1PQAA

Trypsin with pmsf at atomic resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
224
structure length
223
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Trypsin Revisited: CRYSTALLOGRAPHY AT (SUB) ATOMIC RESOLUTION AND QUANTUM CHEMISTRY REVEALING DETAILS OF CATALYSIS.
pubmed doi rcsb
molecule tags Hydrolase
total genus 51
structure length 223
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pqaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pqaA01
1SC8U 2V3HH 4LOYH 3RXFA 3U9AH 1QA7A 3RMMH 1Q2WA 1TPOA 1QURH 4Q2KA 1SGDE 2FOCA 2VNTA 2F3CE 1SGCA 1EB2A 5JBTA 3GY2A 1C1VH 1AU8A 5E0JA 1V2WT 3Q76A 4UE7H 4ZKSU 1P05A 1GI5A 2R2WU 4K69A 5JBCS 5DP6A 4BTIB 1W2KH 3T62A 2C8ZB 4WXVA 1EP5A 1GJ9B 2THFB 1DITH 1BTUA 4NFEA 3T28A 3SV8A 3RXSA 1MKXK 1N1LA 1SQOA 1DWBH 4THNH 2ZGHA 4GPGA 1UHBA 4A1TA 4GCHF 1YPHC 4FUHA 4GCHG 4X2XA 4OS6A 2Q1JA 8GCHF 1LHDH 4B71A 5FXLA 1O3GA 1QQUA 2ZDNA 1DLKB 1MQ5A 1F0TA 5AVDA 3PMBB 4B2BA 1ZTJA 2GVFA 1YBWA 2Z94A 3NWUA 2VIVA 2YNAA 1DS2E 3KQEA 3Q3KA 2FOHA 1GI3A 1P01A 3HKIB 5J4SA 4BTTB 2OBQA 2FOGA 1RRKA 4H42U 3SQHE 4AFSA 1S83A 2RA0A 2ODYB 1VZQH 4AZ2B 2TGDA 2BVXH 5DP9A 3ODFA 4HI3A 2QF3A 2W5EA 1SLVB 2WPMS 2B9LA 3S69A 4I8LA 1TA6A 2BQ6B 3VB7A 1TALA 1GJ7B 2BTCE 1C2MA 1SLWB 1O33A 1LKBA 5DP4A 3MFJA 2ZCLP 1C5UA 2IPHA 4BOHA 1TYNA 2PGQB 2FS9A 2RCEA 3BV9B 1A5HA 2PGBB 4INLA 3UWJH 3ZZBA 1CVWH 4ABHA 2Y5FA 4Y10E 5A8ZA 2CF8H 2BZAA 4E7RG 1W13U 2AIPA 5GWZA 3B23B 2BXTH 2PKSC 3SUEA 1BJUA 2FESH 2TBSA 5EXLA 3PLPA 2ZDAH 3H7OA 4DY7B 1B5GH 1CBWC 4K8BA 1K1PA 1BBRK 1F0RA 1LHGH 2H6MA 1K21H 1THPB 2SNWA 3M3SA 1UTOA 5A0CA 4Y71A 2PW8H 3D65E 2BOHB 4WJG2 3CP7A 1SGYE 2CHAC 2GP9B 3LOXA 4CR5A 1C1WH 1TNKA 1LPZB 1V2TT 3GY3A 1G3DA 2BX3A 1O2VA 2ZQ2A 1GHAF 4NSYA 5IYTA 3UR6A 1GHAG 3MH6A 1MD8A 3P95A 3GY8A 2VH6A 4XBBA 5LGOA 1YPGH 1QY6A 1ZPBA 2VIOA 4K8YA 3RXGA 4OS2A 1GJ6A 2BY7X 3CS0A 1GHYH 4XBCA 1E35B 3C1KA 2F91A 4FVDA 3SOSA 1LVMA 3A84A 3ATWA 3SUFA 5EPYA 5JYIA 1AUJA 4DJZB 3P17H 4ZXXH 3MNCA 1JRTA 4ISHH 1FY1A 2ILNA 5C1YA 2G4TA 4U32A 1W7XH 5EW2H 1FQ3A 1KSNA 3G01A 1OP0A 1THSH 1T4UH 3S9AA 3W94A 1ELVA 2AGGX 1TGNA 1SPJA 1FLEE 3E0PB 4MNVA 2AMQA 1PPZA 1XUIA 1A1RA 4FVBA 1NZQH 1V2QT 5ESBA 3RMNH 3UOPA 1TGBA 3M35A 3QGJA 4CBNA 1HNEE 4CREA 1L1GA 2G55A 1OYQA 4Y8YA 2ZCHP 1SHHB 3SO3A 3DFJA 1GBMA 2O8TA 1TX6A 1LQDB 4D76A 2EI7A 4K60A 4Q7YA 4MLFB 1C5OH 1TOMH 1TGTA 3SV9A 3SJKA 1C5YB 4UEHH 1NFUA 1HB0B 1H4WA 4OS5A 4M7GA 2Y7ZA 1TWXB 4O3TA 5EQQA 2BM2A 1YM0A 5DGJA 2XTTB 5GPIB 1XX9A 1P2JA 3E0NB 2UUYA 4BNRA 3RXBA 1C9PA 1C5SA 1GBTA 2Y80A 1JIMA 2FI3E 3PMHB 2FOEA 3P8FA 4MQAA 2A5AA 1MU8B 2BDHA 1TBZH 3A85A 2BLOA 3BIVH 4E06H 2XC0A 3URDA 3MH4A 3A7YA 1LDTT 1W8BH 1SGNE 1P3CA 4TPYA 4FUDA 1HJAC 4ZHLU 3EGKH 1CT0E 3LH3A 1HUTH 2NU2E 2QXHA 3PM3A 2W3KA 1JBUH 4CHAB 4WWYA 3QO6A 2Z3EA 4D9RA 2A7JA 3DD2H 2AERH 1GI6A 3QZRA 1FMGA 1A0HB 1K1JA 1GBBA 3QTOH 3ZV9A 3MO6A 1P03A 3OY6U 4IN1A 3FFGA 3KQBA 3AW0A 1UHBB 1IHSH 1C4U2 1KY9A 1P11E 2P8OB 3V12A 1O3HA 1AVXA 1P2KA 3ATLA 2VVVA 1PQ5A 2ZPRA 3SQEE 3SU5A 4B2AA 4DURA 3V7TA 1NY22 2SGEE 3ZZDA 3STIA 1MBQA 3TH4H 3MO3A 1SG8B 4O97A 3LH1A 3PROA 2Y6TA 2XC4A 1WAYB 4MTBA 3L33A 2BY8X 2ZZUH 1QRWA 2QGRA 3GCHB 1DY9A 1O2YA 2WV5A 4ZKRU 2PWXA 3EE0B 2GKVE 3TGKE 2IJOB 1CSOE 1GVLA 3S9BA 3UOUA 1NRPH 4ABIA 1GBJA 1O5BB 4SGAE 4RN6A 4K3JA 4ISLA 1O35A 3GY7A 4UD9H 2WPLS 5DP5A 2R0LA 4DT7B 2YNBA 3PMAB 2CXVA 2FOMB 2ZP0H 1FONA 3GYLB 2ALPA 1AKSA 5I25A 4F49A 5JPMH 4YT6H 3CS7A 1KIGH 4GVUA 1HYLA 3QUMP 1EAIA 1Y3YA 1ZHPA 2FTLE 2ZDKA 3U69H 1NN6A 2HNTE 2ZQ1A 2NU3E 3EDXB 1Q3XA 4DIIH 1GDUA 2ZHFH 4MVNA 2HOBA 1TABE 1UVTH 1BA8B 1K1NA 1C9TA 1QB9A 1SGQE 3KEEA 4B1TA 3BTTE 2QY0B 4KTSA 4CBOA 1TQ0B 2OLGA 1FNIA 1TMTH 3BTDE 1FY3A 1T32A 3E6PH 4RSPA 3QX5H 4NZQA 1EAXA 2CV3A 1E0FD 3PB1E 4CRCA 1KDQA 3QZQA 3KCGH 3O8CA 1SBWA 1TNHA 3F9FA 5DPAA 3LGWA 1VITF 2FLRH 2QYIA 1V2NT 1GHZA 3SV6A 1GHXH 2F9OA 1H9LB 4B2CA 3O8DA 1EATA 1QIXB 1CGIE 2A2QH 4NA7A 1DANH 3A8BA 3SI4H 3DFLA 4X1SU 2NWNA 3GDSA 3LGIA 1SGRE 2C90B 3U1JB 1UMAH 1O3IA 1BRUP 2BY6X 2ASUB 1O3JA 5GXPA 5GCHG 1HIAA 3I29A 4I33A 3SU0A 1MKXH 1G3CA 2XYAA 1DM4B 3SNEA 3UNSA 3UUZA 4GLYA 3RXAA 2P93A 1ARBA 2VIQA 2AMDA 4JK5A 1ID5H 4YZUA 3TLOA 4ESTE 1BTWA 3P92A 2G4UA 1GJ4H 3VEQB 1N6XA 3V13A 4D7GA 1T8LA 2UUFB 5DKMA 2A0QB 2ZPSA 1QTFA 1MBMA 2XWBI 5AFYH 3MO9A 2RA3A 9LPRA 2WPIS 3VB5A 2ODPA 2XBXA 4U30A 3GOVB 4MNXA 2QXJA 3A7VA 1SLUB 4X8SH 5FPYA 1ELDE 2TIOA 1CE5A 3ODDA 4CHAC 3PLBA 1HRTH 1EOLA 1AHTH 1HAVA 3VXEH 1HAYB 3HGNA 3V0XA 1W7GH 2OBOA 1L4ZA 3E90B 2VU8E 3UNRA 1IOEA 1ORFA 1OWJA 3S7HB 3MNXA 2A7HA 2Z9GA 1GMHF 4AOQA 2QV1A 2P8OC 1ZTKA 3TH2H 3SJ8A 2UWOA 4IMQA 2D8WA 2O8UA 1MH0A 2R3YA 3IG6B 3TU7H 1YGCH 3MI4A 4HGCA 3MNSA 2F9NA 4JZFH 2GZ7A 3BG4C 1FUJA 3ZVEA 5HM2A 1T8MA 2P94A 3ZZ6A 2OTVA 2PTCE 4OS1A 4WF8A 5G4BA 3MYWA 1YP9A 2HNTF 4DGJA 1UTQA 4WH8A 2H9EH 1XKBC 1C1SA 3FANA 1O34A 1C1MA 2V35A 2P16A 2PKSB 3NKKA 1NRQH 2WPHS 1O5AB 2Z7FE 5EW1H 1RTFB 1BBRH 2BDIA 1GBHA 1WSSH 1DICA 1MTVA 1WTHD 5EU8A 3RXRA 4AX9H 4AYYB 3H5CB 1P3EA 4UONA 5IDKA 3DHKH 4YOJA 1C5PA 1U6QA 4OS7A 2W3IA 2DE8A 1AZ8A 2EI8A 1BMAA 1UVOA 1W3CA 2CHAB 4HFPB 5LPEA 2FOAA 4UFGH 1A5IA 4AG1A 4NG9H 1AWFH 2OC0A 2HLCA 1DX5M 4UFEH 2BLWA 2RDLA 2GMTC 1ZSLA 3DA9B 3TGJE 5AFZH 1AI8H 3UPEA 3PO1B 3ZZCA 4ZH8A 3MH5A 2ZNKH 1HXEH 1TRMA 3HGPA 1S81A 2VIPA 1RXPA 1CHOG 3BTGE 1CGHA 4F4OC 1BRCE 1RTLA 3ZZ7A 2O8WA 2STAE 1GHBF 1OXGA 1QL9A 1WQSA 1GHBG 1QR3E 1KXFA 3M5LA 4AFQA 4YM9A 5JB9S 1TRNA 2BD7A 1MZDA 4IW4E 1AKSB 1O5CB 1G2LA 1BUIA 2ZGBH 3NUMA 3TVJB 4NA8A 3SU3A 3FP8E 1UTLM 2AS9A 1DVAH 1ARCA 3ZZ3A 2OUAA 4A7IB 1HAGE 9ESTA 3QWCH 1F5KU 1CQQA 5ESTE 3LGYA 1XM1A 1QJ7B 1ZR0A 2PUQH 3BTEE 4R8TB 3M5OA 1HAZB 2ANKH 2FS8A 3S7KB 3BTME 1YPLH 2AYWA 1QQ4A 1GG6B 1WUNH 1AFQC 1C2JA 1O2PA 1P2QA 1C1NA 4ZMAH 1HAPH 5L6NH 2R3UA 3SZNA 4YO9A 2BZ6H 5FX5A 1KDQB 2ZDMA 1XXDA 4K2YA 1Y5BT 3JZ1B 5LPRA 3MTYA 4AN7A 4FUCA 3RU4E 2ALVA 4JZDH 2ZCKP 2AEIH 4YT7H 4CRAA 3RLWH 1WCZA 4I8GA 1GI2A 5SGAE 1QHRB 4D7FA 1GVZA 5A8YA 1BHXB 2BMGB 3GCTG 4KKDA 1ACBE 2V3OH 1XMNB 1ZMNA 1C2GA 3Q77A 3SV7A 3SU1A 3RXHA 2OC7A 1E37B 1HJAB 5C1UA 2XXLA 3O8BA 1X7AC 1SQAA 1NFYA 1HIAB 1OWDA 2P3TB 2BDYA 1UVPA 1EOJA 1Z6EA 5FAHA 2FIRH 2ANYA 2BDAA 3TPIZ 4MNYA 1O3FA 1SOZA 2IN2A 4GHTA 4QT8C 4Y0YE 4BTUB 3P70B 4K1TA 3ZZ5A 1L1NA 4XOJA 5JBAS 1A2CH 1TPAE 2ZHEH 1AE5A 2OC8A 1ELBA 3BN9A 2G5NA 1V2RT 3DUXH 4AFZA 2ZDLA 1GI7B 4WMEA 1RD3B 1UCYE 1YKTA 2LPRA 3VB3A 2W7UA 3UQVA 5FX6A 1GMCF 2OD3B 2VWOA 3EYDA 1GMCG 1EZXC 5J4QA 4X2YA 3N7OA 1O31A 3A83A 1SHYA 4O3UA 1GJDB 2BD2A 2UUKB 2ZO3H 1HCGA 3E91A 3FAOA 5TCCA 1EZSC 3GY4A 5A0AE 2QN5T 2P59A 4ABFA 4X1QU 3ZZ4A 3RDZA 3ZVAA 1GJAB 2BQ7B 4X6MA 1ETSH 4GSOA 2PKAA 3BTKE 3R0FA 1VCQA 1BQYA 2WPJS 3KL6A 3RXEA 3TJOA 3MU5A 3BEUA 1UK3A 2F83A 1O36A 5C3NA 3A89A 3K65B 2A4OA 5GDSH 2SGFE 3RUOA 1TRYA 2DE9A 3PWCA 3PO1C 3TGIE 2HPPH 1CT2E 1TPSA 4NIWA 1ETTH 4Y7BA 1D6RA 7ESTE 3NZIA 3O8RA 1AVGH 1AGJA 1OP2A 4Y79A 1FPCH 1DXWA 1CO7E 3BG8A 4IGDA 4X8VH 4JYUH 3BTFE 1TBQH 1BB0B 1O0DH 1NESE 1OWIA 2PR3A 3QGNB 4JCNA 1O3CA 2GV6A 4ABAA 1XVMA 4CRFA 2BX4A 1EJMA 1EXFA 1ELEE 4FUEA 4JYVH 4Q80A 5DG6A 3A86A 2ZTYA 1GCDA 1C5NH 2ZF0H 3RXQA 1P02A 4IBLH 2ZHDA 1SB1H 5C67A 2GZ9A 2BB4A 1E36B 1S82A 5JDUB 4TPIZ 3A8CA 2ZGJA 1EASA 2BY9X 1C5LH 3MWIU 1QRXA 4NCYA 5EXMA 1BTPA 3GICB 1ELCA 4I7YH 1VITH 3MMGA 3M7UA 4R0IA 4D9QA 1PYTD 1P09A 1O3MA 3E16B 3PTBA 1GG6C 1HPGA 3A80A 3HK6B 1VGCB 1PFXC 1MUEB 3M3TA 2A5IA 1GI9B 3ESTA 3P6ZB 3BEIB 1C5VA 1KXAA 3ELAH 1YC0A 4FUJA 1C1PA 2A2XH 1NRNH 1ETRH 1BTZA 3A82A 2BLQA 1B0EA 1C1RA 1G30B 5E0HA 4X1RU 4U01A 5L30H 3EA9A 1ANBA 1H8IH 3T27A 1YPJH 1D3DB 4Y8ZA 3M7TA 3VPKA 1EX3A 1O3DA 2FP7B 4I8KA 2BDGA 1F2SE 4ABGA 1P9UA 5HXFA 3V3MA 3RXTA 4DVAU 4MPUA 3SUGA 1MKWK 3SV2H 3LKWA 2F9VA 1WOFA 3TK9A 1QBVH 1GCTC 1WV7H 1P2OA 1E34B 2PFEA 5T3HA 2FYQA 3JZ2B 1GL1A 1UCYK 1G3EA 1MD7A 1O2LA 3LDXH 2ZGXH 4ZKOU 1XUFA 1P8VC 4NWKA 3ZZ8A 3T29A 3L3TA 4DW2U 3D49H 4X1PU 1QL8A 2BDCA 2FX4A 3TNTA 1RFNA 1ZSJA 5C20A 3AAVA 2J2UA 4ZHAA 1G37A 2FEQH 1HJ8A 5DK1A 3FVFB 1BRAA 1SGIB 3S0NA 1XUGA 1FY4A 1N8OB 3BG4B 1C5XB 2A5KA 1C1QA 4DCDA 1FY5A 3SNAA 3ZVFA 1GI8B 4ZKNU 3QDZB 5EQSA 5FCKA 1GHVH 2VH0A 4TWYA 1PPBH 2TGPZ 3RC5A 2ZTZA 1O2WA 1C2DA 1PQ7A 3SGAE 3UR9A 2BXUH 1NM6A 1TE0A 3D23A 2Y7XA 1KTSB 4ABBA 1ZZZA 3T25A 1J14A 2TGTA 2ZECA 3F9HA 2ZG0H 1DSTA 1HGTH 4JYTA 4NGAH 7GCHF 2FOBA 2K1QA 1BHXF 2GCHF 7GCHG 3LT3A 1V2MT 4ABDA 2GCHG 1H8DH 4IN2A 4X8UH 2CN0H 2KAIA 4BAMB 3U8TH 1Y59T 1D3TB 1ZGVA 1W11U 5F8TA 1W10U 1G9IE 3BTHE 1BT7A 3ZV8A 2ULLA 1ESBA 3VB4A 3M3VA 4ISIH 5E8EH 1D4PB 1OWEA 1P2NA 2XCNA 3SN8A 1A7SA 3SI3H 3SORA 1ELAA 2VWMA 2GMTB 3KHVA 3T26A 1YCPK 2ZU5A 4Z0KA 3SBKA 5ETXA 1O3KA 1P10A 3KF2A 1C5QA 2GDEH 3UWIA 1QB6A 2Z3CA 1OWKA 1EKBB 4PROA 4BXWA 1EAWA 3M5NA 1Y5AT 1ELTA 2R9PA 3A81A 3STJA 3L6PA 1OWHA 4SGBE 1ESTA 4Q7XA 4NIVA 6LPRA 1G2MA 4CRGA 2ZGCA 3EA7A 3RM2H 2FI4E 2FWWA 2JKHA 2VGCB 3TJVA 1O37A 6GCHF 7LPRA 4BAHB 3ENSB 2J94A 2PKAB 4DG4A 6GCHG 2ZTXA 1YLDA 1ELGA 3WY8A 3E8LA 1MAXA 1UVUH 4AB9A 4Y76A 1DWEH 4H4FA 1SGTA 2HALA 1O3LA 1WU1A 1VJ9U 1NU9A 1C2FA 1J16A 4J2YB 3SHAH 1C1TA 2G52A 5FCRA 1LHEH 4ASHA 5EGMA 1NFWA 2OC1A 4LZ1H 1O2UA 2I6SA 2TRMA 3RXOA 1EPTA 1ZMJA 1BJVA 2AMPA 1FZZA 3MU8A 4A92A 1PJPA 2JETB 1S84A 3RC4A 5GCHF 1VGCC 2LNCA 2G81E 2H5CA 1O2SA 1SI5H 1GBKA 3LJOA 1Y3VA 1LPKB 4X2WA 1NT1A 1O39A 1AFQB 1IHTH 1S6FA 3LC3A 1SMFE 1C1UH 1TOCB 3H7TA 3SJOA 1FJSA 2H1UA 3W95A 1A0LA 1XUJA 1O38A 3TK5A 4KTCA 2FOFA 1IQIA 1N6YA 3OSYA 4JK6A 1TBRH 3A7WA 4ZXYH 1FN8A 1YPKH 2CJIA 2ESTE 2G5VA 3AAUA 4ZROA 3QLPH 3M7QA 2FZZA 1V2VT 1ZRBA 1O30A 1O5FH 1C5ZB 3SGQE 1JRSA 1F92A 1KTTB 4FUIA 4MDSA 1ANDA 2WV4A 4CRBA 1RS0A 3P8NA 4CH8B 5HM9A 4HTCH 1HXFH 2EC9H 2ZU3A 1OX1A 4ABEA 3MU1A 4WH6A 2PSXA 1QBOA 3A87A 2VVUA 1A3BH 2SGAA 2BVRH 4JZIA 1AVWA 3GCOA 1S0QA 5C5NA 1SOTA 2P3FH 3RXPA 1CU1A 5EXNA 1LCYA 4LXBH 1Z8JB 1NU7B 1QA0A 1SGEE 1DE7H 2F9PA 1NS3A 1DFPA 1TX7A 1N8OC 3HATH 1AWHB 2G00A 2ZFSA 3OTJE 1O2JA 1E38B 1HAIH 2ZWLH 1OOKB 2PV9B 3IITA 2QXGA 1UTNA 3P8GA 2FO9A 4K1SA 1ZHRA 1UO6A 1F7ZA 2A32A 2ZHWH 3ZVCA 1Z8GA 3B8JA 1KYNA 1O2TA 4FUBA 2WYJA 3BF6H 2C8WB 2QA9E 2O8MA 1Z1JA 1EP6A 5CMXH 1KXCA 2XC5A 1WYKA 1UTKA 4AORA 1PPGE 2W7SA 3RXLA 1Z71A 4KP0A 3UFAA 1YPMH 1VCWA 3ATIA 2H9HA 5FPTA 3GDVA 3TJUA 1IQLA 5HGGA 2BD3A 2PLXA 1DY8A 8KME2 1ZYOA 3SHCH 3FZDA 2ZC9H 2J92A 2SFAA 5E2OA 1TA2A 1TMBH 5C5OA 1Q31A 4YOIA 4H6TA 3RXMA 1GJCB 1FXYA 4FXGH 1G32B 1H9HE 1KLJH 3RP2A 1GMDF 3U1IB 4OGXA 1GMDG 4J1YA 4I8JA 4TYDA 4VGCB 1P2MA 2P3UB 5HYOA 1Y3WA 4YESB 3OX7U 1Z6JH 1ZOMA 4KELA 1CHOF 1DLEA 3BSQA 1IQMA 1MU6B 3C27B 1MTUA 1ZMLA 2H5DA 3RC6A 3GISB 2BD4A 1O5DH 2QIQA 2Z9LA 3EQ0H 4B75A 8ESTE 2VGCC 1LVYA 1Y5UT 3QN7A 5EODA 5GJ4B 4ABJA 2KAIB 4ZUHA 3ZVBA 4CR9A 1QB1A 1GBFA 2J38A 5EQRA 2VIWA 3M36A 3PLKA 2Y82A 2ZU2A 1DXPA 2XBVA 3RXIA 2W26A 2PHBA 1BMMH 1CA0B 5LH8A 1NRRH 3GYMA 2AGIX 5C1XA 1T8OA 1MZAA 1NROH 3RMOH 1ZLRA 2ZA5A 1AUTC 1PPEE 2JETC 1GL0E 4E05H 1TIOA 5ABWA 1H1BA 1L2EA 3F9GA 1W12U 1J8AA 2CGAA 1SLXB 1TGCA 5L2YH 1KXDA 1ABIH 5T6DA 1IQKA 3LPRA 2FDAA 2GT8A 3SNCA 1ANCA 2AIQA 3A7ZA 2R2MB 1JWTA 2ZU4A 4YTAA 4AGKA 3PTNA 4OGYA 4DIHH 1AN1E 1NTPA 3RXJA 1DUAA 2M5TA 3CENA 2C3SA 3GCTF 5A2MH 3UQOA 2UWLA 1MKWH 2FX6A 1EPTB 5CHAB 3SJ9A 2O8LA 1F0UA 4AB8A 1PPFE 3RU4D 4WMDA 1SGFA 4U2WA 1O3EA 3F9EA 4Q7ZA 1W0YH 1ZTLA 1G36A 2VWNA 1AB9B 1GHWH 1PPCE 1UCYH 5FHTA 1K1OA 1GCTB 2J9NA 4X6NA 1QRZA 1JXPA 1A5GH 8GCHG 1HAHH 6CHAB 4IC6A 3U98H 1ELFA 1K2I1 2VB0A 3K6YA 4LK4A 1MCVA 1O2KA 4B76A 1O3BA 1HAOH 1V2UT 1IQEA 1CT4E 1V2PT 2GT7A 2ZFPH 1O2OA 2J4IA 1C5TA 1TNGA 2Y81A 3RMLH 3UNQA 2FLBH 2B7DH 3MOCA 5BPEA 2GZ8A 3U8RH 2OINA 2TGAA 2OQUA 2NU4E 2Q6FA 2ZFRH 1MTNB 1O5EH 4KTUA 2GD4B 1OPHB 1THRH 1P2IA 1VR1H 2ZIQH 1DSUA 1QFKH 1Z7KA 4Y6DA 3SNBA 2C4FH 1V3XA 3KIDU 1WBGB 1O2ZA 1KLTA 4UFDH 1PQ8A 2FTMA 2AFQB 1AY6H 2GGVB 1TFXA 1HAVB 3K6ZA 5EOKA 5T6GA 1MTWA 5JBBS 1HDTH 1EUFA 4FUGA 2D2DA 3AASA 4AFUA 1EZQA 1M9UA 2ZFQH 5GIBA 5PTPA 3VGCB 2ZPQA 1BDAA 1DOJA 3MNBA 3SW2B 1HJ9A 3FP6E 2Z9KA 1LMWB 1BIOA 2HRVA 2XNIA 2EA3A 1A61H 1LO6A 3I78A 1EZUC 1ZJDA 5L2ZH 1O2RA 1RIWB 2WYGA 1A4WH 3A88A 1HLTH 1IAUA 4Z6AH 2ZFFH 1OP8A 1RGQA 1XVOA 5BRRE 1VCPA 3M61U 1YCPH 2ANWA 3TH3H 2B0FA 1O2MA 4VGCC 1LVOA 1WTGH 1QJ1B 1CGJE 5F6MA 1YCPM 3UY9A 3RM0H 1UK4A 4IC5A 2Y5HA 1RTKA 2A4RA 4WMFA 2Z3DA 4I8HA 4FU7A 2WPKS 3KNXA 3KGPA 1C2LA 1P06A 1GDQA 3RLYH 1GBEA 3M37A 1C5WB 3Q00A 3F1SB 1KXBA 3F68H 4NWLA 4O9VA 4XE4A 1SVPA 4X1NU 1GGDB 2VVCA 4YLQH 2GCTB 1CA0C 2Z9JA 4YOGA 3ZYDA 2J34A 4ISNA 1AE8H 1C2EA 3Q3XA 1NPMA 2XWAA 5A0BA 3LJJA 1CA8B 3BTQE 1QL7A 1OS8A 1S85A 3DT0H 3GCNA 1BRBE 1GJ8B 2FODA 4XFQA 1GDNA 4A1XA 4NFFA 1JMOH 4X0WU 2SGDE 1ANEA 1C5RA 2EI6A 3BIUH 4MG3A 5FPSA 3PWBA 1LHFH 2A31A 3TK6A 1QNJA 2A45B 1LKAA 1ESAA 2BHGA 1IQFA 2V6NA 3MH7A 4XDEA 4HZHA 1V2ST 1SR5C 1ZRKA 4X6PA 3E1XB 2BOKA 5FBIA 1HAXB 1GJ5H 1BOQA 2NU0E 1SSXA 3A7TA 3FP7E 1XXFA 2ZEBA 3BEFB 3HK3B 5AF9H 1ZGIA 1FIZA 4MPVA 1BITA 1PPHE 2IOTA 1LPGB 1O2NA 3RXUA 2A1DB 2F9BH 2AGEX 1IQGA 1EPTC 1JIRA 2HGTH 5CHAC 3UIRA 1W0ZU 1J15A 1AB9C 1DWDH 1V2OT 1K1LA 5H4IB 1GBAA 1BTXA 1T8NA 4XSKU 2ZU1A 2BYAX 6CHAC 1NC6A 1ZPZA 4Y11E 3I77A 1PQAA 1TONA 1H9IE 3RXDA 1MTSA 2PUXB 1O2XA 1V2LT 1OSSA 2EEKA 3VXFH 2H9TH 4H6SB 1DWCH 2P95A 3TIUA 2OXSA 2XBYA 1PYTC 1L0ZA 1T31A 3K2UA 3AW1A 1MTNC 1KLIH 1UK2A 1AIXH 1DPOA 1B7XB 1AMHA 3OYPA 2QCYA 1LHCH 1P57B 1NFXA 7KMEH 5DO4H 4DOQA 1V2JT 2QAAA 1SFIA 2B8OH 3MU0A 4NIYA 1TLDA 1AO5A 1Z8IB 2OP9A 4A6LA 4CRDA 4OS4A 2BVSH 4FU8A 4BAKB 1QGFA 4E7NA 4FUFA 4RKJB 3NPSA 3RXKA 1O3OA 1J9CH 2DUCA 1V2KT 3HKJB 3LC5A 4FU9A 4NIXA 2BLVA 1FI8A 1DT2A 5I46H 2G8TA 2Z9IA 1P0SH 4TWWA 1Y3XA 1OYTH 3ATMA 1K1IA 1UTJA 3VGCC 1TQ7B 4YLUA 1S5SA 1XUKA 3LU9B 2C8XB 1BMLA 1YYY1 3NK8A 4CH2B 1TPPA 1EJNA 2C8YB 2ZHQH 1K9OE 1RIWC 3VB6A 1UJ1A 2Q6GA 4B73A 2ZI2H 3E3TA 1EB1H 1GVKB 3LONA 5E2PA 5B6OA 1Y3UA 2UUJB 1NRSH 4ZHMU 2GTBA 2FXRA 3PV4A 1O3NA 1GBCA 1D3PB 2RG3A 4X2VA 3ATKA 1KXEA 2AH4X 3Q3YA 2PSYA 4BAQB 1FPHH 1FDPA 1FAXA 1HFDA 1DUEA 4TY6A 1HV7A 2B5TB 1AQ7A 3P8OA 3A8DA 3KN2A 1TNIA 2VJ1A 2O9QA 1C2KA 5TJXA 1S0RA 1FIWA 2FM2A 2YOLA 3MHWU 3FZZA 1GGDC 2G51A 2HWLB 1K22H 1O3PB 4UFFH 1FV9A 3K9XB 4XBDA 1TNLA 3RU4T 1RJXB 1A3EH 2GCTC 2F9UA 4ISOA 3R3GB 3KQCA 5HMAA 4BAOB 1GWAA 2A7CA 1YPEH 2OQ5A 2VWLA 6ESTA 1WQVH 3LGVA 3D62A 3S9CA 1GI0A 1ABJH 1TB6H 1YLCA 4WY3A 3T2NA 2FYRA 4AYVB 1C5MD 2WINI 2VIDA 1IQHA 1O32A 1TGSZ 1LQEA 1SGPE 1O3AA 3KQDA 1GPZA 3SNDA 1LTOA 2QC2A 1MCTA 5F8XA 3BTWE 3PYHA 4MPWA 2FPZA 1MMJN 1A46H 2HPQH 2H2ZA 1D6WA 3NCLA 3NXPA 3U8OH 4AG2A 2XCFA 1VITG 2XBWA 1LVBA 2GX4A 2ODQA 2XRCA 2C93B 3SJIA 3F6UH 1TX8A 1TNJA 2CF9H 2BQWB 3ITIA 1P04A 4IMZA 3URCA 3ZVGA 5K0HA 1EAUA 2Z6BD 4K5ZA 1SQTA 5EPNA 4D8NA 1C4V2 4NSVA 4Y7AA 5F8ZA 1UTPA 2JH5D 1VJAU 1AD8H 1XKAC 4INHA 4Y8XA 3EAJA 2NU1E 4ZAEA 1B0FA 4NZLA 2HNTC 3LIWA 5E0GA 3OY5U 5C2ZA 1BTYA 1EJAA 3ZVDA 1O2QA 1INCA 1D3QB 1W14U 5DP3A 3ZZAA 3T5FH 1O2HA 2WUBA 1C2HA 5CE1A 2JH6D 2PTNA 5TCAA 5F03A 3SU4A 5FBEA 2XW9A 4IS5A 4Y0ZE 2ANMH 5DP7A 1AZZA 1ZHMA 3GY6A 1O5GH 2J95A 3ZZ9A 2TPIZ 4TY7A 1BCUH 1A0JA 3HPTB 2GDDA 2VINA 5A8XA 5K7RA 3QK1A 1C2IA 2BD8A 5DJ7A 1AFEH 3GDUA 3UTUH 1L1JA 2SGPE 1GBLA 3A7XA 1K28D 1C4Y2 2Q6DA 3VFEA 1P12E 4GUXA 1O2IA 4X6OA 1UVSH 3PMJA 3SU6A 2BD9A 1GI4A 2I6QA 2ZFTA 1UTMA 4X8TH 1GMHG 5LPFA 1GI1A 1BTHH 1FAKH 3OU0A 4WVPE 1V6DA 3MU4A 4JZEH 4MPXA 2D1JA 1GBIA 1Z1IA 3AVZA 1CHGA 3RXVA 1T4VH 2CMYA 1GJBB 4NA9H 1MAYA 1K1MA 2QF0A 1TMUH 5AHGH 3TITA 1G3BA 2BY5X 4MNWA 2Y5GA 3TNSA 1FN6A 3ZYEA 2BD5A 5A09A 1JOUB 2V0BA 1F5LA 3GY5A 1P9SA 1QJ6B 3GCHC 4INKA 4GAWA 4AGJA 4I32A 1GBDA 3TJNA 1HBTH 4JZ1A 4GHQA 1IQNA 8LPRA 1SL3A 1MQ6A 1O2GH 3LGTA 4B74A 1QCPA 1FY8E 1CBWB 2SGQE 1IQJA 1T7CA 4LZ4B 3SGBE 1S6HA 2A4QA 2FI5E 3IWMA 2FMJA 3M5MA 1L4DA 3B9FH 1NO9H 2D26C 2UWPA 2WUCA 5JB8S 4BANB 1SFQB 3EA8A 1C1OA 4JMYA 4RKOB 1QBNA 3LGUA 1EQ9A 1F0SA 1J17T 2JH0D 3RXCA 1BBRE 3SUDA 4BXSA 5T6FA 2BDBA 4O03A 2SNVA 2OCVB 1DDJA 5EG4A 2R0KA 2GV7A 1ZPCA 1SGFG 1Z8RA 1Y8TA 1F5RA 2A4GA 3SU2A 1YPHE 4KGAA 4I31A 1XUHA 3QTVH 1BZXE 1D9IA 1ZJKA 2QXIA 3UREA 1YF4A 4K1EA 1ZSKA 2HVXA 2ZKSA 2STBE 5DP8A 4A5TS 2ZDVH 1TAWA 3A8AA 1BMNH 4WXIA 4UDWH 1OKXA 4A1VA
chains in the Genus database with same CATH superfamily
1SC8U 2V3HH 3FKSD 4LOYH 3RXFA 3U9AH 1QA7A 3RMMH 2WV9A 1Q2WA 1TPOA 1QURH 4Q2KA 1SGDE 3FO8D 2FOCA 2VNTA 2F3CE 1SGCA 1EB2A 5JBTA 3GY2A 1C1VH 1AU8A 5E0JA 1V2WT 3Q76A 4UE7H 4ZKSU 1P05A 1GI5A 2R2WU 2WHXA 4K69A 5JBCS 5DP6A 4BTIB 1W2KH 3T62A 2C8ZB 4WXVA 1EP5A 1GJ9B 2THFB 4OM9A 1DITH 1BTUA 4NFEA 3T28A 3SV8A 3RXSA 1MKXK 1N1LA 1SQOA 1DWBH 4THNH 2ZGHA 4GPGA 1UHBA 4A1TA 4GCHF 1YPHC 4FUHA 4GCHG 4X2XA 4OS6A 2Q1JA 8GCHF 1LHDH 4B71A 4Q63A 5FXLA 1O3GA 3ZIAD 1QQUA 2ZDNA 3SYJA 1DLKB 1MQ5A 1F0TA 5AVDA 3PMBB 4B2BA 1ZTJA 2GVFA 1YBWA 2Z94A 3NWUA 2VIVA 2YNAA 1DS2E 3KQEA 3Q3KA 2FOHA 1GI3A 1P01A 3HKIB 5J4SA 4BTTB 2XOKD 2OBQA 2FOGA 1RRKA 4H42U 3SQHE 4AFSA 1S83A 2RA0A 2ODYB 1VZQH 3H09A 4AZ2B 2TGDA 2BVXH 5DP9A 2WPDD 3ODFA 4HI3A 2QF3A 2W5EA 1SLVB 2WPMS 2B9LA 3S69A 4I8LA 1TA6A 2BQ6B 3VB7A 1TALA 1GJ7B 2BTCE 1C2MA 1SLWB 1O33A 1LKBA 5DP4A 3MFJA 2ZCLP 1C5UA 1W0KD 2IPHA 4BOHA 1TYNA 2PGQB 2FS9A 2RCEA 3BV9B 1A5HA 2PGBB 4INLA 3UWJH 2K0QA 1CVWH 3ZZBA 4ABHA 2Y5FA 4Y10E 5A8ZA 1COWD 2CF8H 2BZAA 4E7RG 1W13U 2AIPA 3PRDA 5GWZA 3B23B 2BXTH 2PKSC 3SUEA 1BJUA 2FESH 2TBSA 5EXLA 3PLPA 2ZDAH 3H7OA 4DY7B 1B5GH 1CBWC 4K8BA 1K1PA 1BBRK 1F0RA 1LHGH 2H6MA 1K21H 1THPB 2SNWA 3M3SA 1UTOA 5A0CA 4Y71A 2PW8H 3D65E 2BOHB 4WJG2 3CP7A 1SGYE 2CHAC 2GP9B 3LOXA 4CR5A 1C1WH 1TNKA 1LPZB 1V2TT 3GY3A 1G3DA 2BX3A 1O2VA 2ZQ2A 1GHAF 4NSYA 5IYTA 3UR6A 1S6LA 1GHAG 3MH6A 1MD8A 3P95A 3GY8A 2VH6A 4XBBA 5LGOA 1YPGH 1QY6A 1ZPBA 2VIOA 4K8YA 3RXGA 4OS2A 1GJ6A 2BY7X 3CS0A 4B6FA 1GHYH 4XBCA 1E35B 3C1KA 2F91A 4FVDA 3SOSA 1LVMA 5EJ1A 3A84A 3ATWA 3SUFA 5EPYA 5JYIA 1AUJA 4DJZB 4ASUD 3P17H 4ZXXH 3MNCA 1JRTA 4ISHH 1FY1A 2ILNA 5C1YA 2G4TA 4U32A 1W7XH 5EW2H 1FQ3A 1KSNA 3G01A 1OP0A 1THSH 1T4UH 3S9AA 3W94A 1ELVA 2AGGX 1TGNA 1SPJA 1FLEE 3E0PB 4MNVA 2AMQA 1PPZA 1XUIA 1A1RA 4FVBA 1NZQH 1V2QT 5ESBA 3RMNH 3UOPA 1TGBA 3M35A 3QGJA 4CBNA 1HNEE 4CREA 5C94A 1L1GA 2G55A 3F3BA 3GS9A 1OYQA 4Y8YA 2ZCHP 1SHHB 3SO3A 3DFJA 1GBMA 3AK5A 2O8TA 1TX6A 3KYGA 1LQDB 4D76A 2EI7A 4K60A 4Q7YA 4MLFB 1C5OH 1TOMH 1TGTA 3SV9A 3SJKA 1C5YB 4UEHH 1NFUA 1HB0B 1H4WA 4OS5A 4M7GA 2Y7ZA 1TWXB 4O3TA 5EQQA 2BM2A 1YM0A 5DGJA 2XTTB 5GPIB 1XX9A 1P2JA 3E0NB 2UUYA 4BNRA 3RXBA 1C9PA 1C5SA 1GBTA 2Y80A 1JIMA 2AHME 2FI3E 3PMHB 2FOEA 1EFRD 3P8FA 4MQAA 2A5AA 1MU8B 2BDHA 1TBZH 3A85A 2BLOA 3BIVH 4E06H 2XC0A 3URDA 3MH4A 3A7YA 1LDTT 1W8BH 1SGNE 1P3CA 4TPYA 4FUDA 1HJAC 4ZHLU 3EGKH 1CT0E 3LH3A 1HUTH 2NU2E 2QXHA 3PM3A 2W3KA 1JBUH 4CHAB 4WWYA 3QO6A 2Z3EA 4D9RA 2A7JA 3DD2H 2AERH 1GI6A 3QZRA 1FMGA 1A0HB 1K1JA 1GBBA 3QTOH 3ZV9A 3MO6A 1P03A 3OY6U 4IN1A 5B6LA 3FFGA 3KQBA 3AW0A 5HIYA 1UHBB 1IHSH 1C4U2 1KY9A 1P11E 2P8OB 3V12A 1O3HA 1AVXA 1P2KA 3ATLA 3SZEA 2EY4C 2VVVA 1PQ5A 2ZPRA 3SQEE 3SU5A 4B2AA 4DURA 3V7TA 1NY22 2SGEE 3ZZDA 3STIA 1MBQA 3TH4H 3MO3A 1SG8B 4O97A 3LH1A 3PROA 2Y6TA 2XC4A 1WAYB 4MTBA 3L33A 2BY8X 2ZZUH 2RDEA 1QRWA 2QGRA 3GCHB 1DY9A 1O2YA 2WV5A 4ZKRU 2PWXA 3EE0B 2GKVE 3TGKE 2IJOB 1CSOE 1GVLA 3S9BA 3UOUA 1NRPH 4ABIA 1GBJA 1O5BB 4SGAE 4RN6A 4K3JA 4ISLA 1O35A 3GY7A 4UD9H 2WPLS 5DP5A 2R0LA 4DT7B 2YNBA 3PMAB 1W0JD 2CXVA 2FOMB 2ZP0H 1YY3A 1FONA 3GYLB 2ALPA 1AKSA 5I25A 4F49A 5JPMH 4YT6H 3CS7A 1KIGH 4GVUA 1HYLA 3QUMP 1EAIA 1Y3YA 1ZHPA 2FTLE 2ZDKA 3U69H 1NN6A 2HNTE 2ZQ1A 2NU3E 3EDXB 1Q3XA 4DIIH 1GDUA 2ZHFH 4MVNA 2HOBA 1TABE 1UVTH 1BA8B 1K1NA 1C9TA 1QB9A 3OTPA 2LELA 1SGQE 3N99A 3KEEA 4B1TA 3BTTE 2QY0B 4KTSA 4CBOA 2YMSD 5C0UA 1TQ0B 2OLGA 1FNIA 1TMTH 3BTDE 1FY3A 1T32A 3E6PH 4RSPA 3QX5H 4NZQA 1EAXA 2CV3A 1E0FD 5CHBA 3PB1E 4CRCA 1KDQA 3QZQA 3KCGH 3O8CA 1SBWA 1TNHA 3F9FA 5DPAA 3LGWA 1VITF 2FLRH 2QYIA 1V2NT 1GHZA 3SV6A 1GHXH 2F9OA 3PRBA 1H9LB 4B2CA 3O8DA 1EATA 1QIXB 1CGIE 2A2QH 4NA7A 1DANH 3A8BA 3SI4H 3DFLA 4X1SU 2NWNA 3GDSA 3LGIA 1SGRE 2C90B 3U1JB 1UMAH 1O3IA 1BRUP 2BY6X 2ASUB 1O3JA 5GXPA 5GCHG 1HIAA 3I29A 4I33A 3SU0A 1MKXH 1G3CA 2XYAA 1DM4B 3SNEA 3UNSA 3UUZA 4GLYA 3RXAA 2P93A 1ARBA 2VIQA 2AMDA 4JK5A 1ID5H 4YZUA 3TLOA 4ESTE 1BTWA 2J97A 2G4UA 3P92A 1GJ4H 3VEQB 1N6XA 3V13A 4D7GA 1T8LA 2UUFB 5DKMA 2A0QB 2ZPSA 1QTFA 1MBMA 2XWBI 5AFYH 3MO9A 2RA3A 9LPRA 2WPIS 3VB5A 2ODPA 2XBXA 4U30A 3GOVB 4MNXA 2QXJA 3A7VA 1SLUB 4X8SH 5FPYA 1ELDE 2TIOA 1CE5A 3ODDA 4YXWD 3PLBA 4CHAC 1HRTH 1EOLA 1AHTH 1HAVA 3VXEH 1HAYB 3HGNA 3V0XA 1W7GH 2OBOA 1L4ZA 4XD7D 3E90B 2VU8E 3UNRA 1IOEA 1ORFA 1OWJA 3S7HB 1K0HA 3MNXA 2A7HA 2Z9GA 1GMHF 4AOQA 2QV1A 2P8OC 1ZTKA 3TH2H 3SJ8A 2UWOA 4IMQA 2D8WA 2O8UA 1MH0A 2R3YA 3IG6B 3TU7H 1YGCH 3MI4A 4HGCA 3MNSA 2F9NA 4JZFH 2GZ7A 3BG4C 1FUJA 3ZVEA 1MABB 5HM2A 1T8MA 2P94A 3ZZ6A 2OTVA 2PTCE 4OS1A 4WF8A 5G4BA 3MYWA 1YP9A 2HNTF 4DGJA 1UTQA 4WH8A 2H9EH 1XKBC 1C1SA 3FANA 1O34A 1C1MA 2V35A 2P16A 2PKSB 3NKKA 1NRQH 2WPHS 1O5AB 2Z7FE 5EW1H 1RTFB 1BBRH 2BDIA 1VKYA 1GBHA 1WSSH 1DICA 1MTVA 1WTHD 5EU8A 3RXRA 4AX9H 4AYYB 3H5CB 1P3EA 4UONA 5IDKA 3DHKH 4YOJA 1C5PA 1U6QA 4OS7A 2W3IA 2DE8A 1AZ8A 2EI8A 1BMAA 1UVOA 5T1VA 1W3CA 2CHAB 2KCYA 4HFPB 4Q4LA 3CNRA 5LPEA 2FOAA 4UFGH 1A5IA 4AG1A 4NG9H 1AWFH 2OC0A 2HLCA 1DX5M 4UFEH 2BLWA 2RDLA 2GMTC 1ZSLA 3DA9B 3TGJE 5AFZH 1AI8H 3UPEA 3PO1B 3ZZCA 3VG8A 4ZH8A 3MH5A 2ZNKH 1HXEH 1TRMA 3HGPA 1S81A 2VIPA 1RXPA 1CHOG 3BTGE 1CGHA 4F4OC 1BRCE 2JDID 1RTLA 3ZZ7A 2O8WA 2STAE 1GHBF 1OXGA 1QL9A 1WQSA 1GHBG 1QR3E 1KXFA 3M5LA 4AFQA 4YM9A 5JB9S 3MQKC 1TRNA 2BD7A 1MZDA 4IW4E 1AKSB 1SQRA 1O5CB 1QZ8A 1G2LA 1BUIA 4RT0A 2ZGBH 3NUMA 3TVJB 4NA8A 3SU3A 3FP8E 1UTLM 2AS9A 1DVAH 1ARCA 3ZZ3A 2OUAA 4A7IB 1HAGE 9ESTA 3QWCH 1F5KU 1CQQA 5ESTE 3LGYA 1XM1A 1QJ7B 1ZR0A 2PUQH 3BTEE 4R8TB 3M5OA 1HAZB 2ANKH 2FS8A 3S7KB 3BTME 1YPLH 2AYWA 2KM0A 5IK2D 1QQ4A 1GG6B 1WUNH 1AFQC 1C2JA 1O2PA 1NBME 1P2QA 1C1NA 4ZMAH 1HAPH 5L6NH 2R3UA 3SZNA 4YO9A 2BZ6H 5FX5A 1KDQB 2ZDMA 1XXDA 4K2YA 1Y5BT 3JZ1B 5LPRA 3MTYA 4AN7A 4FUCA 3RU4E 2ALVA 4JZDH 2ZCKP 3FN8A 2AEIH 4YT7H 4CRAA 3RLWH 1WCZA 4I8GA 1GI2A 5SGAE 1QHRB 4D7FA 1GVZA 5A8YA 1BHXB 2BMGB 3GCTG 4KKDA 1ACBE 1E79D 2V3OH 1XMNB 1ZMNA 1C2GA 3Q77A 2M2AA 3SV7A 3SU1A 3RXHA 2OC7A 1E37B 1HJAB 5C1UA 2XXLA 3O8BA 1X7AC 1SQAA 1NFYA 1HIAB 1OWDA 2P3TB 2BDYA 2KR7A 1UVPA 1WDIA 1EOJA 1Z6EA 5FAHA 2FIRH 2ANYA 2BDAA 3TPIZ 4MNYA 1O3FA 1SOZA 2IN2A 4GHTA 4QT8C 4Y0YE 1BMFD 3P70B 4K1TA 3ZZ5A 4BTUB 1L1NA 4XOJA 5JBAS 1A2CH 1TPAE 2ZHEH 1AE5A 2OC8A 1ELBA 3BN9A 2G5NA 1V2RT 3DUXH 4AFZA 2ZDLA 1GI7B 4WMEA 1RD3B 1UCYE 1YKTA 2LPRA 3VB3A 2W7UA 3UQVA 5FX6A 1GMCF 2OD3B 2VWOA 3EYDA 1GMCG 1EZXC 5J4QA 4X2YA 3N7OA 1O31A 3A83A 1SHYA 4O3UA 1GJDB 2BD2A 2UUKB 2ZO3H 1HCGA 3E91A 3FAOA 5TCCA 1EZSC 3GY4A 5A0AE 2QN5T 2P59A 4ABFA 4X1QU 3ZZ4A 3RDZA 3ZVAA 1GJAB 4TSFD 2BQ7B 4X6MA 1ETSH 2KCOA 4GSOA 2PKAA 3BTKE 3R0FA 1VCQA 1BQYA 2KCPA 2WPJS 3KL6A 3RXEA 3TJOA 3MU5A 3BEUA 1UK3A 2F83A 2KZ4A 1O36A 5C3NA 3A89A 3K65B 2A4OA 5GDSH 2SGFE 3RUOA 1TRYA 2DE9A 3PWCA 3PO1C 3TGIE 2HPPH 1CT2E 1TPSA 4NIWA 1ETTH 5HIZA 4Y7BA 1D6RA 7ESTE 3NZIA 3O8RA 1AVGH 4RT1A 1AGJA 1OP2A 4Y79A 1FPCH 1DXWA 1CO7E 3BG8A 4IGDA 4X8VH 4JYUH 3BTFE 1TBQH 1BB0B 1O0DH 4P00A 1NESE 1OWIA 2PR3A 3QGNB 4JCNA 1O3CA 2GV6A 4ABAA 4F48B 1XVMA 5KEDA 4CRFA 2BX4A 1EJMA 1EXFA 1ELEE 4FUEA 4JYVH 3OEHD 4Q80A 5DG6A 3A86A 2ZTYA 1GCDA 1C5NH 3WWFA 2ZF0H 3RXQA 1P02A 4IBLH 2ZHDA 1SB1H 2J5UA 5C67A 2GZ9A 2BB4A 1E36B 1S82A 5JDUB 4TPIZ 3A8CA 2ZGJA 1EASA 2BY9X 1C5LH 3MWIU 1QRXA 4NCYA 5EXMA 1BTPA 3GICB 1ELCA 4HG6A 4I7YH 1VITH 3MMGA 3M7UA 4R0IA 4D9QA 1PYTD 1P09A 1O3MA 3E16B 3PTBA 1GG6C 1HPGA 3A80A 3HK6B 1VGCB 4P02A 1PFXC 4XRNA 1MUEB 3M3TA 2A5IA 1GI9B 3ESTA 3P6ZB 3BEIB 1C5VA 1KXAA 3ELAH 1YC0A 4FUJA 1C1PA 2A2XH 1NRNH 1ETRH 1BTZA 3A82A 2BLQA 1B0EA 1C1RA 1G30B 5E0HA 4X1RU 4U01A 5L30H 3EA9A 1ANBA 1H8IH 3T27A 1YPJH 1D3DB 4Y8ZA 3M7TA 3VPKA 1EX3A 1O3DA 2FP7B 4I8KA 2BDGA 1F2SE 2YMSB 1P9UA 4ABGA 5HXFA 3DSOA 2W6ID 3V3MA 3RXTA 4DVAU 4MPUA 3SUGA 1MKWK 2QF4A 3SV2H 5DN6D 3LKWA 2F9VA 1WOFA 3TK9A 1QBVH 1GCTC 1WV7H 1P2OA 1E34B 2PFEA 5T3HA 2FYQA 3JZ2B 1GL1A 1UCYK 1G3EA 1MD7A 1O2LA 3LDXH 2ZGXH 4ZKOU 1XUFA 1P8VC 4NWKA 3ZZ8A 3F2GA 3T29A 3L3TA 4DW2U 3D49H 4X1PU 1QL8A 2BDCA 2FX4A 3TNTA 1RFNA 1ZSJA 3UB0A 3AAVA 5C20A 2J2UA 4ZHAA 1G37A 2FEQH 1HJ8A 5DK1A 3FVFB 3OAAD 1BRAA 1SGIB 3S0NA 1XUGA 1FY4A 1N8OB 3BG4B 1C5XB 2A5KA 1C1QA 4DCDA 1FY5A 3SNAA 3ZVFA 1GI8B 4ZKNU 3QDZB 5EQSA 5FCKA 1GHVH 2VH0A 4TWYA 1PPBH 2TGPZ 4DT4A 3RC5A 2ZTZA 1O2WA 1C2DA 1PQ7A 3SGAE 3UR9A 2BXUH 1NM6A 1TE0A 3D23A 2Y7XA 1KTSB 4ABBA 1ZZZA 3T25A 1J14A 4RI0A 2TGTA 2ZECA 3F9HA 2ZG0H 1DSTA 3DCLA 1HGTH 4JYTA 4NGAH 7GCHF 2FOBA 2K1QA 1BHXF 2GCHF 7GCHG 3LT3A 1V2MT 4ABDA 2GCHG 1H8DH 4IN2A 4X8UH 2CN0H 2KAIA 4BAMB 3U8TH 1Y59T 1D3TB 2PP6A 4I86A 1ZGVA 2RFKC 1W11U 5F8TA 1W10U 1G9IE 3BTHE 1BT7A 3ZV8A 2ULLA 3OE7D 1ESBA 3VB4A 3M3VA 4ISIH 5E8EH 1D4PB 1OWEA 3KYFA 1P2NA 2XCNA 3SN8A 1A7SA 3SI3H 3SORA 1ELAA 2VWMA 2GMTB 3KHVA 3T26A 1YCPK 2ZU5A 4Z0KA 3SBKA 5ETXA 1O3KA 1P10A 3KF2A 1C5QA 2GDEH 3UWIA 1QB6A 2Z3CA 1OWKA 3OEED 1EKBB 4PROA 4BXWA 1EAWA 3M5NA 1Y5AT 1ELTA 2R9PA 3A81A 3STJA 3NRLA 3L6PA 1OWHA 4SGBE 1ESTA 4Q7XA 4NIVA 6LPRA 1G2MA 2WZQA 2ZGCA 4CRGA 3EA7A 3RM2H 5EIYA 2FI4E 2FWWA 2JKHA 2VGCB 3TJVA 1O37A 6GCHF 7LPRA 4BAHB 3ENSB 2J94A 2PKAB 4DG4A 6GCHG 2ZTXA 1YLDA 1ELGA 3WY8A 3E8LA 1MAXA 1UVUH 4AB9A 4Y76A 1DWEH 4H4FA 1SGTA 2HALA 1O3LA 1WU1A 1VJ9U 1NU9A 1C2FA 1J16A 4J2YB 3SHAH 1C1TA 2G52A 5FCRA 1LHEH 4ASHA 5EGMA 1NFWA 2OC1A 4LZ1H 1O2UA 2I6SA 2TRMA 3RXOA 1EPTA 1ZMJA 1BJVA 2AMPA 1FZZA 3UAIC 3MU8A 4A92A 3DSGA 1PJPA 2JETB 1S84A 2J98A 3RC4A 5GCHF 1VGCC 2V7QD 2LNCA 2G81E 2H5CA 1O2SA 1SI5H 1GBKA 3LJOA 1Y3VA 1LPKB 4X2WA 1NT1A 1O39A 1AFQB 1IHTH 1S6FA 3LC3A 1SMFE 1C1UH 1TOCB 3H7TA 3SJOA 1FJSA 2H1UA 3W95A 1A0LA 1XUJA 1O38A 3TK5A 4KTCA 2FOFA 1IQIA 1N6YA 3OSYA 4JK6A 1TBRH 3A7WA 4ZXYH 1FN8A 1YPKH 2CJIA 2ESTE 2G5VA 3AAUA 4ZROA 3QLPH 3DSPA 2YMSC 3M7QA 2FZZA 1V2VT 1ZRBA 1O30A 1O5FH 1C5ZB 3SGQE 1JRSA 1F92A 1KTTB 4FUIA 4MDSA 1ANDA 2WV4A 4CRBA 1RS0A 3P8NA 4CH8B 5HM9A 4HTCH 1HXFH 2EC9H 2ZU3A 1OX1A 4ABEA 3MU1A 4WH6A 2PSXA 1QBOA 3A87A 2VVUA 1A3BH 2SGAA 3F2HA 2BVRH 4M9FA 4JZIA 1AVWA 3GCOA 1S0QA 5C5NA 2KX4A 1SOTA 2P3FH 3RXPA 1CU1A 5EXNA 1LCYA 4LXBH 1Z8JB 1NU7B 1QA0A 1SGEE 5EJLA 1DE7H 2F9PA 1NS3A 1DFPA 1TX7A 1N8OC 3HATH 1AWHB 2G00A 2ZFSA 3OTJE 1O2JA 1E38B 1HAIH 2ZWLH 1OOKB 2PV9B 3IITA 2QXGA 1UTNA 3P8GA 2FO9A 4K1SA 1ZHRA 1UO6A 1F7ZA 2A32A 2ZHWH 3ZVCA 1Z8GA 3B8JA 1KYNA 1O2TA 4FUBA 2WYJA 3BF6H 2C8WB 2QA9E 2O8MA 1Z1JA 1EP6A 5CMXH 1KXCA 2XC5A 1WYKA 1UTKA 4AORA 1PPGE 2W7SA 3RXLA 1Z71A 3EE7A 4KP0A 3UFAA 1YPMH 1VCWA 3ATIA 2H9HA 5FPTA 3GDVA 3OFND 3TJUA 1IQLA 5HGGA 2BD3A 2PLXA 1DY8A 8KME2 1ZYOA 3SHCH 3FZDA 2ZC9H 2J92A 2SFAA 5E2OA 1TA2A 1TMBH 5C5OA 1Q31A 4YOIA 4H6TA 2KCAA 3RXMA 1GJCB 1FXYA 4FXGH 1G32B 1H9HE 1KLJH 3RP2A 1GMDF 3U1IB 4OGXA 1GMDG 4J1YA 4I8JA 4TYDA 4VGCB 1P2MA 2P3UB 5HYOA 2QE7D 1Y3WA 4YESB 3OX7U 1Z6JH 1ZOMA 4KELA 1SKYE 1CHOF 1DLEA 3BSQA 1IQMA 1MU6B 3C27B 1MTUA 1ZMLA 2H5DA 3RC6A 3GISB 2BD4A 1O5DH 2QIQA 2Z9LA 3EQ0H 4B75A 2WSSD 8ESTE 2VGCC 1LVYA 1Y5UT 3QN7A 5EODA 5GJ4B 3N7EA 3F0PA 4ABJA 2KAIB 4ZUHA 3ZVBA 4CR9A 1QB1A 1GBFA 2J38A 5EQRA 2VIWA 3M36A 3PLKA 2Y82A 2ZU2A 1DXPA 2XBVA 3RXIA 2W26A 2PHBA 1BMMH 1CA0B 5LH8A 1NRRH 3GYMA 2AGIX 5C1XA 1T8OA 1MZAA 1NROH 3RMOH 1ZLRA 3WW7A 2ZA5A 1OHHD 1AUTC 1PPEE 2JETC 1GL0E 4E05H 1TIOA 5ABWA 1H1BA 1L2EA 3F9GA 2CK3D 1W12U 1J8AA 1YWUA 2CGAA 1SLXB 1TGCA 5L2YH 1KXDA 1ABIH 5T6DA 1IQKA 3LPRA 2FDAA 2GT8A 3SNCA 1ANCA 2AIQA 3A7ZA 2R2MB 1JWTA 2ZU4A 4YTAA 4AGKA 3PTNA 4AC9A 4OGYA 4DIHH 1AN1E 1NTPA 3RXJA 1DUAA 1NBMD 2M5TA 3CENA 1WXRA 2C3SA 3GCTF 5A2MH 3UQOA 2UWLA 1MKWH 2FX6A 1EPTB 5CHAB 3SJ9A 2O8LA 1F0UA 4AB8A 1PPFE 3RU4D 4WMDA 1SGFA 2J98B 4U2WA 1O3EA 3F9EA 4Q7ZA 1W0YH 1ZTLA 1G36A 2VWNA 1AB9B 1GHWH 1PPCE 1UCYH 5FHTA 1K1OA 1GCTB 2J9NA 4X6NA 1QRZA 1JXPA 1A5GH 8GCHG 1HAHH 2QF5A 6CHAB 4IC6A 3U98H 1ELFA 1K2I1 2VB0A 3K6YA 4LK4A 1MCVA 1O2KA 4B76A 1O3BA 1HAOH 1V2UT 1IQEA 1CT4E 1V2PT 2GT7A 2ZFPH 1O2OA 2J4IA 1C5TA 1TNGA 2Y81A 3RMLH 3UNQA 2FLBH 2B7DH 3MOCA 5BPEA 2GZ8A 3U8RH 2OINA 2TGAA 4B6EA 2OQUA 2NU4E 2Q6FA 2ZFRH 1MTNB 2JJ1D 1O5EH 4KTUA 2GD4B 1OPHB 1THRH 1P2IA 1VR1H 2ZIQH 1DSUA 1QFKH 1Z7KA 4Y6DA 3SNBA 2C4FH 1V3XA 3KIDU 1WBGB 1O2ZA 1KLTA 4UFDH 1PQ8A 2FTMA 2AFQB 1AY6H 2GGVB 1TFXA 1HAVB 3K6ZA 5EOKA 4FETA 5T6GA 1MTWA 5JBBS 2IJD1 1HDTH 1EUFA 4FUGA 2D2DA 3AASA 3FOAA 4AFUA 1EZQA 1M9UA 2ZFQH 5GIBA 5CDFE 5PTPA 3VGCB 2ZPQA 1BDAA 1DOJA 3MNBA 3SW2B 1HJ9A 3FP6E 2Z9KA 1LMWB 1BIOA 2HRVA 2XNIA 2EA3A 1A61H 1LO6A 3I78A 1EZUC 1ZJDA 5L2ZH 1O2RA 1RIWB 2WYGA 1A4WH 3A88A 1HLTH 1IAUA 4Z6AH 2ZFFH 1OP8A 1RGQA 1XVOA 5BRRE 1VCPA 3M61U 1YCPH 1H8ED 2ANWA 2B0FA 3TH3H 1O2MA 4VGCC 1E1RD 1LVOA 1WTGH 1QJ1B 1CGJE 5F6MA 1YCPM 3UY9A 3RM0H 1UK4A 4IC5A 2Y5HA 2LP6A 1RTKA 2A4RA 4WMFA 2Z3DA 4I8HA 4FU7A 2WPKS 3KNXA 3KGPA 1C2LA 1P06A 1GDQA 3RLYH 1GBEA 3M37A 1C5WB 3Q00A 3F1SB 1KXBA 3F68H 4NWLA 4O9VA 4XE4A 1SVPA 2JJ2D 1E1QD 4X1NU 5EJZA 1GGDB 4ACBA 2VVCA 1H8HD 5C0TA 4YLQH 2GCTB 1CA0C 2Z9JA 4YOGA 3ZYDA 2J34A 4ISNA 1AE8H 1C2EA 3Q3XA 1NPMA 3PV5A 2XWAA 5A0BA 3LJJA 1CA8B 2W6JD 3BTQE 1QL7A 1OS8A 1S85A 3DT0H 3GCNA 1BRBE 1GJ8B 2FODA 4XFQA 1GDNA 4A1XA 4NFFA 1JMOH 4X0WU 2SGDE 1ANEA 1C5RA 2EI6A 3BIUH 4MG3A 5FPSA 3PWBA 1LHFH 2A31A 3TK6A 1QNJA 2A45B 1LKAA 1ESAA 2BHGA 1IQFA 2V6NA 3MH7A 4XDEA 4HZHA 1V2ST 1SR5C 1ZRKA 4X6PA 1FX0B 3E1XB 2BOKA 5FBIA 2HVYB 1HAXB 1GJ5H 1BOQA 2NU0E 1SSXA 3A7TA 3FP7E 1XXFA 2ZEBA 3BEFB 3HK3B 5AF9H 1ZGIA 1FIZA 1UW7A 1BITA 1PPHE 4MPVA 2IOTA 1LPGB 1O2NA 3RXUA 2A1DB 2F9BH 2AGEX 1IQGA 1EPTC 1JIRA 2HGTH 4TT3D 5CHAC 3UIRA 1W0ZU 1J15A 1AB9C 1DWDH 1V2OT 1K1LA 5H4IB 1GBAA 1BTXA 1T8NA 4XSKU 2ZU1A 2BYAX 6CHAC 1NC6A 1ZPZA 4Y11E 3I77A 1PQAA 1TONA 1H9IE 3RXDA 3U28C 1MTSA 2PUXB 1O2XA 4Z1MD 1V2LT 1OSSA 2EEKA 2HLDD 3VXFH 2H9TH 4H6SB 1DWCH 2P95A 3TIUA 2OXSA 2XBYA 2F43B 1PYTC 1L0ZA 1T31A 3K2UA 3AW1A 1MTNC 1KLIH 1UK2A 1AIXH 1DPOA 1B7XB 1AMHA 3OYPA 2QCYA 1LHCH 1P57B 1NFXA 7KMEH 5DO4H 4FOUC 3PV2A 4DOQA 1V2JT 2QAAA 1SFIA 2B8OH 3MU0A 4NIYA 1TLDA 1AO5A 1Z8IB 2OP9A 4A6LA 4CRDA 4OS4A 2BVSH 4FU8A 4BAKB 1QGFA 5C17A 4E7NA 4FUFA 4RKJB 3NPSA 3RXKA 1O3OA 1J9CH 2DUCA 1V2KT 3HKJB 5HKKD 3LC5A 4FU9A 4NIXA 2BLVA 1FI8A 1DT2A 5I46H 2G8TA 2Z9IA 1P0SH 4TWWA 1Y3XA 1OYTH 3ATMA 1K1IA 1UTJA 3VGCC 1TQ7B 3N7DA 4YLUA 1S5SA 1XUKA 3LU9B 2C8XB 1BMLA 1YYY1 3NK8A 4CH2B 1TPPA 4ACAA 1EJNA 2C8YB 2ZHQH 5GNDA 1K9OE 1RIWC 3WWBA 3VB6A 1UJ1A 2Q6GA 4B73A 2ZI2H 3E3TA 1EB1H 1GVKB 3LONA 5E2PA 5B6OA 1Y3UA 2UUJB 1NRSH 4ZHMU 2GTBA 2FXRA 3PV4A 1O3NA 1GBCA 1D3PB 2RG3A 4X2VA 3ATKA 1KXEA 2AH4X 3Q3YA 2PSYA 4BAQB 1FPHH 1FDPA 1FAXA 1HFDA 1DUEA 4TY6A 2OK5A 1HV7A 2B5TB 1AQ7A 3P8OA 3A8DA 3KN2A 1TNIA 2VJ1A 2O9QA 1C2KA 5TJXA 1S0RA 5F53A 1FIWA 2FM2A 2YOLA 3MHWU 3FZZA 1GGDC 2G51A 2HWLB 1K22H 1O3PB 4UFFH 1FV9A 3K9XB 4XBDA 1TNLA 3RU4T 1RJXB 1A3EH 2GCTC 2F9UA 4ISOA 3R3GB 3KQCA 5HMAA 4BAOB 1GWAA 2A7CA 1YPEH 2OQ5A 2VWLA 6ESTA 1WQVH 3LGVA 3D62A 3S9CA 1GI0A 1ABJH 2IPQX 1TB6H 1YLCA 4WY3A 3T2NA 2FYRA 4AYVB 1C5MD 2WINI 2VIDA 1IQHA 1O32A 1TGSZ 1LQEA 1SGPE 1O3AA 3KQDA 1GPZA 3SNDA 1LTOA 2QC2A 1MCTA 5F8XA 3BTWE 3PYHA 4MPWA 2FPZA 1MMJN 1A46H 2HPQH 2H2ZA 1D6WA 3NCLA 3NXPA 3U8OH 2F4LA 2XCFA 1VITG 2XBWA 4AG2A 1LVBA 2GX4A 2ODQA 2XRCA 2C93B 3SJIA 3F6UH 1TX8A 1TNJA 2CF9H 2V3MA 2BQWB 2EQNA 3ITIA 1P04A 4IMZA 3URCA 3ZVGA 5K0HA 1EAUA 2Z6BD 4K5ZA 1SQTA 5EPNA 5KGOA 4D8NA 1C4V2 4NSVA 4Y7AA 5F8ZA 1UTPA 2JH5D 1VJAU 1AD8H 1XKAC 4INHA 2L6OA 4Y8XA 3EAJA 2NU1E 4ZAEA 1B0FA 4NZLA 2HNTC 3LIWA 5E0GA 3OY5U 5C2ZA 1BTYA 1EJAA 3W1EA 3ZVDA 1O2QA 1INCA 1D3QB 1KMHB 1W14U 5DP3A 3ZZAA 3T5FH 1O2HA 2WUBA 1C2HA 5CE1A 2JH6D 2PTNA 5TCAA 5F03A 3SU4A 5FBEA 2XW9A 4IS5A 4Y0ZE 2ANMH 5DP7A 1AZZA 1ZHMA 2JIZD 3GY6A 1O5GH 2J95A 3ZZ9A 2TPIZ 4TY7A 1BCUH 1A0JA 5KECA 3HPTB 2GDDA 2VINA 5A8XA 5K7RA 3QK1A 1C2IA 2BD8A 5DJ7A 1AFEH 3GDUA 5FL7D 3UTUH 1L1JA 2SGPE 1GBLA 3A7XA 1K28D 1C4Y2 2Q6DA 3VFEA 1YLNA 3F0OA 1P12E 4GUXA 2L74A 1O2IA 4X6OA 2K8IA 1UVSH 3PMJA 3SU6A 2BD9A 1GI4A 2I6QA 2ZFTA 1UTMA 4X8TH 1GMHG 5LPFA 1GI1A 1BTHH 1FAKH 3OU0A 4WVPE 1V6DA 3MU4A 4JZEH 4MPXA 2D1JA 1GBIA 1Z1IA 3AVZA 1CHGA 3KQ5A 3RXVA 1T4VH 2CMYA 1GJBB 4NA9H 1MAYA 1K1MA 2QF0A 1TMUH 5AHGH 3F2FA 1G3BA 2BY5X 4MNWA 3TITA 2Y5GA 3TNSA 1FN6A 3ZYEA 2BD5A 5A09A 1JOUB 2V0BA 1F5LA 3GY5A 1P9SA 1QJ6B 3GCHC 4INKA 4GAWA 4AGJA 4I32A 1GBDA 3TJNA 1HBTH 4JZ1A 4GHQA 1IQNA 8LPRA 1SL3A 1MQ6A 1O2GH 3LGTA 4B74A 1QCPA 1FY8E 1CBWB 2SGQE 1IQJA 1T7CA 4LZ4B 3SGBE 1S6HA 2A4QA 2FI5E 3IWMA 2FMJA 5DSFA 3M5MA 1L4DA 3B9FH 1NO9H 2D26C 2UWPA 2WUCA 5JB8S 4BANB 1SFQB 3EA8A 1C1OA 4JMYA 4RKOB 1QBNA 3LGUA 1EQ9A 4F55A 1F0SA 1J17T 4ZCNA 2JH0D 3RXCA 1BBRE 3SUDA 4BXSA 5T6FA 2BDBA 4O03A 2VBCA 2SNVA 2OCVB 1DDJA 5EG4A 2R0KA 2GV7A 1ZPCA 1SGFG 1Z8RA 1Y8TA 1F5RA 2A4GA 3SU2A 1YPHE 4KGAA 4I31A 1XUHA 3QTVH 1BZXE 1D9IA 1ZJKA 2QXIA 3UREA 2XNDD 1YF4A 4K1EA 1ZSKA 2HVXA 2ZKSA 2STBE 5DP8A 4A5TS 2ZDVH 1TAWA 2KFWA 3A8AA 1BMNH 4WXIA 4UDWH 1OKXA 2GJGA 4A1VA
chains in the Genus database with same CATH topology
1SC8U 2V3HH 4LOYH 3RXFA 3U9AH 1QA7A 3RMMH 1Q2WA 1TPOA 1QURH 4Q2KA 1SGDE 2FOCA 2VNTA 2F3CE 1SGCA 1EB2A 5JBTA 3GY2A 1C1VH 1AU8A 5E0JA 1V2WT 3Q76A 4UE7H 4ZKSU 1P05A 1GI5A 2R2WU 4K69A 5JBCS 5DP6A 4BTIB 1W2KH 3T62A 2C8ZB 4WXVA 1EP5A 1GJ9B 2THFB 1DITH 1BTUA 4NFEA 3T28A 3SV8A 3RXSA 1MKXK 1N1LA 1SQOA 1DWBH 4THNH 2ZGHA 4GPGA 1UHBA 4A1TA 4GCHF 1YPHC 4FUHA 4GCHG 4X2XA 4OS6A 2Q1JA 8GCHF 1LHDH 4B71A 5FXLA 1O3GA 1QQUA 2ZDNA 1DLKB 1MQ5A 1F0TA 5AVDA 3PMBB 4B2BA 1ZTJA 2GVFA 1YBWA 2Z94A 3NWUA 2VIVA 2YNAA 1DS2E 3KQEA 3Q3KA 2FOHA 1GI3A 1P01A 3HKIB 5J4SA 4BTTB 2OBQA 2FOGA 1RRKA 4H42U 3SQHE 4AFSA 1S83A 2RA0A 2ODYB 1VZQH 4AZ2B 2TGDA 2BVXH 5DP9A 3ODFA 4HI3A 2QF3A 2W5EA 1SLVB 2WPMS 2B9LA 3S69A 4I8LA 1TA6A 2BQ6B 3VB7A 1TALA 1GJ7B 2BTCE 1C2MA 1SLWB 1O33A 1LKBA 5DP4A 3MFJA 2ZCLP 1C5UA 2IPHA 4BOHA 1TYNA 2PGQB 2FS9A 2RCEA 3BV9B 1A5HA 2PGBB 4INLA 3UWJH 3ZZBA 1CVWH 4ABHA 2Y5FA 4Y10E 5A8ZA 2CF8H 2BZAA 4E7RG 1W13U 2AIPA 5GWZA 3B23B 2BXTH 2PKSC 3SUEA 1BJUA 2FESH 2TBSA 5EXLA 3PLPA 2ZDAH 3H7OA 4DY7B 1B5GH 1CBWC 4K8BA 1K1PA 1BBRK 1F0RA 1LHGH 2H6MA 1K21H 1THPB 2SNWA 3M3SA 1UTOA 5A0CA 4Y71A 2PW8H 3D65E 2BOHB 4WJG2 3CP7A 1SGYE 2CHAC 2GP9B 3LOXA 4CR5A 1C1WH 1TNKA 1LPZB 1V2TT 3GY3A 1G3DA 2BX3A 1O2VA 2ZQ2A 1GHAF 4NSYA 5IYTA 3UR6A 1GHAG 3MH6A 1MD8A 3P95A 3GY8A 2VH6A 4XBBA 5LGOA 1YPGH 1QY6A 1ZPBA 2VIOA 4K8YA 3RXGA 4OS2A 1GJ6A 2BY7X 3CS0A 1GHYH 4XBCA 1E35B 3C1KA 2F91A 4FVDA 3SOSA 1LVMA 3A84A 3ATWA 3SUFA 5EPYA 5JYIA 1AUJA 4DJZB 3P17H 4ZXXH 3MNCA 1JRTA 4ISHH 1FY1A 2ILNA 5C1YA 2G4TA 4U32A 1W7XH 5EW2H 1FQ3A 1KSNA 3G01A 1OP0A 1THSH 1T4UH 3S9AA 3W94A 1ELVA 2AGGX 1TGNA 1SPJA 1FLEE 3E0PB 4MNVA 2AMQA 1PPZA 1XUIA 1A1RA 4FVBA 1NZQH 1V2QT 5ESBA 3RMNH 3UOPA 1TGBA 3M35A 3QGJA 4CBNA 1HNEE 4CREA 1L1GA 2G55A 1OYQA 4Y8YA 2ZCHP 1SHHB 3SO3A 3DFJA 1GBMA 2O8TA 1TX6A 1LQDB 4D76A 2EI7A 4K60A 4Q7YA 4MLFB 1C5OH 1TOMH 1TGTA 3SV9A 3SJKA 1C5YB 4UEHH 1NFUA 1HB0B 1H4WA 4OS5A 4M7GA 2Y7ZA 1TWXB 4O3TA 5EQQA 2BM2A 1YM0A 5DGJA 2XTTB 5GPIB 1XX9A 1P2JA 3E0NB 2UUYA 4BNRA 3RXBA 1C9PA 1C5SA 1GBTA 2Y80A 1JIMA 2FI3E 3PMHB 2FOEA 3P8FA 4MQAA 2A5AA 1MU8B 2BDHA 1TBZH 3A85A 2BLOA 3BIVH 4E06H 2XC0A 3URDA 3MH4A 3A7YA 1LDTT 1W8BH 1SGNE 1P3CA 4TPYA 4FUDA 1HJAC 4ZHLU 3EGKH 1CT0E 3LH3A 1HUTH 2NU2E 2QXHA 3PM3A 2W3KA 1JBUH 4CHAB 4WWYA 3QO6A 2Z3EA 4D9RA 2A7JA 3DD2H 2AERH 1GI6A 3QZRA 1FMGA 1A0HB 1K1JA 1GBBA 3QTOH 3ZV9A 3MO6A 1P03A 3OY6U 4IN1A 3FFGA 3KQBA 3AW0A 1UHBB 1IHSH 1C4U2 1KY9A 1P11E 2P8OB 3V12A 1O3HA 1AVXA 1P2KA 3ATLA 2VVVA 1PQ5A 2ZPRA 3SQEE 3SU5A 4B2AA 4DURA 3V7TA 1NY22 2SGEE 3ZZDA 3STIA 1MBQA 3TH4H 3MO3A 1SG8B 4O97A 3LH1A 3PROA 2Y6TA 2XC4A 1WAYB 4MTBA 3L33A 2BY8X 2ZZUH 1QRWA 2QGRA 3GCHB 1DY9A 1O2YA 2WV5A 4ZKRU 2PWXA 3EE0B 2GKVE 3TGKE 2IJOB 1CSOE 1GVLA 3S9BA 3UOUA 1NRPH 4ABIA 1GBJA 1O5BB 4SGAE 4RN6A 4K3JA 4ISLA 1O35A 3GY7A 4UD9H 2WPLS 5DP5A 2R0LA 4DT7B 2YNBA 3PMAB 2CXVA 2FOMB 2ZP0H 1FONA 3GYLB 2ALPA 1AKSA 5I25A 4F49A 5JPMH 4YT6H 3CS7A 1KIGH 4GVUA 1HYLA 3QUMP 1EAIA 1Y3YA 1ZHPA 2FTLE 2ZDKA 3U69H 1NN6A 2HNTE 2ZQ1A 2NU3E 3EDXB 1Q3XA 4DIIH 1GDUA 2ZHFH 4MVNA 2HOBA 1TABE 1UVTH 1BA8B 1K1NA 1C9TA 1QB9A 1SGQE 3KEEA 4B1TA 3BTTE 2QY0B 4KTSA 4CBOA 1TQ0B 2OLGA 1FNIA 1TMTH 3BTDE 1FY3A 1T32A 3E6PH 4RSPA 3QX5H 4NZQA 1EAXA 2CV3A 1E0FD 3PB1E 4CRCA 1KDQA 3QZQA 3KCGH 3O8CA 1SBWA 1TNHA 3F9FA 5DPAA 3LGWA 1VITF 2FLRH 2QYIA 1V2NT 1GHZA 3SV6A 1GHXH 2F9OA 1H9LB 4B2CA 3O8DA 1EATA 1QIXB 1CGIE 2A2QH 4NA7A 1DANH 3A8BA 3SI4H 3DFLA 4X1SU 2NWNA 3GDSA 3LGIA 1SGRE 2C90B 3U1JB 1UMAH 1O3IA 1BRUP 2BY6X 2ASUB 1O3JA 5GXPA 5GCHG 1HIAA 3I29A 4I33A 3SU0A 1MKXH 1G3CA 2XYAA 1DM4B 3SNEA 3UNSA 3UUZA 4GLYA 3RXAA 2P93A 1ARBA 2VIQA 2AMDA 4JK5A 1ID5H 4YZUA 3TLOA 4ESTE 1BTWA 3P92A 2G4UA 1GJ4H 3VEQB 1N6XA 3V13A 4D7GA 1T8LA 2UUFB 5DKMA 2A0QB 2ZPSA 1QTFA 1MBMA 2XWBI 5AFYH 3MO9A 2RA3A 9LPRA 2WPIS 3VB5A 2ODPA 2XBXA 4U30A 3GOVB 4MNXA 2QXJA 3A7VA 1SLUB 4X8SH 5FPYA 1ELDE 2TIOA 1CE5A 3ODDA 4CHAC 3PLBA 1HRTH 1EOLA 1AHTH 1HAVA 3VXEH 1HAYB 3HGNA 3V0XA 1W7GH 2OBOA 1L4ZA 3E90B 2VU8E 3UNRA 1IOEA 1ORFA 1OWJA 3S7HB 3MNXA 2A7HA 2Z9GA 1GMHF 4AOQA 2QV1A 2P8OC 1ZTKA 3TH2H 3SJ8A 2UWOA 4IMQA 2D8WA 2O8UA 1MH0A 2R3YA 3IG6B 3TU7H 1YGCH 3MI4A 4HGCA 3MNSA 2F9NA 4JZFH 2GZ7A 3BG4C 1FUJA 3ZVEA 5HM2A 1T8MA 2P94A 3ZZ6A 2OTVA 2PTCE 4OS1A 4WF8A 5G4BA 3MYWA 1YP9A 2HNTF 4DGJA 1UTQA 4WH8A 2H9EH 1XKBC 1C1SA 3FANA 1O34A 1C1MA 2V35A 2P16A 2PKSB 3NKKA 1NRQH 2WPHS 1O5AB 2Z7FE 5EW1H 1RTFB 1BBRH 2BDIA 1GBHA 1WSSH 1DICA 1MTVA 1WTHD 5EU8A 3RXRA 4AX9H 4AYYB 3H5CB 1P3EA 4UONA 5IDKA 3DHKH 4YOJA 1C5PA 1U6QA 4OS7A 2W3IA 2DE8A 1AZ8A 2EI8A 1BMAA 1UVOA 1W3CA 2CHAB 4HFPB 5LPEA 2FOAA 4UFGH 1A5IA 4AG1A 4NG9H 1AWFH 2OC0A 2HLCA 1DX5M 4UFEH 2BLWA 2RDLA 2GMTC 1ZSLA 3DA9B 3TGJE 5AFZH 1AI8H 3UPEA 3PO1B 3ZZCA 4ZH8A 3MH5A 2ZNKH 1HXEH 1TRMA 3HGPA 1S81A 2VIPA 1RXPA 1CHOG 3BTGE 1CGHA 4F4OC 1BRCE 1RTLA 3ZZ7A 2O8WA 2STAE 1GHBF 1OXGA 1QL9A 1WQSA 1GHBG 1QR3E 1KXFA 3M5LA 4AFQA 4YM9A 5JB9S 1TRNA 2BD7A 1MZDA 4IW4E 1AKSB 1O5CB 1G2LA 1BUIA 2ZGBH 3NUMA 3TVJB 4NA8A 3SU3A 3FP8E 1UTLM 2AS9A 1DVAH 1ARCA 3ZZ3A 2OUAA 4A7IB 1HAGE 9ESTA 3QWCH 1F5KU 1CQQA 5ESTE 3LGYA 1XM1A 1QJ7B 1ZR0A 2PUQH 3BTEE 4R8TB 3M5OA 1HAZB 2ANKH 2FS8A 3S7KB 3BTME 1YPLH 2AYWA 1QQ4A 1GG6B 1WUNH 1AFQC 1C2JA 1O2PA 1P2QA 1C1NA 4ZMAH 1HAPH 5L6NH 2R3UA 3SZNA 4YO9A 2BZ6H 5FX5A 1KDQB 2ZDMA 1XXDA 4K2YA 1Y5BT 3JZ1B 5LPRA 3MTYA 4AN7A 4FUCA 3RU4E 2ALVA 4JZDH 2ZCKP 2AEIH 4YT7H 4CRAA 3RLWH 1WCZA 4I8GA 1GI2A 5SGAE 1QHRB 4D7FA 1GVZA 5A8YA 1BHXB 2BMGB 3GCTG 4KKDA 1ACBE 2V3OH 1XMNB 1ZMNA 1C2GA 3Q77A 3SV7A 3SU1A 3RXHA 2OC7A 1E37B 1HJAB 5C1UA 2XXLA 3O8BA 1X7AC 1SQAA 1NFYA 1HIAB 1OWDA 2P3TB 2BDYA 1UVPA 1EOJA 1Z6EA 5FAHA 2FIRH 2ANYA 2BDAA 3TPIZ 4MNYA 1O3FA 1SOZA 2IN2A 4GHTA 4QT8C 4Y0YE 4BTUB 3P70B 4K1TA 3ZZ5A 1L1NA 4XOJA 5JBAS 1A2CH 1TPAE 2ZHEH 1AE5A 2OC8A 1ELBA 3BN9A 2G5NA 1V2RT 3DUXH 4AFZA 2ZDLA 1GI7B 4WMEA 1RD3B 1UCYE 1YKTA 2LPRA 3VB3A 2W7UA 3UQVA 5FX6A 1GMCF 2OD3B 2VWOA 3EYDA 1GMCG 1EZXC 5J4QA 4X2YA 3N7OA 1O31A 3A83A 1SHYA 4O3UA 1GJDB 2BD2A 2UUKB 2ZO3H 1HCGA 3E91A 3FAOA 5TCCA 1EZSC 3GY4A 5A0AE 2QN5T 2P59A 4ABFA 4X1QU 3ZZ4A 3RDZA 3ZVAA 1GJAB 2BQ7B 4X6MA 1ETSH 4GSOA 2PKAA 3BTKE 3R0FA 1VCQA 1BQYA 2WPJS 3KL6A 3RXEA 3TJOA 3MU5A 3BEUA 1UK3A 2F83A 1O36A 5C3NA 3A89A 3K65B 2A4OA 5GDSH 2SGFE 3RUOA 1TRYA 2DE9A 3PWCA 3PO1C 3TGIE 2HPPH 1CT2E 1TPSA 4NIWA 1ETTH 4Y7BA 1D6RA 7ESTE 3NZIA 3O8RA 1AVGH 1AGJA 1OP2A 4Y79A 1FPCH 1DXWA 1CO7E 3BG8A 4IGDA 4X8VH 4JYUH 3BTFE 1TBQH 1BB0B 1O0DH 1NESE 1OWIA 2PR3A 3QGNB 4JCNA 1O3CA 2GV6A 4ABAA 1XVMA 4CRFA 2BX4A 1EJMA 1EXFA 1ELEE 4FUEA 4JYVH 4Q80A 5DG6A 3A86A 2ZTYA 1GCDA 1C5NH 2ZF0H 3RXQA 1P02A 4IBLH 2ZHDA 1SB1H 5C67A 2GZ9A 2BB4A 1E36B 1S82A 5JDUB 4TPIZ 3A8CA 2ZGJA 1EASA 2BY9X 1C5LH 3MWIU 1QRXA 4NCYA 5EXMA 1BTPA 3GICB 1ELCA 4I7YH 1VITH 3MMGA 3M7UA 4R0IA 4D9QA 1PYTD 1P09A 1O3MA 3E16B 3PTBA 1GG6C 1HPGA 3A80A 3HK6B 1VGCB 1PFXC 1MUEB 3M3TA 2A5IA 1GI9B 3ESTA 3P6ZB 3BEIB 1C5VA 1KXAA 3ELAH 1YC0A 4FUJA 1C1PA 2A2XH 1NRNH 1ETRH 1BTZA 3A82A 2BLQA 1B0EA 1C1RA 1G30B 5E0HA 4X1RU 4U01A 5L30H 3EA9A 1ANBA 1H8IH 3T27A 1YPJH 1D3DB 4Y8ZA 3M7TA 3VPKA 1EX3A 1O3DA 2FP7B 4I8KA 2BDGA 1F2SE 4ABGA 1P9UA 5HXFA 3V3MA 3RXTA 4DVAU 4MPUA 3SUGA 1MKWK 3SV2H 3LKWA 2F9VA 1WOFA 3TK9A 1QBVH 1GCTC 1WV7H 1P2OA 1E34B 2PFEA 5T3HA 2FYQA 3JZ2B 1GL1A 1UCYK 1G3EA 1MD7A 1O2LA 3LDXH 2ZGXH 4ZKOU 1XUFA 1P8VC 4NWKA 3ZZ8A 3T29A 3L3TA 4DW2U 3D49H 4X1PU 1QL8A 2BDCA 2FX4A 3TNTA 1RFNA 1ZSJA 5C20A 3AAVA 2J2UA 4ZHAA 1G37A 2FEQH 1HJ8A 5DK1A 3FVFB 1BRAA 1SGIB 3S0NA 1XUGA 1FY4A 1N8OB 3BG4B 1C5XB 2A5KA 1C1QA 4DCDA 1FY5A 3SNAA 3ZVFA 1GI8B 4ZKNU 3QDZB 5EQSA 5FCKA 1GHVH 2VH0A 4TWYA 1PPBH 2TGPZ 3RC5A 2ZTZA 1O2WA 1C2DA 1PQ7A 3SGAE 3UR9A 2BXUH 1NM6A 1TE0A 3D23A 2Y7XA 1KTSB 4ABBA 1ZZZA 3T25A 1J14A 2TGTA 2ZECA 3F9HA 2ZG0H 1DSTA 1HGTH 4JYTA 4NGAH 7GCHF 2FOBA 2K1QA 1BHXF 2GCHF 7GCHG 3LT3A 1V2MT 4ABDA 2GCHG 1H8DH 4IN2A 4X8UH 2CN0H 2KAIA 4BAMB 3U8TH 1Y59T 1D3TB 1ZGVA 1W11U 5F8TA 1W10U 1G9IE 3BTHE