1PQUA

Crystal structure of the h277n mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with nadp, s-methyl cysteine sulfoxide and cacodylate
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
371
structure length
371
Chain Sequence
MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQAGQKAPVFGGKDAGDLKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNCTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCNSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of substrate-binding groups in the mechanism of aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
source organism Haemophilus influenzae rd
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase
total genus 121
structure length 371
sequence length 371
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1pquA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pquA01
4ZVVA 4L75A 1HXHA 3ZV6A 3H3JA 1HYEA 3NYWA 4FGWA 1O6ZA 4CLDA 4N54A 3CINA 2GLXA 4CM8B 1TEHA 3KSUA 1RM5A 1YQXA 3UAGA 2O3JA 5EIOA 3Q1LA 1HZJA 3ZWBA 3DHNA 2XF8A 5F1PA 2DFVA 4BNWA 5JDIC 1UP6A 2YHUA 4YAKA 1B26A 4MP3A 1BDMA 4IQGA 4HX5A 2X8LA 5CP8A 3TDKA 2PH5A 1NP3A 5G4KA 2I65A 4RVUA 4CM5A 3TL2A 4DQVA 3P5SA 4EBFA 4XRGA 1KYQA 4AJOA 3JQAB 3S1LA 1WPQA 1P33A 4FFPA 4J1QA 5GY7A 5T6BA 2EW2A 3JV7A 2JAPA 3PQFA 5F1OA 2GNAA 3H4VA 3RQSA 4YJFB 1CIVA 4MVJI 5JAZA 1PZGA 1RM0A 3VH4A 3WG9A 4BNVA 4CV1A 4EEXA 4DRYA 3DBLB 1DOHA 4MOWA 2FSVA 2HMVA 1YH3A 1SAYA 1GUZA 1ZH8A 3FNGA 3MJ4A 1IPFA 2JCVA 4P4GA 4HP8A 2Y1CA 4NBVA 5JY1A 4WKGA 4ID9A 4ND4A 4Y8VA 3I9KA 1V35A 1DLJA 1WZEA 2ZTUA 3JYOA 2VRBA 3S2IA 9LDTA 5F5LA 3WGGA 1PJTA 2YQ5A 5ILGA 3AU9A 3H9JA 4RQTA 9LDBA 1I2BA 1C0IA 4PLFA 1NAHA 1P45A 5KVQA 3HFSA 4ZD6A 1IZ0A 4ALJA 1ZIDA 1PEDA 3RUAA 1PL8A 3EAGA 5I7SA 2PKQO 5JYFA 4J9VA 2Y1GA 2AEJA 1Z73A 2DBVO 2Q4EA 3VKVA 3VVBA 1YL7A 1QYXA 4TRMA 4TSKA 3OH8A 3PJFA 5CHEA 1VL0A 5ES3A 3HB5X 4OHUA 3FHLA 4OSOA 1EFKA 3GEGA 5KKCA 3K9QO 1T2EA 3G1TA 4Y6SA 5CEFA 3WBBA 1KY5A 2ZJ0A 4RLHA 3RSHA 5FEUA 5FI5A 3ZHYA 4CLXA 4CPDA 3GVHA 3DBVO 4OSPA 1XU9A 1R0SA 1U7HA 1D7OA 1V8BA 4O1MA 1I2CA 1Y7TA 1ZK2A 3QWAA 5IN4A 1KEPA 1CWUA 1FXSA 3JQDA 1GZ6A 3MWDB 2AA3A 1CETA 1U3UA 5COBA 4YPOA 3SX2A 4C7KA 3SBOA 4GMFA 4FDAA 2EGGA 5I9MA 1BXGA 3F4LA 4YJDA 1SOVA 2YYYA 3N7UA 4IJKA 1NVGA 1A9ZA 5FF9A 2CDAA 5U1PA 2FWMX 2PH3A 4FFRA 3I9OA 3W8FA 1O8CA 3PJGA 3WSVA 1D3AA 3WDSA 4YAGA 2PGLA 3E9NA 1RKXA 1P74A 2D5CA 2PTGA 3C1TA 4RDIA 3ST7A 4BGUA 3DZFA 1HL3A 5AXAA 2YJZA 1GCUA 1RYEA 1SMKA 1SCUA 2JCYA 2P5YA 3JD4A 3ANNA 3RCBA 3WSWA 1JA9A 1MXFA 1KBZA 4A27A 1FDVA 2C59A 3H5AA 3U3XA 4B3IA 3ZHBA 1HSZA 4AJIA 1M67A 2TMDA 3MCVA 5L95A 3L4BC 4YCAA 1QORA 2YUTA 1H9AA 4XDZA 4LMPA 2HKIA 5KVVA 1IHYA 3VH1A 2QG4A 3EUWA 3WGQA 1SZJG 4JBIA 2FP4A 3NDIA 1FK8A 1ZK4A 1T26A 2A35A 4LSWA 4XKJA 4XYMA 1HDGO 2QIOA 4JQCA 1PR3A 4A7PA 3BTOA 2JL1A 4QXMA 4RCVA 2E48A 4U6SA 2AEFA 1YB1A 3BA1A 2X6TA 2WYWA 4FJ2A 4IDEA 4RPGA 3ROQA 4D42A 3NT2A 3B70A 3EVNA 3C85A 4BNGA 2WD7B 1LTHR 2Q1WA 1WP4A 4KTTE 4KZPA 4R3WA 1ZUD1 1YKFA 1VL8A 1ZCJA 2CUKA 3VZPA 1E7QA 3KVOA 3LC1O 4HFNA 3PQDA 3C7CB 4P4LA 3N58A 4Q3NA 2AHRA 1R0KA 2ZB7A 2Y0EA 3GUCA 2X86A 3LLVA 3I9MA 4FQ8A 2VYND 1BTOA 2A9FA 1X14A 2ZTLA 3RC1A 1ADBA 4I5FA 4IS2A 2EWMA 3RWBA 3T4EA 4D45A 3HSKA 1HLDA 3G49A 1FDSA 2CD9A 3C7AA 1G1AA 3DXFA 4FS3A 3ZWYA 3QWBA 2IRWA 1I8TA 5JBIA 3W4KA 2HK8A 4LRTB 3ITDA 1OC4A 3JQ6A 4Y9DA 5TX7A 3WNQA 2DBRA 4YAIA 1E3JA 1O0SA 2JD1A 3WNVA 5B4TA 4F3YA 1VPDA 2YHIB 4PLTA 4BNMA 1NXQA 4NMHA 4EDFA 1UDBA 2H6EA 3PZBA 2OMEA 2X5JO 4PFJA 3E18A 5LCXA 2VYVD 4NI5A 2EV9A 4JK3A 4XGKA 4E32A 4ZN6A 4M55A 1ENPA 3JD3A 3EZLA 3MTGA 3SLGA 3JQGA 1EUZA 2EHDA 2SCUA 3JYPA 3OP4A 3E5MA 3RC2A 4PLHA 3DMYA 4XGNA 3GFBA 4YDRA 3QY9A 4JLWA 2X9VA 3QWFA 5THQA 4BO7A 5G0WA 1ZKMA 4G81A 4JXKA 1D4FA 3CIFA 5F5NA 2UAGA 3GMSA 3GUYA 6LDHA 5I8WA 5DN9A 1P0CA 4DBVO 4NPCA 4NK4A 5LC1A 1E3EA 1UJMA 3GNSA 2J3IA 1J5PA 1DO8A 3QA9A 3X2FA 5IZCC 4ALNA 1PGNA 4S3MA 1T25A 3C1OA 3DHEA 3RUEA 1ZMOA 3U5TA 4AJ1A 4Z9FA 3DZIA 4BNIA 4NQZA 3PPIA 3QVTA 1E92A 1LSOA 2NV6A 4BNTA 3BMOA 1SB8A 2DKNA 5JAMA 5DOZA 3T7EA 5EPOA 3GDOA 3MZ0A 1XEAA 1IUKA 2AW5A 5I9NA 1GQYA 3JYLA 2JJYA 1EVJA 3D4PA 4IJVA 5ICMA 1ZNQO 3INGA 3WX0A 2HO5A 3MEQA 1I2ZA 3U9LA 2Y1FA 3HUDA 1DIGA 2YY7A 1YDWA 3H7AA 3JQAD 4QFDA 1W8DA 1NHWA 2Y66A 3GMDA 4J91A 3IUSA 5B37A 3U4HA 3QV1A 3F4BA 1QYVA 2Q99A 4PLVA 1HDRA 4IQ8A 4IY1A 1GD1O 1MA0A 3OIFA 2BGMA 4CMJA 2WM3A 3VZSA 2QQ5A 4YAJA 4CR6A 4BKRA 2NVWA 1NR1A 1UH5A 4J7XA 4OXYA 4BO2A 2PLAA 4M49A 2BLLA 2W90A 1P9LA 1AN9A 2HJSA 2XXJA 4DGSA 1I3KA 1S7CA 3MJVA 4L9RA 4AJNA 4GKVA 3PHIA 1SEPA 4W9NC 3R6DA 4GGOA 3DOOA 1LLDA 1DIRA 1KC1A 2RH4A 4J3FA 4OL9A 1V3UA 1YB5A 2VQ3A 1VSVA 4J49A 1U4OA 5HRUA 2QYTA 1Q7GA 1F12A 3WWZA 4P4NA 1NFFA 1LRKA 1OZAA 2GN8A 2IDZA 1KEVA 3SLKA 4ZU3A 4GSKA 2CMDA 2B5VA 2PZKA 4JBHA 3LC2O 1XHLA 3L07A 4NJMB 1BGVA 2CF5A 1JDJA 4XR4A 5TIIA 4J9UE 4GX5A 4D41A 3PIDA 4E4YA 1WVGA 2J3HA 2Z95A 5JXWA 2BFPA 4ND1A 1ZVMA 3KOUA 2UV8A 3IIEA 1IPEA 1I5RA 1CYDA 3H65A 3TJRA 3E03A 5G4LA 1GV0A 3FR7A 5A1TA 4MKZA 4FC6A 2NM0A 3R3SA 1X1EA 3HHPA 4PLCA 4J16A 1XCBA 3WOHA 1U28A 1JKIA 3QVXA 1D1SA 1F8GA 1H9BA 2G5CA 3UHAA 1O9BA 3ZNNA 3RU9A 5GZ3A 3DZHA 1E5QA 1ENOA 4I9UA 2BMAA 4O63O 2C07A 1HEUA 2IXAA 3WGZA 5C3MA 1HDZA 1U3TA 2DTEA 3VPSA 3GQVA 3ZDFA 2D8AA 3C7DB 2QRKA 4YB8A 1DFIA 4QT0A 2NTVA 3ONFA 5JDCA 3ZWMA 5HTOA 4ZQBA 1C0LA 5U9CA 1ZJZA 3D64A 1LDEA 1W0CA 1KVQA 2YFHA 4BMVA 2XXBA 4YRDA 3K31A 5FFFA 4LCJA 1SPXA 4PZCA 1AUPA 1Z6ZA 1LSSA 1X7GA 2X9GA 3DFUA 2FOIA 4IXWA 5TT0A 1PQPA 2E4AA 1HE2A 3MTJA 3N74A 3DAPA 3EDMA 1ADGA 2ZQYA 4BKUA 3BMNB 3GK3A 1QLHA 4YAEA 3OQBA 2DQ4A 4RZIA 2PFGA 2QZZA 4KQWA 3E9QA 4L4RA 3GGPA 1VJ0A 1NVMB 2E6UX 4GBJA 4AVYA 2JFGA 3TWOA 3FWNA 3QVOA 5B12A 1WDLA 1J0XO 2FR0A 3GHHA 1GAEO 2HK7A 3CE6A 5DCYA 4Z6KA 1QRRA 3PYMA 4BMSA 3F46A 4EZBA 1DBVO 1C1DB 4IINA 1KVUA 3BMQA 3M6IA 5T5QA 4E31A 2YDXA 2O7SA 1B8UA 5IF3A 4BNKA 3WYEA 3ZWCA 3IJRA 2QYSA 3UH1A 4QQRA 1EBUA 1LUAA 4DPLA 1ZEJA 1R4MA 2UVDA 3NJ4A 3PQEA 1JWAB 4YJHB 1R15A 1PIWA 3C24A 3H8VA 5TSDA 4DBZA 4QO8A 5AVOA 4ZRNA 3QIVA 1PZEA 2O3RA 1CEQA 4GQAA 3D3EA 5DCWA 5A05A 1I10A 1QV6A 1ONPA 3HWRA 3I52A 4HFJA 3JQEA 4LMRA 3GC6A 3LYLA 2H1SA 1ONNA 4FFLA 3JCZA 3VKUA 3CZMA 2TMGA 5L4SA 4ROSA 5DOVA 1H6BA 3ZU4A 5DP1A 5L53A 4PIVA 3VH3A 4DLLA 1HETA 1MG0A 1NHGA 2NTJA 1MB4A 3HFGA 4Q3CA 2YZ7A 3ICCA 1KVTA 1DFHA 3G0OA 1KS9A 2NVBA 1ZK1A 1M76A 4EJ6A 4LK3A 4FW8A 2G17A 4ILKA 5AXDA 1B7GO 4EEZA 2WD8A 5A02A 1C0KA 1AGNA 1Y8RA 2D5AA 5ICSA 4UEKA 5EINA 2VYVA 3ON5A 4OJNA 4MVJG 3OEWA 4Q3DA 4Z0PA 3O8QA 3KO8A 4QEDA 2VOEA 1DC3A 1E7MA 1UDCA 2WE8A 5C5IA 1Q2XA 4EI2A 2WD7A 3VDQA 1BMDA 4BVAA 2HQ1A 2HAEA 3W8EA 2P5UA 1BVRA 1I30A 2ZTVA 2ZB3A 3SC6A 3NJ8A 2EW8A 5BR7A 1AE1A 3SVTA 1SNYA 2Z1MA 3AUAA 3RI3A 2C29D 4BHTA 4BQRA 3RKRA 1BW9A 2JCXA 4U0JA 3DBRB 1P1IA 4IIUA 3VPFA 3DTTA 3QSGA 4J6FA 1HKUA 2DBQA 3OJ0A 1VLLA 2YW9A 4PCVA 5I8ZA 3VPHA 2VYNA 4DPKA 1SO8A 4O0LA 2G82A 1PJ3A 5JLAA 3ZWXA 3MJTA 4D3SA 4WUVA 5IDXA 1L7DA 4PRKA 1F17A 1ML3A 2X23A 1KC3A 4BGVA 4BO1A 1LNQA 5IG2A 3BMQB 5DF1A 3INTA 1E6UA 1NX6A 3PWKA 1JTVA 1GQQA 2X9NA 2C5AA 2P68A 5IFLA 3A4VA 4R1NA 4YQYA 8ADHA 1N9GA 3BTVA 4N5MA 4L76A 3B1KA 1MXHA 2PK3A 3I23A 4GKBA 3DBHB 1JW9B 4A0SA 1Y1PA 1MV8A 3AFNA 3T4XA 3PEFA 4NR0A 4GMGA 2AE1A 3PHLA 1ZSVA 3TN7A 4CMKA 3OEYA 1CERA 3COSA 5A4DA 2B4QA 4NK5A 2HU2A 5DP2A 4UREA 5A5EA 5A04A 4DIBA 2ZB4A 4INAA 4WEQA 1XQ6A 3L9XA 4PN3A 4E2ZA 3ZW9A 3KYDA 4ONEA 3GPIA 1HDCA 4FOOA 3KYCA 4CUKA 4EJ0A 4GGPA 4E33A 3W4IA 4BKQA 1XDWA 1I3MA 4ALIA 3V1YA 1G6KA 2IEBA 3KEOA 4KWIA 3WR5A 4FIZA 3OM9A 5IDQA 2DT5A 3AI1A 2IYPA 3DONA 3TZQA 4B4WA 5T57A 4IMRA 4E5KA 3PTZA 1IOLA 1GFSA 1HTBA 3WB9A 4CM1A 4TRNA 1IHXA 1ZW1A 4BUCA 1XELA 2B0JA 1HT0A 2NTNA 1J6UA 1LA2A 3RUDA 1BXKA 4IDAA 3CZRA 5DULA 1LDMA 1QYDA 4BB6A 1NQTA 1V6AA 3K96A 2O4UX 4QTZA 3FTNA 3WTBA 4TWRA 1PS8A 1JU9A 1X0VA 3GG9A 1I0ZA 4BNFA 2VTEA 3B20A 4HY3A 3TOZA 3PHJA 3U49A 4O59O 4U0KA 4X54A 4C7JA 4R1TA 2X58A 5G0UA 2NU7A 4H3VA 2HMSA 1PJLA 1WW8A 3GRPA 4FC7A 4TMFA 1W4ZA 3RIHA 4LSMA 3B6ZA 1ZK0A 3GVXA 5AXBA 1W6UA 5MDHA 2C2XA 1NAIA 3ZV4A 1H5QA 3V2UA 4UUNA 3DOCA 5F1KA 4JIGA 1O5IA 5DCUA 5L7TA 2BFAA 1I3NA 3VHRA 4II3A 2VN8A 3HADA 4NG5A 4URFA 2E37A 4K28A 4D44A 3UKOA 3K2BA 2VHYA 3ZU2A 4XB2A 1SOWA 5KTKA 5EQDA 5A3VA 3ABIA 1GY8A 1KEUA 4BGEA 5CDGA 1R4NA 2HJRA 4O5OA 2Q45A 1UP7A 3JQCA 2ZYDA 1B3BA 1AXEA 4UVDA 3ZV5A 2R6JA 1GCOA 3K6JA 2HCTA 2ZATA 3ETGA 3JYNA 3RROA 4B4UA 4YRAA 2I67A 1PX0A 3RC7A 3H9EO 3GNTA 4HNHA 1XLTA 2J6IA 4WCFA 3G3EA 2NLOA 2I3GA 3DDNA 4W7IA 3WS7A 1EBFA 3MOIA 3L6EA 4WEOA 1U8FO 1OMOA 4ZA2A 1HE3A 1ZMTA 4IXTA 1DRUA 3EYWA 5IJZA 3ZH2A 1NM5A 1XWFA 4K1LA 1YDEA 1Y5MA 1RWBA 1FDUA 3L4SO 1EVIA 2UUPA 2XOXA 1PSDA 1UAYA 3NX4A 5KVCA 5JS6A 1QMGA 4CMEC 1Y81A 1N9GB 2W8ZA 4D3DA 2DAPA 2GDZA 4YEDA 2W2LD 5JPIA 3IKTA 2DU8A 4MVJD 1FDWA 2CNBA 1Z7BA 1BXGB 1YONA 1SEVA 2OBYA 3W4JA 3AOEA 4B8ZA 4ITUA 3UN1A 3JQFA 1E6EA 2DPGA 4WCFC 3NTOA 2BI8A 2CF6A 4UVGA 3V5NA 4CM9D 3KRTA 1V3TA 2EERA 2D4AA 3GRKA 3I9JA 2PGJA 1TB4A 4MINA 4L73A 1Y8QA 4AJ2A 3RFXA 3KLPX 1P1FA 3QE3A 2GN9A 4K6FA 1BWSA 1TT5B 3L0DA 4N5NA 2Q2QA 3DTYA 5L7YA 1HZZA 3R3JA 1QKIA 3DBHA 3LT1A 2HUNA 5T67A 3WFIA 4YJGB 1TVEA 3BAZA 4R41A 2B35A 2OBNA 1AHHA 1YJQA 5K6AA 3BTSA 2AG8A 1X7DA 2CY0A 1YQGA 3ZNPA 4DVJA 1B2LA 3UOGA 1KIFA 4GWKA 3ADPA 2I66A 1KVSA 2Y0DA 4RVHA 1GZ4A 1ZXLA 4BNUA 4MVJM 4E5PA 2HRBA 4OM8A 4WCDA 2ZK7A 3IQDB 3S2GA 4PG6A 4B7CA 3U09A 3SC4A 4BO3A 1PS0A 1U7TA 1WMBA 3RD5A 3KHUA 2P9GA 2QZ9A 4DXHA 1L7EA 4U6QA 4RF2A 3PZRA 4ZJUA 1BVUA 2NVUA 3UCXA 4RPLA 4OKIA 1MC5A 1PQWA 3C8MA 4Y6RA 4ND2A 4PZEA 4RDHA 3PP8A 2DC1A 1PQUA 5BNTA 1XG5A 1EE2A 4E2YA 3QVSA 2GZ1A 4E3ZA 3ONEA 1E7SA 2WTBA 3FSRA 2NSDA 2J5RA 1HSOA 3ASUA 3RJ5A 4J1TA 4R4JA 2NU6A 3SXPA 1QP8A 4CUZA 1EVZA 3TOXA 2O3SA 1J49A 4OQZA 5DBGA 1XYGA 4LN1A 4RORA 3GN1A 2GASA 4HWKA 3DEYX 4OMUA 1ADFA 2WMDA 3G1UA 3HDYA 1P1RA 2C7VA 4KQXA 5AOVA 1E6WA 2LDBA 2VOJA 1R12A 1PGOA 3WIDA 3F9IA 4D43A 1XGKA 4RVGA 3W8DA 1GL3A 3DZKA 4EYEA 1PZHA 3PJEA 5KVSA 4IM7A 1UXKA 3RASA 2O2YA 1X1TA 3ZNOA 2O23A 4MVJP 1UZMA 3AFMA 4DQUA 1R66A 1QLJA 4ALLA 3Q0EA 3RUCA 1N2SA 1YE3A 3U4CA 1ISHA 3KYBA 1A4UA 3PFWO 4B79A 1EDOA 1DC4A 1MC4A 1OFGA 1H6AA 4FJ1A 4WGGA 2G0TA 3I1JA 5T73A 1C14A 4M89A 1GPJA 2VHZA 4GL4A 4B3JA 4NH4A 4YR9A 5KJ6A 4LVUA 3EZYA 5IXYA 2OFPA 4FFMA 1RJWA 3FRJA 1C1DA 3HDQA 3Q11A 2I76A 4KP7A 4CMCA 1PTJA 4XDYA 2AEMA 4OAQA 3WFJA 3E1KA 2YV3A 4PLZA 4MJLA 4QECA 4OH1A 5CEEA 1B16A 2C0CA 3GVPA 1Y8QB 3DOJA 3QWHA 4BNHA 4CMHA 3JQ7A 3V2GA 4XQGA 3Q6IA 1IB6A 3KLMX 2JFHA 4DWVA 3H2ZA 4YT5A 3D3WA 3ZNQA 4LCEA 1UP4A 4B4VA 4QSMA 2JD0A 5K0ZA 3KV3O 3F1LA 2J3KA 1O95A 2JHFA 2OOSA 2RAFA 2VWGA 5ER9A 2HRZA 4AJKA 2BELA 2Y0CA 1Y5RA 3DHYA 1ISMA 3G79A 1PWXA 3HJAA 4F6LA 1Y6JA 3OMLA 4AJEA 4D3FA 3FN4A 4GX0A 1R0LA 2OL4A 1P0FA 4Z9XA 2PGDA 2H63A 3CSDA 1HF3A 1DIHA 3GOHA 2VWQA 3AUUA 1Z74A 3QWIA 4E2XA 4IZHA 1LC0A 2VRCA 4OYRA 1RM4A 2CVQA 5A03A 4BO5A 4DLAA 3ZGYA 2NU9A 2NU8A 3WTCA 3JTMA 2PZJA 3AI3A 1N8KA 5ITVA 4RPJA 5DNAA 1VE9A 3HE3A 2OP0A 3CH6A 3D0OA 3GVCA 3ASVA 4IJUA 3PGXA 5HM8A 2C2YA 5JCXA 2VRCD 1PWZA 4CLHA 1LEHA 3QJ5A 4RPHA 5L40A 4XR9A 2ZCUA 3DZGA 3UUWA 3FD8A 3TPCA 4I1IA 3RUIA 3IS3A 3IC5A 4HNGA 1E7WA 2VCYA 1QYCA 5BNIA 1E3SA 4HKTA 1D8AA 3IKVA 3TQHA 1U8XX 5IDYA 4B4OA 3A9WA 4RL6A 1JQBA 3FNHA 4OOEA 4AFNA 1F0YA 3S2EA 3PXXA 1NFQA 2A94A 4R3NA 1F14A 4A2CA 2OGUA 5IXSA 4J4HA 1A71A 5KKAA 1YGYA 4D46A 3LVFO 3RU7A 2Y1DA 4CLOA 3KETA 1U2GA 5GMOA 4BL5A 1I3LA 3LF2A 1P1HA 4XJTA 2Z1NA 5JDCC 4J4TA 3VAZA 1YWGO 4PLYA 2VNAA 3KYCB 4IZIA 2H9IA 5J9GA 3B1JA 2CVZA 1ORRA 5CDTA 4YJHA 1QG6A 4NNJA 4Y6PA 1X15A 3PGJA 1T2DA 3L9WA 4OOFA 3D1LA 4I9NA 5MGBA 2D59A 3NGXA 4KUEA 4EUFA 4F6CA 2ILTA 2FZWA 2IZ0A 2PV7A 3D3WB 2HMUA 1E7YA 1HRDA 2X0IA 3BHIA 4M86A 1T4DA 3VTZA 4HADA 3I83A 2EKQA 4XWYA 2B69A 3ORFA 4TRJA 5IAAA 1U3WA 4CV2A 3LSYA 3VPGA 4TVBA 1YOVB 5IDWA 1Z45A 3VPXA 3WGIA 1OBFO 1KOLA 5EQFA 4KMSA 3KYDB 1MP0A 3TL3A 5L4NA 3GGGA 4XQ9A 2ZCVA 3DB2A 1RM3A 4KOAA 1AHIA 2IZ1A 4CR7A 3WXBA 2RBEA 4BKPA 4KDFA 3NEPX 4YT2A 3PYXA 2A4KA 4WNCA 4F45A 3E48A 4FB5A 1WLYA 1I01A 2B5WA 4P22A 1IY8A 4Q3EA 4TKLA 4DMLA 5BSFA 5CDSA 1NBOA 5EMHA 3CMCO 4RF4A 1F06A 3HDJA 4AG3A 3NDJA 2E49A 2NUAA 1DRVA 3LT0A 3E8XA 4TQGA 2FMUA 3IP1A 3GGOA 4BO4A 3ANMA 4HXYA 3UGKA 5JNLA 2PKQP 1LI4A 3P7MA 5KOIA 2QRJA 4CQMD 3O8QB 3M1LA 3JQBA 5JSFA 1QYWA 3FI9A 2HMTA 3ENKA 5KWEA 3OA0A 2QRLA 2PY6A 4MDHA 4QFCA 2GERA 4Y98A 3E82A 4MKXA 4YRBA 1ZEMA 4EW6A 1Q0LA 1K6IA 3KEQA 1AXGA 5TF4A 4JBGA 2VNSA 3PHHA 4L8VA 1BW9B 4AJHA 1E5LA 2BFOA 3ZZNA 1CQIA 5GZ6A 4FCCA 3PWSA 1E3IA 2H5LA 2VWHA 3D4OA 4XX0A 2F1KA 2W2KB 5HA5A 3D5QA 2OP1A 5C7OO 2PR2A 4O6VA 3W6ZA 4YBZA 4CUJA 3UVEA 5KNLA 3SJUA 3BZUA 4MPDA 4RJTA 3ZI0A 3K2EA 3TZCA 1NWCA 1OAAA 2BGKA 1CRWG 1B3RA 4R1UA 2AG5A 5L3ZA 2J3JA 1U3VA 2V6BA 2DUWA 4KUHA 1B8VA 1LSJA 3OFSA 4WLUA 4YJFA 2PZMA 4FGSA 5JCJD 2JFFA 2AQIA 2NVUB 4L4SA 5G0TA 3F6YA 5I7EA 2X0JA 2D0IA 3LU1A 3DFZA 1ZFNA 5B1YA 3PDJA 1RPNA 3AY3A 2IEDA 2Q22A 3DWFA 3ZWVA 4R68A 5JCJA 3AM3A 1LQTA 3IJPA 4UULA 2B37A 3ZHXA 3I9NA 3ADOA 1JN0A 4CM9A 4J1NA 5F21A 2P9CA 4UUMA 4GLOA 5BNFA 1I33A 1JAYA 3UF0A 4MVJA 1C3VA 1NQAO 2B83A 2EGHA 3KZVA 2W2LA 3OECA 1LLQA 5CG1A 2Q4BA 1ZO8A 3HNPA 4KDEA 4BOYA 1EEHA 3H9UA 4DIFA 3BHMA 1BHSA 3AK4A 1P31A 1XU7A 2VHVA 1U4SA 1ISJA 3NUGA 4CLRA 2I6TA 4I5DA 4J4BA 1I24A 1KETA 2FRDA 3H5NA 3PIIA 5KJEA 3T7CA 2LDXA 4CQLA 1MFZA 3VZQA 4CM6A 4TZTA 5CPFA 1VSUA 4Q3BA 4BO0A 4DC0A 3DQPA 1I32A 4Z3DA 4G2NA 2BHLA 4EJMA 5K9ZA 2O3TA 5DT9A 2A92A 3ETEA 3LF1A 4UUOA 5JMWA 1TLTA 4TKMA 3BMCB 1KVRA 2VUUA 3GG2A 4CLRB 4MIOA 1UZLA 2FHSA 4CL3A 4XYBA 5BSEA 1GYPA 2PNFA 1GZ3A 4Z3KA 4J43A 1Y9AA 1K6JA 2VUSA 2VZ8A 3NDRA 3DMTC 5TJHA 4AJ4A 2D1YA 2P9EA 4BGIA 2EEZA 4XA8A 2GR9A 4NBTA 4WCFB 2C54A 3WGOA 1GPDG 1EMDA 2FR1A 3LQFA 4QO7A 3VOSA 2Y93A 4B3HA 4IUYA 1JKJA 2VUTA 1P44A 1T2FA 4NBUA 4A26A 4PLPA 8LDHA 1VKNA 2IYOA 1D1TA 2I5PO 1LDGA 2NACA 1CDOA 3LK7A 2Y1OA 3EK2A 3MWEB 2DTDA 3QQPA 4MP8A 4AJPA 3IAHA 4CMIB 4YA6A 5G2OA 4OO3A 2W98A 2RHCA 3FF4A 5JY6A 2DTXA 3AM4A 5TQVA 2EP5A 4BNLA 5JYEA 4XYGA 3WGHA 2WE7A 4OXKA 1N1GA 1T1SA 1Z82A 2IZZA 4NJMA 1JVSA 1NQ5A 1JWBB 4J7CA 3WGYA 3A1NA 4J0FA 2DFDA 4QX6A 1E7RA 1BDBA 4IS3A 4DUPA 5EN4A 2CZCA 2HMWA 4HUJA 5JW6A 3PVZA 1YQDA 5B4UA 5ENVA 1VJTA 3HQ4O 2OXIA 1JKFA 5A9RA 4TVOA 1UXGA 4XQEA 3Q3CA 4LISA 3I4FA 1LLUA 1LDNA 1KEWA 1YXMA 1YL5A 3GHYA 5T8KA 2FY8A 1IL0A 3A06A 3DAGA 4I8XA 3ZU5A 4B7UA 3ROKA 2UUOA 4BV8A 2YV1A 3GN2A 3JD0A 4IPTA 4N7RA 4ND5A 3W1VA 1E3WB 2NQ8A 2I9PA 4QUKA 5L9AA 4XYLA 5T8KC 1E77A 4EGFA 2VT3A 5JMPA 4U7WA 3K8ZA 2DLDA 5TS3A 4DQXA 3HDHA 4YT8A 1A72A 1A5ZA 3WMWA 4CMBA 3TZHA 2GN6A 2X5KO 4LW8A 2Q3EA 5FI3A 1Q0QA 4NU6A 4DYVA 3PWZA 3VDRA 4PG7A 3ZN2A 5L4LA 5L51A 1E1KA 4BQPA 4RO0A 1T2CA 5CDYA 3PRJA 3H2SA 4OGWA 4RQUA 3FPLA 4FOSA 4CQMA 2AQKA 4W6ZA 5I9LA 2PD4A 4D79A 1N7GA 2X7HA 4R5MA 2EF1A 1B14A 2OHXA 1DJQA 3QRWA 3O9ZA 4DREA 2EP7A 4DA9A 4L74A 2DPHA 1B15A 3EGOA 4UVIA 2R00A 4I9HA 4E30A 4YJGA 1CJCA 1VM6A 4R9RA 3I5MA 3V2HA 1NWHA 1Q7CA 4OKNA 3PJDA 3TRIA 4UUPA 4UVEA 5CPBA 4KWHA 3I6IA 4E5YA 4IGFA 4RF5A 5M6DA 4C4OA 4MIYA 2VHXA 3H9GA 5HS4A 4FPXA 4AL4A 4EUEA 5IN5A 4CMGA 4CMIA 1K3TA 1E1MA 1A7AA 1HDYA 1NYTA 2B36A 3D7LA 2Q2WA 3GFGA 3JQFC 4I08A 3JQ9C 4B8WA 3TZ6A 2C7GA 1PGJA 3BMCA 1C1XA 2BKAA 4JROA 5ER6A 4II2A 3FNFA 4PRLA 4U8GA 4NZ9A 2Q49A 1SC6A 2I99A 3WICA 5G0VA 5C7LO 4YQZA 2O4CA 2P4HX 4R54A 3OIDA 1LJ8A 2Y68A 4WLEA 3UCEA 4W9NA 3UXYA 3F5SA 1NPYA 4IJWA 4XJSA 1NVTA 5CG2A 3L77A 5JAIA 3H6KA 4EUHA 1GV1A 3PYLA 1Q1NA 1V0JA 4XRRA 3JQ7B 2OZPA 2GRAA 4H16A 4MO2A 1M6HA 1VRWA 3Q2KA 4CR8A 2CDBA 2NWQA 1PGPA 2YHIA 3I9LA 3A14A 2WYUA 4D7AA 3PLNA 4MVJH 3M2PA 1Q0HA 5L45A 3OQ6A 1SB9A 1Y9EA 3LDHA 4JJGA 5BSGA 1GUFA 2V6GA 4R1SA 4ZQGA 5TJ9A 4GSLA 4GVXA 5AXCA 4TZKA 4XIYA 3KM0A 4PG8A 3KB6A 5AQ1A 3ROMA 3OETA 1DC5A 3BYZA 3MJSA 4W4TA 3JSAA 5ADHA 2NNLD 1IE3A 2AQ8A 3JYQA 4NFYA 4ZRMA 4JP3A 3GH3A 4M1QA 4BIIA 2BD0A 2BRUA 3RUHA 4NDNE 2HSDA 4WLOA 1FDTA 3ULKA 3H3FA 4JCOA 3NKLA 3CMMA 3GEDA 3OQ1A 3ZCXA 3PK0A 5KJ1A 1E1NA 2RCYA 4DMMA 2RIRA 1P3DA 1WAMA 5BSHA 3KXDA 2X0NA 1HWYA 2QHXA 4NHEA 3DZJA 1GADO 2ZYGA 5JC1A 3WYBA 3F1KA 2GN4A 4XZ3A 2ZB8A 4XQCA 1LRLA 2DVMA 4RLSA 3WLFA 1RYDA 1EFLA 1ENYA 5HS6A 3P2OA 2POQX 4WLFA 3EW7A 3RBZA 3U4DA 3WYCA 1M66A 1ISIA 4ZHSA 3B1FA 1ULUA 2EKLA 2OO5A 4NFSA 3WLEA 3LT2A 2GCGA 3GLQA 4NJOA 5TRTA 3ZU3A 1K5HA 1XQ1A 2HLPA 4BO8A 5KJFA 1OI7A 3K73O 2ZIZA 4PG5A 2EIHA 1DDOA 4J2HA 2Q2VA 3NTQA 4CM8A 3OBBA 5FWNA 2GSDA 1YRLA 1LDYA 1S6YA 2O2SA 4RVFA 4WK6A 1P1KA 4YWJA 1WMAA 4R16A 4WECA 2VHWA 1T24A 2W4QA 1H6DA 1ISFA 3A28A 3O38A 4A10A 3CXRA 3FTPA 3H5RA 3BMOB 4AICA 1HDXA 4R69A 3HB4X 1PJ4A 3HG7A 3FBTA 4KTVE 4EITA 2FPIA 2ZJ1A 4RZHA 1NPDA 2OORA 3BMNA 1LLCA 3OICA 4YVFA 3KUXA 4RF3A 3ENNA 5LDGA 4DLBA 2GUGA 1R4MB 4NBWA 2CFCA 4W7HA 1P77A 3F5QA 5KIAA 3MOGA 2AMFA 4CODB 5KCZA 1PR9A 4L0QA 2B4RO 4GPD1 2YV2A 1UXIA 1UZNA 1XSEA 2V7PA 2AXQA 1BRMA 3C1AA 3TF5A 1R6DA 2WSBA 1B8PA 4JP2A 2C20A 1HDOA 4R01A 5H81A 3OHSX 2WDZA 4ZQFA 5G0SA 3AUTA 1W73A 4ZICA 5ITWA 2JAHA 3NV9A 3BXXA 1ZXBA 1FF9A 1YS4A 4PG4A 4BB5A 3FPCA 5HBRA 1DLIA 1V3VA 2R2GA 4Q3AA 4XEHA 5COAA 4CV0A 1YBVA 2JD2A 4Z0TA 4BNJA 3IP3A 3O26A 2ET6A 1K0UA 2QX7A 1O89A 5TC4A 1MG5A 4L4XA 2BH9A 2Y05A 1QSGA 2VZ0A 1EE9A 3VVCA 1PL7A 3ROPA 3I6QA 1GYQA 4CV3A 1VC2A 3JD2A 5FYDA 1WXDA 3GEMA 1NFRA 4LVCA 3MJEA 4RVSA 5A9TA 3HN2A 1HLPA 1KY4A 3BTUA 2Q50A 4Q9NA 3ANLA 2X4GA 3WJ7A 3EC7A 3RKUA 3P19A 3OIGA 1GQ2A 1U1IA 1K6XA 3RFVA 2RHRA 4OIMA 3RFTA 4R51A 1B0AA 4W99A 4JJFA 3EY4A 3KTDA 3P2YA 4BNZA 4XD2A 4IDCA 1PJCA 3S55A 3Q2IA 2IE0A 1TI7A 2YDYA 3AUSA 3GDGA 4DL9A 1NPTO 1XR3A 3L6OO 4NFHA 1QXSA 1SBYA 2VWPA 3DBLA 4GWGA 5DZSA 3RAJA 3CUKA 3HZZA 2FPGA 3GZNB 4G65A 1LQUA 1N7HA 3AOEC 5TGDA 4A5OA 4HFRA 4XCVA 4E21A 3ZWPA 5KJCA 1J4AA 1LBEA 1NQOA 4E6PA 1Q7BA 4FN4A 4JJIA 4PVCA 1H6CA 2CSUA 4XYEA 4FFOA 4CQMB 4IIVA 4E5MA 2B4TO 3JQAA 3INRA 4JN6B 2X5OA 2VZ9A 4YACA 2P2SA 1PZFA 1Z7EA 2Q1UA 3GNQA 3O4RA 4BV9A 3STHA 3AI2A 3Q9UA 3WGTA 1L1FA 1LRJA 1YL6A 2E82A 3NTRA 4H15A 4R9SA 1N1EA 1UAGA 3UFXA 2YQ4A 2GGSA 4J7UA 1DRWA 4HBGA 1P1JA 4CLOB 3TNLA 1U9JA 3EHEA 2G76A 1ZK3A 3M2TA 4M54A 4N18A 4HFMA 3AM5A 4YT4A 3IOYA 4BO9A 4D0SA 3ICPA 4XIJA 3JQBC 1E3WA 4GAEA 3SEFA 3Q9NA 4FD3A 6ADHA 3GZ4A 1X7HA 3WQRA 2C82A 4DTIA 4S1VA 4XGIA 3WQSB 2W2KA 3U62A 1BSVA 1ZJYA 3M1AA 1YBMA 3U4IA 3GVIA 2Y67A 3JQ8B 3TFOA 1UXHA 5JYDA 3WMXA 2PD3A 4K9DA 3GDFA 4BMNA 3IL2A 1ONOA 1DIAA 1DAOA 4J0EA 4ZQEA 3VZRA 1G0OA 2ZYAA 5DBIA 5ENDA 2AQHA 2EJVA 4DIOA 3OJFA 1VKOA 3EMKA 1CF2O 3KSZO 2HK9A 3FCOA 3DC2A 4FJ0A 1EK5A 4E0BA 2PZLA 4DYDA 1NASA 5JFOA 1HE5A 4WJZA 1GYRA 1BXZA 3DAFA 3GR6A 5JC8A 3PDUA 4J2OA 4ZQHA 2DBZA 4WNIA 1EVYA 4UAGA 1JVBA 4BNNA 4XB1A 4LGVA 1X13A 2P4QA 5EL0A 5TLSA 1HE4A 4I5GA 1XA0A 4GX1A 1DSSG 4RPKA 1HYGA 4RGBA 4P8RA 1T2AA 3GAZA 7MDHA 4MKRA 4BNYA 1IULA 1EUDA 2IXBA 3H9QA 2V6MA 1NNUA 4D0RA 5B4VA 3ZWNA 3PI7A 2O3UA 3HN7A 3NT5A 4MVJE 2UYYA 2JKVA 2GYYA 5T64A 4E2WA 2IODA 3VC7A 2J5QA 2WJPA 1LXCA 2PWZA 2AE2A 1H2BA 3KSDO 4JX8A 2HDHA 3PLRA 3WIEA 4M87A 3K92A 5CAEA 1GR0A 1EUCA 1ID1A 1PJSA 2C5EA 4WLNA 3U0BA 3WQQA 2O7QA 4IDBA 3QLJA 4Z0HO 1WNTA 2DM6A 3E5RA 4BNXA 1PGQA 1PJBA 1XKQA 1YVEI 1VL6A 5A06A 1JAXA 1UUFA 2QW8A 1G0NA 1F8FA 1M2WA 3JQ8A 4AJLA 1K89A 3L6DA 5THKA 2WEKA 1DB3A 4OQYA 4E12A 3AW9A 4IDFA 4ND3A 4OXNA 3LC7O 3GF4A 3WBFA 1DJNA 3R0IA 1TT7A 4MP6A 5K6AC 3BIOA 2Q1SA 7ADHA 5H82A 4G5HA 1NTOA 1LC3A 1Z75A 1EQ2A 1N5DA 1GEEA 4ZGWA 1GUYA 2GF2A 1LSUA 3AJRA 3QHAA 1EK6A 3TZKA 2EJWA 4IQ0A 2BF7A 3NAQA 4B7XA 1DHTA 3EVTA 1VJ1A 4BS9A 3LT4A 1GTMA 1MUUA 2NADA 5JE8A 1GEGA 4IMPA 5CDUA 5A9SA 1H93A 1Y8RB 2VT2A 4CM3A 1E1LA 4U5QA 5L7WA 2J5KA 3E9MA 5IZ4A 2F00A 3E6AA 3OJEA 4FBGA 4MIEA 1WDKA 5JO9A 1T4BA 1N92A 4K26A 5G4KB 2X22A 4DC1A 3ZV3A 4A73A 4CMEA 4CM4A 2GZ3A 2FR8A 3PFFA 3CEAA 3AU8A 1UXJA 1E3LA 1WWKA 5DBFA 1ULSA 4IBOA 1EZ4A 1U5CA 2FSSA 3WJAA 4H7PA 2CVOA 3FR8A 4UEJA 4NU5A 4WOJA 1I36A 2RH8A 2X0RA 3GAFA 4P38A 1VI2A 3GA0A 2Z5LA 4YTEA 3RBXA 2GO1A 1DPGA 1YBAA 3UCFA 5JDIA 3DO5A 1DC6A 5EESA 2FZEA 3C3XA 4RVDA 2CDCA 4RV9A 3DR3A 3GT0A 3X2EA 4IGEA 1MFPA 4PVDA 4TRRA 4CMAA 3F3SA 5TT1A 3IUPA 4K6CA 5A3JA 4HV4A 1GDHA 3PHGA 4GI2A 3DL2A 1TA4A 5JAQA 2Y99A 3V1UA 3DBRA 2PKRA 1A4IA 3JD1A 3I4CA 3K5PA 3OSUA 4TROA 1C1XB 4ALMA 2V6FA 2O3QA 4JGBA 1LDBA 5BQFA 3ZWAA 3D5TA 5C7IO 4M8SA 4CQLB 1OOEA 4WE3A 5EERA 1MGOA 3LLSA 2Q1TA 1HYHA 4GVLA 3AY6A 3GPDG 3OJLA 4UEOA 3NT4A 2BGLA 3I3OA 3W6UA 4CM4B 1H0KA 4FSHA 2ZTMA 3ETDA 3LZ6A 3OF2A 1KERA 1EQUA 3AY7A 4Q39A 2G1UA 1DFGA 1ADCA 3IMFA 1FMCA 5J23A 1QV7A 2ZKLA 1E0DA 3D4NA 3MJCA 1H94A 3ITKA 4F46A 3JQGB 5BT9A 2Q46A 1U5AA 3R1IA 4IDDA 3RUFA 1BG6A 4IDGA 2GD1O 4KUGA 5A9SB 3TFQA 5H83A 1YOVA 1ZSYA 4WOKA 1EDZA 3QW2A 5IZCA 5I7FA 1ZBQA 1GU7A 3GY0A 5HWSA 1R37A 4Z9YA 5A5FA 2DUUA 2WWRA 3BHJA 4PGFA 1O94A 1ENZA 3TSCA 2OUIA 3OJOA 4BKOA 2UDPA 1DXYA 4A03A 4JNKA 3RJ9A 5ILOA 5LDHA 3JQ9A 4GH5A 1H2HA 2EXXA 3K30A 4UVHA 1M6WA 2GPTA 3GZNA 3RVDA 5AYVA 3CPSA 1IZ9A 4GLLA 5U4QA 3ZHZA 3AWDA 4N5LA 1ISGA 2EG9A 5TNXA 5GZ1A 1LU9A 1TXGA 4CL8A 1PJ2A 4CJXA 4PZDA 1DEHA 3KBOA 2GZ2A 3G17A 4I5EA 1QR6A 4R5HA 1IYZA 4NBRA 2V65A 1MLDA 4WPGA 1R16A 2ZQZA 3VTFA 3F47A 1XIVA 3S2FA 3OA2A 1PS9A 1TT5A 2WYVA 2Y1EA 2EKPA 4E5NA 5I7VA 3WWYA 2O50A 1WDMA 2FPPA 3ZWOA 5COQA 4BO6A 1FJHA 3L4BA 4YXFA 5F3RA 1U2DA 1PJQA 5JYAA 4AJJA 4GX2A 3UICA 3V1TC 1A27A 1C0PA 3NRCA 2BI7A 4CLEA 2J8ZA 2VTDA 3FNEA 3QP9A 3FBGA 4E13A 4J90A 4NIMA 5C37A 3CTMA 3UW3A 1A9YA 2FN7A 4LRSB 3IDSA 1DAPA 1YO6A 5CEJA 1ZSNA 2R00C 2P91A 4YYZA 3ONDA 1NR7A 4FR5A 4PLWA 1OC2A 4CM7A 5CFZA 1YJ8A 1JLLA 3QVWA 1CQJA 1WZIA 2PD6A 1T1RA 1LX6A 2D2IA 2D3TA 1MX3A 3SJ7A 2JHGA 3AOGA 1PU2A 2X1HA 3V8BA 1X0XA 4J1SA 3CKYA 3VH2A 3ZW8A 4WLVA 1DIBA 1UDAA 3O03A 4MVJF 3ZWWA 2NQTA 1V9LA 1PL6A 2YFQA 1M75A 4Y67A 2BFMA 2XAAA 3DMTA 3RC9A 4DPMA 4ESOA 1K2WA 2PA3A 2XPCA 1ARZA 4PLGA 4WASA 3FWZA 1R4NB 1YB4A 3S8MA 1DHRA 3RBVA 4ALKA 5EJ2A 5DDIP 2I3AA 1ZZEA 3NGLA 1A7KA 4FFNA 1UR5A 5JO0A 3DZBA 2O48X 4W82A
chains in the Genus database with same CATH superfamily
3OZTA 4ZVVA 2IYVA 2FMHA 5LZ4A 2EFJA 4DCUA 3EAQA 4FGWA 1DEOA 1UK9A 2H48A 3ORQA 2F1OA 2HCJB 5IT9A 1OXMA 1PEYA 1IY1A 3CINA 2UXDB 4FOTA 3L7OA 3VNQA 3VC3A 2O3JA 5EIOA 1PUIA 1Z06A 4B2YA 2ID7A 5DE3A 1HG1A 1KFKB 4J0GA 3ZQUA 3VISA 1XVUA 4CDMA 1WMFA 4X8OA 4P4UA 1XEXB 4BNWA 5JDIC 3M6UA 2YN4A 4LXYA 4COOA 5M3BA 4URUR 3TEMA 3LUJA 1PF7E 1JAHA 2PH5A 1NP3A 1OXBB 3PFKA 4KXFB 5G4KA 3W8NA 3KQVA 4NC9A 5E6UA 2I65A 3F6RA 4RVUA 4CM5A 1ILWA 2HSJA 4QPJC 4D5EA 2ZVPX 2DH5A 2J4DA 1EH5A 3C3DA 4I1RA 4KV9A 1DBSA 4XWTA 1IJFA 1P5HA 1U6IA 2PBRA 3JV7A 3LRTA 4UHFA 1ZI8A 3A8TA 2BY4A 3HZHA 4P98A 2PX2A 4GMXA 3K9LA 3WSTA 4MVJI 1BDJA 1PZGA 3M34A 5JAZA 3WG9A 4EEXA 2D74A 3P0HA 3VKHA 1QX4A 2O7RA 1DMRA 4DRYA 1UBMS 4OQMA 5H70A 3T9BA 2R1UA 2CBXA 3IMEA 3URKA 4KITB 1Z6TA 4R8VA 4PYIA 1N5LA 1SAYA 1GUZA 1ZH8A 1OJLA 3MJ4A 4B45A 3VGPA 4HP8A 1EG7A 1RRMA 3M6VA 4QVGA 1N2CA 2DHRA 2P6OA 5LMCA 1JR2A 4P5PA 4WKGA 4ID9A 3T1QA 5EAIA 1SKBA 4IX1A 4KJZA 1V35A 3RS8A 2Q8QA 3O7MA 2XWPA 1YCGA 3O47A 1C1HA 3JZDA 4UNRA 5EIWA 3PB3A 4C4RA 5EG5A 4JLKA 2ZP1A 3FLEA 4IUBS 4ARCA 1J2YA 4D4LA 3AU9A 4A92A 1BJKA 3REGA 4EPXA 3RG8A 3ZVKA 4M0LA 2P0AA 3F9CA 4K9OA 4JV5B 4G0OA 4M0CA 4NLLA 5EE0A 1BDIA 4JKYA 1WCIB 1VJCA 5AKYA 3K05A 1PEDA 5KO2A 2NXJA 3JATB 3AEKA 3O8CA 4YLEA 2PX4A 3AF3A 4LJ5A 2AEJA 3HMQA 3IAEA 3MILA 2Q6VA 3DV0B 4FW9A 2DBVO 3Q3GE 3U3KA 3VKVA 4GWLA 5ALQA 3RGWS 1TJYA 2GYWA 4C7OA 5JXIA 3P2KA 1IWPB 1DJLA 3BBLA 3PJFA 1VMEA 1A9XB 3HB5X 3DCJA 4IYRA 2ZBQA 2YHAA 3FHLA 4QYXA 3TR0A 5E9JA 1IXSB 1DTWA 1U5BB 4MWOA 3TW4A 3GEGA 4ARVA 2B25A 1Y7IA 5IYZF 4V0OA 1T2EA 2SKDA 4TL6A 1FFXA 2EZ9A 2KPOA 4Y6SA 5CT8A 1WG8A 4Q1FA 5E6SA 1Y63A 5J1TB 2F62A 2FUG6 4RLHA 1ZN7A 3X44A 1KXJA 2AMLA 3JPYA 2J9FA 1U7UA 1XHFA 4CLXA 5FPTA 3DBVO 2ECOA 5KI6A 1IEXA 2GBLC 2CXSA 1QHSA 1D7OA 3LY5A 3QQ5A 1I2CA 3A9CA 4WZBE 4GL2A 1Y98A 3KHSA 1YZTA 5JCZA 5CITA 2XWBF 2QBYA 5COBA 1L5OA 1P2VA 1U3UA 1HFKA 2CKDA 4PSAA 3SX2A 4YPOA 5JSZB 1E79A 2WJHA 1N5MA 1QAQA 5IKMA 3F4LA 1F4LA 4YJDA 3N7UA 1GNPA 1A9ZA 1SVWA 3EIUA 4NMXB 4F4HA 4LJ7A 4LPKA 2PH3A 5LOVA 4G5FA 3WA7A 4W5TA 2R8XA 4HZGA 2ISCA 3W8FA 2OLEA 4HAUA 5JAOA 3WSVA 3OT1A 3H5LA 2A9KA 2NPOA 2P5TB 3C4QA 3PPVA 4ENPA 1GQRA 2IUTA 3C1TA 4PZLA 3ST7A 3TW6A 2W48A 5AO9A 3ROZA 2H65A 4BGUA 1X1BA 5H3LA 3DZFA 1G5PA 2YJZA 2P5YA 2Q4DA 1T4CA 3VYRB 1W4CA 2PGAA 3ANNA 5EKDA 2G9QA 3OEHD 1U7WA 1YU6A 2M32A 3PC2A 4LZPA 5EZQA 1PBNA 1S8AA 4ARAA 1FDVA 2C59A 2NSLA 1EDDA 1USUA 3ENWA 3H5AA 5THXA 1FY2A 2VA8A 3ZHBA 1HSZA 1RHUA 1XK7A 4TXHA 4CE6A 1QORA 3WLSA 3X1ZA 4BVKA 1H9AA 1I6MA 3COWA 3IDFA 3L1JA 1FLDA 4OH7A 5D5PA 3Q5DA 3WGQA 4HMOA 1SZJG 1FCJA 3NDIA 4LKRA 1FK8A 1ZK4A 2B6HA 4LSWA 1HDGO 2KHZA 1OPXA 1N8NA 2ZPAA 3M7IA 4JQCA 4QWMA 5DIZA 3EQ7A 5JSHA 5JZMA 4D4GA 2HWWA 2BBTA 4LHWA 1M33A 5BOSA 3RVSA 3BRCA 5HCIA 4YV0A 2PZGA 4RPGA 3A4MA 3W9BA 5FLKA 3T9AA 1PHRA 3NT2A 3B70A 5D7NA 2GVDC 4BNGA 3MFYA 4HS9A 5ALTA 3IILA 3VJLA 1H0SA 3RRJA 3U5ZB 1M0SA 3PR1A 3IYLW 3HLTA 4J0DA 4GOLD 3T61A 4Z7OB 1NG9A 1AKEA 3PXUA 4ZI2A 2BE7A 2VJQA 3VZPA 3KU1A 4JS0A 4YRMA 2CT8A 4OPMA 4BV3A 3N58A 4Q3NA 4EKYA 1WU8A 4P53A 4RMIA 4K2AA 1FTWA 3RQIA 5BQ3A 3LOUA 3OEED 2X86A 3H4MA 4OGFA 1GGNA 3PD0A 3AVTA 2VYND 1J06A 3WHIA 1LWOA 2D1SA 4XIGS 3AHGA 3G9TA 3PFGA 3KOOA 4IWXA 4OHYA 2EWMA 1UBLS 3AONB 3RWBA 2HQBA 1HLDA 5EE1A 2MOKA 1FDSA 1E3MA 1LGYA 1M2FA 4X71A 4UBJA 3HO1A 1G1AA 4OU4A 3DXFA 3LQKA 3AH8A 3CUSA 4FS3A 4U63A 4UCFA 3ZWYA 1JTEA 2ECQA 1DWPA 1XTTA 3IGFA 4O8JA 1QFZA 3ABRB 2Q0QA 3JQ6A 3MPOA 3BE4A 4Y9DA 3WMGA 4ARZA 5CFOA 4YAIA 4RTJA 3WGVA 4O4IB 4BMZA 3WNVA 5DMXA 2OBMA 2CE2X 1MENA 1VPDA 2D06A 3GLGA 1NVUQ 4BNMA 2JKZA 4X7RA 4PPYA 5H16A 2WJAA 2F3QA 4P7JA 1UDBA 3BL8A 7YASA 3N28A 2OMEA 2X5JO 1TTPB 3EGVA 3LCCA 3Q7PA 4XGKA 2QPAA 2DETA 5E4TA 1CB7A 2VCHA 5AJVB 2Q8NA 1J20A 2I2DA 2QK4A 1DAGA 1Y4UA 2OGWA 2H85A 3EZLA 5LLSA 3T7TA 3MUNA 3VVMA 4JYMA 4TOIA 2ZVDA 1X38A 3E5MA 3GFBA 3L7MA 4BFSA 1XPUA 1VXOA 1RXYA 2JCSA 4S1OA 5CYPA 4JLWA 3QWFA 1UJ2A 4JP5A 5LZ8A 4ZMBA 2QQEA 3EGCA 1P62B 1JV2B 2TECE 4WBNF 1OBHA 1ACJA 5EHGA 3ZJYA 1SZCA 3GUYA 1P2BA 5I8WA 2RB5A 2PMFA 1MOPA 1P0CA 4DBVO 2ZIXB 5LC1A 3T3HA 1E2EA 1W5FA 2H4FA 4L50A 1N2XA 1J5PA 1DO8A 2J3IA 4NCAA 3X2FA 5IZCC 1E79D 3R7NA 3C1OA 3RUEA 3A9SA 2HU8A 5C8YF 4U7JA 3K3PA 3C2QA 3U7HB 4PYOA 3RS3A 4ZK2A 1W9HA 2FKNA 1XXHB 4Z9FA 2OD2A 3SOZA 5ECYA 3VBCA 3TX2A 2PWPA 4TL9A 1U8ZA 2I6GA 4BNTA 3GD7A 4DBLE 1SB8A 5E7MA 1OB2A 1SUSA 4G4IA 3SKYA 1I0IA 2RHWA 4BTLA 1AM4D 3UXHA 3GOQA 4RK5A 2XB6A 5LLDA 1CD5A 2GD2A 2ZVJA 1SXJE 2RAVA 4DARA 5I9NA 4ZGBA 4EZIA 2I33A 3SBXA 4I50F 5JFGA 2I6XA 3GBSA 4B46A 2BMDA 3B2NA 1JPNA 3K6KA 4GRDA 1BN6A 4IIHA 1Y6GA 3P20A 2BGTA 3UAWA 3TRFA 4E3WA 5ICMA 3INGA 4PX3A 4C0BA 3SC3A 2Z08A 5K5EA 4RHCA 3HUDA 2J41A 1DIGA 3BQMB 2PU7A 4ZDJA 4K88A 1JQJC 1NQXA 1W8DA 2GCOB 3BQNB 2Y66A 3AIOA 1R5BA 1FQJA 2PUTA 3GMDA 4GIBA 3I9V6 3U3DA 4ZYVA 4DM7A 1JSCA 5C1DA 5DRTA 1QGYA 4V38A 5T4BA 4ZOBA 1ZOIA 1NKTA 3AXTA 5HTKA 1CIJA 2RGGA 4LWZA 4CTKA 1RXWA 3AC0A 1KQ3A 2Q99A 2VK2A 4PLVA 1QE0A 4OFZA 2PANA 3VZSA 4P9NA 4BMPB 4YAJA 4Y1RB 3L7YA 4F06A 2ZAMA 2BLLA 4XVUA 1P9LA 2H1WA 3G0DA 3NM5A 4PAMA 4L9RA 4G1UC 3ZV7A 3ILSA 3FHOA 2GBIA 3IB6A 3R6DA 3FYUA 5FOWA 3EQ2A 2Y8EA 4P33A 3UMMA 4G5OA 4QUDA 1RACA 4TWAA 1KC1A 1PHPA 3AP1A 3PHBE 3GH1A 4OL9A 1W7AA 3A1TA 3NBKA 3UMJA 4DNQA 5IBQA 1Y6QA 2GRJA 1XLUA 1YRAA 1IHPA 4B6JA 3BUSA 4DSZA 2OM2A 4C3VA 4Y2XA 5IP5A 1CVLA 4XJVA 4IF4A 2RHLA 3SLKA 5CBPA 4FYVA 2FU5C 4X9XA 1UFKA 2JF0A 4GSKA 5BWBA 3RVPA 2V7GA 3IIMA 3O92A 4Y2RA 4BVEA 3F3KA 1TADA 3L7DA 2WQZA 5TIIA 1RAHA 4O8CA 2XCRB 3IE0A 4GX5A 4FS8A 1UK8A 4QGGA 3PIDA 4RQAA 1AQIA 1BCSB 1U8YA 4ND1A 1L4HA 2ACKA 3V1KA 4X91A 3IIEA 1IPEA 4LWOA 2VK8A 3KXLA 1RJ9B 3WK9A 4AWBA 4KXNA 5BVHA 2A9OA 2ZYIA 1XL1A 4LHEA 5G4LA 5A1TA 3F97A 4FC6A 4AZVA 1I1QB 5KYVA 3U2QA 1WUJS 2FPXA 3R3SA 3R9WA 1JQAA 1QGUA 4YCMA 3E9ZA 3HHPA 3R7WB 1ZN9A 2GKSA 5C8VA 1HMPA 1U28A 3N7TA 2HCBA 1VE5A 2IF0A 3CVJA 4N8EA 3SQNA 1U11A 1QFYA 3QVXA 1D1SA 4AN4A 2O0KA 2ZZNA 2ES4A 3HKCB 1H9BA 3RV4A 5JJBA 1O9BA 3LNCA 5JS7A 4MRMB 1E5QA 2PO5A 4MPJA 3DE7X 3L7BA 3EX7C 4I9UA 3LRPA 4MV6A 5BNZA 2BMAA 3KZKA 4O63O 3K53A 4OJMX 2EL9A 3DZ3B 4D9GA 4ZALA 1G59A 2GAIA 1EXMA 1A76A 1VLHA 3E1SA 4MHSA 1E9RA 1OVGA 2HY7A 3GQVA 1W48A 1LTQA 4II7A 1Y6ZA 1Q1GA 1TIPA 2QRKA 2V7TA 3QXHA 1E2KA 2QEQA 3I09A 3R4CA 1FQOA 1QO9A 3VPCA 1Z3CA 3CNNA 3CUVA 5LPNA 3F2VA 1GL6A 1R8QA 3CJTA 1KAEA 4UTRA 1KWGA 2Z4RA 4YI3A 4J0IA 3UGQA 3NIDB 4A6XA 1FNMA 1T0IA 3OX1A 3TBFA 1CUVA 4JFRA 3LQ2A 2HC9A 2XXBA 4MITA 4C76A 1G6OA 2RHTA 3IBTA 1D4OA 1NXXA 2C3PA 4E2FA 1MO2A 1AUPA 1KO8A 1Z6ZA 2FWPA 4LOJA 5AHRA 4KQ1A 1ZRSA 3B9RA 3VV3A 1HURA 4PFKA 4EHHA 2FOIA 3QLUC 4WOBA 3VO8A 1A4XA 2VPQA 2ZANA 5TT0A 1RMYA 9ATCA 1KP9A 4EPVA 1W47A 3EDMA 1FUIA 2ZQYA 5I7OA 3U7JA 4BNDA 3HO6A 4EQ6A 4KN5A 1B6GA 1PJZA 2YBEA 3A1WA 3T9FA 3B5EA 1YU9A 1VZ3A 3RFUA 3UT6A 2B2NA 1M2JA 4GBJA 4J6EA 3U1TA 2JFGA 1L8AA 1Z8HA 3KZOA 3PEVA 5K3FA 1TO6A 3I8OA 3EE6A 3EQ8A 2IHBA 3QVOA 3SMVA 2WT9A 2FR0A 1J09A 4BASA 5FLXA 3WRYA 2J6CA 2VRNA 5JNTA 2YRWA 3NRJA 2IYLD 2C3YA 1QRRA 3AL3A 5A2GA 3THWB 3AEYA 3P0EA 4BMSA 5KNBA 2HCRA 4D9CA 1I6KA 3F46A 2Q5FA 4EZBA 5IKXA 2JIZA 3HJFA 4ENRA 1MB9A 3WI7A 2IS6A 2I7TA 2FSVC 2JG3A 4ZARA 2I1VB 3OZUA 1RPAA 2PBLA 2ZDGA 2HHLA 2O7SA 1R0WA 3ZLTA 2GFHA 4Z54A 2EVWX 1M7HA 3GP5A 2NPFA 3OFNA 3UKJA 3ZWCA 3LPCA 4FXOA 2QYSA 3AL2A 2R1TB 3W2TA 3WAKA 2JAUA 4NZOA 1LUAA 4DPLA 2ZJBA 3PQEA 3NJ4A 4OLJA 1JWAB 4YJHB 4B33A 2LTAA 4HN4B 1EXDA 3EXEB 3LUKA 4QDUA 2XTMA 5E0KB 4DBZA 1YFLA 4QO8A 4NATA 3EUEA 3TGLA 1F1BA 3R6WA 4UE6A 1E2QA 1SUFA 5FPYA 2UZ0A 4K6MA 3IHKA 3TLJA 4M9QA 1DO0A 4LRUA 1Z62A 2ZBGA 4IYJA 1L8OA 3ADDA 2O8BB 1I10A 3UWDA 3I52A 2EDAA 3RVBA 3CLSC 2BMVA 3JQEA 1M7BA 1IXZA 3LYLA 3H87A 1TM1E 3QOXA 3JCZA 4W8OA 3TB6A 3U1BA 2ZUFA 1K86A 3AJAA 1UMBA 1GPNA 4HVLA 1V43A 3LIIA 4DIUA 5ILQA 1TNDA 3LX5A 5L53A 1G63A 1HETA 1E1CB 4JJAA 5KYGA 5JTTA 1MG0A 4W5RA 3ICCA 4ENVA 4WBNA 1UKCA 4OLBA 1R5JA 4F97A 2NVBA 1ZK1A 2LPMA 4EJ6A 4LK3A 5AXDA 2G17A 5EYPA 2ZI9A 3EWIA 1B7GO 1D4ZA 1RYNA 2WD8A 5K0GA 5A02A 1AGNA 3HCPA 4XCXA 2P65A 3ACBA 1FYVA 3HC7A 4MLDA 4ZT2A 3S99A 3PJRA 4AAYA 3GEHA 1CY6A 3ON5A 1T4CB 4RSMA 1YZUA 2YY5A 1ONSA 1FFGA 3O8QA 3R3VA 2O5CA 3OAAD 1V4VA 2KMLA 3QYJA 3P4XA 1U2EA 5ELLA 1Q2XA 3EOAI 1LH0A 2WD7A 4GMKA 3T95A 1UMDB 2HQ1A 4ID3A 3SU8A 2J0UA 2P5UA 5AVJA 2ZTVA 2GTPA 2FH5B 1YCFA 3FPBA 3NJ8A 5BN3A 3WL3A 3DTVB 2R7LA 4LHZA 3V1LA 3P9ZA 4RYLA 3T5AA 2C29D 1SBQA 1V5EA 1W94A 4KR9A 5JNVA 1E99A 3GLSA 5JS8A 4IIUA 4MEJA 4LYEA 1E0AA 1RWOA 4PYKA 3NDPA 5I8ZA 4PCVA 4UFNA 1U2ZA 3VPHA 5JEDA 1SO8A 1PJ3A 1OILA 4W5WA 5JLAA 3W1EA 5FOXA 4CYMA 3MJTA 2FUG1 3L18A 4F5DA 2WJ6A 2ZSDA 5IDXA 1ST3A 3R9IA 5TS2A 3KWJA 3TINA 2B21A 4AULA 1F51E 1GFWA 3LPDA 1LNQA 2TYSB 4R7GA 2AKAB 3KJGA 2JI4A 2ZE5A 2H5JA 2XQVA 3UNXA 3T3MB 5GP1A 2IUEA 1P9RA 3EDCA 3AP3A 2VSFA 1JTVA 2X9NA 1GQQA 4LXHA 5TQ2A 3VO2A 8ADHA 3AO0B 3UUEA 2C5GA 3INYA 4L76A 3KPUA 3Q12A 3RVKA 3H7IA 1HEIA 1JW9B 2OWEA 3B51X 3DBHB 3OOHA 4NRDA 4A0SA 3AFNA 5J5CA 3ROEA 4NR0A 5DYGA 4GMGA 1Z0AA 2EC5A 2FGJA 1ZSVA 3TN7A 2AN1A 2WWGA 3NV7A 1CUAA 2JGDB 3OEYA 2ODTX 5JQGA 2BT4A 1MNQA 2B4QA 4IL5A 4P6VF 1ILEA 5A5EA 2ZSHA 5A04A 3A6HA 1QU2A 1NMEA 4L8YA 5CNMA 5CLLA 3AILA 4INAA 3FUXA 4WEQA 1GSOA 5DLQC 3R8XA 1NN1A 3LVBA 4HAOA 2ZU6A 3DKPA 4ITVA 4GP6A 1RLUA 3WZMA 5EZ6B 5ESWA 1QTRA 3D6JA 3WLQA 1J00A 3KYDA 4ONEA 2Q9CA 3C6YA 4B6EA 5B30A 3FOZA 1SXHA 4BKQA 2YUIA 1CE8A 1VIMA 2QRNA 5CTAA 4F9EA 1XDWA 1I3MA 1PG2A 1TTTA 1G3RA 2GMWA 3W9UA 2W42A 4AMGA 3HHEA 4QVKA 2R87A 1WQ4A 2A5FA 1MZVA 3AI1A 5DASA 3T0IA 2BFFA 2IYPA 4QPCA 3TZQA 1E98A 3B3AA 1SXPA 1VA4A 4IH1A 4AY3A 1II8B 5IJWA 4C7OB 5IT5A 4UC0A 1NZJA 4I4IA 3OQJA 5B5SA 1J0AA 4I46A 4CM1A 4TRNA 1IHXA 4BUCA 3S2SA 2B0JA 2XNCA 3B52X 1J6UA 3RYHB 2BVNA 1LPMA 3MTBA 4MLZA 1LDMA 1Q1AA 3TI9A 3AKDA 3KPYA 3ILHA 3EVZA 2AN9A 2IBMA 4BB6A 4JI0B 1BJTA 1UC4B 3TKAA 1LFDB 1UFVA 1GGFA 4C05A 1EQAA 4FGKA 4BRWA 4TWRA 4ASUD 1PS8A 1JU9A 4MYSA 2OPBA 4R71A 5AKHA 2BEJA 3STUA 1V16B 3T3PB 3TRJA 1X7XB 2OHFA 4BNFA 1HFWA 2CSXA 5K3CA 3UGTA 3BE5A 5E1MA 3B20A 3CLUD 1CNFA 3PHJA 3R6LA 5H80A 3V4RA 1H85A 2V7EA 4R1TA 4RDCA 2X58A 1TM3E 2NU7A 5C52B 1PDOA 2A5DA 3WLLA 2OESA 1UXOA 1GA6A 2FDRA 2XVXA 3BWMA 3CO0S 1W4ZA 3GRPA 3WKAA 2AOVA 5EP1A 3OLYA 3L41A 4JOQA 3NHZA 3FNRA 1NAIA 1QG0A 3FOCA 2VJCA 4MRSA 2D5LA 3ZV4A 1AS2A 3IALA 1ZM2A 3GJTA 4UCXA 5F1KA 4AZ3B 2HQOA 1O5IA 2GSWA 2OSBA 5DCUA 2V4MA 5L7TA 3CWQA 1I3NA 2GTHA 1XD2B 3LYHA 4DQKA 1C9YA 1Z6QA 4P35A 4EB8A 5LUAA 1N8TA 2LIVA 2YYAA 4QUIA 4LXGA 1NF3A 5FPQA 3LPAA 2OV1A 1J56A 4X1IA 3UKOA 4PPGA 2LXNA 4XB2A 1CEXA 1SOWA 2YXNA 3M1IA 4MKHA 4QXPA 4C6HA 5JNUA 1A04A 1Y1KE 5A3VA 2RC6A 4F4DA 3WP0A 1R4NA 3P32A 3N2YA 3I76A 2HJRA 4HEQA 4O5OA 1UP7A 1N36B 2NUPB 1XPJA 2TS1A 3DOFA 1AXEA 1PNTA 4UVDA 4CT5A 2QUZA 3JYNA 5CXXA 2JGLA 3UJ6A 2GFQA 3RC7A 2FSFA 1E4OA 1UJ6A 4MUHA 5DHPA 2XITA 2J6IA 2I71A 2ZWOA 2FFRA 2OKCA 3H99A 1OFUX 2R8PA 2VDVE 5DHTA 1P6XA 2B9VA 3VDMA 3A3PA 1U8FO 3G13A 4QREA 1P7PA 1HE3A 3D8HA 4M0DA 3ZH2A 4HRAA 2A0WA 2VK1A 3CBQA 5K0SA 2AOTA 1RWBA 1Z07A 3EEOA 2ILVA 3D0RA 1VPVA 2B8NA 2RGNA 2JIQA 3N53A 4AS1A 1GJRA 2UUPA 5ERXA 1FMJA 1YKGA 3EDYA 5KVCA 2G1PA 1NU6A 4XIIA 1Y9JA 2J9YB 3OCWA 5JS6A 1QMGA 2P41A 1GSIA 2WU4A 3WK8A 1N9GB 1SG6A 3H0EA 1MV5A 3E61A 4R0MA 1SEVA 1KDYA 2WG2A 3W4JA 1WBJB 5H9VA 5IC5A 3RRZA 1V7ZA 1I3OA 4R3UC 1KGSA 6REQB 1DAHA 5M29A 2DBYA 4UVGA 3V5NA 1FU8A 1I7QB 1UOPA 4FDLA 3VI4B 1TYDE 3UMRA 1E5TA 1VBNA 4GECA 4MINA 4MQ6A 1XCLA 2PT9A 1P1FA 5CVCA 2GN9A 3MSXA 4WQMA 3ROXA 1NJFA 4V1CB 3L0DA 2OV6A 4N5NA 4YGXB 2X8WA 3AVWA 1YZ3A 3RV3A 3DTYA 1IIBA 3STTA 3W05A 5DBEX 1HZZA 3VX4A 1QKIA 3MJDA 2HUNA 4PHTA 2C4UA 4YJGB 5CH8A 4MA0A 2DUMA 3D4BA 2OBNA 2PBFA 4PZAA 4FKBA 4P7BA 1AHHA 1YJQA 3VPBA 3BTSA 4RHYA 4MKIA 4E46A 5KNCA 3NHSA 1D1PA 3KQOA 4QJIA 4Z1MA 4UKDA 1B2LA 3UOGA 3BXPA 1BX1A 2O1WA 3ADPA 1ESEA 5BV2P 1UFOA 1H2ZA 1YGPA 3V6LA 1KVSA 6NULA 2NYUA 5JWOA 1CJTC 3COJA 1N2GA 3LLCA 4GXQA 4Q5IA 1V11A 3N59A 1DU4A 5AWFC 4RZQA 3HNRA 1GVHA 3CR7A 2WPNA 3VJMA 1KI9A 2QIPA 3SC4A 2FMFA 1PS0A 1U7TA 5K99A 3EPLA 1NGSA 2IXTA 4B74A 3MWGA 5F73A 3FCCA 3CLVA 1R50A 2WJWA 2P9GA 4G3XA 4RMGA 3MMXA 2GWHA 2QZ9A 3FAKA 1WPRA 2XKKA 2NGRA 3NHJA 3BAFA 3PZRA 4JC0A 4FLFA 5TPWA 1PT8A 1A9PA 1ZAKA 2DZDA 2R47A 3TXXA 4J0QA 4ZJUA 5HQ3B 5IJ0B 3QELA 4ZAZA 1PQWA 3HBJA 1G4HA 1KY3A 1WY7A 2DPYA 4K6GA 4PZEA 2AJDA 3VR5A 3DVQX 3KNZA 1PQUA 5BNTA 3HRIA 4KXWA 3RPEA 1GZUA 4MUBA 3N8IA 2BBOA 1MJNA 5DXFA 1HT1E 3ONEA 5LXTB 2X76A 2QTLA 2HFJA 2Z8ZA 1VSTA 4UE3S 4WKBA 4C1BA 4C7XA 1HSOA 4J1TA 1D2NA 2NU6A 2PN1A 5E2BA 3HBMA 5EJ7A 4GI5A 3SEZA 3UB2A 1FNDA 4OQZA 3ZK9A 4KNWA 3FPHA 4MV5A 2G80A 5BR1A 4RORA 1VE6A 3OX2A 2DQSA 4QQNA 4OMUA 1ADFA 2C4TA 2WMDA 3G1UA 1P1RA 3AQIA 1ZGAA 5AOVA 1P91A 2FQ1A 3EEQA 2VOJA 2FPMA 4JU9A 4OHWA 5E2IA 4YXWD 3WIDA 3NI2A 4RADA 4RKEA 3PQVA 1S2DA 2YZMA 4REQB 1RRVA 2PRYA 3FOWA 5FR2A 3W8DA 3DFIA 4AS2A 5KQLA 1UPAA 4UU1A 4EYEA 3V8NA 2NIPA 4GU5A 1UPUA 1U0HC 1JHOA 1LD3A 3RASA 2OCKA 1QVWA 2QX6A 1YJ5A 2XGJA 5REQA 3S5UA 4MVJP 1UZMA 4FQ5A 4FMCF 4C88A 2QMHA 3I5AA 3WRVA 4EGQA 4URHA 4YUXA 2VHUA 1QLJA 1SUPA 1EZ1A 3SAJA 1SCIA 1C2TA 1YE3A 1V5IA 2XGSA 3KDPA 5CCXA 5KNDD 3PFWO 1S3IA 1VHDA 1TC2A 1AHNA 1Y1LA 3THSA 1IQ0A 4S1PA 2Q5JA 4ND7A 4NONA 5T73A 1BE1A 2W6IA 2P5SA 4U2DA 5HGXA 1GPJA 1ZCBA 2VHZA 4YR9A 1ELOA 3HLYA 4NH4A 4ERNA 5L3QB 2PL9A 4DMHA 4V03A 2QG9A 3JR3A 5KWSA 3OM0A 1Z4NA 3BXOA 4UOEA 1G17A 1N3IA 2BMFA 2IUFA 3DMNA 5JSZA 2G3YA 3G9QA 1ZL2A 4UAVA 5CLJA 3LA6A 3WFJA 5FNZA 3HFRA 2OBBA 3K94A 3IEUA 2YV3A 1SU7A 4QECA 4ZVTA 2QM8A 4URZR 3T5TA 4W5NA 2QVBA 2C0CA 2XVYA 4FHGA 1H1LB 4C4AA 3QWHA 4BNHA 2XB4A 3ES9A 1ETUA 3V2GA 2H2FA 4XQGA 3Q6IA 3KAPA 3F7TA 2EJTA 3EBLA 4DWVA 3N2GB 5AW4A 3IBFA 4YT5A 1NUPA 1TAHA 2ONKA 2XSZA 4CIWA 2VXYA 1UP4A 4LZAA 4TYPA 5GV7A 4HZUB 4QSMA 4B4VA 1QHNA 2JD0A 3G2PA 2B0CA 3KV3O 4QQFA 5HQTA 2ADMA 2VWGA 2JHFA 5ER9A 2RAFA 1X74A 1M2EA 1WR8A 2HRZA 4FSXA 3AVVA 4WD3A 4NDZA 1IATA 1MAWA 4UTZA 1NIJA 2RH5A 2Z3VA 3G79A 1PWXA 1RJDA 2EG5A 2IYTA 3GL9A 3IVCA 1K8YB 1OCEA 2BEUA 2C7QA 2PE5A 2RK4A 5KAMA 2WNIA 1R0LA 2ZU0C 3A36A 2PGDA 1HF3A 4YV7A 3I58A 1QJ4A 1VGVA 3GOHA 3HKBA 2JIPA 1RZUA 4E2XA 3WDKA 2I87A 4OYRA 4QTTB 1ECFA 4A0HA 2P4EA 5JMOA 4BO5A 4DLAA 5B7PA 4RA9B 2GVZC 3A1CA 3MXOA 2NU8A 5LNK6 3HCRA 1LVGA 1N6NA 2Z2KA 1X80B 1VJ5A 1JT2A 1OI2A 4ZAYA 1OIWA 5ITVA 2B1QA 3B3GA 1VE9A 1BD3A 4GW3A 3QUTA 3QYPA 3WGLA 4PR3A 3DXZA 1XMOB 4K40A 4KXLA 1U99A 3NNSA 4RWZA 3VR1A 3FZYA 1PWZA 3WE7A 2D1RA 2Q41A 1MJFA 3QJ5A 3CPHA 2I03A 3HRKA 4MUIA 4XR9A 1RWXA 2PS0A 3UG7A 1G5HA 3ZDRA 4F71A 3GAAA 4BP9A 3WKEA 3WZLA 2ORWA 3QEMA 4X44A 4KX3A 3BGIA 1LV8A 4FOPA 5AI6A 3WDLA 2JGFA 3FGOA 4J16C 3ELUA 5CX1B 1C30A 5EXXA 1YNSA 1E7WA 2IYEA 2VCYA 4FLMA 1TZBA 1NQVA 4LMBA 5B1IA 3MNFA 3WGUA 3K71B 2XXAA 3A9WA 1G20E 1IJKA 4RL6A 1O87A 4ACAA 4Z4CA 1OXTA 1RCTE 2DUNA 1E2IA 4X85A 1NF2A 4U02A 4DLUA 2ZZKA 1F0YA 3KSRA 2MSCB 1H66A 2XWSA 3NYRA 3GMTA 2A94A 5HOEA 4R3NA 3TQRA 1ZBDA 2M6RA 4KN9S 3FZNA 1JPVA 2I4RA 1YGYA 2IIBA 3G5AA 2PUEA 1TRHA 1B4DA 2PZAA 2Y1DA 3CIOA 2V03A 3A9UA 5AJXA 1JLRA 3C1UA 3BHNA 5GMOA 1LPAB 1I3LA 2IYFA 3LF2A 1RSZA 3QEJA 3N8DA 5FI1B 4RA6A 2GXAA 1SRRA 3VAZA 5L3RA 4EOGA 4PLYA 4EGJA 3D6MA 4H27A 3V33A 5CB6A 1J7KA 3LP5A 4FCTA 4S12A 4JI4B 4WW0A 4O2BB 1PJAA 5BOSB 5CDTA 1FRFS 1QG6A 3Q3JB 1XVLA 5BMVA 3PGJA 3TMAA 1FNSA 3K7EA 4DV2B 1L6IA 4DKJA 2R1VA 3QNUA 4I9NA 5LP6A 1N0IA 4LRYA 3NGXA 2ZS9A 3DL0A 1EGVB 1RBMA 2J09A 1QANA 3OC0A 3PE6A 2F8SA 1FXWF 3ILVA 3A6FA 4P3PA 2IZ0A 1I5OA 5BYKA 4QAJA 1P2SA 3BHIA 3TCKA 1GSAA 4M86A 3RFCA 3VTZA 4HADA 4D97A 4RDXA 2IOHA 3D2AA 1FFHA 5JNWA 3J81k 4TRJA 4ZYWA 3GPCA 6AT1A 1JLMA 3NP7A 4TVBA 3L0IB 2FMXA 1UWVA 3WGIA 3EIFA 3D31A 3NBYC 4CF4A 1YR8A 5H4GA 3EEIA 2CVPA 3KHKA 5FWYA 3BH0A 3AEXA 4CR7A 5FX2A 4LC1A 2COKA 3FA2A 3A2LA 3VXKA 4BKPA 3SJCA 2BWJA 3KJFA 1W9MA 2Q9UA 2CEAA 3MWDA 2B5WA 3KAQA 3OUZA 4I19A 3N75A 5LOVB 3D2CA 2R5FA 5ALPA 5T41A 3SBEA 1OU4A 5DM60 2RGRA 2QUKA 1OD6A 2YW2A 4GQIA 3A3KA 2DECA 4YCBA 5EMHA 1RS0A 4A1FA 3MJHA 1M1YB 3ILYA 5A6VA 3B1ZA 4AG3A 1P8JA 3R3WA 2NUAA 1OUMA 1BXRB 4AS3A 3TW8A 5KNDH 4MQ5A 1HLGA 5E3HA 1Z0SA 3GGOA 4JDUA 3ANMA 4BO4A 1HFJA 2VDMB 1CFZA 4BECA 3DHWC 4JR1A 3RR2A 3TOVA 5JNLA 3M1YA 5F7JA 5FUBA 5T7BA 3MCZA 4CVNA 1QV9A 1CVRA 2REQB 3JSXA 4ZZIA 1M0TA 4LBZA 3VU1A 4W5OA 2IFTA 4CQMD 4KQHA 3O8QB 2HF8A 4KXQA 4LJ9A 4QTUB 5LQJA 1J21A 3JQBA 1QYWA 1EA5A 2VG8A 3EP9B 3QU5A 1IVYA 1JZQA 1U5BA 3W9YA 1R0YA 3PU6A 3TLCA 1TO2E 2C7BA 3IHWA 1C4KA 1VA5A 2WWIA 2YINC 2GEKA 3COPA 3GGSA 2QRLA 4XLZA 3UATA 2DKOA 4ANFA 4F3KA 1DQPA 4B6FA 3E82A 4MKXA 1C7FA 2IWHA 3A6ZA 2I4MA 1TUIA 2BFEA 1W0KD 2ZE7A 4DLWA 1AXGA 3R0ZA 3W3AD 3DOEA 4L8VA 1X1DA 2VJLA 3RTDA 4I1YA 4AJHA 3I01A 4Y9RA 3OZRA 3ZZNA 3BSYA 3QEKA 4NE7A 1LY1A 2Z43A 1GPKA 2XVAA 4JLDA 2VWHA 4WX2B 1AN0A 1CC1S 1L5KA 1IXRC 2Y1XA 3WBKA 4DCSA 1FRVA 5HA5A 5KTTA 3L1IA 1T1EA 1Z5GA 2CHQA 2YIMA 3QLTA 4Y6OA 1NMZA 3UVEA 4DA7A 1NMXA 2G0AA 4UTXA 4MWGA 2PXXA 1E8MA 1JX6A 3A4IA 3F8WA 3TJMA 3DP9A 5H8WA 1RWMA 1ATIA 1B3RA 3AGPA 4HAWA 2AG5A 3M5PA 2R7AA 4FZJA 1BO6A 4TMZA 3FTEA 1Z8FA 1RI1A 2TRSB 1U3VA 3JZMA 2DUWA 1B8VA 1LSJA 4YJFA 3KXIA 1K6MA 4KFSA 4CNBA 4HEA1 2JFFA 1MQSA 5KNBH 2QF7A 1RRKA 1KEEA 1S1MA 4QU8A 5I7EA 1ORVA 1E2BA 1OX4B 4F1JA 2PKXA 3DFZA 1X8KA 2DULA 3AY3A 4LQ4A 3BQ9A 1QZXA 3EXHA 5H4HA 2FPRA 2I29A 4EPYA 2WYOA 5LMZA 3DZ2B 1MVOA 1FYFA 4WUTA 1R9JA 3MS2A 2WFMA 3DMRA 2JB9A 2NZXA 3CLKA 5E7IA 4EYOA 2FZ5A 4MYHA 1QB8A 3U48A 2QWXA 2I6QA 5F21A 2XE4A 1TQHA 3TAXA 3HXMA 4MW6A 4LJYA 2Q3JA 3ZGOA 3R6TA 2QN3A 1PW5A 2VO1A 3UF0A 4QHYA 4CF3A 3KZVA 3NPAA 5K3FB 3OECA 1LLQA 2WZBA 5JG7A 16PKA 1KIMA 3L8MA 2BJWA 4FFBA 2WA1A 3ITNA 2AFHB 3ROTA 4X7MA 1EEHA 4KPYA 2WSYB 4G0MA 1TFUA 1P31A 1XU7A 1SKUA 2VHVA 3HP7A 4JNCA 4ATNA 2SKCA 4YN3A 2R60A 2OHGA 1NSTA 2ZJ6A 3QU7A 4L1KA 4YRRA 3UMBA 4D99A 4CDNA 5HKKD 4N6OA 4JHLA 3KKMA 1OU0A 5DNDA 1UDRA 2IDMA 3PSHA 3ZZMA 1I32A 2AG1A 3HYLA 2BHLA 3GT4A 2A5LA 2FFJA 4Z3DA 3U16A 3NFRA 3ROFA 3TW3A 4KWTA 4O2BF 2FXVA 3PQCA 4EF6A 4X94A 5DT9A 2JIDA 3MA0A 1PVVA 1OX6A 2BEWA 2G9UA 1N7JA 3H1TA 3LF1A 3BE8A 3M6XA 4H7FA 1Z4PX 2ZR9A 4C06A 4ZCTA 3BMCB 5KYWA 3OCUA 2O8VA 1G2OA 2VUUA 2WWFA 4CLRB 4MPRA 2YZGA 5C31A 4CMKA 1RZVA 4Q19A 1I7DA 1DCTA 4QEZA 4XYBA 1WEHA 4MDYA 4KLCA 1SBTA 3HBLA 5F1YA 1QLWA 1TVKB 4Z3KA 4RSGA 2OYCA 3Q9SA 1O97C 3ET4A 3QXCA 2JFZA 2VUSA 4PHHA 4UAUA 2P3OA 5D85A 1SCKA 3I2JA 4BGIA 5FNVA 3SS8A 4GPAA 1KQFA 4XA8A 2WFLB 2ARKA 2XBLA 3CM0A 2VAPA 5B7QA 3O3OB 4CCSA 4LF5B 4WCFB 2GZSA 1GPDG 4G84A 2GPNA 1JS1X 1L7RA 1XTSA 3DAOA 3DE5X 1ND5A 4DMGA 3I39X 1JALA 4CEJA 2HA0A 4KIUA 4IUYA 4TS1A 1JKJA 2PR7A 2VUTA 4H1WA 1P44A 1PUXA 2VF5X 2QZJA 5J59A 1CU1A 4GC5A 2C99A 2C7RA 3IQZA 1NKSA 3MUOA 1VKNA 1MPTA 4F1KA 4G37A 1QKKA 2WVHA 1XNQB 1XEWX 2C57A 2QRVA 2C42A 3VR0A 4F4CA 4F6RB 5AW6A 2QN2A 1OV4A 4YO7A 4P2BA 4HLUC 4HL6A 4OO3A 2W98A 4LWQA 3A2MA 2WQ6A 3AV0B 1ODKA 2OGSA 4C3OB 3GJZA 1KFCB 5TQVA 4BNLA 3WK7A 2WE7A 1N1GA 1Z82A 1BMFD 3DV2A 5J58A 3DDUA 1B0UA 3DAHA 4D4KA 3HVRA 1UINA 1ZC4A 4F2WA 4J7CA 3WGYA 1IN7A 2KLHA 4REMA 1KOFA 4IEEA 4IS3A 1E7RA 1BDBA 4J0FA 2P40A 3PCXA 2KI5A 1R6UA 3PVZA 2J9ZB 1RAIA 2CLHB 1VJTA 2C1ZA 1KI6B 1JKFA 1JEQA 2NZUG 2OXIA 4MUYA 3GXBA 4XQEA 2GXSA 2QU8A 4FDMA 4LISA 1N2BA 1V1MA 3I4FA 1EM8B 5JZVA 4W9MC 3RC8A 1LDNA 1KEWA 3RAGA 1G2PA 3SDBA 4HYYA 2BSQA 1NIPA 2HMAA 3EFHA 3FNBA 3K8YA 2VJKA 3DAGA