1PQAA

Trypsin with pmsf at atomic resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
224
structure length
223
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Trypsin Revisited: CRYSTALLOGRAPHY AT (SUB) ATOMIC RESOLUTION AND QUANTUM CHEMISTRY REVEALING DETAILS OF CATALYSIS.
pubmed doi rcsb
molecule tags Hydrolase
total genus 51
structure length 223
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pqaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pqaA01
1SFIA 2A2QH 1XUGA 3EGKH 1LQDB 3H7OA 2D8WA 5FX6A 1P03A 1TGSZ 1GI7B 1K1LA 2PTCE 5AFYH 2Y7ZA 1HIAA 2AMQA 1N8OC 3P8FA 2WV5A 1GCTC 1O38A 1P12E 2VVUA 1C5UA 3P8OA 1A5GH 2C8YB 1THPB 1ESTA 3UR6A 3M3VA 2VVVA 3RUOA 1SQOA 3U69H 6ESTA 2A4OA 4NZQA 1AQ7A 1CT4E 5DP8A 1AWFH 4AB8A 4O3TA 1H8IH 1LQEA 1TGTA 4MQAA 1FN8A 2XBXA 3TU7H 1TBRH 4DT7B 1MQ6A 1A3BH 2ZA5A 1DM4B 4JYUH 1KXAA 1DUAA 1TALA 1T8LA 1ID5H 2NU2E 2VWMA 2R0KA 1NRPH 1O2ZA 2BDAA 3VEQB 1UTMA 2BDYA 4LK4A 4CBOA 1RGQA 1SOTA 4J2YB 1EOLA 1SOZA 1GI6A 4WXVA 1QTFA 2XRCA 4UFDH 1TNJA 2O9QA 1P2KA 2ZCLP 4BTUB 1T8NA 2O8UA 4F4OC 2HNTE 3L33A 1SL3A 1GBFA 2SFAA 3ZYDA 3UY9A 2QC2A 3SQHE 4LZ4B 3I78A 2R3YA 3W94A 2B8OH 2Q6DA 3ZVFA 3LGYA 1A1RA 2ZDKA 3A8CA 4UDWH 3SHAH 1P04A 3LH1A 1FAKH 1GDQA 4BAOB 2SGAA 1HAVA 4X2XA 2UUJB 1SQTA 1HUTH 2FX6A 3GYLB 3QZQA 3BTDE 5K7RA 1EPTB 1YBWA 3M37A 2BX4A 1O2JA 4YM9A 3SNCA 3T2NA 1O3LA 1WUNH 5T6GA 4B73A 4ZROA 1O2QA 2VIDA 3NWUA 1O5GH 2AMDA 4INLA 1O37A 3UOPA 1KLIH 3URDA 1CA8B 3PROA 2QXJA 3MU1A 2J4IA 3QZRA 1V2OT 2A5AA 1GI1A 4CBNA 4IMQA 3TJUA 4Y76A 5A09A 2BQ6B 1P3EA 2ZKSA 2ZU2A 4Y8YA 3E91A 4WH8A 2ZZUH 1GHWH 5SGAE 1B7XB 1QR3E 2ZFQH 3LU9B 1ELTA 2RA3A 1D3PB 1AZZA 3SU5A 1TLDA 3UTUH 3ZZ4A 3A87A 2V3OH 2BVSH 1HYLA 2J95A 1GI2A 1FMGA 1P2MA 4K8BA 4KTSA 1C5VA 2BOHB 1DT2A 1NESE 1SBWA 4DIIH 1SGYE 5JDUB 4AFQA 1V2JT 1F5KU 1B0FA 2W7UA 1UCYE 1QJ1B 1ZSJA 2AERH 3MH5A 3RMNH 3SGQE 2CF8H 1ELVA 2PGBB 1SSXA 2Y6TA 1TQ0B 4Z6AH 1Q3XA 2JETC 1C5NH 1AHTH 2BYAX 1GG6B 1D6WA 4QT8C 3VB6A 3E6PH 1TMTH 3OY5U 4IGDA 5E8EH 1GBJA 4GCHF 2FS8A 3M7QA 2ANYA 5DP6A 2EA3A 1NFXA 5EG4A 1FQ3A 1UVTH 2ZGJA 3KQEA 1EZUC 3ZZDA 2PUXB 1DWDH 1YPKH 2HOBA 1NFWA 4ABFA 1CE5A 1CGJE 4F49A 1C5SA 1YLDA 2RG3A 4AGKA 2UUKB 5EQRA 1NO9H 2FOCA 1PYTD 2R2MB 2AIPA 1GI8B 2OC0A 5HM2A 1EOJA 1LPKB 1EAIA 2HNTF 1BDAA 3OX7U 1P9UA 3QWCH 1WOFA 1FV9A 2C4FH 3RU4D 2RDLA 1EPTA 3S9BA 2ULLA 1W10U 2F91A 7ESTE 5I25A 3SU0A 2PV9B 5DK1A 4NA7A 1HAOH 1C1SA 3V0XA 2UWPA 5EPNA 1B5GH 2QGRA 4MNXA 3U8TH 1OYQA 2WYGA 1MD7A 2BD2A 4MPWA 2QCYA 3OTJE 2H5CA 3UPEA 1IHSH 1SMFE 3SV2H 1SG8B 1AE5A 4X1NU 1O2PA 1V2WT 5DPAA 3RC6A 3SNDA 1RIWB 2VU8E 1AVWA 3Q3XA 2ZHFH 1XX9A 2A7JA 1ORFA 1BB0B 1ZMNA 1KTSB 1ZSLA 1TIOA 2FOGA 3HKJB 1W7XH 1N1LA 8ESTE 2ESTE 2W5EA 2NWNA 4Z0KA 4YOGA 1DLKB 1TMUH 2STAE 1Z6JH 3QTOH 1TBZH 2GTBA 3SZNA 2OC1A 1Z8GA 1C5MD 1N8OB 1TGNA 4ASHA 1N6YA 1UK3A 1GCTB 2QN5T 1BRUP 3M3SA 3M7TA 2PSXA 4D7FA 1BZXE 1PPEE 3TJNA 4CRDA 1Y8TA 4UD9H 4HFPB 1BTWA 1SGPE 2GCTC 1PJPA 2GVFA 1D3DB 3QDZB 1EAUA 2B7DH 4ZKOU 1T32A 1CT0E 2OBOA 1TPPA 6GCHG 7KMEH 5FAHA 1AKSB 2I6SA 2Z3EA 1UCYK 3BEIB 2A4GA 3RMMH 1A5HA 4NA9H 3M61U 1OSSA 2GKVE 3HGPA 2FESH 3BTKE 1SQAA 1A2CH 4O97A 1DICA 1SPJA 1OP0A 5CHAB 3O8DA 1QIXB 2J9NA 2Q1JA 1IOEA 3LT3A 4K2YA 2FOMB 3SJIA 3V7TA 3A7XA 1ETSH 3SU1A 3ZZAA 4ISLA 2FO9A 2GP9B 1Z8JB 2F9UA 4IMZA 1H9LB 5DG6A 1LHCH 3SORA 5C1UA 1O5EH 1A46H 5FBIA 2ZO3H 1XKBC 1B0EA 1E0FD 3P8NA 2XC0A 3VB3A 1O2HA 2WINI 5TJXA 3UNSA 1BA8B 2O8WA 4Q7ZA 2G00A 4Q80A 2V35A 7GCHF 2ZNKH 1DSTA 1DXWA 3LKWA 2VIPA 3T29A 4SGAE 4I8LA 1DOJA 1ELAA 1TNGA 1SGTA 3QUMP 4X2VA 4IS5A 4IW4E 1SLXB 4GAWA 1JRSA 2SNWA 1ARCA 5E0JA 1JXPA 3MU5A 3ZVCA 1HJ9A 1C2MA 1DUEA 5GCHF 1H4WA 2IN2A 3A7ZA 4YOJA 3W95A 3RU4T 1OWHA 1ARBA 1BBRE 3URCA 2ZU1A 1O33A 1WQVH 4BANB 1C9PA 1XMNB 2Z3DA 4IN1A 2FIRH 2STBE 3KQCA 5JYIA 2J94A 3ZVAA 1DX5M 4E06H 3U8OH 1QBOA 2WPIS 1E38B 3UWIA 1ELDE 4X6OA 5L6NH 2GV6A 4JZDH 1O3EA 2ZHEH 2FOBA 5C67A 3G01A 1THSH 1ELEE 1CT2E 3QO6A 5DP5A 1RJXB 3M35A 1A0JA 4DW2U 2HGTH 1TE0A 1MBMA 2W26A 2FXRA 5E2OA 4X8VH 2GZ9A 5GXPA 3SV9A 1IQNA 3ZZ8A 3SV8A 3PTNA 3ZVBA 1GMDG 1S5SA 1JMOH 3RXJA 1H9HE 2J38A 1AKSA 1L2EA 5GPIB 3LGUA 2YNAA 5DO4H 2HPQH 3A84A 1DANH 4YZUA 2FLBH 1Y3XA 1MKXH 2C8WB 1TOCB 2JETB 3DFJA 1V2NT 4Y0YE 1O2UA 1HRTH 4TPIZ 4U32A 3T26A 1O2VA 1FUJA 3FVFB 3LDXH 3S0NA 4TPYA 2ZU4A 2NU0E 2Z9IA 5K0HA 1GHXH 3ATLA 3ZVDA 1SGFG 5T3HA 1HXFH 1IQJA 1ZTJA 4ABBA 1O3HA 1CHOG 1ZHPA 2ZTZA 2F9BH 2P3TB 1EATA 4FUBA 1TRNA 3LOXA 3RXDA 4JK6A 3M36A 1C2HA 1ANEA 1NRSH 2TGAA 2FOHA 4PROA 3FAOA 1WCZA 4TWWA 1TRMA 3PWBA 1NTPA 4WMDA 1IQIA 1RTLA 3QX5H 1C1PA 2ZCKP 1GBTA 1W12U 2EI6A 7GCHG 1RD3B 1A0LA 2FTLE 1UVOA 1Y5BT 3Q3YA 3AASA 4INHA 2V0BA 5B6OA 1BRAA 4FUIA 2PLXA 2BB4A 2WYJA 2B0FA 1NC6A 3AAVA 5JPMH 2AGGX 2BHGA 1ZTKA 2R0LA 1A3EH 9LPRA 3FZDA 4THNH 4YTAA 1ZHRA 3ENSB 1X7AC 1YPMH 1HJ8A 1UMAH 5A8ZA 1IAUA 5AHGH 4JK5A 1AU8A 1O0DH 3MO6A 3TH3H 1GPZA 1T7CA 4DGJA 1S84A 1GBDA 1BITA 2ANKH 4RKOB 1FIWA 1SGDE 4UFFH 4FUFA 5F6MA 3RP2A 2DE8A 2FTMA 2BLOA 1K1NA 1TPSA 1EZQA 1SFQB 4XBDA 3EA7A 5EXNA 1TMBH 5E0GA 1GG6C 1FY3A 1K1IA 3GDVA 2ZQ2A 1QHRB 3RU4E 2NU4E 1SHHB 2EC9H 3D23A 3KQDA 4NG9H 2UWOA 4FVBA 3RXFA 1TABE 1SGFA 4I33A 5JBTA 1UHBA 2GCTB 4RSPA 3ZYEA 1IQMA 3SHCH 3U98H 1UK4A 3LGVA 1IQEA 1QBVH 3MTYA 1JIRA 1GJ4H 1Q31A 1KXCA 3KCGH 4BOHA 3ELAH 1MUEB 4ZHLU 2D26C 4H6SB 2Y82A 5DP7A 3C1KA 3SJ9A 5BRRE 2BD8A 4JYVH 1FAXA 3TK9A 1D4PB 3ATIA 1LHEH 2CGAA 3B9FH 2A45B 1E35B 1J8AA 2GZ8A 3CP7A 1UTKA 4FUDA 3N7OA 3E0PB 3SOSA 1VITH 2ZCHP 2ZDAH 1XKAC 2BDBA 4CR9A 5LPRA 1ZR0A 1C1MA 3U1IB 1SLWB 2TGPZ 3NPSA 4HTCH 3BV9B 1O2OA 3EA8A 4MDSA 1FN6A 2ANWA 3D62A 4JYTA 1YKTA 1O3MA 2PTNA 2GDDA 5EOKA 3PMHB 1MQ5A 2C8XB 2AMPA 4NIWA 1MKWK 3PO1B 3MNBA 2BTCE 4AGJA 1C1UH 1O3DA 1BOQA 3V13A 3UOUA 3B23B 1BIOA 1XUFA 1GJDB 3EA9A 3RC5A 3AVZA 1FIZA 8GCHG 2HLCA 3KQBA 1OKXA 2H1UA 4ABIA 1YCPK 1YPJH 2BDIA 2TPIZ 3DT0H 2AYWA 1O31A 2HWLB 4I7YH 1K1OA 5L30H 3ATWA 3KNXA 3UNRA 1O35A 5HMAA 2P8OC 3LC5A 1SGIB 3GCHC 3A83A 1S83A 3A82A 5T6DA 3MI4A 4NCYA 3A7VA 2F9PA 3SJOA 1YCPM 1W14U 1PPCE 4H4FA 4ABJA 4DCDA 4UEHH 2VINA 1G3CA 4Y6DA 5PTPA 3U9AH 2XNIA 3RMOH 1VJAU 3FP8E 1C5OH 2K1QA 1UTLM 3IWMA 1O2TA 4KKDA 1BTPA 2V3HH 1O3CA 4DG4A 2AFQB 1VITG 1DITH 4NSVA 4FU7A 2R9PA 4D9QA 5GWZA 4MNWA 1PQ8A 5CHAC 1P9SA 1HAXB 4TYDA 2XC4A 2XYAA 3LGWA 1A7SA 1MMJN 3JZ1B 1EB2A 1O3BA 3BTTE 4OS6A 1O3AA 2DE9A 4XBBA 1L4DA 1BJVA 2ZECA 5FBEA 1PPBH 1ZRKA 1FONA 4FUCA 3RXAA 5EW1H 1EX3A 1NS3A 3P95A 3SNBA 1CHGA 4GLYA 1Z71A 2ZC9H 4ABDA 4NFFA 2QXIA 4UE7H 3ZZBA 5C3NA 1UTOA 1QURH 2GDEH 4R8TB 4ISNA 2ZP0H 4MNYA 1BT7A 3T5FH 5EPYA 1BQYA 1DPOA 3P70B 1VCPA 5EGMA 4A5TS 1GHYH 2XW9A 1MTWA 1V2LT 2ZGBH 1KIGH 2QV1A 1WV7H 1TX6A 1XXDA 1J16A 2ZHDA 1KY9A 2AH4X 3M3TA 2ILNA 3RXSA 1G3BA 2JH5D 1ELBA 1YYY1 1M9UA 1PPHE 3MYWA 1OWJA 3CENA 3MHWU 1QB9A 4MG3A 1TNLA 1TA6A 1MTNC 1S6HA 1QBNA 2ZG0H 9ESTA 2GCHG 4ISHH 1DY9A 3AAUA 3ZVEA 2O8TA 1EZSC 4Q7XA 1DS2E 1O5CB 3PYHA 5FHTA 3M5MA 3UWJH 1GJCB 3QK1A 1FZZA 3RXLA 3UUZA 3MH6A 4CHAC 1L4ZA 3JZ2B 4TWYA 1Y59T 3RXMA 1SC8U 1HLTH 1THRH 3TPIZ 1NU7B 4JZIA 4NGAH 2F9VA 4X1RU 4I31A 1BJUA 1KLTA 2VVCA 2BDCA 1DLEA 5HXFA 2PKAB 2ZFSA 5GIBA 1HAZB 6GCHF 1GCDA 4RKJB 4ZAEA 2ZEBA 5A0BA 1F5RA 1AE8H 1O5DH 1ZSKA 4CR5A 3S69A 2SGFE 4K60A 2BXUH 5I46H 2AGIX 3E1XB 3LJJA 1J14A 1BRCE 3ITIA 2G5NA 1NPMA 1QRZA 1RFNA 5F03A 1S81A 1C2GA 1HFDA 1HNEE 3RLWH 3O8CA 3SI3H 1C2JA 1GHBG 1OOKB 1RXPA 1DVAH 2IOTA 2G52A 1O2GH 1K28D 4FUEA 4WXIA 5AFZH 2BD5A 3HATH 1PQAA 1XM1A 2FOEA 4CH8B 2FODA 5JB9S 3BEFB 1ETRH 1XUJA 2A4QA 3BTFE 1SB1H 1QRWA 3PWCA 4GHQA 3A85A 1C2IA 4JZFH 2FPZA 1AVXA 3OSYA 4HGCA 1BHXB 1GJ7B 2FDAA 4X0WU 2EI8A 1SLUB 4XE4A 4Y10E 1OWDA 1FI8A 1XXFA 2XBVA 5EXMA 2ZDMA 4NWKA 1SHYA 4D76A 2RCEA 3RXUA 2Z9GA 3MNSA 4KGAA 1PQ5A 1BTHH 2H6MA 1WTHD 3GY4A 1V2PT 2BM2A 2FI4E 3K65B 1WSSH 1OPHB 3PLPA 1ZGIA 1G3DA 3RXCA 4A1VA 3HKIB 4Y79A 3GDUA 1OYTH 4Y11E 2G4UA 1TGBA 2M5TA 4X1SU 1SR5C 2SGEE 4WH6A 8KME2 3LH3A 2TGTA 1MH0A 2C93B 1MBQA 2WPLS 2FOFA 2VWOA 1K9OE 1P2NA 1TNIA 3MNCA 1Z6EA 2XCFA 1WAYB 2GT7A 1HAIH 1CBWC 1P2IA 4M7GA 4ZHMU 3RXGA 1PQ7A 5DP9A 4K69A 3SUEA 4AX9H 1TYNA 1F0SA 1MCTA 1RTKA 3MO3A 2ZDVH 2W3IA 1AI8H 1KXEA 1P2OA 2BZAA 3M5NA 1LVYA 2BY6X 2PKAA 2Z3CA 1GBKA 2P8OB 2VH6A 1J9CH 3GCHB 1GMDF 1YM0A 1SGCA 1O32A 1C2FA 4ZKNU 1ABJH 1OP2A 4OS2A 1T8OA 2PKSC 3LPRA 3F9GA 1LHFH 2Z9LA 1GDUA 1Z1IA 3BTME 5F8TA 5DP3A 2SNVA 1MD8A 1HBTH 2A7HA 4WF8A 1SGQE 5G4BA 1HDTH 1YPHC 3ATMA 4U2WA 5DP4A 2XC5A 4X6NA 4B2BA 4MLFB 1C2KA 3ODFA 3SU4A 4FUJA 5ESTE 2THFB 1LHGH 2P59A 2Z7FE 4CH2B 3SBKA 1CHOF 3PM3A 2G51A 1O2NA 3AW0A 1GGDC 4XBCA 5JBCS 1YLCA 4MNVA 5A0AE 2YOLA 1UTPA 1IQGA 1OP8A 1ZHMA 1HAGE 1L1GA 1IHTH 4KTCA 1F2SE 1AFEH 1ZOMA 3M5OA 3NKKA 1FNIA 1L0ZA 4A1TA 3Q76A 4R0IA 2A31A 2XWBI 5DJ7A 2J92A 1J15A 1EP5A 1DY8A 3PO1C 2XCNA 1VJ9U 1YGCH 2BY9X 1UCYH 1P01A 2HALA 2B9LA 4DURA 4K1TA 4XDEA 2CHAC 4MPUA 3STJA 1Y3WA 1Y3VA 4FXGH 1S0QA 3VB5A 1L1JA 1P2JA 1MTNB 3BG8A 2UUFB 2I6QA 4CRGA 2UWLA 3MH4A 1UTJA 3F9HA 1AN1E 2H5DA 4GHTA 3T27A 1FJSA 1K1PA 1T4UH 5FPTA 1HAPH 2OLGA 2BDHA 2ZDLA 1A0HB 2C90B 1QL8A 4CHAB 1QQ4A 1GJ6A 4B71A 4JMYA 3KL6A 1D3QB 4KELA 2QXHA 2BY5X 3GISB 1S82A 3F68H 5EQSA 1GBIA 2AIQA 3PMJA 1CGHA 4XSKU 2FYRA 3CS0A 1F0RA 1L1NA 3BTHE 3S7HB 1MZDA 3K6YA 1UHBB 3SNEA 1VZQH 2V6NA 1O2MA 2OC8A 3A89A 3O8BA 2ODYB 5J4QA 3UREA 1GHAG 1V2KT 2A4RA 5L2YH 4RN6A 1P02A 5AF9H 1GMCG 1MTVA 3HK3B 5DKMA 2TGDA 4BAHB 1FPCH 3L3TA 1C1VH 3PTBA 3SQEE 1F7ZA 1QA7A 2OQ5A 3PMAB 3U8RH 4DVAU 3SU3A 3A8BA 4MVNA 3S9AA 1QFKH 1C1QA 1KTTB 1AUTC 2KAIB 2QF0A 1AMHA 3RXOA 4FUHA 5JBAS 2AEIH 2Z6BD 5IDKA 3FANA 5GJ4B 4DOQA 1JOUB 3RM0H 3VXEH 2ZI2H 4ZKSU 1C2EA 1TOMH 5CE1A 1C5PA 3QTVH 1AB9C 1C4V2 1FXYA 1G36A 3VGCC 1Y3YA 2QF3A 1LDTT 5GDSH 3RXQA 3TGIE 2ODQA 3LJOA 4Y71A 4HZHA 3TGKE 2FI5E 3SUDA 2DUCA 3LGTA 4XOJA 2F83A 3SV6A 2A7CA 1OS8A 1LTOA 5BPEA 3LC3A 1P57B 2BLVA 1O5BB 3TITA 3ZZ9A 8GCHF 1YC0A 2FP7B 2OUAA 1HV7A 1NM6A 1LVOA 2OC7A 2GT8A 2P16A 5EODA 4GSOA 1TGCA 4WMEA 1V2RT 4ZH8A 4Y7AA 2PR3A 3GCTF 1AIXH 1UO6A 3D49H 3PMBB 3TH4H 4AG1A 1MTUA 3A7WA 3R3GB 1JIMA 5F8XA 1GBMA 1AGJA 3VB4A 1BBRK 3DA9B 3QN7A 2VIQA 1CBWB 1FDPA 4AN7A 2GV7A 1H1BA 1PYTC 3SV7A 1NY22 1F92A 1W11U 1TFXA 1ZPCA 5J4SA 1VITF 2BLQA 3A80A 1ELGA 4UFEH 4U30A 4K5ZA 1NN6A 4OS5A 2WUCA 3RXVA 3V12A 3A7YA 5E2PA 1W8BH 3KGPA 4FUGA 4X1QU 3SU2A 2PKSB 1P10A 2WPHS 3NCLA 3KF2A 3OY6U 4LOYH 3KEEA 3M5LA 2ZFPH 3B8JA 1MU6B 1VGCC 2H9EH 2TBSA 4K3JA 1NRQH 1HXEH 1C5TA 5FX5A 1EJNA 1W0YH 1DSUA 1QJ6B 1D6RA 1LKAA 3MMGA 2KAIA 2G55A 1TRYA 1GGDB 3STIA 3VB7A 1KYNA 1O2SA 3TJVA 4B76A 2SGPE 1HAHH 1GI3A 3L6PA 3MO9A 3BSQA 3TH2H 4AFZA 1P2QA 2ZPSA 1QL9A 2NU3E 3FP7E 4D8NA 1LPZB 3A8AA 1O3JA 2Y5HA 1CU1A 2G5VA 2VB0A 5TCAA 3A88A 4NZLA 2GCHF 1DXPA 1SLVB 1P09A 4AYYB 1XUKA 1O2YA 3UNQA 2SGQE 1GMHG 2FMJA 2BX3A 2RA0A 3SUFA 5JB8S 2A5KA 1EAXA 2CHAB 1PPZA 4VGCC 3VPKA 4BAKB 2HPPH 3MNXA 2VGCC 4B75A 4A1XA 1ANDA 3GY6A 1O2RA 2CXVA 3GCTG 4YOIA 1BTYA 4LZ1H 3TK6A 4BNRA 2BQWB 1O5FH 1BUIA 1HAYB 2BZ6H 1TBQH 3IG6B 2XWAA 3PV4A 1O3OA 3RXHA 1XVMA 1O3FA 3S9CA 3RM2H 4X8UH 1DWCH 1H8DH 2ANMH 2ZFTA 1QJ7B 4YT7H 3Q00A 1Y5AT 4ZKRU 4NIXA 1ZTLA 2VJ1A 1W2KH 3KHVA 2ZF0H 1TB6H 1FY5A 5F8ZA 5A2MH 1CVWH 1W7GH 5LGOA 1GHBF 1BTXA 1MKWH 3GY7A 1EP6A 1OXGA 2ZHQH 2ZDNA 4GVUA 4ZUHA 2Y5GA 3UQOA 1FPHH 3LIWA 3EE0B 2PGQB 1TX7A 5T6FA 2VNTA 2W7SA 1JBUH 1GJ5H 1YCPH 3FP6E 3GDSA 4O3UA 2HNTC 1BMMH 1O2LA 1FY8E 3C27B 4INKA 3GCNA 1ZMLA 1F0UA 2A0QB 4ZXYH 3RXIA 4BAQB 2XTTB 2FEQH 1SGEE 3PLBA 2O8LA 1FY1A 1PPFE 1JWTA 2ALVA 2AS9A 2JH0D 4MTBA 1EQ9A 3A8DA 2A32A 4Y8ZA 4X1PU 1O3IA 1RRKA 2C8ZB 1O3NA 6CHAC 4GPGA 1CSOE 4UFGH 3SW2B 1G2MA 1F5LA 2JKHA 2G8TA 1C1RA 3PB1E 1K1JA 4X2WA 2PSYA 1ZMJA 1G9IE 1ANCA 1BHXF 2ODPA 3F9FA 4AORA 3F9EA 5FCKA 3ZZ7A 5A0CA 1AB9B 1XVOA 2XBYA 4ABEA 4OS1A 3KIDU 3FFGA 3VGCB 2FZZA 1ETTH 2WV4A 1H9IE 1KSNA 1IQLA 1BRBE 1RTFB 3VFEA 3AW1A 1ESAA 1QB6A 1UJ1A 4IBLH 2BLWA 1BMAA 2FM2A 3DFLA 1V2UT 1QA0A 1SGNE 4WJG2 3RDZA 3I29A 5EU8A 2W3KA 1C1OA 4UONA 2VIWA 1XUHA 3TNSA 2F9NA 1AVGH 4ABHA 4BTTB 2QYIA 2PHBA 3F6UH 1GJAB 1OX1A 1GL0E 1P8VC 2G81E 5DGJA 2GD4B 1UVUH 1ACBE 4ISIH 4JZ1A 4WY3A 5JBBS 1TPOA 1AY6H 1ZJKA 3MU8A 4MPVA 4CRCA 1QRXA 3GY8A 3UQVA 1DDJA 1AFQC 2SGDE 2BD9A 3SUGA 1NRNH 4YT6H 3UR9A 1O2WA 1XUIA 4WMFA 1EJMA 3TK5A 1K22H 5FCRA 1HB0B 1TWXB 3RXPA 4A92A 4NA8A 3F1SB 4FU9A 1W13U 2BY7X 1QGFA 8LPRA 1QNJA 3VXFH 1OWIA 3MH7A 1GL1A 2Y81A 1LKBA 3NZIA 3P17H 3UIRA 1HJAC 2D2DA 5C1XA 2G4TA 3RLYH 1HCGA 1RS0A 3TVJB 2ZU3A 1GBAA 1IQHA 3BTQE 1VGCB 4IC6A 3EYDA 2ZTYA 3GY3A 4KTUA 1T4VH 1AUJA 2OP9A 2H2ZA 4E05H 1IQFA 2BOKA 1OWKA 4TY6A 2GGVB 4DIHH 1GI9B 3RXRA 1K1MA 4I32A 1DWEH 2ZIQH 4B1TA 5FPSA 3R0FA 1CQQA 1KXBA 1CGIE 1O39A 2Q6FA 5FXLA 2BVRH 2Z9JA 5IYTA 2OTVA 2PWXA 1D9IA 3DHKH 4OS7A 2R3UA 4YLUA 1MAXA 1EJAA 3ZV8A 2GX4A 3IITA 4X6MA 4AG2A 1NFUA 4A6LA 2Y7XA 4J1YA 4I8JA 1V2VT 3ZZ5A 4K8YA 2XXLA 2AGEX 1QY6A 4ABAA 2ASUB 2LNCA 3MU4A 2Q6GA 3SJ8A 5H4IB 2VIVA 4WWYA 4ESTE 1C5RA 2QXGA 1C1WH 3BG4C 1G2LA 3ZZ6A 2ZFFH 1V2ST 2TIOA 1EXFA 1NROH 2WPJS 2QIQA 2EI7A 1HGTH 4VGCB 3RC4A 3QGJA 1WQSA 2BDGA 2VGCB 2QAAA 5ESBA 1C1TA 1D3TB 2CN0H 4CRFA 4B2AA 3T25A 5LPFA 1BTUA 1V2QT 3ESTA 1WTGH 5C20A 3A7TA 1SVPA 4I8KA 1EKBB 1DWBH 1A5IA 1O3KA 1GHAF 2LPRA 4OGYA 1O3GA 4I8GA 1GMCF 1NFYA 3OYPA 1O2KA 3MU0A 3RXKA 4AZ2B 7LPRA 4Q7YA 2OCVB 2FWWA 1C4U2 4HI3A 3GOVB 1ESBA 1CA0C 4A7IB 4CRAA 2XBWA 1ZRBA 1EZXC 1GWAA 2VH0A 1YPHE 1Z8RA 1TONA 1C5YB 1W3CA 4H6TA 1TNHA 1UVSH 4GCHG 4GUXA 2BMGB 1P0SH 3TNTA 1CO7E 3GICB 1C5WB 1ZJDA 2Y80A 2ZGXH 3MOCA 1EB1H 3H5CB 2J2UA 4MPXA 3I77A 2GMTC 4CREA 2H9HA 1YPEH 1AZ8A 3SN8A 1N6XA 6LPRA 4BXWA 5A8YA 2P3FH 3DUXH 2BD7A 1VR1H 1MU8B 1OWEA 5HM9A 1KXFA 3BF6H 1WYKA 1LVBA 2ZQ1A 1AWHB 3SGAE 3E90B 6CHAB 1WBGB 2PW8H 1KLJH 4WVPE 1BMNH 4B2CA 5ABWA 2ZGCA 2QY0B 1Z8IB 2VWLA 1UVPA 3BTEE 1GJ9B 1GJ8B 1GVLA 4O03A 1Y5UT 2F9OA 2A5IA 3TLOA 2ZWLH 4H42U 1C2DA 1GHVH 2D1JA 3GYMA 2CV3A 1LPGB 4B74A 1MKXK 3SGBE 4E7NA 2ALPA 3ZZCA 4AOQA 3SO3A 3E3TA 2ZGHA 2VIOA 4YO9A 4JZEH 4XFQA 1AO5A 3Q3KA 1C2LA 1NT1A 1MCVA 4E7RG 1K21H 1UTQA 1G37A 3A86A 5C2ZA 2P95A 1QL7A 1LO6A 4TY7A 3OU0A 1P3CA 1GBBA 4ISOA 2BD3A 4NWLA 2J34A 3RMLH 2A1DB 1C5XB 2H9TH 5EW2H 1J17T 1ZPZA 1G3EA 3CS7A 1NRRH 1P05A 5EQQA 4SGBE 4I8HA 4Y0ZE 2BD4A 2OQUA 2R2WU 4FVDA 4ZMAH 1O2IA 1AFQB 2P94A 2YNBA 4X8SH 3T28A 5ETXA 3HPTB 1S0RA 3NXPA 1LHDH 2HVXA 2BQ7B 3SI4H 1UTNA 2C3SA 1ZPBA 5C5NA 3O8RA 3BN9A 1NU9A 3E16B 1Y3UA 3K2UA 1G30B 4LXBH 1DFPA 2FS9A 1KDQB 1W0ZU 1YP9A 1F0TA 1S6FA 1HJAB 4X6PA 2PFEA 5L2ZH 1HPGA 1JRTA 1EAWA 3KN2A 2ZHWH 4NFEA 1A4WH 3D65E 2BVXH 1GVKB 3BIUH 1QCPA 4NIYA 1FLEE 3M7UA 2CJIA 3NK8A 1WU1A 3EQ0H 1QQUA 3T62A 4JCNA 2FI3E 3P8GA 1EPTC 1K2I1 1VCQA 2B5TB 1YF4A 2JH6D 1GBHA 3MWIU 3ODDA 5C5OA 4OGXA 4BAMB 4K1SA 1GVZA 4NIVA 2ZTXA 2OBQA 1C4Y2 1SGRE 1C5LH 4U01A 1GMHF 1ZYOA 2BXTH 5TCCA 1EUFA 4D9RA 4AFUA 1Z1JA 5LH8A 3BTWE 4ZXXH 1BMLA 1NZQH 1ANBA 1E36B 1GI4A 1Z7KA 2Y5FA 1G32B 1AD8H 1V2MT 3TJOA 2F3CE 1TPAE 1TNKA 3MFJA 1P11E 2Z94A 3GY2A 1GBCA 2UUYA 3V3MA 1U6QA 1ELCA 3UFAA 1V3XA 1MZAA 2PUQH 5E0HA 3E0NB 1EASA 3LGIA 4DJZB 1QB1A 1TA2A 1MAYA 2ZFRH 3BG4B 2BY8X 1YPLH 3RXBA 3U1JB 4DY7B 1T8MA 1V2TT 3H7TA 3EAJA 3RXTA 1BTZA 4YLQH 2A2XH 1ZLRA 3Q77A 3P92A 3P6ZB 5GCHG 1LMWB 5HYOA 1GBEA 3SNAA 4AYVB 3K9XB 2Z9KA 1C5QA 1ZGVA 4CRBA 1O30A 1HIAB 2P93A 3PLKA 2NU1E 5EXLA 3ZVGA 1TQ7B 2HRVA 3HK6B 1UK2A 1GI0A 1GI5A 1C1NA 1YPGH 4D7GA 4O9VA 2CMYA 1KXDA 1SI5H 3BTGE 1IQKA 4Y7BA 2O8MA 3BEUA 1PPGE 2OD3B 5A8XA 3GY5A 1FY4A 1ABIH 2OXSA 5LPEA 2TRMA 4ABGA 3DD2H 5HGGA 4YESB 2WPMS 1C9TA 1ELFA 2FLRH 5FPYA 3ATKA 2CF9H 1CA0B 1GJBB 1BCUH 4K1EA 1INCA 1KDQA 2QA9E 2ZPRA 3EDXB 4IN2A 4Y8XA 3TGJE 2VWNA 3K6ZA 2FOAA 3ZV9A 1ZZZA 1Q2WA 4ZHAA 4Q2KA 2GZ7A 1BBRH 3RXEA 1O2XA 1O5AB 4AB9A 3NUMA 4FU8A 5AVDA 1S85A 1VCWA 3BIVH 1V6DA 2P3UB 4AFSA 4BXSA 4OS4A 4X8TH 2GMTB 3SJKA 3WY8A 1GBLA 2FX4A 2WPKS 1P06A 4NSYA 5CMXH 3A81A 5C1YA 1C5ZB 3FZZA 1E34B 1O3PB 1HAVB 4X2YA 2IJOB 3GCOA 2WUBA 1GHZA 1LVMA 1E37B 1GDNA 2FYQA 4KP0A 1MTSA 3HGNA 3LONA 1T31A 1DE7H 3TIUA 2ZPQA 4BTIB 3ZZ3A 3QGNB 4IC5A 1TAWA 2OINA 1LCYA 1TX8A 2EEKA 1A61H 1RIWC 2IPHA 1O34A 3QLPH 3S7KB 3E8LA 3SU6A 1PFXC 2ZU5A 1O36A
chains in the Genus database with same CATH superfamily
1SFIA 2A2QH 1XUGA 3EGKH 1LQDB 1NBMD 2J98B 3H7OA 2D8WA 5HIZA 5FX6A 1P03A 1TGSZ 1GI7B 1K1LA 2PTCE 5AFYH 2Y7ZA 1HIAA 2AMQA 2F43B 1N8OC 3P8FA 1SKYE 2WV5A 1GCTC 1O38A 1P12E 2VVUA 1C5UA 3P8OA 5F53A 1A5GH 2C8YB 1THPB 1ESTA 3UR6A 3M3VA 2VVVA 3RUOA 1SQOA 3U69H 6ESTA 2A4OA 4NZQA 1AQ7A 1CT4E 5DP8A 1AWFH 4AB8A 4O3TA 1H8IH 1LQEA 1TGTA 4MQAA 1FN8A 2XBXA 3TU7H 1TBRH 4DT7B 1MQ6A 1A3BH 2ZA5A 1DM4B 2KM0A 4JYUH 1KXAA 1DUAA 1TALA 2L6OA 1T8LA 1ID5H 2NU2E 2VWMA 2R0KA 1NRPH 1O2ZA 2BDAA 3VEQB 1UTMA 2BDYA 4LK4A 3H09A 4CBOA 1RGQA 1SOTA 4J2YB 1EOLA 1SOZA 1GI6A 4WXVA 1QTFA 2XRCA 4UFDH 1TNJA 2O9QA 1P2KA 2ZCLP 4BTUB 1T8NA 2O8UA 4F4OC 2HNTE 3L33A 1SL3A 1GBFA 2SFAA 3ZYDA 3UY9A 2QC2A 3SQHE 4LZ4B 3I78A 2R3YA 3W94A 2B8OH 2Q6DA 3ZVFA 3LGYA 1A1RA 2ZDKA 3A8CA 4UDWH 3SHAH 1P04A 3LH1A 1FAKH 3OE7D 1GDQA 4BAOB 2SGAA 2EQNA 1HAVA 4X2XA 2UUJB 1SQTA 1HUTH 2FX6A 3GYLB 3QZQA 3BTDE 5K7RA 1EPTB 1YBWA 3M37A 2BX4A 1O2JA 4YM9A 3SNCA 3T2NA 1O3LA 1WUNH 5T6GA 4B73A 4ZROA 1O2QA 2VIDA 3NWUA 1O5GH 2AMDA 4INLA 1O37A 3UOPA 1KLIH 3URDA 1CA8B 3PROA 2QXJA 3MU1A 2J4IA 3QZRA 5EJZA 1V2OT 2A5AA 1GI1A 4CBNA 4IMQA 3TJUA 3NRLA 4Y76A 5A09A 3KQ5A 2BQ6B 1P3EA 3N7DA 2ZKSA 2ZU2A 4Y8YA 3E91A 3FKSD 2J98A 4WH8A 2ZZUH 1GHWH 5SGAE 1B7XB 1QR3E 2ZFQH 3LU9B 1ELTA 2RA3A 3ZIAD 1D3PB 1AZZA 3SU5A 1TLDA 3UTUH 3ZZ4A 3A87A 2V3OH 2BVSH 1HYLA 2J95A 2CK3D 1GI2A 1FMGA 1P2MA 4K8BA 4KTSA 1C5VA 2BOHB 1DT2A 1NESE 1SBWA 4DIIH 1SGYE 5JDUB 4AFQA 1V2JT 1F5KU 1B0FA 2W7UA 1UCYE 1QJ1B 1ZSJA 2AERH 3MH5A 4HG6A 3RMNH 3SGQE 2CF8H 1ELVA 2PGBB 1SSXA 2Y6TA 1TQ0B 4Z6AH 1Q3XA 2JETC 1C5NH 1AHTH 2BYAX 1GG6B 1D6WA 4QT8C 3VB6A 3E6PH 1TMTH 3OY5U 4IGDA 5E8EH 1GBJA 4GCHF 2FS8A 5T1VA 3M7QA 2ANYA 5DP6A 2EA3A 1NFXA 5EG4A 1FQ3A 1UVTH 2ZGJA 3KQEA 1EZUC 3ZZDA 2PUXB 1DWDH 1YPKH 2HOBA 1NFWA 4ABFA 1CE5A 1CGJE 4F49A 1C5SA 1YLDA 2RG3A 1H8HD 4AGKA 2YMSC 2UUKB 5EQRA 1NO9H 2FOCA 1PYTD 2R2MB 2AIPA 1GI8B 2OC0A 3DCLA 5HM2A 1EOJA 1LPKB 1EAIA 2HNTF 1BDAA 3OX7U 1P9UA 3QWCH 1WOFA 1FV9A 2C4FH 3RU4D 4AC9A 2RDLA 1EPTA 3S9BA 2ULLA 1W10U 2F91A 7ESTE 2W6JD 2W6ID 5I25A 3SU0A 2PV9B 5DK1A 4NA7A 1HAOH 1C1SA 1YY3A 3OEHD 3V0XA 2UWPA 5EPNA 1B5GH 2QGRA 4MNXA 3U8TH 1OYQA 2WYGA 1MD7A 2BD2A 4MPWA 2QCYA 3OTJE 2H5CA 3UPEA 1IHSH 5IK2D 4RT1A 1SMFE 3SV2H 1SG8B 1AE5A 4X1NU 1O2PA 4DT4A 1V2WT 2RDEA 5DPAA 3RC6A 3SNDA 1RIWB 2VU8E 1AVWA 3Q3XA 2ZHFH 1XX9A 2A7JA 1ORFA 1BB0B 1ZMNA 1KTSB 1ZSLA 1TIOA 2FOGA 3HKJB 1W7XH 1N1LA 8ESTE 2ESTE 2W5EA 2NWNA 4Z0KA 4YOGA 1DLKB 2WV9A 1TMUH 2STAE 1Z6JH 3QTOH 4I86A 1TBZH 2GTBA 3SZNA 2OC1A 1Z8GA 1C5MD 1N8OB 1TGNA 4ASHA 1N6YA 1UK3A 1GCTB 2QN5T 1BRUP 2GJGA 3M3SA 3M7TA 2PSXA 4D7FA 1BZXE 1PPEE 3TJNA 4CRDA 1Y8TA 4UD9H 4HFPB 1BTWA 1SGPE 2GCTC 1PJPA 2GVFA 1D3DB 3QDZB 3OAAD 1EAUA 2B7DH 4ZKOU 1T32A 1CT0E 2OBOA 1TPPA 6GCHG 7KMEH 5FAHA 1AKSB 2I6SA 2Z3EA 1UCYK 3BEIB 2A4GA 3RMMH 1A5HA 4NA9H 3M61U 1OSSA 2GKVE 3HGPA 2FESH 3BTKE 1SQAA 1A2CH 4O97A 1DICA 1SPJA 1OP0A 5CHAB 3O8DA 1QIXB 2J9NA 2Q1JA 3SZEA 1IOEA 3LT3A 4K2YA 2FOMB 3SJIA 3V7TA 3A7XA 1ETSH 3SU1A 3ZZAA 1SQRA 2FO9A 4ISLA 2GP9B 3KYFA 1Z8JB 2F9UA 4IMZA 1H9LB 5DG6A 1LHCH 3SORA 5C1UA 1O5EH 1A46H 5FBIA 2ZO3H 1XKBC 1B0EA 1E0FD 3P8NA 2XC0A 3VB3A 1O2HA 4ACAA 2WINI 5TJXA 3UNSA 1BA8B 2O8WA 4Q7ZA 2G00A 4Q80A 2V35A 7GCHF 2ZNKH 1DSTA 1DXWA 3LKWA 2VIPA 3T29A 4SGAE 4I8LA 1DOJA 1ELAA 1TNGA 1SGTA 3QUMP 4X2VA 2J5UA 4IS5A 4IW4E 1SLXB 4GAWA 1JRSA 2SNWA 1ARCA 5E0JA 1JXPA 3MU5A 3ZVCA 1HJ9A 1C2MA 1DUEA 5GCHF 1H4WA 1QZ8A 2IN2A 3A7ZA 4YOJA 3W95A 3RU4T 1OWHA 1ARBA 1BBRE 3URCA 2ZU1A 1O33A 1WQVH 2L74A 4BANB 1C9PA 1XMNB 2Z3DA 4IN1A 2FIRH 2STBE 2HLDD 3KQCA 5JYIA 2J94A 3ZVAA 1DX5M 4E06H 3U8OH 1QBOA 2WPIS 1E38B 3UWIA 5CDFE 1ELDE 4X6OA 1VKYA 2LELA 5L6NH 2GV6A 4JZDH 1O3EA 2ZHEH 2FOBA 5C67A 3G01A 1THSH 1ELEE 1CT2E 3QO6A 5DP5A 1RJXB 3M35A 1A0JA 4DW2U 2HGTH 1TE0A 1MBMA 2W26A 4XRNA 2FXRA 5E2OA 4X8VH 2GZ9A 5GXPA 3SV9A 5CHBA 1IQNA 3ZZ8A 3SV8A 3PTNA 3ZVBA 1GMDG 1S5SA 1JMOH 3RXJA 1H9HE 2J38A 1AKSA 1L2EA 5GPIB 3LGUA 2YNAA 5DO4H 4Q63A 2HPQH 3A84A 1DANH 4YZUA 2FLBH 1Y3XA 1MKXH 2C8WB 2QE7D 1TOCB 2JETB 3DFJA 1V2NT 4Y0YE 4RI0A 1O2UA 1HRTH 4TPIZ 4U32A 3T26A 1O2VA 1FUJA 3FVFB 3LDXH 3S0NA 4TPYA 2ZU4A 2NU0E 2Z9IA 5K0HA 1WXRA 3DSPA 1GHXH 3ATLA 3ZVDA 1SGFG 5T3HA 1HXFH 1IQJA 1ZTJA 4ABBA 1O3HA 1CHOG 1ZHPA 2ZTZA 2F9BH 2P3TB 1EATA 4FUBA 1TRNA 3LOXA 2YMSB 3RXDA 4JK6A 3M36A 1C2HA 1ANEA 1NRSH 2TGAA 2FOHA 4PROA 3FAOA 1WCZA 4TWWA 1TRMA 3PWBA 1NTPA 4WMDA 3PRBA 1IQIA 1RTLA 3QX5H 1C1PA 2ZCKP 1GBTA 1W12U 2EI6A 7GCHG 1RD3B 1A0LA 2FTLE 1UVOA 1Y5BT 3Q3YA 3AASA 4INHA 2V0BA 5B6OA 1BRAA 4FUIA 2PLXA 2BB4A 2WYJA 2B0FA 1NC6A 3AAVA 5JPMH 2AGGX 2BHGA 1ZTKA 2R0LA 1A3EH 9LPRA 3FZDA 4THNH 4YTAA 1ZHRA 3ENSB 1X7AC 1YPMH 1HJ8A 1UMAH 5A8ZA 1IAUA 5AHGH 4JK5A 1AU8A 1O0DH 2YMSD 3MO6A 3TH3H 1GPZA 1T7CA 4DGJA 1S84A 1GBDA 1BITA 2ANKH 5EJLA 4XD7D 4RKOB 1FIWA 1SGDE 4UFFH 4FUFA 5FL7D 5F6MA 3RP2A 2DE8A 2FTMA 2BLOA 1K1NA 1TPSA 1EZQA 1SFQB 4XBDA 3EA7A 5EXNA 1TMBH 5E0GA 1GG6C 1FY3A 1K1IA 3GDVA 2ZQ2A 1QHRB 3RU4E 2NU4E 1SHHB 2EC9H 3D23A 3KQDA 4NG9H 2UWOA 4FVBA 3RXFA 1TABE 1SGFA 4I33A 5JBTA 1UHBA 2V7QD 2GCTB 4RSPA 3ZYEA 1IQMA 3SHCH 3U98H 1YWUA 1UK4A 3LGVA 1IQEA 1QBVH 3MTYA 1JIRA 1GJ4H 1Q31A 1KXCA 3KCGH 4BOHA 3ELAH 1MUEB 4ZHLU 2D26C 4H6SB 2Y82A 5DP7A 3C1KA 3SJ9A 5BRRE 2BD8A 4JYVH 1FAXA 3TK9A 1D4PB 3ATIA 1LHEH 2CGAA 3B9FH 2A45B 1E35B 1J8AA 2GZ8A 3CP7A 3PV5A 1UTKA 4FUDA 3N7OA 3E0PB 3SOSA 3F2FA 1VITH 2ZCHP 2ZDAH 1XKAC 2BDBA 4CR9A 5LPRA 1ZR0A 1C1MA 3U1IB 1SLWB 2TGPZ 3NPSA 4HTCH 3BV9B 1O2OA 3EA8A 4MDSA 1FN6A 2ANWA 3D62A 4JYTA 1YKTA 1O3MA 2PTNA 2GDDA 5EOKA 3PMHB 1MQ5A 4FOUC 2C8XB 3AK5A 2AMPA 4NIWA 4P00A 1MKWK 3PO1B 3MNBA 2BTCE 4AGJA 1C1UH 1O3DA 1BOQA 3V13A 3UOUA 3B23B 1BIOA 1XUFA 1GJDB 3EA9A 3RC5A 3AVZA 2JJ1D 1FIZA 8GCHG 2HLCA 3KQBA 1OKXA 2H1UA 4ABIA 1YCPK 1YPJH 2BDIA 2TPIZ 3DT0H 2AYWA 1O31A 2HWLB 4I7YH 1K1OA 5L30H 3ATWA 3KNXA 3UNRA 1O35A 5HMAA 2P8OC 3LC5A 4ZCNA 1SGIB 3GCHC 3A83A 3VG8A 1S83A 3A82A 5T6DA 3MI4A 4NCYA 3A7VA 3WWFA 2F9PA 3SJOA 1YCPM 1W14U 1PPCE 4H4FA 4ABJA 4DCDA 4UEHH 2VINA 1G3CA 4Y6DA 5PTPA 3U9AH 2XNIA 3RMOH 1VJAU 3FP8E 1C5OH 2K1QA 1UTLM 3IWMA 1O2TA 4KKDA 1BTPA 2V3HH 1O3CA 4DG4A 2AFQB 1VITG 1DITH 4NSVA 4FU7A 2R9PA 4D9QA 5GWZA 4MNWA 1PQ8A 5CHAC 1P9SA 1HAXB 2HVYB 4TYDA 2XC4A 2XYAA 3LGWA 1A7SA 1MMJN 3JZ1B 1EB2A 1O3BA 3BTTE 4OS6A 5KGOA 1O3AA 2DE9A 4XBBA 2AHME 1L4DA 1BJVA 2ZECA 2WZQA 5FBEA 1PPBH 1ZRKA 1FONA 4FUCA 3RXAA 5EW1H 1EX3A 1NS3A 3P95A 3SNBA 4Z1MD 1CHGA 2IJD1 4GLYA 1Z71A 2ZC9H 4ABDA 4NFFA 1E79D 2QXIA 4UE7H 3ZZBA 5C3NA 1UTOA 1QURH 2GDEH 4R8TB 4ISNA 2ZP0H 4MNYA 1BT7A 3T5FH 5EPYA 1BQYA 1DPOA 3P70B 1VCPA 5EGMA 4A5TS 1GHYH 2XW9A 1MTWA 1V2LT 2ZGBH 1KIGH 2QV1A 1WV7H 1TX6A 1XXDA 1J16A 2ZHDA 4B6FA 1KY9A 2AH4X 3M3TA 2ILNA 3RXSA 1G3BA 2JH5D 1ELBA 1BMFD 1H8ED 1YYY1 1M9UA 1PPHE 3MYWA 1OWJA 3CENA 3MHWU 1QB9A 4MG3A 1TNLA 1TA6A 1MTNC 1S6HA 1QBNA 2ZG0H 9ESTA 2GCHG 4ISHH 1DY9A 3AAUA 3ZVEA 2O8TA 1EZSC 4Q7XA 1DS2E 1O5CB 3PYHA 5FHTA 3M5MA 3UWJH 1GJCB 3QK1A 1FZZA 3RXLA 3UUZA 3MH6A 4CHAC 1L4ZA 3JZ2B 4TWYA 1Y59T 3RXMA 1SC8U 1HLTH 1THRH 3TPIZ 1NU7B 5C0UA 4JZIA 4NGAH 2F9VA 4X1RU 4I31A 1BJUA 1KLTA 2VVCA 2BDCA 1DLEA 5HXFA 2PKAB 2ZFSA 5GIBA 1HAZB 6GCHF 1GCDA 4RKJB 4ZAEA 2ZEBA 5A0BA 1F5RA 1AE8H 1O5DH 1ZSKA 4CR5A 3S69A 2SGFE 4K60A 2BXUH 5I46H 2AGIX 3E1XB 3LJJA 1J14A 1BRCE 3ITIA 2G5NA 1NPMA 1QRZA 1RFNA 5F03A 1S81A 1C2GA 1HFDA 1HNEE 3RLWH 3O8CA 3SI3H 1C2JA 1GHBG 1OOKB 1RXPA 4YXWD 1DVAH 5GNDA 2IOTA 2G52A 2OK5A 1O2GH 1K28D 4FUEA 4WXIA 5AFZH 2BD5A 3HATH 1PQAA 1XM1A 3UB0A 2FOEA 4CH8B 2FODA 5JB9S 3BEFB 1ETRH 1XUJA 2A4QA 3BTFE 1SB1H 1QRWA 3PWCA 3W1EA 4GHQA 3A85A 1C2IA 4JZFH 2FPZA 1AVXA 3OSYA 4HGCA 1BHXB 1GJ7B 2FDAA 4X0WU 2EI8A 1SLUB 4XE4A 4Y10E 1OWDA 1FI8A 1XXFA 2XBVA 5EXMA 2ZDMA 4NWKA 1SHYA 4D76A 2RCEA 3RXUA 2Z9GA 3MNSA 4KGAA 1PQ5A 1BTHH 2H6MA 1WTHD 3GY4A 1V2PT 2BM2A 2FI4E 3K65B 1WSSH 1OPHB 3PLPA 1ZGIA 1G3DA 3RXCA 4A1VA 3HKIB 4Y79A 3GDUA 1OYTH 4Y11E 2G4UA 1TGBA 2M5TA 4X1SU 1SR5C 2SGEE 4WH6A 3F0OA 8KME2 3LH3A 2TGTA 1MH0A 2C93B 1MBQA 2WPLS 2FOFA 2VWOA 2XOKD 1K9OE 3N7EA 1P2NA 1TNIA 3MNCA 1Z6EA 2XCFA 1WAYB 2GT7A 1HAIH 1CBWC 3EE7A 1P2IA 4M7GA 4ZHMU 5EIYA 3RXGA 1PQ7A 5DP9A 4K69A 3SUEA 4AX9H 1TYNA 1F0SA 1MCTA 1RTKA 3MO3A 2ZDVH 2QF5A 2W3IA 1AI8H 1KXEA 1P2OA 2BZAA 3M5NA 1LVYA 2BY6X 2PKAA 2Z3CA 1GBKA 2P8OB 2VH6A 1J9CH 3GCHB 1GMDF 1YM0A 1SGCA 1O32A 3SYJA 1C2FA 4ZKNU 1ABJH 1OP2A 4OS2A 1T8OA 5C17A 2PKSC 3LPRA 3F9GA 1LHFH 2Z9LA 1GDUA 1Z1IA 5C94A 2F4LA 3BTME 5F8TA 5DP3A 2SNVA 1MD8A 1HBTH 2A7HA 4WF8A 3F2GA 1SGQE 5G4BA 1HDTH 1YPHC 3ATMA 4U2WA 5DP4A 2XC5A 4X6NA 4B2BA 4MLFB 4B6EA 1C2KA 3ODFA 3SU4A 4FUJA 5ESTE 2THFB 1LHGH 2P59A 2Z7FE 4CH2B 2KCAA 3SBKA 1CHOF 3PM3A 2G51A 1O2NA 3AW0A 1GGDC 4XBCA 5JBCS 1YLCA 4MNVA 5A0AE 2YOLA 1UTPA 1IQGA 1OP8A 1ZHMA 1HAGE 1L1GA 1IHTH 4KTCA 1F2SE 1AFEH 1ZOMA 3M5OA 3NKKA 1FNIA 1L0ZA 4A1TA 3Q76A 4R0IA 2A31A 2XWBI 5DJ7A 2J92A 1J15A 1EP5A 1DY8A 3PO1C 2XCNA 1VJ9U 4ACBA 1YGCH 3FO8D 3WWBA 5KEDA 2BY9X 1UCYH 1P01A 2M2AA 2HALA 2B9LA 4DURA 4K1TA 4XDEA 2CHAC 4MPUA 3STJA 1Y3WA 3GS9A 1Y3VA 4FXGH 1S0QA 3VB5A 1L1JA 1P2JA 1MTNB 3BG8A 2UUFB 2I6QA 4CRGA 2UWLA 3MH4A 1UTJA 4ASUD 3F9HA 1AN1E 2H5DA 4GHTA 3T27A 1FJSA 1K1PA 1MABB 1T4UH 5FPTA 1HAPH 2OLGA 2BDHA 2IPQX 2ZDLA 1A0HB 2C90B 2K8IA 1QL8A 2JDID 1QQ4A 1GJ6A 4CHAB 4B71A 4JMYA 3KL6A 1D3QB 4KELA 2QXHA 2BY5X 3GISB 1S6LA 1S82A 3F68H 5EQSA 1GBIA 2AIQA 3PMJA 1CGHA 4XSKU 2FYRA 3CS0A 2KZ4A 1F0RA 1E1RD 1L1NA 3BTHE 3S7HB 1MZDA 3K6YA 1UHBB 3SNEA 1VZQH 2V6NA 1O2MA 2OC8A 3A89A 3O8BA 2ODYB 5J4QA 3UREA 1GHAG 1V2KT 2A4RA 5L2YH 4RN6A 1P02A 5AF9H 1GMCG 1MTVA 3HK3B 5DKMA 2TGDA 4BAHB 1FPCH 3L3TA 1C1VH 3PTBA 3SQEE 4P02A 1COWD 1F7ZA 3PV2A 1QA7A 2OQ5A 3PMAB 3U8RH 4DVAU 3SU3A 3A8BA 4MVNA 3S9AA 1QFKH 1C1QA 1KTTB 3F3BA 1AUTC 2KAIB 2QF0A 1AMHA 3RXOA 4FUHA 5JBAS 2AEIH 2Z6BD 5IDKA 3FANA 5GJ4B 4DOQA 1JOUB 3RM0H 3VXEH 2ZI2H 4ZKSU 1C2EA 1TOMH 5CE1A 1C5PA 3QTVH 1AB9C 1C4V2 1FXYA 1G36A 3VGCC 1Y3YA 2QF3A 1LDTT 5GDSH 3RXQA 3TGIE 2ODQA 3LJOA 4Y71A 4HZHA 3TGKE 2FI5E 3SUDA 2KR7A 2DUCA 3LGTA 4XOJA 2F83A 2EY4C 3SV6A 2A7CA 1OS8A 1LTOA 5BPEA 3LC3A 1P57B 2BLVA 1O5BB 3TITA 3ZZ9A 8GCHF 1YC0A 2FP7B 3CNRA 2OUAA 1HV7A 1NM6A 1LVOA 2OC7A 2GT8A 2P16A 5EODA 4TT3D 2WSSD 1TGCA 4GSOA 4WMEA 1V2RT 1OHHD 3KYGA 4ZH8A 4Y7AA 2PR3A 3GCTF 1AIXH 1UO6A 3D49H 3PMBB 3TH4H 4AG1A 1MTUA 3A7WA 3R3GB 1JIMA 5F8XA 1GBMA 1AGJA 3FN8A 3VB4A 1BBRK 2V3MA 3DA9B 3QN7A 2VIQA 1CBWB 1FDPA 4AN7A 2GV7A 5KECA 1H1BA 1PYTC 3SV7A 5HIYA 1NY22 1F92A 1W11U 1TFXA 1ZPCA 5J4SA 1VITF 2BLQA 3A80A 1ELGA 4UFEH 4U30A 4K5ZA 1NN6A 4OS5A 2WUCA 3RXVA 3V12A 3A7YA 2WHXA 5E2PA 1W8BH 3KGPA 4FUGA 4X1QU 3SU2A 2PKSB 1P10A 2WPHS 3NCLA 3KF2A 3OY6U 4FETA 5EJ1A 1K0HA 4LOYH 3KEEA 3M5LA 2ZFPH 3B8JA 1MU6B 1VGCC 2H9EH 2TBSA 4K3JA 1NRQH 1HXEH 1C5TA 5FX5A 1EJNA 1W0YH 1DSUA 1QJ6B 1D6RA 1LKAA 3MMGA 2KAIA 2G55A 1TRYA 1GGDB 3STIA 3VB7A 1KYNA 1O2SA 3TJVA 4B76A 3DSOA 2SGPE 1HAHH 1GI3A 3L6PA 3MO9A 3BSQA 3TH2H 4AFZA 1P2QA 2ZPSA 1QL9A 2NU3E 1UW7A 3FP7E 4D8NA 1LPZB 2KCYA 3A8AA 1O3JA 2Y5HA 1CU1A 2G5VA 2VB0A 5TCAA 3A88A 4NZLA 2GCHF 1DXPA 1SLVB 1P09A 4AYYB 1XUKA 1O2YA 3UNQA 2SGQE 1GMHG 2FMJA 2BX3A 2RA0A 3SUFA 5JB8S 4Q4LA 2A5KA 1EAXA 2CHAB 2PP6A 1PPZA 4VGCC 3VPKA 4BAKB 2HPPH 3MNXA 2VGCC 4B75A 4A1XA 1ANDA 3GY6A 1O2RA 2CXVA 3F2HA 3GCTG 4YOIA 1BTYA 4LZ1H 3TK6A 4BNRA 2BQWB 1O5FH 1BUIA 1WDIA 1HAYB 2BZ6H 1TBQH 3IG6B 2XWAA 3PV4A 1O3OA 3RXHA 1XVMA 1O3FA 3S9CA 3RM2H 4X8UH 1DWCH 1H8DH 2ANMH 2ZFTA 1QJ7B 3OFND 4YT7H 3Q00A 1Y5AT 4ZKRU 4NIXA 1ZTLA 2VJ1A 1W2KH 3KHVA 2ZF0H 1TB6H 1FY5A 5F8ZA 5A2MH 1CVWH 1W7GH 5LGOA 1GHBF 1BTXA 1MKWH 3GY7A 1EP6A 1OXGA 2ZHQH 2ZDNA 4GVUA 4ZUHA 2Y5GA 3UQOA 1FPHH 3LIWA 3EE0B 2PGQB 1TX7A 5T6FA 2VNTA 2W7SA 1JBUH 1GJ5H 1YCPH 3FP6E 3GDSA 4O3UA 2HNTC 1BMMH 1O2LA 1FY8E 3C27B 4INKA 3GCNA 1ZMLA 1F0UA 2A0QB 4ZXYH 3RXIA 4BAQB 2XTTB 2FEQH 1SGEE 3PLBA 2O8LA 1FY1A 1PPFE 1JWTA 2ALVA 2AS9A 2JH0D 4MTBA 1EQ9A 3A8DA 2A32A 4Y8ZA 4X1PU 1O3IA 1RRKA 2C8ZB 1O3NA 6CHAC 4GPGA 1CSOE 4UFGH 3SW2B 1G2MA 1F5LA 2JKHA 2G8TA 1C1RA 3PB1E 1K1JA 4X2WA 2PSYA 1ZMJA 1G9IE 1ANCA 1BHXF 2ODPA 3F9FA 4AORA 3F9EA 5FCKA 3ZZ7A 5A0CA 1AB9B 1XVOA 2XBYA 4ABEA 4OS1A 3KIDU 3FFGA 3VGCB 2FZZA 1ETTH 2WV4A 1H9IE 1KSNA 1IQLA 1BRBE 1RTFB 3VFEA 3AW1A 1ESAA 1QB6A 1E1QD 1UJ1A 4IBLH 2BLWA 1BMAA 2FM2A 3DFLA 1V2UT 1QA0A 1SGNE 4WJG2 1KMHB 3RDZA 3I29A 5EU8A 2W3KA 1C1OA 4UONA 2VIWA 1XUHA 3TNSA 2F9NA 1AVGH 4ABHA 4BTTB 2QYIA 2PHBA 3F6UH 1GJAB 1OX1A 1GL0E 1P8VC 2G81E 5DGJA 2GD4B 1UVUH 1ACBE 4ISIH 4JZ1A 4WY3A 5B6LA 5JBBS 1TPOA 1AY6H 1ZJKA 3MU8A 4MPVA 4CRCA 1QRXA 3GY8A 3UQVA 1DDJA 1AFQC 2SGDE 2BD9A 3SUGA 4OM9A 1NRNH 4YT6H 3UR9A 1O2WA 1XUIA 4WMFA 1EJMA 3TK5A 1K22H 5FCRA 1HB0B 1TWXB 3RXPA 2JIZD 4NA8A 4A92A 3F1SB 4FU9A 1EFRD 1W13U 2BY7X 2KX4A 1QGFA 8LPRA 1QNJA 3VXFH 1OWIA 3MH7A 3OEED 1GL1A 2Y81A 1LKBA 3NZIA 3P17H 3UIRA 1HJAC 2D2DA 2XNDD 5C1XA 2G4TA 3RLYH 1HCGA 1RS0A 3TVJB 2ZU3A 1GBAA 1IQHA 3BTQE 1VGCB 4IC6A 3EYDA 2ZTYA 3F0PA 3GY3A 4KTUA 1T4VH 1AUJA 2OP9A 2H2ZA 4E05H 1IQFA 2BOKA 1OWKA 4TY6A 2GGVB 4DIHH 1GI9B 3RXRA 1K1MA 4I32A 1DWEH 2ZIQH 4B1TA 5FPSA 3R0FA 1CQQA 1KXBA 4TSFD 1CGIE 1O39A 2Q6FA 2QF4A 5FXLA 2BVRH 1YLNA 2Z9JA 5IYTA 2OTVA 2PWXA 1D9IA 3DHKH 4OS7A 2R3UA 4YLUA 1MAXA 2K0QA 1EJAA 3ZV8A 2GX4A 3IITA 4X6MA 4AG2A 1NFUA 4A6LA 2Y7XA 4J1YA 4I8JA 1V2VT 3ZZ5A 4K8YA 2XXLA 2AGEX 1QY6A 4ABAA 2ASUB 2LNCA 3MU4A 2Q6GA 3SJ8A 5H4IB 2VIVA 4WWYA 4ESTE 1C5RA 2QXGA 1C1WH 3OTPA 3BG4C 1G2LA 3ZZ6A 2ZFFH 1V2ST 2TIOA 1EXFA 1NROH 2WPJS 2QIQA 2EI7A 1HGTH 4VGCB 3RC4A 3QGJA 1WQSA 2BDGA 2VGCB 2QAAA 5ESBA 1C1TA 1D3TB 2CN0H 4CRFA 4B2AA 3T25A 5LPFA 3MQKC 2KFWA 1BTUA 1V2QT 3ESTA 1WTGH 5C20A 2RFKC 3A7TA 1SVPA 4I8KA 1EKBB 1DWBH 1A5IA 1O3KA 1GHAF 2LPRA 4OGYA 4M9FA 1O3GA 4I8GA 1GMCF 1NFYA 3OYPA 1O2KA 3MU0A 3RXKA 4AZ2B 7LPRA 4Q7YA 2OCVB 2FWWA 1C4U2 4HI3A 3GOVB 1ESBA 1CA0C 4A7IB 4CRAA 2XBWA 1ZRBA 1EZXC 1GWAA 2VH0A 2J97A 1YPHE 4F48B 1Z8RA 1TONA 1C5YB 1W3CA 4H6TA 1TNHA 1UVSH 4GCHG 4GUXA 2BMGB 1P0SH 3TNTA 1CO7E 3GICB 1C5WB 1ZJDA 1W0KD 2Y80A 2ZGXH 3MOCA 1EB1H 3H5CB 2J2UA 4MPXA 3I77A 2GMTC 4CREA 2H9HA 2JJ2D 1YPEH 1AZ8A 3SN8A 1N6XA 3UAIC 6LPRA 4BXWA 5C0TA 5A8YA 2P3FH 3DUXH 2BD7A 1VR1H 1MU8B 1OWEA 5HM9A 1NBME 1KXFA 3BF6H 1WYKA 1LVBA 2ZQ1A 1AWHB 3SGAE 3E90B 6CHAB 1WBGB 2PW8H 1KLJH 4WVPE 1BMNH 4B2CA 5ABWA 2ZGCA 2QY0B 1Z8IB 2VWLA 1UVPA 3BTEE 1GJ9B 1GJ8B 1GVLA 4O03A 1Y5UT 2F9OA 2A5IA 3TLOA 2ZWLH 4H42U 1C2DA 1GHVH 2D1JA 3GYMA 2CV3A 1LPGB 4B74A 1MKXK 3SGBE 4E7NA 2ALPA 3ZZCA 4AOQA 3SO3A 3E3TA 2ZGHA 2VIOA 4YO9A 4JZEH 4XFQA 1AO5A 3Q3KA 1C2LA 1NT1A 1MCVA 4E7RG 5DN6D 1K21H 1UTQA 1G37A 3A86A 5C2ZA 2P95A 1QL7A 1LO6A 4TY7A 3OU0A 1P3CA 1GBBA 4ISOA 2BD3A 4NWLA 2J34A 3RMLH 2A1DB 1C5XB 2H9TH 5EW2H 1J17T 1ZPZA 1G3EA 3CS7A 1NRRH 1P05A 5EQQA 4SGBE 4I8HA 4Y0ZE 2BD4A 2OQUA 2R2WU 4FVDA 4ZMAH 1O2IA 1AFQB 2P94A 2YNBA 4X8SH 3T28A 5ETXA 3HPTB 1S0RA 3NXPA 1LHDH 2HVXA 3FOAA 2BQ7B 3SI4H 3DSGA 1UTNA 2C3SA 1ZPBA 5C5NA 3O8RA 3BN9A 1NU9A 3E16B 1Y3UA 3K2UA 1G30B 4LXBH 3WW7A 1DFPA 2FS9A 1KDQB 1W0ZU 1YP9A 1F0TA 1S6FA 1HJAB 4X6PA 2PFEA 5L2ZH 1HPGA 1JRTA 1FX0B 1EAWA 3KN2A 2ZHWH 4NFEA 1A4WH 3D65E 2BVXH 1GVKB 3BIUH 1QCPA 4NIYA 1FLEE 3M7UA 2CJIA 3NK8A 1WU1A 3EQ0H 1QQUA 3T62A 4JCNA 2FI3E 3P8GA 1EPTC 1K2I1 1W0JD 1VCQA 2B5TB 1YF4A 2JH6D 1GBHA 3MWIU 3ODDA 5C5OA 4OGXA 4BAMB 3N99A 4K1SA 5HKKD 1GVZA 4NIVA 2ZTXA 2OBQA 1C4Y2 1SGRE 1C5LH 4RT0A 2VBCA 3PRDA 4U01A 1GMHF 1ZYOA 2BXTH 5TCCA 1EUFA 4D9RA 4AFUA 1Z1JA 5LH8A 3BTWE 4ZXXH 1BMLA 1NZQH 1ANBA 1E36B 1GI4A 1Z7KA 2Y5FA 1G32B 2LP6A 1AD8H 1V2MT 3TJOA 2F3CE 1TPAE 1TNKA 3MFJA 1P11E 2Z94A 3GY2A 1GBCA 2UUYA 3V3MA 1U6QA 1ELCA 3UFAA 1V3XA 1MZAA 2PUQH 5E0HA 2KCPA 3E0NB 1EASA 3LGIA 4DJZB 1QB1A 1TA2A 1MAYA 2ZFRH 3BG4B 2BY8X 1YPLH 3RXBA 3U1JB 4DY7B 1T8MA 1V2TT 3H7TA 3EAJA 3RXTA 1BTZA 4YLQH 2A2XH 1ZLRA 3Q77A 3P92A 3P6ZB 5GCHG 1LMWB 5HYOA 1GBEA 3SNAA 4AYVB 3K9XB 2Z9KA 1C5QA 1ZGVA 4CRBA 1O30A 1HIAB 2P93A 3PLKA 2NU1E 5EXLA 3ZVGA 2KCOA 1TQ7B 2HRVA 3HK6B 1UK2A 1GI0A 1GI5A 1C1NA 1YPGH 4D7GA 4O9VA 2CMYA 3U28C 1KXDA 1SI5H 3BTGE 1IQKA 4Y7BA 2O8MA 3BEUA 1PPGE 2OD3B 5A8XA 3GY5A 1FY4A 1ABIH 2OXSA 5LPEA 2TRMA 4ABGA 3DD2H 5HGGA 4YESB 2WPMS 1C9TA 1ELFA 2FLRH 5FPYA 3ATKA 2CF9H 1CA0B 1GJBB 1BCUH 4K1EA 1INCA 1KDQA 2QA9E 2ZPRA 3EDXB 4IN2A 4Y8XA 3TGJE 2VWNA 3K6ZA 2FOAA 3ZV9A 1ZZZA 1Q2WA 4ZHAA 4Q2KA 2GZ7A 1BBRH 3RXEA 1O2XA 1O5AB 4AB9A 3NUMA 4FU8A 5AVDA 1S85A 1VCWA 3BIVH 1V6DA 2P3UB 4F55A 4AFSA 4BXSA 4OS4A 4X8TH 2GMTB 3SJKA 3WY8A 1GBLA 2FX4A 2WPKS 1P06A 4NSYA 5CMXH 3A81A 5C1YA 1C5ZB 3FZZA 1E34B 1O3PB 1HAVB 4X2YA 2IJOB 3GCOA 2WUBA 1GHZA 1LVMA 1E37B 1GDNA 2FYQA 4KP0A 5DSFA 1MTSA 3HGNA 3LONA 1T31A 1DE7H 3TIUA 2ZPQA 4BTIB 3ZZ3A 3QGNB 4IC5A 1TAWA 2OINA 1LCYA 1TX8A 2EEKA 1A61H 1RIWC 2IPHA 2WPDD 1O34A 3QLPH 3S7KB 3E8LA 3SU6A 1PFXC 2ZU5A 1O36A
chains in the Genus database with same CATH topology
1SFIA 2A2QH 1XUGA 3EGKH 1LQDB 3H7OA 2D8WA 5FX6A 1P03A 1TGSZ 1GI7B 1K1LA 2PTCE 5AFYH 2Y7ZA 1HIAA 2AMQA 1N8OC 3P8FA 2WV5A 1GCTC 1O38A 1P12E 2VVUA 1C5UA 3P8OA 1A5GH 2C8YB 1THPB 1ESTA 3UR6A 3M3VA 2VVVA 3RUOA 1SQOA 3U69H 6ESTA 2A4OA 4NZQA 1AQ7A 1CT4E 5DP8A 1AWFH 4AB8A 4O3TA 1H8IH 1LQEA 1TGTA 4MQAA 1FN8A 2XBXA 3TU7H 1TBRH 4DT7B 1MQ6A 1A3BH 2ZA5A 1DM4B 4JYUH 1KXAA 1DUAA 1TALA 1T8LA 1ID5H 2NU2E 2VWMA 2R0KA 1NRPH 1O2ZA 2BDAA 3VEQB 1UTMA 2BDYA 4LK4A 4CBOA 1RGQA 1SOTA 4J2YB 1EOLA 1SOZA 1GI6A 4WXVA 1QTFA 2XRCA 4UFDH 1TNJA 2O9QA 1P2KA 2ZCLP 4BTUB 1T8NA 2O8UA 4F4OC 2HNTE 3L33A 1SL3A 1GBFA 2SFAA 3ZYDA 3UY9A 2QC2A 3SQHE 4LZ4B 3I78A 2R3YA 3W94A 2B8OH 2Q6DA 3ZVFA 3LGYA 1A1RA 2ZDKA 3A8CA 4UDWH 3SHAH 1P04A 3LH1A 1FAKH 1GDQA 4BAOB 2SGAA 1HAVA 4X2XA 2UUJB 1SQTA 1HUTH 2FX6A 3GYLB 3QZQA 3BTDE 5K7RA 1EPTB 1YBWA 3M37A 2BX4A 1O2JA 4YM9A 3SNCA 3T2NA 1O3LA 1WUNH 5T6GA 4B73A 4ZROA 1O2QA 2VIDA 3NWUA 1O5GH 2AMDA 4INLA 1O37A 3UOPA 1KLIH 3URDA 1CA8B 3PROA 2QXJA 3MU1A 2J4IA 3QZRA 1V2OT 2A5AA 1GI1A 4CBNA 4IMQA 3TJUA 4Y76A 5A09A 2BQ6B 1P3EA 2ZKSA 2ZU2A 4Y8YA 3E91A 4WH8A 2ZZUH 1GHWH 5SGAE 1B7XB 1QR3E 2ZFQH 3LU9B 1ELTA 2RA3A 1D3PB 1AZZA 3SU5A 1TLDA 3UTUH 3ZZ4A 3A87A 2V3OH 2BVSH 1HYLA 2J95A 1GI2A 1FMGA 1P2MA 4K8BA 4KTSA 1C5VA 2BOHB 1DT2A 1NESE 1SBWA 4DIIH 1SGYE 5JDUB 4AFQA 1V2JT 1F5KU 1B0FA 2W7UA 1UCYE 1QJ1B 1ZSJA 2AERH 3MH5A 3RMNH 3SGQE 2CF8H 1ELVA 2PGBB 1SSXA 2Y6TA 1TQ0B 4Z6AH 1Q3XA 2JETC 1C5NH 1AHTH 2BYAX 1GG6B 1D6WA 4QT8C 3VB6A 3E6PH 1TMTH 3OY5U 4IGDA 5E8EH 1GBJA 4GCHF 2FS8A 3M7QA 2ANYA 5DP6A 2EA3A 1NFXA 5EG4A 1FQ3A 1UVTH 2ZGJA 3KQEA 1EZUC 3ZZDA 2PUXB 1DWDH 1YPKH 2HOBA 1NFWA 4ABFA 1CE5A 1CGJE 4F49A 1C5SA 1YLDA 2RG3A 4AGKA 2UUKB 5EQRA 1NO9H 2FOCA 1PYTD 2R2MB 2AIPA 1GI8B 2OC0A 5HM2A 1EOJA 1LPKB 1EAIA 2HNTF 1BDAA 3OX7U 1P9UA 3QWCH 1WOFA 1FV9A 2C4FH 3RU4D 2RDLA 1EPTA 3S9BA 2ULLA 1W10U 2F91A 7ESTE 5I25A 3SU0A 2PV9B 5DK1A 4NA7A 1HAOH 1C1SA 3V0XA 2UWPA 5EPNA 1B5GH 2QGRA 4MNXA 3U8TH 1OYQA 2WYGA 1MD7A 2BD2A 4MPWA 2QCYA 3OTJE 2H5CA 3UPEA 1IHSH 1SMFE 3SV2H 1SG8B 1AE5A 4X1NU 1O2PA 1V2WT 5DPAA 3RC6A 3SNDA 1RIWB 2VU8E 1AVWA 3Q3XA 2ZHFH 1XX9A 2A7JA 1ORFA 1BB0B 1ZMNA 1KTSB 1ZSLA 1TIOA 2FOGA 3HKJB 1W7XH 1N1LA 8ESTE 2ESTE 2W5EA 2NWNA 4Z0KA 4YOGA 1DLKB 1TMUH 2STAE 1Z6JH 3QTOH 1TBZH 2GTBA 3SZNA 2OC1A 1Z8GA 1C5MD 1N8OB 1TGNA 4ASHA 1N6YA 1UK3A 1GCTB 2QN5T 1BRUP 3M3SA 3M7TA 2PSXA 4D7FA 1BZXE 1PPEE 3TJNA 4CRDA 1Y8TA 4UD9H 4HFPB 1BTWA 1SGPE 2GCTC 1PJPA 2GVFA 1D3DB 3QDZB 1EAUA 2B7DH 4ZKOU 1T32A 1CT0E 2OBOA 1TPPA 6GCHG 7KMEH 5FAHA 1AKSB 2I6SA 2Z3EA 1UCYK 3BEIB 2A4GA 3RMMH 1A5HA 4NA9H 3M61U 1OSSA 2GKVE 3HGPA 2FESH 3BTKE 1SQAA 1A2CH 4O97A 1DICA 1SPJA 1OP0A 5CHAB 3O8DA 1QIXB 2J9NA 2Q1JA 1IOEA 3LT3A 4K2YA 2FOMB 3SJIA 3V7TA 3A7XA 1ETSH 3SU1A 3ZZAA 4ISLA 2FO9A 2GP9B 1Z8JB 2F9UA 4IMZA 1H9LB 5DG6A 1LHCH 3SORA 5C1UA 1O5EH 1A46H 5FBIA 2ZO3H 1XKBC 1B0EA 1E0FD 3P8NA 2XC0A 3VB3A 1O2HA 2WINI 5TJXA 3UNSA 1BA8B 2O8WA 4Q7ZA 2G00A 4Q80A 2V35A 7GCHF 2ZNKH 1DSTA 1DXWA 3LKWA 2VIPA 3T29A 4SGAE 4I8LA 1DOJA 1ELAA 1TNGA 1SGTA 3QUMP 4X2VA 4IS5A 4IW4E 1SLXB 4GAWA 1JRSA 2SNWA 1ARCA 5E0JA 1JXPA 3MU5A 3ZVCA 1HJ9A 1C2MA 1DUEA 5GCHF 1H4WA 2IN2A 3A7ZA 4YOJA 3W95A 3RU4T 1OWHA 1ARBA 1BBRE 3URCA 2ZU1A 1O33A 1WQVH 4BANB 1C9PA 1XMNB 2Z3DA 4IN1A 2FIRH 2STBE 3KQCA 5JYIA 2J94A 3ZVAA 1DX5M 4E06H 3U8OH 1QBOA 2WPIS 1E38B 3UWIA 1ELDE 4X6OA 5L6NH 2GV6A 4JZDH 1O3EA 2ZHEH 2FOBA 5C67A 3G01A 1THSH 1ELEE 1CT2E 3QO6A 5DP5A 1RJXB 3M35A 1A0JA 4DW2U 2HGTH 1TE0A 1MBMA 2W26A 2FXRA 5E2OA 4X8VH 2GZ9A 5GXPA 3SV9A 1IQNA 3ZZ8A 3SV8A 3PTNA 3ZVBA 1GMDG 1S5SA 1JMOH 3RXJA 1H9HE 2J38A 1AKSA 1L2EA 5GPIB 3LGUA 2YNAA 5DO4H 2HPQH 3A84A 1DANH 4YZUA 2FLBH 1Y3XA 1MKXH 2C8WB 1TOCB 2JETB 3DFJA 1V2NT 4Y0YE 1O2UA 1HRTH 4TPIZ 4U32A 3T26A 1O2VA 1FUJA 3FVFB 3LDXH 3S0NA 4TPYA 2ZU4A 2NU0E 2Z9IA 5K0HA 1GHXH 3ATLA 3ZVDA 1SGFG 5T3HA 1HXFH 1IQJA 1ZTJA 4ABBA 1O3HA 1CHOG 1ZHPA 2ZTZA 2F9BH 2P3TB 1EATA 4FUBA 1TRNA 3LOXA 3RXDA 4JK6A 3M36A 1C2HA 1ANEA 1NRSH 2TGAA 2FOHA 4PROA 3FAOA 1WCZA 4TWWA 1TRMA 3PWBA 1NTPA 4WMDA 1IQIA 1RTLA 3QX5H 1C1PA 2ZCKP 1GBTA 1W12U 2EI6A 7GCHG 1RD3B 1A0LA 2FTLE 1UVOA 1Y5BT 3Q3YA 3AASA 4INHA 2V0BA 5B6OA 1BRAA 4FUIA 2PLXA 2BB4A 2WYJA 2B0FA 1NC6A 3AAVA 5JPMH 2AGGX 2BHGA 1ZTKA 2R0LA 1A3EH 9LPRA 3FZDA 4THNH 4YTAA 1ZHRA 3ENSB 1X7AC 1YPMH 1HJ8A 1UMAH 5A8ZA 1IAUA 5AHGH 4JK5A 1AU8A 1O0DH 3MO6A 3TH3H 1GPZA 1T7CA 4DGJA 1S84A 1GBDA 1BITA 2ANKH 4RKOB 1FIWA 1SGDE 4UFFH 4FUFA 5F6MA 3RP2A 2DE8A 2FTMA 2BLOA 1K1NA 1TPSA 1EZQA 1SFQB 4XBDA 3EA7A 5EXNA 1TMBH 5E0GA 1GG6C 1FY3A 1K1IA 3GDVA 2ZQ2A 1QHRB 3RU4E 2NU4E 1SHHB 2EC9H 3D23A 3KQDA 4NG9H 2UWOA 4FVBA 3RXFA 1TABE 1SGFA 4I33A 5JBTA 1UHBA 2GCTB 4RSPA 3ZYEA 1IQMA 3SHCH 3U98H 1UK4A 3LGVA 1IQEA 1QBVH 3MTYA 1JIRA 1GJ4H 1Q31A 1KXCA 3KCGH 4BOHA 3ELAH 1MUEB 4ZHLU 2D26C 4H6SB 2Y82A 5DP7A 3C1KA 3SJ9A 5BRRE 2BD8A 4JYVH 1FAXA 3TK9A 1D4PB 3ATIA 1LHEH 2CGAA 3B9FH 2A45B 1E35B 1J8AA 2GZ8A 3CP7A 1UTKA 4FUDA 3N7OA 3E0PB 3SOSA 1VITH 2ZCHP 2ZDAH 1XKAC 2BDBA 4CR9A 5LPRA 1ZR0A 1C1MA 3U1IB 1SLWB 2TGPZ 3NPSA 4HTCH 3BV9B 1O2OA 3EA8A 4MDSA 1FN6A 2ANWA 3D62A 4JYTA 1YKTA 1O3MA 2PTNA 2GDDA 5EOKA 3PMHB 1MQ5A 2C8XB 2AMPA 4NIWA 1MKWK 3PO1B 3MNBA 2BTCE 4AGJA 1C1UH 1O3DA 1BOQA 3V13A 3UOUA 3B23B 1BIOA 1XUFA 1GJDB 3EA9A 3RC5A 3AVZA 1FIZA 8GCHG 2HLCA 3KQBA 1OKXA 2H1UA 4ABIA 1YCPK 1YPJH 2BDIA 2TPIZ 3DT0H 2AYWA 1O31A 2HWLB 4I7YH 1K1OA 5L30H 3ATWA 3KNXA 3UNRA 1O35A 5HMAA 2P8OC 3LC5A 1SGIB 3GCHC 3A83A 1S83A 3A82A 5T6DA 3MI4A 4NCYA 3A7VA 2F9PA 3SJOA 1YCPM 1W14U 1PPCE 4H4FA 4ABJA 4DCDA 4UEHH 2VINA 1G3CA 4Y6DA 5PTPA 3U9AH 2XNIA 3RMOH 1VJAU 3FP8E 1C5OH 2K1QA 1UTLM 3IWMA 1O2TA 4KKDA 1BTPA 2V3HH 1O3CA 4DG4A 2AFQB 1VITG 1DITH 4NSVA 4FU7A 2R9PA 4D9QA 5GWZA 4MNWA 1PQ8A 5CHAC 1P9SA 1HAXB 4TYDA 2XC4A 2XYAA 3LGWA 1A7SA 1MMJN 3JZ1B 1EB2A 1O3BA 3BTTE 4OS6A 1O3AA 2DE9A 4XBBA 1L4DA 1BJVA 2ZECA 5FBEA 1PPBH 1ZRKA 1FONA 4FUCA 3RXAA 5EW1H 1EX3A 1NS3A 3P95A 3SNBA 1CHGA 4GLYA 1Z71A 2ZC9H 4ABDA 4NFFA 2QXIA 4UE7H 3ZZBA 5C3NA 1UTOA 1QURH 2GDEH 4R8TB 4ISNA 2ZP0H 4MNYA 1BT7A 3T5FH 5EPYA 1BQYA 1DPOA 3P70B 1VCPA 5EGMA 4A5TS 1GHYH 2XW9A 1MTWA 1V2LT 2ZGBH 1KIGH 2QV1A 1WV7H 1TX6A 1XXDA 1J16A 2ZHDA 1KY9A 2AH4X 3M3TA 2ILNA 3RXSA 1G3BA 2JH5D 1ELBA 1YYY1 1M9UA 1PPHE 3MYWA 1OWJA 3CENA 3MHWU 1QB9A 4MG3A 1TNLA 1TA6A 1MTNC 1S6HA 1QBNA 2ZG0H 9ESTA 2GCHG 4ISHH 1DY9A 3AAUA 3ZVEA 2O8TA 1EZSC 4Q7XA 1DS2E 1O5CB 3PYHA 5FHTA 3M5MA 3UWJH 1GJCB 3QK1A 1FZZA 3RXLA 3UUZA 3MH6A 4CHAC 1L4ZA 3JZ2B 4TWYA 1Y59T 3RXMA 1SC8U 1HLTH 1THRH 3TPIZ 1NU7B 4JZIA 4NGAH 2F9VA 4X1RU 4I31A 1BJUA 1KLTA 2VVCA 2BDCA 1DLEA 5HXFA 2PKAB 2ZFSA 5GIBA 1HAZB 6GCHF 1GCDA 4RKJB 4ZAEA 2ZEBA 5A0BA 1F5RA 1AE8H 1O5DH 1ZSKA 4CR5A 3S69A 2SGFE 4K60A 2BXUH 5I46H 2AGIX 3E1XB 3LJJA 1J14A 1BRCE 3ITIA 2G5NA 1NPMA 1QRZA 1RFNA 5F03A 1S81A 1C2GA 1HFDA 1HNEE 3RLWH 3O8CA 3SI3H 1C2JA 1GHBG 1OOKB 1RXPA 1DVAH 2IOTA 2G52A 1O2GH 1K28D 4FUEA 4WXIA 5AFZH 2BD5A 3HATH 1PQAA 1XM1A 2FOEA 4CH8B 2FODA 5JB9S 3BEFB 1ETRH 1XUJA 2A4QA 3BTFE 1SB1H 1QRWA 3PWCA 4GHQA 3A85A 1C2IA 4JZFH 2FPZA 1AVXA 3OSYA 4HGCA 1BHXB 1GJ7B 2FDAA 4X0WU 2EI8A 1SLUB 4XE4A 4Y10E 1OWDA 1FI8A 1XXFA 2XBVA 5EXMA 2ZDMA 4NWKA 1SHYA 4D76A 2RCEA 3RXUA 2Z9GA 3MNSA 4KGAA 1PQ5A 1BTHH 2H6MA 1WTHD 3GY4A 1V2PT 2BM2A 2FI4E 3K65B 1WSSH 1OPHB 3PLPA 1ZGIA 1G3DA 3RXCA 4A1VA 3HKIB 4Y79A 3GDUA 1OYTH 4Y11E 2G4UA 1TGBA 2M5TA 4X1SU 1SR5C 2SGEE 4WH6A 8KME2 3LH3A 2TGTA 1MH0A 2C93B 1MBQA 2WPLS 2FOFA 2VWOA 1K9OE 1P2NA 1TNIA 3MNCA 1Z6EA 2XCFA 1WAYB 2GT7A 1HAIH 1CBWC 1P2IA 4M7GA 4ZHMU 3RXGA 1PQ7A 5DP9A 4K69A 3SUEA 4AX9H 1TYNA 1F0SA 1MCTA 1RTKA 3MO3A 2ZDVH 2W3IA 1AI8H 1KXEA 1P2OA 2BZAA 3M5NA 1LVYA 2BY6X 2PKAA 2Z3CA 1GBKA 2P8OB 2VH6A 1J9CH 3GCHB 1GMDF 1YM0A 1SGCA 1O32A 1C2FA 4ZKNU 1ABJH 1OP2A 4OS2A 1T8OA 2PKSC 3LPRA 3F9GA 1LHFH 2Z9LA 1GDUA 1Z1IA 3BTME 5F8TA 5DP3A 2SNVA 1MD8A 1HBTH 2A7HA 4WF8A 1SGQE 5G4BA 1HDTH 1YPHC 3ATMA 4U2WA 5DP4A 2XC5A 4X6NA 4B2BA 4MLFB 1C2KA 3ODFA 3SU4A