFE 1G37A 3ITIA 4JCNA 1K1OA 1Q31A 1JXPA 1TBQH 5H4IB 2CN0H 4YO9A 3E3TA 2ZP0H 2B0FA 4H4FA 1EZXC 2B9LA 3NK8A 1ZSJA 2BY9X 4UD9H 3RXEA 3I29A 4X1PU 1LQEA 2Y6TA 3RLYH 1YPGH 1K9OE 4AX9H 4DIIH 1O3CA 4DT7B 3M37A 4DURA 1SC8U 1GL0E 1LHDH 2PUXB 3V12A 3EQ0H 4FUJA 1GVZA 4BAHB 4U2WA 3UWJH 1G2MA 3PTBA 3RXVA 1V2MT 1QBVH 5A0CA 1C2JA 2PKAB 3SV8A 3ATIA 5FHTA 1BRCE 1C5RA 3D62A 4Y7AA 1V2KT 1ZMJA 1SLUB 3NPSA 1HXEH 2EA3A 2PSXA 1YPKH 3I77A 3SO3A 2GZ9A 3DFLA 2ODYB 4WXVA 2XBVA 2OBOA 4FU9A 3LJJA 4WMFA 2ESTE 5EXLA 1QY6A 2XTTB 1YPHC 4B76A 1BB0B 1ESTA 1GBKA 1ZPCA 2I6SA 3ZZAA 4K1TA 3RXHA 1ZGVA 1A5HA 2G51A 4ABIA 1C1TA 3AW0A 4ZMAH 7GCHF 4CRDA 2W5EA 3H7TA 5A09A 1YPJH 2G8TA 3ATKA 2RG3A 2FZZA 1BA8B 2R3UA 3M5LA 1TGBA 4B1TA 1ZLRA 1C1OA 1BIOA 1GG6C 2DE9A 2SNWA 2GT8A 5LPEA 2R3YA 3GDVA 1N6XA 1V2RT 2A2XH 1HPGA 1AFQC 1ZOMA 2A4RA 2XWBI 1D4PB 1A5GH 1MD7A 1ZYOA 1OWDA 1YLDA 2HPPH 2KAIA 1XUJA 2D8WA 5FX5A 1F0TA 3BG8A 4DOQA 1SQAA 3VGCC 5IYTA 1ETSH 1KYNA 4BAOB 2DE8A 3OTJE 1B5GH 1HAHH 2BDBA 4IW4E 1IQNA 1KXBA 4TPYA 3UOUA 4I7YH 1VCPA 2ZHFH 5A8XA 1IAUA 3BTWE 3PMAB 5GJ4B 1HUTH 4NIVA 1SFIA 4D76A 1BMAA 4J2YB 3NKKA 2ZFFH 2ANKH 1H4WA 3M5NA 4Y76A 1TFXA 4INLA 2O8LA 3LC3A 5DK1A 3GICB 2D2DA 2Y7ZA 3ESTA 4AN7A 4NGAH 3ZZBA 2C8YB 3RXPA 3A8DA 1ELTA 1GHWH 2R0KA 2G4TA 1MH0A 2BQ6B 1KXAA 4H42U 1FY3A 1ZSLA 8GCHG 2OXSA 2PHBA 1P2KA 2J4IA 3BG4B 3T28A 1V2NT 4YT6H 1Y5UT 3ODDA 3RXSA 3LH1A 1TOMH 4Y8YA 4I8HA 3BTFE 4Y0ZE 1YPEH 3SN8A 2XXLA 3TNTA 3T26A 1HBTH 1TNKA 2Y81A 1A2CH 3U98H 5K7RA 1LVBA 2RA0A 2ZQ1A 1MKWK 2HNTE 1C5OH 1EP6A 5B6OA 3V7TA 1O3DA 4JZ1A 2A7HA 3TK6A 2FOEA 1SMFE 3EYDA 5DP8A 1KDQA 1P3EA 5FCRA 4Q7ZA 1MAXA 4IGDA 3SNDA 3WY8A 4A6LA 3V13A 4HI3A 1F92A 6LPRA 1NM6A 1CVWH 2A45B 4AFQA 1K2I1 3QN7A 1GI0A 1D6RA 1XUFA 2BY7X 1BTXA 2FODA 2OQ5A 3ATMA 2A2QH 5EPYA 2Q6FA 4D9QA 1CGIE 2FTMA 1S0QA 1NU9A 4K60A 3GISB 2F83A 1LMWB 1A4WH 4AFUA 5BRRE 2BXTH 2ZZUH 2FP7B 1BOQA 1KTTB 5FX6A 2ZKSA 1GHZA 1FIWA 4THNH 3VB3A 3MU4A 3Q3KA 3LGUA 1HAZB 1TNIA 4NWKA 3VB6A 2ZTYA 2Y5HA 2ZA5A 3SU6A 1J15A 2PV9B 2QF3A 2HVXA 2GCTB 1DX5M 3RMMH 1S81A 2WYGA 1TAWA 2XC5A 2R9PA 3RC4A 1O3LA 2BVXH 1GHVH 4FVBA 1G3EA 1WUNH 5HM2A 1P2OA 1TPSA 4X8VH 2PTNA 1LO6A 2A5KA 1QL7A 1C2MA 1ETRH 1ANDA 3MH7A 2M5TA 8GCHF 1C5QA 2VB0A 2V0BA 5I46H 3BEUA 1AN1E 2UUKB 1YCPH 3E0PB 1QB1A 2IPHA 1UVPA 3BG4C 3SQHE 2CF9H 1J14A 1AWHB 3TK5A 2FOAA 1NROH 1P0SH 4FUCA 1AE5A 2BVRH 1Q2WA 3MO9A 1UTKA 3ZVGA 2HNTF 1TONA 2ZGJA 4K1SA 1GBFA 3SUGA 2GD4B 2PGBB 1EJNA 5LPFA 3SJOA 4K69A 5DG6A 1EKBB 4ZHAA 1HFDA 2H5CA 2BVSH 4UFFH 5HXFA 4X6OA 3CS7A 1FPCH 4LZ4B 4TYDA 3RUOA 2QXHA 3GCHB 4ISLA 1ABJH 1ETTH 1NTPA 2AMDA 3GY8A 3ZVFA 1GJAB 1P04A 1C1SA 2BDYA 4ZH8A 1P2QA 4YTAA 1VGCB 1Z6JH 1NESE 1OWHA 2D26C 4U32A 2AGGX 1W10U 5EGMA 2C4FH 1O5DH 1VZQH 4Y6DA 1CT2E 2XBWA 1GBAA 1ANBA 1SQTA 1IQIA 2ZPSA 1C5MD 4YLQH 1G32B 1DITH 1O2JA 1PYTC 3K2UA 5EPNA 3LDXH 1LTOA 1C5VA 1GI7B 4Q7YA 3PWCA 1C1QA 1V2ST 1HRTH 1MMJN 3SU1A 4X2VA 3W94A 1ANCA 3ENSB 2FESH 2SGEE 1IQJA 3A85A 1EXFA 5IDKA 4GSOA 3NCLA 2P3UB 1GBHA 1UO6A 2GCTC 2F3CE 1BTZA 1P09A 5DKMA 3SV2H 2ALVA 4NZLA 4NFFA 4U01A 4K2YA 3OSYA 2G5VA 1QR3E 2O8WA 1TNLA 4FUBA 1LHEH 1N8OB 1IQKA 1SOTA 1H1BA 4Y8ZA 3AASA 3UY9A 4K3JA 5HMAA 1CT0E 5JBBS 3KNXA 1C2IA 1ZJDA 1F2SE 1GHBG 1KY9A 2J2UA 1O32A 2ZCKP 1MKWH 2ZU3A 1O31A 1C4V2 2W3KA 3TH3H 3LGWA 2QC2A 3MWIU 2BHGA 4DCDA 3RC5A 3FP8E 3A7ZA 4Z0KA 1UJ1A 3S9AA 2OTVA 1YPHE 2SNVA 7KMEH 1Z8GA 1P8VC 1TPOA 2ZDVH 1YPMH 5EODA 1IQMA 5C2ZA 5FPTA 1S6FA 1GJ5H 1FJSA 3MMGA 4X1NU 3QZRA 2FX6A 3SUFA 1G3BA 4D7FA 4OS2A 1QQUA 1WQVH 1XXFA 3L33A 4GUXA 4D7GA 2Y82A 3QTVH 1DVAH 2FLRH 1P3CA 1OYQA 2IOTA 1GI3A 1MKXH 1QFKH 3GCHC 1IQLA 1EPTB 1DOJA 1THRH 1V2WT 2ZDAH 1DPOA 5AHGH 1RTKA 5CHAB 1EB2A 2ULLA 3GDUA 2BY8X 4NWLA 4ZUHA