1PQUA

Crystal structure of the h277n mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with nadp, s-methyl cysteine sulfoxide and cacodylate
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
371
structure length
371
Chain Sequence
MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQAGQKAPVFGGKDAGDLKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNCTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCNSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of substrate-binding groups in the mechanism of aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
source organism Haemophilus influenzae rd
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase
total genus 121
structure length 371
sequence length 371
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1pquA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pquA01
3D3EA 3UXYA 1LRKA 1ADGA 3QVWA 4R1NA 2GN4A 1UZMA 3C8MA 5T73A 4H7PA 3ST7A 3MJVA 3JYLA 4IJKA 4J2HA 3HUDA 4GAEA 4FB5A 5CPBA 1KVUA 4WECA 3VVCA 3E03A 4YB8A 3OJLA 3U62A 4DC1A 1CYDA 1E3JA 3WTBA 2EP7A 1OC2A 3NTRA 3EHEA 4MVJF 5TC4A 1KEUA 5I7EA 5K6AC 7ADHA 4ND4A 2HLPA 2FP4A 2IYOA 2ZB7A 4NDNE 4UVHA 1F12A 3Q9UA 3ONDA 4W9NC 3RFVA 2YJZA 2WWRA 3RC7A 4IM7A 4NK5A 1DOHA 3SC6A 3FWNA 4BNWA 1M76A 3CSDA 2W8ZA 4NK4A 1U9JA 3N74A 3C3XA 3U4CA 3L6EA 4EEZA 4LGVA 2DFVA 2H6EA 2XAAA 5BT9A 2VUSA 1C0IA 4IIUA 4PRKA 3UFXA 2DC1A 3AY6A 8ADHA 4TRJA 4MKRA 4XIJA 4MVJH 3KYCB 2X9GA 1MXFA 1LLCA 5A5FA 3IOYA 4XRGA 4MVJD 2Y99A 4LMPA 3EY4A 2VT2A 3DBRB 3JQBA 2E49A 1U5AA 3DZIA 3LLSA 1BVRA 4DTIA 5JY1A 4O59O 4ND5A 4NBWA 3F6YA 3VDRA 1ZEMA 4I9UA 3RUCA 1AN9A 4GLOA 4TROA 3NAQA 2GYYA 3QLJA 2Y0CA 4GX5A 4W82A 1U7TA 3NT4A 4LSMA 2H9IA 4CUJA 4RLSA 1OZAA 3ZH2A 1XWFA 3G1TA 3GOHA 4R3NA 3DAGA 1HL3A 3ABIA 4BKQA 3ZHZA 1UP7A 3Q2IA 2JCVA 3ZWVA 1BMDA 4BS9A 4NU5A 1TEHA 5AVOA 4OHUA 2ZQZA 3OQBA 1F14A 2GR9A 3PLRA 4F6CA 4H3VA 4H16A 1V6AA 4J0FA 1NAHA 5DBIA 1BRMA 3H9EO 2AW5A 4FIZA 3EW7A 4E31A 5HBRA 4DLLA 5KWEA 5A5EA 1X13A 3ON5A 3AI2A 2X5OA 4EYEA 3IC5A 3HG7A 1O9BA 3WQQA 4O6VA 4OIMA 3AY3A 1ENYA 2P68A 4JP2A 2ZJ0A 2GF2A 4UUPA 1SMKA 2JCXA 4DGSA 3DDNA 2JD1A 1DPGA 5T6BA 4JLWA 1JN0A 2GPTA 5JAMA 2Q22A 1K6IA 2Q1WA 1UP4A 1I2CA 3WIDA 4HY3A 1ZW1A 4K28A 3OICA 5H83A 4FFNA 2J5KA 4NHEA 1Y5MA 4UAGA 1DC6A 3SJ7A 4DPKA 4CMCA 4RZHA 1J49A 3HE3A 4F6LA 2I3AA 3ANMA 4TSKA 3WMXA 5ILGA 4IS2A 1DRUA 1A7KA 1ORRA 3ZW8A 3C1AA 3NDIA 1R4NB 4CMIA 3WLEA 1ONNA 3WSWA 4NBRA 1EVZA 1L7DA 1B16A 2A4KA 1DC3A 3PFWO 3PEFA 3PHIA 2VWGA 3KYBA 1VSUA 5TJHA 4DA9A 6LDHA 1ZK1A 4OAQA 5JCJD 4C7KA 1C0LA 4LVCA 4XZ3A 5I7SA 3KO8A 2Q46A 1ZK4A 4J6FA 1JKJA 3DZKA 3G1UA 1YQGA 2E4AA 4J1NA 5L4SA 4OOEA 2EJWA 2HAEA 3F1LA 3M2PA 1HE2A 1E3WA 1E7YA 4GKBA 4J9VA 5A06A 1E7MA 3L0DA 3MJSA 1VE9A 3OQ1A 1QP8A 5JXWA 1YXMA 3EZYA 3GGOA 3JD0A 5ENVA 3B1JA 5L40A 1Q1NA 3DHEA 4GVLA 3W1VA 1DJQA 2Q2VA 2VHZA 3TFOA 4GQAA 1U3TA 5DZSA 2PTGA 3QSGA 1OBFO 1G0NA 3GZNA 3EC7A 4ZHSA 2W2KB 1LUAA 3ENKA 1DIGA 1G6KA 2ZTUA 3TN7A 1F17A 3PZRA 3X2EA 1L7EA 4BKPA 5CDYA 1XU7A 2EGHA 4UVIA 3WGGA 3RJ5A 2DBZA 3F47A 3RCBA 4L4RA 5U1PA 3DOCA 3COSA 1P3DA 3DMYA 4M49A 4N18A 3HFSA 1LBEA 4F46A 1DJNA 1SOVA 2HKIA 3QWAA 3IKVA 1ENOA 1XEAA 1Y8RA 3GNTA 2YY7A 4AJ4A 1JDJA 2AHRA 2P9CA 4E12A 2OL4A 1PS9A 3F5QA 1M67A 4IBOA 3EZLA 3RU9A 2VHYA 3V2GA 2PWZA 5JPIA 4ALMA 4D3DA 4D42A 1ONOA 3G49A 2NLOA 1WZIA 1PGJA 1HKUA 2PGDA 3WNQA 4BMNA 4D79A 1P1HA 5FYDA 5HM8A 5IF3A 5JDIC 4MVJG 1HWYA 1LQUA 3H3JA 4NFSA 4PZEA 3ZHXA 4BNIA 5BNTA 2DTXA 3V2UA 3ZWPA 4RQTA 4WCFB 3TFQA 2X86A 1DFGA 4BGEA 4D41A 2PZKA 3T4EA 4CM6A 4S3MA 2GZ1A 2DAPA 3E82A 1P1JA 1LDBA 3HDJA 1I2BA 3FR7A 1A7AA 2HJRA 2VHWA 1T1RA 4KQXA 3RUHA 2O3QA 3ZZNA 1P74A 3GT0A 3L77A 2Q49A 4L4SA 5HS4A 5C37A 4FOOA 4FCCA 3QRWA 2HRBA 3RC9A 1UZNA 1NR7A 1TVEA 2X6TA 1SCUA 1KEWA 3NTOA 4RVFA 5A9SB 1EUZA 3DEYX 4QTZA 1KC3A 3FR8A 3EYWA 2O3RA 2R00C 1UAGA 5CHEA 3UCFA 2ZKLA 3V1YA 3FNFA 4KOAA 5EERA 4E30A 3K9QO 3WYBA 1IHXA 2PKRA 3PGJA 4WEQA 1Q0QA 3SVTA 3DMTC 5G2OA 5I9NA 3BMQA 1NQTA 4WCFA 4II2A 4NI5A 4NH4A 3TF5A 3RUIA 2BKAA 2YFQA 3OH8A 3K6JA 3O8QB 4JQCA 2PGLA 4TKLA 5JSFA 4EI2A 2C82A 4DC0A 1P0CA 5CP8A 3SEFA 4U8GA 1KC1A 4BV8A 1ADCA 1I30A 4CMKA 4WOKA 3BTUA 4MJLA 4P4LA 3TPCA 3VTZA 4JK3A 1Z82A 3ETGA 3ZDFA 1V0JA 4LN1A 3ULKA 1YS4A 3ZWYA 5TF4A 2BH9A 4CM4B 4XYLA 4IMRA 1GEEA 1QLHA 1V3TA 3A4VA 3P5SA 4OYRA 3UCXA 4NJMB 1XSEA 4L75A 2I9PA 3IS3A 4UULA 2IE0A 3ZV5A 5CEJA 2F00A 3ZWCA 5AXAA 3WMWA 1VLLA 3PIIA 4YQZA 3GG2A 3RUDA 3MWDB 3HZZA 4CLDA 3WICA 3H7AA 3L4BA 3DBHA 1E7QA 3RFTA 4MPDA 1ZIDA 2CDBA 2A9FA 3BHJA 4O1MA 1CERA 4GGPA 3H2SA 1J0XO 4BKRA 1ZVMA 3BMNB 1B2LA 1LSSA 4UVDA 4WGGA 2VWPA 4MP8A 1H6BA 3PHHA 1UDCA 4GL4A 3ZWBA 2OZPA 3PRJA 2GN6A 4E4YA 3JQFA 4LRSB 3UVEA 3UHAA 3K2BA 3PHJA 4NR0A 1R6DA 3KEOA 4YAIA 2VRBA 4XA8A 1HDOA 1U7HA 3WGOA 2QRJA 1YWGO 3DBVO 3L6DA 1NTOA 4MVJP 5IDQA 4BNFA 2PGJA 3C1TA 3DZHA 3HDHA 2XOXA 2X8LA 2C07A 3KLMX 1P0FA 1QXSA 4MVJE 3WNVA 4YJHA 1U1IA 2WTBA 4XRRA 3WOHA 2E82A 1M6WA 2VOJA 2J3KA 3KVOA 4BQRA 4J16A 3VVBA 2P4HX 2FSSA 4E3ZA 1LNQA 2FY8A 3F3SA 3GA0A 5TX7A 4CMAA 3R6DA 1AHHA 3U09A 2WYVA 4J43A 2BGKA 3DTTA 3U49A 1EFLA 3WGHA 3IMFA 3L4BC 3L4SO 1NHGA 2QYTA 4A03A 1HEUA 4R3WA 4OXKA 3D4OA 3RC2A 4CLOB 1YOVB 1ML3A 1YB5A 2YQ5A 2B69A 3N58A 4I5FA 3VZQA 3LC2O 3ZGYA 1U4SA 1WXDA 1XKQA 2JHGA 3BAZA 4CM5A 5I8WA 1R0LA 3JQ6A 3DQPA 3IJRA 4QFCA 2EG9A 1E7RA 4DMMA 1EQ2A 1EDOA 2YDXA 4Z9FA 5KJEA 3TZHA 4PLPA 1K2WA 4RPKA 4UEJA 2O4CA 3WR5A 1I36A 1N92A 3AU8A 4XB2A 2JAPA 5LDGA 4DBZA 3GRPA 4NBTA 1SB8A 1O6ZA 5BNIA 2NVWA 1A4UA 2BFAA 2FPPA 4A0SA 1K5HA 4GPD1 1CETA 1B3BA 1N7GA 4PIVA 4KUHA 1QRRA 3PK0A 4DQUA 1O8CA 1FMCA 1LDYA 3GDFA 2P9EA 3ZWXA 4I08A 1PQWA 3WGIA 4D46A 4ND2A 2NU7A 1PJTA 3DFZA 5JC8A 3GMDA 1N2SA 1YB4A 4DQXA 3RBZA 1D1TA 4DYDA 1W6UA 4BKUA 3CUKA 3DAPA 1HDYA 2Y1OA 3K31A 4O5OA 4PRLA 4P8RA 4A26A 4ND3A 3BHIA 3UH1A 3K8ZA 1WDLA 2GZ2A 4ZA2A 1S7CA 1SZJG 3LT4A 5I9MA 1LSOA 3DWFA 2GN9A 1T25A 1ZNQO 2ZTLA 3RU7A 1WP4A 5A3JA 2ZB3A 1PGOA 3WFJA 3BMCA 3A9WA 3GY0A 2VOEA 4CM1A 3WWYA 3OJOA 1XIVA 3ONEA 3RD5A 1U8FO 1XA0A 2PNFA 4P22A 2FR1A 3HSKA 1KVTA 1SEVA 3VH4A 4N5NA 2BFMA 3VHRA 4OQYA 1PJSA 4UVEA 4A73A 2CVZA 3M2TA 4AFNA 4ALKA 2DBRA 5HRUA 3S2FA 4BB6A 2AQIA 1YRLA 2X1HA 3JD4A 3OJEA 2NV6A 2D1YA 2EKQA 1NQOA 4BO6A 3QVXA 1U4OA 3M6IA 2JL1A 1Q7CA 4UEKA 3U9LA 1ISJA 1ARZA 2VNSA 2XF8A 3OIFA 2P4QA 3C24A 3VZRA 2DPHA 1XHLA 3DFUA 4B4WA 1EBFA 4PLYA 3S2GA 1I2ZA 3ZV4A 4BVAA 3PPIA 2AA3A 4YJDA 1NNUA 2O2SA 1I24A 4Q3CA 2BFPA 1JVBA 2Q4EA 3GVXA 3NJ8A 3OBBA 4RO0A 2ZYGA 2B35A 2VTEA 3GDOA 3SC4A 1V3VA 3TOZA 1MV8A 3W4IA 3O4RA 3WS7A 2VYVA 4BOYA 5A3VA 3QV1A 2WM3A 3V8BA 2PK3A 3UW3A 5J23A 4AG3A 4AJJA 1IB6A 3H65A 5FEUA 3U5TA 4YJFA 1Y9EA 1KVQA 5HTOA 3L9WA 1NX6A 2P5YA 4YWJA 3DMTA 1HLDA 3LSYA 3D4PA 4JBIA 4RLHA 3T4XA 1P33A 5F1KA 2OHXA 2HQ1A 1HZZA 4HFJA 4Y6PA 4Y9DA 1E0DA 2W98A 2E37A 4MINA 1R0KA 3QWFA 1JU9A 4W4TA 4YTEA 4WKGA 1WVGA 4INAA 4MIEA 3AK4A 1VC2A 2GZ3A 4YJHB 5GZ3A 2VUUA 1H93A 1Q7GA 3INGA 1R4MB 3LT0A 1GFSA 1Y7TA 3AI3A 1RJWA 4FGWA 3ZHYA 3ZWMA 4MIYA 2HRZA 4AJHA 5COBA 4CUKA 2QX7A 3CZMA 4TZKA 5T8KA 4FSHA 1DO8A 3RSHA 2VT3A 4AICA 3JQEA 4QXMA 3TZKA 4AJNA 1GTMA 4PG8A 1Y81A 4QECA 1ISFA 4CLOA 4AJKA 4YXFA 3OEYA 1QG6A 3FPCA 3KYCA 2EHDA 4L76A 1DFHA 1PJ2A 2NU9A 4RVGA 1JTVA 3AM4A 4ZQGA 3TL3A 3HB4X 1DAPA 2D4AA 4DLBA 4TWRA 1WZEA 2B36A 3CMMA 1H0KA 4FFPA 4LW8A 4U0KA 3JV7A 5U9CA 3PDUA 3ZN2A 1GADO 3PDJA 5I7FA 2HDHA 1BVUA 4FFLA 3FI9A 2OGUA 3TDKA 2O50A 1P44A 4FD3A 4PVDA 1T4DA 4IJVA 3GR6A 4AJ1A 3TWOA 1VKOA 1GYPA 4IS3A 4LMRA 4M1QA 1ZZEA 1OFGA 5A05A 3ITKA 4Y8VA 1I8TA 2PH3A 2UYYA 1FK8A 3OM9A 2GLXA 1F06A 1W8DA 2PZMA 4BNXA 3E5MA 3QY9A 3VH3A 1BXKA 4XD2A 2JFGA 4Q3EA 3JQGA 2NQ8A 1N9GB 2W2LA 2J8ZA 4MKZA 3JQ7B 3I9MA 4PLGA 4BNHA 2BGLA 2D0IA 3E1KA 4BO3A 4CLRB 2I65A 5A02A 1K3TA 3S2IA 1MA0A 4IUYA 4AL4A 2AMFA 1E92A 3OQ6A 5AYVA 5TT1A 5LDHA 2I6TA 5TQVA 5JAZA 3RJ9A 4BO1A 4YAKA 1H6AA 2RCYA 1LEHA 4CJXA 1ZJYA 2D2IA 3KZVA 3GHHA 5DF1A 1UJMA 2YHIB 1UAYA 4L4XA 3NV9A 1BXGB 2C2XA 3MJEA 3ADOA 2DVMA 2CDCA 1Y1PA 3FD8A 1U8XX 5JY6A 3LC1O 4ESOA 3PQDA 4RPHA 4IGFA 1I33A 2Y1GA 2YFHA 4YCAA 4E2XA 1UXGA 1H6DA 3GUCA 6ADHA 2OUIA 1SOWA 5EPOA 1D3AA 5L9AA 2RBEA 5KCZA 1TT7A 1H2HA 2IYPA 3RAJA 3Q3CA 4RPGA 4HNHA 5IN5A 4FBGA 2C5AA 4GWGA 3TSCA 1VI2A 4EJ0A 2H63A 1E77A 5EQDA 5JO9A 4U0JA 4J1SA 5JLAA 5DCUA 3UF0A 1K6JA 5LCXA 2DQ4A 4O63O 2C0CA 4OXYA 3DO5A 5KOIA 3PZBA 3ZU4A 1EVYA 4ITUA 3GVIA 1FDTA 3ZWAA 2Z1NA 2Q50A 3ETDA 3VZPA 1KBZA 3ITDA 1YE3A 1E6UA 2G5CA 3HJAA 2G17A 3WGZA 1DLIA 2B4TO 1UZLA 1PJCA 2DKNA 1NQAO 4D0RA 4W7HA 5KVVA 5CG2A 1VSVA 3UCEA 3VH1A 3QIVA 2X0JA 4XB1A 3IL2A 2LDXA 5JW6A 3GVCA 1WDMA 1NFQA 4KQWA 4HV4A 1E7WA 2DLDA 3ZV6A 3OF2A 3WDSA 4YT8A 1U3VA 3NGXA 2GO1A 3O26A 5DT9A 1DRVA 1C0KA 1GZ6A 3JYPA 1JWBB 2WE7A 3NTQA 3HN7A 3W8EA 4Z9XA 1QLJA 4WCFC 2D59A 1GPDG 4BNTA 5IJZA 4FDAA 1PEDA 4CV2A 2NACA 1PSDA 3GUYA 3I9OA 2GNAA 5JDIA 2CMDA 1MFZA 4HXYA 3GAFA 4OM8A 2BI8A 2QZ9A 4JP3A 4KWHA 1D8AA 4FJ0A 2C5EA 4NZ9A 2QRKA 5C7OO 4A5OA 2GUGA 4OO3A 3PFFA 4GKVA 5ILOA 2C54A 3JD1A 4Z9YA 5L3ZA 4WLOA 3PGXA 4R41A 2AQHA 3IJPA 4J1QA 4HFRA 2PKQP 5FWNA 3U4DA 5G0TA 2VYVD 4Q3BA 4JCOA 4CLRA 5JAIA 3QWHA 4UUMA 4I9HA 5TRTA 3FBTA 3V1UA 4YT2A 2DM6A 2Y1FA 3DAFA 3B1KA 1EE9A 4BL5A 3W6UA 1ULUA 5C5IA 2J3HA 5G4LA 2V65A 3DTYA 1E1NA 4WE3A 1YQDA 5COAA 2WD7B 9LDBA 1BW9A 4D3FA 1FDUA 4YYZA 1EQUA 5MDHA 1A9YA 4CL8A 4YRDA 3A14A 1EE2A 4BIIA 4WOJA 1A27A 4E5YA 3HWRA 4CMEC 3RI3A 2PZJA 5CEEA 1GDHA 3MJTA 4BNKA 1MXHA 1U3WA 2YV3A 4E21A 3R3JA 4IPTA 1PZGA 3IKTA 3D3WB 4U6QA 3NT2A 3SJUA 4B79A 4XQEA 3ZWWA 4HX5A 1DB3A 4ZVVA 3EAGA 4B4OA 5IDYA 1PQPA 5TT0A 3GDGA 1DDOA 1P45A 3KLPX 3QWIA 5I7VA 4CL3A 3CPSA 5ITWA 2EGGA 1Z6ZA 1ZUD1 2I66A 3U0BA 3D64A 2YZ7A 2FOIA 1K6XA 4Y6RA 1MG5A 1R0SA 4ZRNA 3TJRA 1CDOA 1BW9B 1PR3A 5KJFA 1JAYA 4XYMA 5TSDA 2BMAA 2NU6A 2W2LD 4R1TA 1R4MA 3ASUA 4I8XA 1XDWA 1D1SA 2BRUA 4HUJA 3GEGA 4DQVA 2JCYA 5IZCA 3DZFA 5BNFA 2I99A 1YVEI 1VM6A 3ZWOA 3WG9A 4XQ9A 1HZJA 1TT5B 5IDXA 1D4FA 1NQ5A 1IL0A 1QYWA 5TIIA 1LRLA 1EK5A 4DREA 4ALJA 3VOSA 1I10A 3KETA 2V6BA 3RQSA 1H94A 3W6ZA 1JWAB 5F5LA 1DFIA 1HYEA 1KEPA 4B8WA 3F5SA 3V5NA 5DBGA 5ES3A 3AFNA 1U2DA 2VHVA 3VPXA 3RUAA 2PD3A 1PS0A 3OP4A 4U6SA 3FTNA 1HE5A 3JQ9C 1ONPA 4IDDA 3JQCA 1A4IA 4PVCA 3MTJA 1F8FA 4IDGA 4BGUA 1PR9A 3GZ4A 1HTBA 5FI3A 3BMCB 3WXBA 2B4RO 3GN2A 1V8BA 3KRTA 4TQGA 1X0VA 4WLFA 5DCYA 3UUWA 3B20A 5L51A 1XG5A 4YT4A 4P38A 4M89A 4WNIA 2PD4A 3CIFA 1Z74A 1ZKMA 3PI7A 5G0SA 4O0LA 1JKFA 2B5VA 3LZ6A 2CZCA 3H9UA 4G81A 4R5MA 3DHNA 1SNYA 4E32A 4IJWA 2I3GA 2HK8A 4D3SA 3G79A 2P9GA 3DC2A 5GZ1A 2HMWA 3FPLA 4GBJA 3ZNNA 4IINA 3E5RA 5B4TA 4YBZA 4Y98A 2GERA 1LXCA 2O23A 1KVSA 4BNGA 3GNSA 3ANNA 1V3UA 2EKLA 3ICPA 4YJGB 3D4NA 3DBHB 4DIOA 1RYEA 2AE2A 3OJ0A 1PJBA 5DP1A 1HRDA 4MP6A 1WMAA 1XGKA 5EESA 2O48X 1PX0A 1H6CA 3A28A 1Z75A 1BXZA 4CPDA 2YV2A 4IDAA 1GQYA 1NFRA 2J3IA 3TZCA 4DPLA 2J5RA 4FOSA 2WMDA 4QSMA 2AG8A 5JDCC 3BTVA 2B83A 1T4BA 1J6UA 1TA4A 4NPCA 3ROMA 4PG6A 5TJ9A 4K6CA 1KY5A 2FRDA 4CQMB 3HNPA 4BO5A 2O3JA 1T2AA 3F4BA 1A71A 3K73O 3CINA 4XGNA 4BO4A 4XKJA 2OFPA 1LDNA 3RKRA 1RM0A 3U3XA 1RYDA 2Z95A 1QV6A 4MP3A 5K6AA 1LQTA 2NNLD 3IQDB 5M6DA 2VUTA 1ENPA 4RVHA 4CV0A 4L9RA 4KTTE 1WLYA 3JQAB 3TNLA 4I5EA 5JMPA 2P91A 2IEBA 5FI5A 1QYCA 3I23A 1CQJA 5DN9A 4BMVA 4D44A 5TS3A 2Q1UA 4HFMA 2X23A 3I9KA 1NR1A 3I6IA 3LF2A 4C4OA 4G65A 1R15A 4PN3A 1YB1A 2O7SA 2UUOA 1XR3A 4K26A 1OC4A 3PQFA 4NIMA 4F3YA 3WIEA 5KNLA 3BYZA 5KTKA 3M1LA 1RM3A 2R00A 4PG5A 3KUXA 4BNVA 5KJ1A 4J0EA 1GEGA 3GK3A 3SLGA 4WPGA 5DP2A 3HB5X 3WTCA 2GN8A 2Q3EA 4M8SA 3VPSA 1OAAA 1LX6A 2RHCA 3QP9A 2GRAA 4N7RA 4GLLA 1DHTA 1HDZA 3ZV3A 1WWKA 4ZQFA 1KETA 3OJFA 2W90A 2UAGA 1Y9AA 4DL9A 5CDSA 3KXDA 4R1UA 1PZHA 2VWQA 4FR5A 4JNKA 5LC1A 1C1DB 1TXGA 4FW8A 4GX2A 4EITA 1ZSYA 3M1AA 3H6KA 1ZK0A 1J5PA 2EEZA 2I67A 3ZW9A 4GWKA 2TMGA 3UICA 3DBLB 3HADA 1IYZA 3I4CA 3NKLA 1CWUA 4LRTB 3FNEA 5DULA 1B7GO 3NGLA 1Y8RB 1FJHA 2C29D 1GV0A 4ZN6A 3VKVA 2NWQA 3ASVA 3LLVA 1KS9A 3CKYA 1H5QA 4YVFA 4D45A 1GV1A 2O3SA 2YHIA 2A92A 3OECA 2C2YA 5JCJA 4BQPA 4BV9A 2HO5A 4E2WA 1ISIA 4CM4A 4NFYA 2YW9A 1E3SA 3ZNPA 1PL7A 2CDAA 3FSRA 2GSDA 1SAYA 4RL6A 1YDWA 3L07A 2VZ8A 4UVGA 1BTOA 3DB2A 2PD6A 3B70A 4ZQEA 1EK6A 4X54A 3F4LA 1FDSA 1HYHA 3RKUA 3WX0A 3STHA 2BGMA 1IHYA 1F8GA 1E1MA 3S2EA 3UKOA 5CFZA 2Y93A 1R12A 3JQ7A 3GAZA 4IDCA 2VZ9A 3JCZA 2ZK7A 3QVSA 3BMQB 3JQGB 1ZK3A 3OETA 1R37A 3TOXA 3LT1A 3E9MA 1KEVA 3BZUA 1UUFA 3E6AA 1BWSA 3I4FA 2X0RA 1LU9A 1QORA 4RPLA 1ZXBA 5G0UA 5AOVA 3LU1A 1YONA 3PWZA 1NASA 1ZJZA 3FCOA 1NXQA 4JJFA 5EJ2A 4NJMA 1GAEO 4HADA 1LLDA 5IXYA 2RHRA 3PYLA 3WQRA 4PG7A 2C7GA 1NM5A 3LK7A 3GGPA 4BNNA 4D0SA 1XQ1A 3SX2A 3H5AA 3OFSA 2G82A 2X0IA 4AJOA 4TRRA 3EVTA 5L53A 3Q1LA 1GZ3A 2QIOA 3AM5A 4XQCA 4CUZA 1QV7A 2SCUA 5L45A 1NVGA 2AG5A 1LSJA 2FZWA 3TZQA 3VPGA 1AXGA 4J4BA 4BGVA 1YBMA 1TB4A 2VRCD 4KDEA 4QUKA 5A04A 4DUPA 3RC1A 1EUDA 3NEPX 3WSVA 4Q3DA 3RIHA 1S6YA 3CMCO 5F21A 1YL6A 1XU9A 3GLQA 3VTFA 1N1GA 4OH1A 4NMHA 3D0OA 3V2HA 1WAMA 2DTDA 3LYLA 1P1KA 1UDBA 2VN8A 3IUSA 4FN4A 4PLHA 4W99A 2CVOA 3GGGA 2C7VA 4J7CA 5DCWA 2J6IA 4ZQBA 3U4HA 4RJTA 3PWSA 3T7CA 5FFFA 1O0SA 1QYVA 1XQ6A 3ROQA 3F9IA 2Z1MA 3IAHA 1ZMTA 4CMEA 4Z0PA 3ZU2A 4CM3A 2PZLA 1YBVA 4JJIA 4M55A 4RVSA 4QO8A 3RUFA 3DOOA 3HN2A 3LF1A 1GR0A 1QR6A 1A72A 3MWEB 4MKXA 1ZSVA 2WJPA 1ZMOA 3JD2A 2JKVA 2NVUA 5CPFA 5ER9A 3ROKA 3RWBA 2I5PO 1ZXLA 2OP0A 4WLEA 3PJEA 2NVBA 4J7XA 3H5NA 4E5KA 3QJ5A 2GASA 1NYTA 3JQAA 5KVSA 5AXCA 1AHIA 2UDPA 2V7PA 2JD2A 4WNCA 3MCVA 5T64A 4MIOA 5ITVA 4E6PA 4OQZA 5KKCA 3RUEA 2VTDA 4NG5A 4ALIA 1GZ4A 3GPIA 3QVOA 3IP3A 5HS6A 4TKMA 1V9LA 3DR3A 3D5TA 5HWSA 3C1OA 3A1NA 4R01A 5JCXA 3BTSA 1DSSG 1FDWA 3L9XA 3SBOA 1B8PA 3AY7A 3P19A 4BNMA 4RVDA 1D7OA 3H3FA 3MJ4A 2ET6A 3F46A 4HP8A 5F1PA 4FJ2A 1U2GA 5JMWA 2CD9A 3AUAA 3UAGA 3Q2KA 2EW8A 4HWKA 1R66A 4FS3A 1HE3A 2HMUA 4BO9A 4NBVA 3DL2A 3DHYA 1IE3A 4WUVA 4GH5A 4EBFA 4QEDA 1MP0A 2GCGA 4EUEA 4II3A 2NU8A 3PTZA 1LC0A 3HHPA 3JQ8B 1RM5A 3EUWA 4DBVO 2ZCVA 4B7XA 1KOLA 4XR9A 1LDEA 1HYGA 2UV8A 4B4UA 4BO2A 5FF9A 5I9LA 4QT0A 1TT5A 1JW9B 7MDHA 2IZ1A 1MC5A 3Q0EA 3ADPA 3K30A 3MJCA 4BNUA 3DZBA 4CM9A 1TI7A 1VL6A 3NUGA 4R4JA 1NP3A 1OOEA 4RV9A 1DIBA 3WJ7A 4B4VA 4W9NA 1NPTO 4IDEA 5B12A 4ONEA 4WJZA 4NFHA 2PV7A 5KKAA 4Y6SA 4AVYA 2Y1CA 4K6FA 3VAZA 1JVSA 4E0BA 1P1FA 5K0ZA 2QZZA 1Y8QB 1Z45A 4J1TA 3TZ6A 2HMTA 4J4TA 2Z5LA 4CV1A 1HF3A 3JQDA 3W8FA 1NVMB 2ZTVA 5CAEA 4ZRMA 1IULA 1E6EA 2EXXA 3CH6A 3UOGA 3GC6A 4RF4A 2A35A 1HDCA 4RORA 1C14A 5BSFA 4JJGA 4JBHA 1JLLA 2G0TA 1T2CA 1G0OA 2VYNA 1HETA 1MLDA 4I1IA 2ZB8A 2V6GA 4QX6A 4B3JA 3PP8A 1C0PA 2D3TA 4IJUA 2DBVO 3LDHA 4E5PA 1NHWA 1YQXA 3H4VA 1B26A 2YHUA 4EJ6A 3FNHA 4WCDA 5DOZA 5CDGA 4OL9A 1P1RA 4ZD6A 1JAXA 3VDQA 1I01A 5T57A 1U3UA 4YPOA 2E48A 4DPMA 1YKFA 4HBGA 4FGSA 4BNLA 2NTNA 3E48A 2P2SA 5JYFA 1VJ1A 4J91A 4OOFA 4P4NA 4B8ZA 4D43A 1IZ0A 4L8VA 5A9TA 4PLWA 3OEWA 3FBGA 3I3OA 4H15A 4FFMA 4XDZA 2TMDA 3D3WA 2OBYA 2HU2A 4BUCA 2CF5A 4IQ8A 1B15A 4AJPA 4YAEA 5GMOA 5IXSA 3A06A 1DXYA 1PTJA 1EMDA 5JBIA 1GUFA 1DIRA 4XDYA 2OMEA 1YJ8A 1VKNA 4BGIA 3JD3A 1YO6A 3O9ZA 3WB9A 1GUZA 3MTGA 4B3IA 2ZYAA 5JYAA 3KSDO 4NBUA 2NM0A 3ZWNA 3AM3A 2FPIA 3VPHA 1DHRA 4YRBA 5A03A 1AE1A 1GPJA 1PJQA 1ID1A 1UP6A 4OKIA 4YT5A 4M87A 3KSZO 4JIGA 4CM8A 4FC7A 4JN6B 4R54A 1I3KA 2FSVA 5G0VA 4J9UE 4IGEA 2CSUA 5BR7A 5L4LA 3JQBC 1QYDA 3P2OA 4YRAA 4CM8B 3WYCA 1N9GA 1TLTA 1AXEA 3ANLA 2AEJA 1BDBA 1LI4A 1PQUA 1MUUA 2A94A 4M86A 5CEFA 3JTMA 4UEOA 2CNBA 3PHGA 5I8ZA 3S55A 4BNZA 1LA2A 3WBFA 1BDMA 4KDFA 3VC7A 2OXIA 1Q7BA 2YUTA 1ISMA 2EW2A 2ZTMA 5DNAA 4ILKA 1MC4A 1O89A 4YAJA 3VPFA 3BMOA 1QYXA 3FF4A 4GGOA 4WEOA 4CLEA 1GY8A 1DBVO 3WGTA 1Q0LA 5THQA 2Y1DA 2Y66A 4KP7A 3E18A 5B4UA 1PJ3A 4CMGA 2VCYA 3NRCA 4GMFA 3TQHA 1N5DA 4IZIA 3AFMA 1PGQA 1R16A 3GN1A 4DMLA 5ICSA 4CMJA 2HCTA 3U4IA 3O38A 1Q2XA 1ISGA 1KIFA 4RF5A 5KJCA 4Z0HO 4FFOA 1T2DA 3WFIA 3OSUA 1EVJA 1X1TA 1LLUA 3G17A 3QE3A 1PJ4A 5T5QA 5J9GA 1IOLA 4R9RA 2D8AA 4CQMD 4JROA 1PWXA 4N5MA 4IIVA 2X9VA 4FPXA 4XR4A 5EIOA 1DIHA 2ZYDA 4E2ZA 1I3MA 3GEDA 4TRNA 1N8KA 4NNJA 2HMVA 1EFKA 4RDHA 3IP1A 3DZJA 3CXRA 2EV9A 1PJLA 1I32A 4Q39A 5DDIP 1E6WA 4GMGA 3L6OO 1EUCA 1LTHR 3INTA 4NJOA 4TVOA 5F5NA 1Y6JA 3JQAD 1BHSA 2E6UX 5KVQA 5A9SA 3CTMA 3D1LA 2H5LA 5IAAA 1GYRA 1ULSA 1W73A 2QG4A 1LDGA 3V1TC 5JYDA 1DRWA 2PY6A 3MZ0A 4R68A 4J49A 1O95A 1C1XA 2RH4A 1BGVA 1C1XB 3E9NA 4EW6A 1CIVA 3QA9A 4Q3AA 2NTVA 1CEQA 2YV1A 2GD1O 5AXBA 3AOEC 3GVPA 3P7MA 1U5CA 4PLZA 4PCVA 3C85A 1X7DA 1Z73A 1A5ZA 1P9LA 2QQ5A 1CJCA 4XX0A 4FJ1A 2AQKA 4M54A 3WGYA 4YDRA 3CE6A 2IZZA 3ZNQA 4PG4A 2O3UA 2Y0DA 4TRMA 4XYEA 5COQA 3OMLA 4FC6A 3NDJA 2JJYA 3Q9NA 1YDEA 3JYQA 3H8VA 4R9SA 4CM7A 2IXBA 1T2FA 4AJIA 1EEHA 3D7LA 4UREA 1RWBA 3HDQA 4CLHA 1H2BA 1C3VA 3DXFA 4L73A 3AI1A 5F3RA 4LK3A 2NQTA 4PLFA 1ZH8A 1VJTA 3RVDA 4J4HA 1GD1O 3C7AA 3OA0A 3AW9A 3OIDA 5JO0A 5C7LO 2X9NA 4AJEA 1E3WB 1FXSA 1UH5A 1RPNA 4RPJA 2ZIZA 1N1EA 4XQGA 1ZO8A 3DOJA 1M2WA 4CR7A 3KBOA 3KEQA 2V6MA 3EK2A 1X7GA 3I1JA 2O4UX 4R69A 4J90A 3HQ4O 4J3FA 4E5MA 2HJSA 1Z7BA 4Y67A 5G4KB 1PGPA 3PQEA 3JQ8A 3MEQA 4EEXA 5IFLA 1ZEJA 4HFNA 1JKIA 4TMFA 4ZICA 4NQZA 2CY0A 1B8UA 2OBNA 2UVDA 3GFBA 3QWBA 1LSUA 5H82A 3R3SA 8LDHA 3GZNB 1BSVA 1IPFA 4CR6A 4ZQHA 2GGSA 1VPDA 4YA6A 5BQFA 3UGKA 1E1KA 3I5MA 4JBGA 4R1SA 1E7SA 5L7WA 1VL0A 2EKPA 4PZDA 1W0CA 1PZEA 4CQMA 3H9QA 1N7HA 2RAFA 2V6FA 2DU8A 2OO5A 3HFGA 3MOIA 1XLTA 4OKNA 2UUPA 3WBBA 4OMUA 4PLVA 4HKTA 4WK6A 2BD0A 3T7EA 2RH8A 3ZU3A 4MVJA 1ADBA 4I5DA 1HSZA 2PH5A 4B7CA 3I9NA 1E5QA 1LJ8A 3NDRA 3C7DB 4CODB 2D5CA 2I76A 4PLTA 2H1SA 3NJ4A 4YACA 2Q45A 2ZJ1A 4RF2A 3S1LA 3AOGA 4A7PA 2VYND 3PLNA 4Z3KA 2O2YA 3DBLA 4KUEA 4LVUA 1PZFA 3RBVA 1UR5A 4LISA 1FF9A 1T24A 2Q1TA 3PVZA 2CFCA 2DBQA 3VH2A 1PGNA 4CMIB 3O8QA 1ZCJA 3QQPA 1R4NA 2HK7A 2EJVA 1PIWA 1SB9A 3GRKA 2RIRA 5IZ4A 3DONA 2WDZA 3SXPA 2HMSA 4GSKA 2NVUB 3I9LA 1HSOA 5H81A 2X58A 4IXTA 3RASA 3H9JA 1VL8A 4W7IA 5K9ZA 2PLAA 3NYWA 3PHLA 3WWZA 4CQLB 1GU7A 2IODA 1SBYA 1IPEA 4ALNA 2QYSA 3ZU5A 4LSWA 3QW2A 3H2ZA 1DEHA 4GVXA 1ZSNA 4CQLA 1NAIA 2J3JA 4QQRA 4Z0TA 5CG1A 3PWKA 5JFOA 1UXHA 3GH3A 4EZBA 2DUWA 4XYGA 3I9JA 1YBAA 1Y5RA 4E33A 3IUPA 4UUOA 1GL3A 2B37A 3QHAA 1YOVA 2QRLA 2IXAA 3B6ZA 2JAHA 3DZGA 3AOEA 1SO8A 2AEFA 3BA1A 4L74A 4QO7A 1YL7A 5DBFA 2ZQYA 1QSGA 2FHSA 3KB6A 4IZHA 3LC7O 4N54A 1M66A 2BFOA 4URFA 4XJTA 4YEDA 1EVIA 1KVRA 1NFFA 1T1SA 3W4JA 1NBOA 4ND1A 5JC1A 1CQIA 4FQ8A 2WD7A 1LRJA 1UXKA 2EF1A 1EDZA 5JYEA 3D5QA 1MFPA 5JNLA 2VHXA 1K89A 5CDUA 2PKQO 3BTOA 4C7JA 5F1OA 2AQ8A 2C59A 3DBRA 4CMBA 5BSHA 1IUKA 4K1LA 3LT2A 3EGOA 4CMHA 2G76A 4GX1A 2EERA 5IG2A 1PL6A 1PL8A 2Y1EA 4FFRA 4KUGA 1AUPA 5GY7A 4PGFA 5KVCA 1NWHA 1LDMA 4XIYA 3CEAA 1VJ0A 1ZK2A 5GZ6A 2Y0EA 4IXWA 4E2YA 2WEKA 3JQFC 1AGNA 2W4QA 1X15A 4DVJA 1F0YA 1O5IA 5THKA 3RFXA 5L4NA 2BLLA 4RZIA 2W2KA 3K2EA 1Y8QA 5L7TA 3JSAA 1HXHA 5JS6A 3N7UA 2OOSA 3JYNA 1B8VA 4R51A 3TL2A 1YGYA 1MGOA 3RBXA 1I3NA 1XYGA 5IN4A 2NSDA 3GPDG 1E3EA 2VWHA 4KZPA 4DWVA 4AJ2A 1WPQA 3JYOA 3G3EA 3C7CB 4EJMA 5A4DA 3WQSB 3KSUA 4XWYA 5MGBA 4OSOA 2NTJA 3B1FA 1QKIA 4JXKA 2AEMA 2EIHA 5TGDA 4BB5A 4R16A 4CM9D 3ETEA 2VRCA 3K92A 5EL0A 1UXIA 2VZ0A 2WD8A 4ROSA 1X7HA 1U28A 1E3LA 4DIFA 2CF6A 4AJLA 1X1EA 4B3HA 4R5HA 4EUFA 2DTEA 1C1DA 2Q4BA 1I3LA 1H9BA 3K96A 5U4QA 1O94A 3HDYA 1L1FA 1NVTA 2BF7A 1XELA 1JA9A 3R1IA 5ICMA 3GFGA 4JGBA 5KIAA 4A10A 3ZNOA 2Q99A 4XCVA 1DIAA 2CVQA 2C20A 2R2GA 1DAOA 5EMHA 4P4GA 4NU6A 4S1VA 5C3MA 1WNTA 3QVTA 1KERA 1WDKA 3O03A 3Q11A 4GSLA 3S8MA 1X14A 3OHSX 2FN7A 3PJFA 1GYQA 4MVJI 4W6ZA 4A27A 4ID9A 4IY1A 4B7UA 3Q6IA 3F1KA 3IDSA 2NADA 1I0ZA 3EDMA 4PLCA 3LQFA 1M75A 4OJNA 1DC5A 4RGBA 5ER6A 4I9NA 4XEHA 3P2YA 3TRIA 4ZJUA 9LDTA 3GNQA 4KWIA 5EINA 4HNGA 4BO0A 3AU9A 4Z6KA 1SPXA 2X4GA 1T26A 2EP5A 2O3TA 3BHMA 3WGQA 1NPDA 4KTVE 1LLQA 1IY8A 4LCJA 3AUUA 3BMNA 4DXHA 1SC6A 1KYQA 5JAQA 4TZTA 4Q9NA 1PU2A 2NUAA 1P77A 3AJRA 3FNGA 5AXDA 2ILTA 3KYDB 4DYVA 1P31A 1YH3A 1HDGO 3FTPA 1A9ZA 1PWZA 3MOGA 4PZCA 2HUNA 4QFDA 4YAGA 4IDFA 5IZCC 1ADFA 4CLXA 4XYBA 4EGFA 5BSGA 1GCUA 2Y05A 1HLPA 3I83A 3CZRA 3VKUA 4BNYA 1BXGA 1NPYA 2DFDA 4G2NA 4XGKA 4D7AA 3PIDA 5EN4A 4Z3DA 2JHFA 3GG9A 4RQUA 1X0XA 5JE8A 4BMSA 1WW8A 5T8KC 2WE8A 1DC4A 4DLAA 4WASA 2HSDA 3VZSA 3E8XA 3GQVA 4RCVA 3EVNA 2JFFA 5B37A 4G5HA 4MDHA 4CV3A 4J2OA 4RVUA 4BO7A 1GCOA 5TNXA 3WLFA 4YQYA 1IZ9A 1B0AA 2OP1A 5IDWA 1E5LA 2X22A 2QHXA 1HT0A 3PJDA 1P1IA 5KJ6A 2Y68A 4YR9A 2HK9A 3AUSA 4LCEA 1E3IA 4N5LA 5DOVA 1OI7A 2XPCA 4BKOA 2Y67A 2CUKA 3PYMA 5L7YA 3WYEA 3ZCXA 4ALLA 4GI2A 1FDVA 4IQ0A 5HA5A 3BMOB 1Q0HA 1LC3A 1T2EA 1KY4A 4A2CA 1HDRA 1B14A 3FWZA 5T67A 3ZHBA 2G1UA 2ZATA 1J4AA 4I5GA 3KYDA 1UDAA 2ZCUA 1ZBQA 3EMKA 4KMSA 2PA3A 5G0WA 3ONFA 1MB4A 4TVBA 3ORFA 1W4ZA 3PYXA 4WLVA 2XXBA 4DIBA 2FR0A 3AUTA 4GX0A 4ZU3A 2JD0A 1HE4A 3WJAA 2IRWA 3BXXA 4L0QA 2JFHA 3ICCA 5C7IO 3PJGA 3LVFO 4F45A 1BG6A 1EBUA 3I6QA 1UXJA 3I52A 2GDZA 3GMSA 1NWCA 2FMUA 1RKXA 1I5RA 2EWMA 3KM0A 5G4KA 3NT5A 1OMOA 2PR2A 5ADHA 4J7UA 1PS8A 2B5WA 3INRA 4BHTA 2Q2QA 2FZEA 2YYYA 2IEDA 2X5KO 1XCBA 2Q2WA 5B4VA 2WYWA 2WYUA 2X0NA 2B0JA 3H5RA 1Z7EA 3W8DA 4OGWA 2AE1A 3KHUA 2FR8A 3X2FA 3R0IA 2QW8A 3RROA 5ENDA 4IMPA 3ZI0A 1E1LA 2PFGA 3K5PA 2D5AA 4U7WA 3SLKA 5TLSA 2R6JA 3GHYA 2FWMX 5A9RA 1GQQA 4MO2A 3GF4A 4WLUA 1GUYA 3JQ9A 1GQ2A 1CF2O 5BSEA 1WMBA 3AWDA 2P5UA 2YQ4A 4RDIA 5JDCA 4IDBA 2O7QA 3H9GA 1B3RA 1K0UA 2BHLA 2BELA 3PXXA 4RF3A 4E5NA 2LDBA 3NX4A 3BIOA 4OSPA 1M6HA 5L95A 1JQBA 4DRYA 3ENNA 3KV3O 1G1AA 2BI7A 2DPGA 5AQ1A 3IIEA 1VRWA 5EQFA 4K9DA 1MG0A 2IZ0A 4OXNA 4EDFA 2Q1SA 4BNJA 2FPGA 3ROPA 3KOUA 2X5JO 2X7HA 4WLNA 3FRJA 2IDZA 3GEMA 2F1KA 3FN4A 4PFJA 1QMGA 4MOWA 5CDTA 4E13A 2VNAA 1SEPA 4Q3NA 2DT5A 1CRWG 1ISHA 2ZB4A 4ZGWA 2J5QA 1H9AA 1YL5A 4BO8A 4MVJM 1DLJA 5B1YA 2YDYA 4IQGA 1EZ4A 2AXQA 4EUHA 2DUUA 2WSBA 2OORA 3E9QA 4UUNA 4U5QA 4YJGA 1HDXA 1ZFNA 3UN1A 5A1TA 3KTDA 4JX8A 2XXJA 3G0OA 2POQX 1YJQA 3GVHA 4XJSA 1MX3A 3FHLA 4YJFB 2VQ3A 1ENZA 4XGIA 3W4KA 1V35A 4CR8A 2B4QA 3OA2A 3OIGA 1RM4A
chains in the Genus database with same CATH superfamily
4KXWA 2K2WA 1BE0A 1ADGA 1T0BA 2F4NA 3AHHA 1L4FA 4H7PA 3ST7A 4TLDA 3HCCA 1QLWA 4BRUA 5MHTA 4FB5A 5CPBA 3C3WA 3LBIA 4JLJA 1FRNA 5HMMA 4FVTA 5JOQA 4DC1A 2Z8YA 3BE4A 3A8TA 2ZI6A 2ZITA 5JQGB 4JOBA 3NTRA 1BVYF 4E88A 5I7EA 4KC0A 1EGHA 4F5EA 3HZOA 4DV0B 4G8DA 4AZ3B 3OO0A 1L0BA 1TIKA 2YJZA 3Q7EA 3RC7A 4IM7A 2ZOSA 1DOHA 3RFVA 3SC6A 2NU7B 2ZJZA 1JXQA 3CSDA 2W8ZA 1L7VC 1U9JA 1D2AA 1FOEB 5TVKA 3WP1B 3U4CA 5LL6P 4KJZA 5DMXA 4EEZA 2IHUA 2WJZB 3N5KA 4PRKA 1C0IA 4IIUA 1ONSA 1QIJA 3PR2B 2IL1A 5JROA 4IOJA 2WMYA 4PYOA 4X00A 2CFTA 4OTZA 1K7CA 3A6FA 1ZAYA 3AY6A 4UHFA 3SK0A 4X63A 2OCAA 1MHMB 4M21A 5BN5B 2CKMA 3T7DA 1XZLA 4Q1DA 1SCBA 2FRVA 3KYCB 2X9GA 4IKOA 3UWKA 5JQGA 1L1QA 1PW7A 3F5FA 3IOYA 2ZRCA 3ZBPA 2Q0XA 4MVJD 1KR2A 7ABPA 3EY4A 3NJRA 3AJ9A 1CHDA 3DZIA 4FYWA 1GGMA 1KU6A 3I9V6 4HEA1 4LJLA 2B94A 4EB6B 5JY1A 1AHPA 2JG3A 3F6YA 1AN9A 2HIHA 2VA9A 3QLVC 4GLOA 4MWZA 2O2HA 5DLYA 4YCCA 5NLLA 3H1FA 4YXWA 2GYYA 2C4KA 1DELA 2HTFA 4GX5A 4YP0A 4URXR 2PUGA 4AG5A 4LSMA 2YWGA 2BE7A 3W9UA 3D6MA 1OZAA 4MUBA 1B0ZA 4BQOA 4CUJA 1WU8A 1PJAA 3T5BA 4UU8A 2QPOA 4MPRA 5FDFA 3DAGA 1TKBA 3SC2B 4E1VA 4YYEA 3QKUA 4DAOA 4BKQA 1QRDA 4H4CA 4Y2HA 3SZRA 1JGTA 2VHEA 2AFVA 3VAYA 1TEHA 3WMFA 2RC6A 4BS9A 5AVOA 4TMKA 4IFEA 3C3KA 2ZQZA 4CIWA 1WB9A 5ITZA 4JQZA 2Q6KA 2XUHA 2OE2A 1V6AA 2J31A 4J0FA 4TLCA 3H9EO 3H1AA 4E31A 1E63A 5KWEA 4F2DA 5KNDD 5A5EA 1X13A 5J2UF 1QHEA 1PE0A 2I1QA 1Z0ZA 1VG8A 2RKBA 2ZWAA 2D2VA 2I55A 3AF0A 4G5FA 5BRJA 1K8ZB 5AKJA 4JXZA 4ZTUB 2UZ1B 3AY3A 1DADA 1W93A 4OVKA 3DT8A 4ND6A 5FRDA 2XQGA 3LIPA 3RHZA 2IZ7A 4MWDA 3U6KA 3A04A 4LXIA 4BZZA 3ROQA 4O4IF 4BRSA 3CX8A 1U31A 1XD2B 3SC2A 5F76A 2NO4A 3BXPA 4C87A 1K5PA 3FDZA 3K9HA 1K6IA 2Q1WA 1GXSB 1NW6A 1UP4A 1QFYA 3REOA 3WIDA 4M8NE 3BCHA 4HY3A 5D8DA 4U63A 4FFNA 2J5KA 1TJ5A 1Y5MA 4UAGA 3V3KA 2ZM6B 4AKTA 4FGLA 3VSBA 1J49A 1UBEA 4HRXA 3ZE6A 4F6LA 3T7JA 3DNMA 2I3AA 1SIOA 2F17A 1VA5A 1SUCA 3ANMA 4BVBA 1V43A 1Y80A 1PFGA 3ZZ0A 5D87A 3T7IA 2XHZA 4I1RA 4F1JA 3ZZMA 3C1AA 2FUKA 4H1UA 5DXAA 3NDIA 1P0IA 1IEWA 1LB1B 1R4NB 1T0JB 3IPLA 2P67A 4CMIA 4ENTA 4DV1B 1ONNA 2W6MA 3JZIA 3SFTA 5ALEA 4Y1RB 1Y9ZA 1NVWQ 2OV1A 2Q5CA 1NXSA 3G1WA 1NP7A 1NY6A 1VGVA 4FDLA 4IFTA 4MUJA 2L82A 4QPCA 3MJHA 1EVQA 1PBNA 2YS6A 3ZE0B 4YMHA 3NUZA 1CZHA 1ZK1A 3K9LA 3GP5A 3QA3E 3LUCA 1DX9A 1FTWA 2Y1KA 2Z57A 3DW1X 4U2GA 4XLLA 5FAKA 4M0UA 5BVGA 5I7SA 3SZMA 2Q46A 3GV0A 2HR1A 3FFTA 2QTGA 2XVAA 3EOBI 1VKRA 4IIEA 3VMMA 4NXNB 4NFLA 3ZDCA 2E4ZA 4RIFA 3PITA 5L4SA 1SXJE 2ZQ5A 4MS4B 4DUYB 4WFJA 2HRCA 1P7PA 5FV7A 2B4KA 4BLUA 4DA6A 4TL7A 5A06A 5DTQA 2WJIA 1J8DA 3DEAA 2QUAA 2IIQA 3DUWA 2QNIA 5JXWA 1YXMA 4AMBA 4Q02A 4JEUA 3S2YA 1BGXT 2LNDA 1G5RA 3CR8A 1I7QB 1NYRA 4KGDA 4H17A 1CJMA 1Q1NA 2CL6X 3DHEA 3NNSA 4GVLA 4NARA 3W1VA 4ZEMA 4PYKA 1XLUA 3GZNA 4HDNA 6CHYA 5JR3A 3EEYA 1DIGA 1QG2A 1Y7LA 2ZTUA 4X94A 3TN7A 3NONA 5REQB 4O02B 3CWQA 5C8XA 2XRZA 1F20A 1WUJS 1ZONA 3AHDA 3NP7A 4Z9AA 5SY9A 5ERYA 4CIDA 3DH0A 1JX6A 4V3CA 2YWJA 5ELLA 4EYOA 2DKFA 5U1PA 3S27A 4DCVA 3COSA 2C4TA 1P3DA 2OMKA 1T29A 2AR9A 2VNKA 3RFFA 4DM7A 2OCBA 3SNKA 3DOEA 3IAM6 3R4VA 2HIGA 5EYPB 5KSPA 5BQXA 1DG3A 5MN5A 1S9DA 2O14A 4YV1A 1CSEE 1GTRA 5LU9A 3EXEA 1IXRC 2GTHA 4ISBA 2WKSA 3GNTA 4WDRA 3E2MA 1PS9A 4F56A 4ME6A 4KPEC 5DYGA 2A5GA 3KCNA 2VHYA 4QXPA 1K97A 2D3WA 2OLJA 4DRZA 2OV2A 2Y0BA 4X85A 5JPIA 1TADA 2FV8A 2QQEA 4KE9A 4EO7A 5A2GA 3CNOA 1FU7A 4BJ3A 3RSQA 1JG2A 3MLAA 3QBTA 4YI5A 1LQUA 4RJLA 1LBTA 1MD9A 2AOVA 4BFSA 4BNIA 1NDUA 2NZYA 2XB9A 1E5XA 1UWKA 3V2UA 4PBTA 3A7DA 1DQRA 3L7IA 4WBXC 2WMOB 3ZWPA 3DE0X 4AY2A 5LXTA 3QXGA 4D41A 2WWXA 3T4EA 1G3RA 2BFBA 1Y5NA 4HZUA 1Q16A 2IOYA 2DAPA 3E82A 1RYYA 4PPNA 2XUFA 4HMQA 1LDBA 2HMYB 4O4HB 4D6YA 4Z2AA 5SV2A 4RTJA 2NT3A 3L8YA 2FMKA 1YK1A 3HFRA 4KQXA 2WT9A 1KDRA 4UBMA 2QV0A 2WUFA 4WINA 5C31A 3GT0A 1Y3IA 1M0SA 2WK1A 4L4SA 2HC9A 4BP8A 4ZAFA 2IWRA 4EFMA 1ISPA 1LF5A 3ZDZB 2QLJA 4M1OA 4JB3A 4KVFA 1LK0A 2CXXA 2BMDA 4L6IA 4A0QA 1SCUA 4GC9A 4HDOB 4KPGA 3WAGA 4KQKA 4WJLA 1EUZA 4QTZA 5J63A 1RC8A 4U5XA 5IJXA 4XW2A 3ZR4B 2G06A 3K8OE 1GR1A 2R00C 1UAGA 1RRKA 2HEGA 2N47A 3FNFA 2V1UA 5P21A 3WYBA 1KSJA 2O19A 2PKRA 4OBBA 3SVTA 3DOUA 1BMFA 4XDGA 5I9NA 1XNJA 4OI1A 3ZHVA 1SG0A 3ETCA 1RXYA 4HVLA 2BKAA 2YFQA 4EAAA 4JQCA 2EJUA 1EAYA 4ZEWA 2PGLA 4EI2A 5CXUA 5CP8A 4ZAXA 3MMNA 3IVAA 3K15A 3VR6H 1IXSB 4Q9LA 3L7MA 1S2GA 3CRVA 1CXZA 3BK1A 4U8GA 1SCKA 1OI4A 4BV8A 1BYIA 1MEOA 4HOYA 4CMKA 2ZVDA 4WOKA 1U5BB 2FWRA 3VTZA 1P61B 3E9YA 1F2TA 1HT3A 3LJKA 3TPCA 1Z82A 3ZWDA 4C3UA 4A8PA 2YKGA 1V0JA 4I50A 1RWVA 4JB0A 1XRMA 2F67A 3TDNA 1RP7A 2QMOA 1ILEA 2BBOA 1D2HA 1NVVR 4G0ZA 3PQ3A 1GPUA 2ODPA 4B17A 4ZRDA 4WESB 4IMRA 2FFJA 3A4VA 3ICWA 3L8ZA 1EA7A 5FOUA 1J2EA 2G40A 3TGWA 4CHGA 1KJIA 4BV2A 4L75A 4X41A 1B93A 1M1YB 4QXRA 2AEEA 4ZZ0A 3ZWCA 2ZWIA 2OVBA 4M46A 4A8JC 2QP9X 5M5BA 2C8LA 3GG2A 3H83A 3K09A 3FPFA 1K66A 4BWYA 4HNRA 1JMVA 3CN7A 4FYIA 2CYBA 1C1YA 2PRKA 3DBHA 1ODIA 3RFTA 4R9VA 3EIHA 4J07A 3B38A 5DYWA 3VDXA 3C39A 2IOFA 3GYGA 4BB9A 2CDBA 2A9FA 1ES9A 1J07A 1DAGA 4GEKA 5E9JA 1CERA 3I28A 3IMCA 3KPWA 3KQOA 4LTMA 4N12A 4HAOA 4BKRA 4HCJA 4K9NA 1RT9A 4JGGA 1B2LA 4UVDA 4KFCA 3MQ4A 4WGGA 4E09A 4LY0A 1RLOA 2VWPA 3FAKA 1ODCA 3L1KA 2FFAA 5AHKA 1YJ5A 2VS1A 4UBOA 4Q18A 5JSZA 1JDBB 1UDCA 4GL4A 6REQB 2MHCA 3NM4A 2JLQA 2CB9A 2F9LA 1AKQA 2WSLA 3ZWBA 1URPA 4TSFD 2JBAB 5BV2P 3OY2A 1C7EA 3CX3A 4AO6A 4LRSB 4AXBA 1JFFA 1RJDA 1VSQA 2Q07A 3I0NA 4WK0B 3K2BA 5AI8A 3UVEA 4MUYA 1Z4OA 3KEOA 4RH0A 4YAIA 2A1UA 3OI7A 5IUKC 3LUBA 1N2IA 4MR7B 1HDOA 5EXTA 5DU2A 3TGPA 1N2GA 1U7ZA 3KTOA 2MSCB 4KHZA 5F4BA 3DP7A 2XGSA 4H31A 5AM3A 2B3DA 4PXSA 5IDQA 1HGXA 3GQBB 5DNEA 3MLEA 3R9KA 1J8VA 4BNFA 2Z08A 3DZHA 2XOXA 2X8LA 3CLVA 3IVXA 2J9ZB 3K0HA 4QNRA 4BN5A 4YJHA 4GWLA 4LYHA 2LUOA 4B3MB 4XRRA 1K4MA 1NE7A 3WOHA 4A9AA 1H8ED 4NMMA 4BQRA 1G64A 1ZRSA 1FB5A 3AKDA 3I2HA 3VVBA 2FSSA 1UBNA 1LNQA 2FY8A 3HU3A 2O1WA 2FZKA 3U4QB 1T5SA 1AHHA 4PF1A 5JDIC 1I7CB 4P93A 1HURA 1Z5WA 3R77A 4RMNA 3N75A 3RJTA 3DTTA 3SYLA 3Q7PA 3U49A 2ATXA 3JAWA 3A3KA 1EFTA 2H4FA 3HH8A 1E2KA 1KPGA 2HPHA 2A0WA 1KQPA 3IMFA 3N3BC 4IVNA 4R3WA 3OPXA 3TXYA 6ABPA 4R81A 2HI0A 3WKCA 2WB4A 2IHVA 4BVEA 5CLFA 1BU8A 2XGGA 3B2EA 1IK4A 3FZEA 3TD2A 3VZQA 4BQFA 3BFPA 3KV1A 5IT0A 5BV1A 1JA1A 1XKQA 1WXDA 3O0TA 3ODGA 5K6TA 2PKYX 4CM5A 4LBYA 4H4EA 2FN9A 3JQ6A 4XX0B 2CV2A 4BZQA 5CFRA 3GJRA 5KDOA 4TV9B 3VU8A 5KPDA 3DMGA 4GKAA 1ESDA 1E7RA 4UUBA 4HRYA 1EQ2A 2D74A 5DT2A 1I4OA 5KJEA 4NS1A 3TZHA 1ZGJA 4HB3A 4UEJA 1DBQA 4RPKA 3TG2A 1DKPA 3ZTWA 3BULA 2TRSB 3WA6A 1XZ8A 2O4CA 1W36B 3RIGA 3AGPA 2ZJ4A 4EVRA 3TLXA 2FW9A 3KR9A 2OCKA 3SBXA 4YMSA 4CKBB 1LQ2A 2QJWA 2X1MA 3K9NA 1SB8A 4YJ2A 4HUQA 5A7FA 1L5VA 2PS3A 3KVVA 1GGJA 5EJFA 1ABFA 1FDRA 4JP5A 4ABYA 1WS6A 4NS4A 4A0SA 1PNOA 5F4ZA 4GPD1 1D6SA 1CETA 5GAJA 1P2UA 4LX0A 4QELA 3FDIA 2OKCA 4BAUA 4RTKA 5AFSA 4LUCA 1J9GA 2POCA 3UTCA 1QO7A 5HRAA 4G5GA 2J9GA 4CU2A 3DWGA 4K9RA 4I08A 2Q9CA 4NBSA 5G1OA 2OFFA 2QSYA 1EX6A 3WGIA 5EUMA 1OD6A 4KU4A 3C15C 4LZPA 2OKGA 1D1TA 3W3AD 1W6UA 2RH5A 2P2CA 3UT5A 3RAFC 1NIJA 1V2HE 3F3MA 4O0MA 4MV3A 2P6OA 4ND3A 3EDOA 4ZPJA 3CURA 4CEIA 1KRWA 1CUZA 2EP8A 1PFWA 3UH1A 1WDLA 4XWWA 4LXUA 4PTYA 1J25A 2QT9A 1CY7A 1S7CA 3VNVA 1SZJG 2LXNA 1ZC3A 3LT4A 1OLOA 4IHQA 3AWIA 1O54A 2WT8A 3FYDA 2I34A 3UQZA 1JKMA 1WPXA 2ZB3A 3VJRA 4D4MA 2IF2A 1E2PA 1EJ0A 1WHTA 3A9WA 1NBMD 5ALUA 4FHGA 1HV8A 1EP2B 4D9GA 3OJOA 2BKUA 3FMPB 3ONEA 3UWMA 4A0FA 1U8FO 1XA0A 2PNFA 4OQLA 1RS0A 4P22A 4B0OA 4OMDA 1JHZA 1G5HA 4RSGA 3HSKA 5HIIA 3VH4A 5LD2B 2BFMA 4ND8B 2JIZD 2G1PA 3JU3A 3T38A 1DEOA 1FYXA 1G3IA 1MPXA 3HYSA 2L69A 3S2FA 4I4TA 1A9SA 1B0UA 2CWDA 3OJEA 2NV6A 4B43A 4YLEA 3AR9A 3MGGA 5EZSA 4C4ZA 1AF4A 4IL5A 4DCSA 5CK5A 5LLDA 5J2TB 1DL5A 3M6IA 1GN9A 1FC0A 3KKNA 2ILVA 2YCLA 2COUA 1FFEA 5EKXA 2OZEA 3C6QA 1CX9B 1K1EA 2P4QA 4MMYB 3VZRA 4Q19A 1XHLA 3OT1B 3IXMA 4KQGA 4HZIA 3SXUA 4WZAA 4IG4A 3KQHA 1US8A 3PPIA 1CC1S 3ZCTA 3NLLA 1NNUA 5HJ2A 3IEPA 9ABPA 5C51B 3MYYA 3OZWA 1BEZA 2B7LA 1GZVA 2E5WA 4Q3CA 5LQJA 2H00A 2IH2A 1M2OA 4GOJA 4QJ4A 3GVXA 1ECLA 3R9IA 3OBBA 4RO0A 1HT1E 4IH4A 3AHCA 5DH9A 2GPNA 2XWBF 2ZUSA 3S8YA 3IAS1 1V3VA 4LHXA 1NG9A 2UXBB 5HILA 4WT7A 1GRNA 3WS7A 4LE0A 1ULZA 1JENB 1N57A 3UW3A 1NUHA 1SBQA 3FWYA 3NEAA 3P2KA 4OP2A 4AJJA 1ZWKA 3GLSA 4YJFA 3S1AA 2O7RA 1TU0A 1EG7A 1DCTA 3I5YA 3ETHA 2WWIA 1CNFA 1UFVA 1DT3A 1UBUS 2GN1A 4TUYA 2RG1A 3LPAA 4G9BA 1FDIA 1TM1E 1K2VN 3G8AA 5HEKA 2G6TA 3D4PA 3JAWB 1U8EA 3KPVA 4RLHA 2GBLC 4BUZA 3QVGB 1P33A 4W9RA 5F1KA 5AW9A 3T4XA 3VSEA 3KWMA 1J0DA 2DYKA 2W98A 2BM9A 4R2KA 5FI1B 4MINA 4OLFA 1ZM4A 4RCYA 4U9UA 5K4GA 4DKJA 4W4TA 4WKGA 3FYHA 1NKSA 3V33A 3O4IA 1PUXA 1KNXA 2ZYWX 4E1AA 1VC2A 1JEQA 5EIXA 3FCSB 2I4NA 4YJHB 5GZ3A 3GUVA 2I78A 1Q7GA 1BOOA 3PT5A 1SVOA 4FE7A 4B2YA 4BCDA 1R4MB 4FGWA 2CLDX 1Z6QA 3GQBA 4NU0A 1FSZA 1JIIA 1W76A 3ZWMA 1HC7A 3KHSA 3B9RA 5IEJA 5E38A 1LF0A 2HRZA 2TECE 1VLJA 1WA5A 2XGMA 3JY6A 5COBA 1TNDA 2QX7A 3O4JA 4NL4H 3A4NA 1ECFA 1E66A 2GS9A 1QWSA 3D8TA 1MGPA 5J47A 3FPBA 4ARZB 4BRWA 5JEDA 4EJSB 3TZKA 4JITA 3ZW7A 5EJ9A 2GPJA 4R0NA 3QFSA 4QOSA 4PG8A 1K8YB 1Y81A 4FFBA 3GCDA 3KTAB 2JBAA 2QLNA 4WBSA 4PX9A 1ISFA 1T6XA 2ENUA 1QG6A 3OEED 3ORRA 4POAA 4DCCA 1DFHA 1GIAA 1CUFA 2PYDA 1ZUIA 1WQ1R 2QE6A 4M76B 4ZQGA 3I73A 2CD7A 2YHAA 1Z7YA 3BXFA 2ZBDA 1SVWA 3UHFA 2R8EA 2JFNA 1OE0A 4JCCA 4EPYA 4U0KA 5U9CA 1U65A 2V54A 2FOXA 5J4YA 2ZI3A 1XRNA 4Y2RA 4FFLA 4DEXA 2GKGA 2GLTA 4D57A 2ZWMA 4IJVA 4AURA 1KXJA 4AJ1A 1H23A 3BGOS 1ZZEA 3WHKA 1OFGA 2ATVA 5FO1A 3DDWA 3VNRA 4F2WA 1JQEA 3GEEA 1I8TA 2WNHA 3QELA 4GZLA 5EIHA 3KJEA 3VPBA 4RDXA 1F6WA 1W8DA 2PZMA 1J20A 2ZAYA 1ZL0A 2M6KA 2JH3A 2BCGY 4TXLA 4BNXA 3DDZX 4OQXA 2F1OA 4R7GA 4GHWA 2V7VA 1K5GA 1RQ7A 2VNJA 4BQSA 3H5OA 2I4RA 4K9LA 3JQGA 5A5DA 5ARBA 5FA5A 3L6BA 1DP4A 4UM5A 3MCZA 1W85A 2DWUA 3DVSX 4N48A 3BE8A 2QUIA 3JQ7B 4A0RA 1ABBA 1U0BB 3BRSA 5DSTA 1DC7A 2JHPA 1A82A 3QHPA 4PC6A 3A58B 4DV2B 1FYDA 2Y6UA 4BO3A 1DDIA 1EHYA 2I65A 1MA0A 3NIBA 1D2NA 4O89A 4HLUA 4IUYA 3K5IA 4M53A 2AUMA 4Q1BA 2PSSA 1J42A 2AX3A 1PEAA 4EQZA 1XHEA 1W25A 1Y4UA 3MGCA 4QATA 1IZ8A 1TUBA 4DDHA 5FCDA 3VR2D 2W4IA 5I9TA 4KR7A 4O2AB 4XLZA 4L27A 1LEHA 1NQXA 2F3QA 2IYAA 2NSYA 3PPXA 1M7BA 5AK0A 1UJMA 1GNTA 3QGMA 1UAYA 4TOIA 4I99A 1T9GS 2CFRA 1BXGB 3JQQA 3MJEA 4IVQA 4ZXPA 5C8YF 1N77A 1IM8A 1VE1A 2PYZA 2CDCA 3IWBB 1A8PA 1PNQA 1E9FA 4X0EA 1KDYA 2ESRA 2VF4X 1YS1X 1KYWA 4IIYA 2VF8A 3FUCA 3PQDA 1THTA 3EGDA 3CN9A 4IGFA 4E2XA 1R5OA 1C3OB 3JVDA 4FFSA 4E11A 3GUCA 4EPXA 2OILA 4EUKA 5IYZA 1SOWA 4LOJA 1NVFA 4MGYR 4G0XA 1O94C 4Y2TA 5EPOA 5K0NA 5GJWC 3MPOA 3RFUA 3N2LA 1TT7A 5E0OA 1H2HA 2IYPA 3RAJA 1DU4A 2V8OA 3JR3A 4M88A 1GVHA 1I2AA 5IN5A 1AUXA 1GAJA 2VSXA 4BLRA 2X77A 1K7EB 1ZW6A 2ZSDA 1E18A 1VI2A 4RNCA 1RE0A 2C99A 5DHUA 3TX6A 2HYIC 1QK4A 3W9SA 1ZQ1A 3CY6A 3LDUA 5JLAA 5MN6A 5DCUA 1UOPA 1T8PA 2ZUUA 5TV2A 4G0PA 2WF6A 3U4MA 1G41A 3GT4A 1KE1A 3PV0A 3UF0A 4EF5A 2PIAA 4C2BA 4ZGGA 5LCXA 1Z4NA 3ABSB 1G17A 2NO6A 4KLZA 3WKBA 4BX8A 3GGSA 2NT4A 4OXYA 3DO5A 5KOIA 5ALSA 4ITUA 4MNTA 3IESA 4QEKA 2MWMA 3ZWAA 2CUTA 4GOKA 2GPYA 3IHKA 1XCOA 3RRXA 5BWNA 1YDMA 1ZLXA 2QX9A 4FKMA 1KBZA 3HU1A 2FSUA 1BS9A 4N5DA 2X13A 4F3NA 3QE4A 3HCRA 1R18A 2X2OA 4PHGA 3EXEB 3GRUA 5MFZA 1QZTA 2B8NA 3VC3A 5CA1A 5EJ7A 2B4TO 3CCBA 1VRCA 5FBZA 2CNDA 2DKNA 4D0RA 1SIBE 3CYFA 2VJDA 3IB6A 2WPDA 3QVKA 3CLTC 3F3KA 3H9CA 5I7OA 1AT1A 3AUFA 3ZY6A 5KVVA 2CB0A 1LW7A 1VSVA 1SUIA 4HXGA 4RKYA 4B9EA 4ZDWA 5F9HA 2IS1A 4XB1A 1T9DA 2LDXA 2WABA 3QM1A 5FADA 4IRXA 4Y9RA 2YZ2A 1WXIA 3EXHC 2AFIB 2B2XA 2DLDA 2SKDA 1BD3A 3DLBA 3IQEA 4GG1A 3UJPA 3UW1A 1DJLA 5ANRB 4YT8A 2QD1A 5JH7A 1BNCA 2VT7A 3O26A 1ZGCA 4PS0A 5FFNA 3OF5A 4JJKA 4HWOA 3JYHA 2Z0MA 2SCUB 2H7YA 2JEYA 3F7NA 3G8DA 3GLRA 3DKKA 4X71A 3DMNA 3ZCVA 5J4KA 1U2TA 4UD6A 1U0TA 2PMCA 4OPMA 3UWSA 1CD5A 3W8RA 5DISB 4UHEA 3W8EA 3ZUGA 1FSPA 2FKNA 3C70A 2IV2X 4FP9A 1QVAA 1GPDG 4XUCA 2AXPA 5FOTA 4FDAA 4YDHB 1ZHHA 3I9OA 5JDIA 5LYJB 1AO0A 2UZIR 3M4NA 3C5HA 4BP9A 3I39X 5BSVA 3HKEA 4M8KA 1D8AA 3B3QA 2XB4A 5SZIA 2H29A 4FJ0A 2XTAA 4NZ9A 4Q47A 5C7OO 2ZR8A 2GVDC 2B8EA 1GG2A 4Z9YA 2F90A 4OI4A 4DUZB 4WLOA 1JG6A 3TRDA 1Y6FA 4OGFA 2FEPA 1GP2A 4XGQA 1SFRA 3L02A 4RVNA 4YJKA 1EFVB 1NBIA 4GZ6A 2CDNA 3IJPA 3IVCA 2BUBA 2QB5A 2D0PB 3H04A 5DTEA 4GE3A 4X44A 3ZV7A 2A0XA 3T9AA 1P4JA 4XWOA 1E32A 5FNZA 2BFFB 3OZ7A 1CF9A 2FLKA 3KU4A 3VOBA 4Y2JA 4G9EA 1X9HA 4D4LA 2XWQA 4B44A 2B2CA 4GGMX 4UMFA 3V1UA 4K6MA 2Y1FA 3DAFA 4GRAA 4BL5A 4BPBA 2DPLA 3U4GA 1UBRS 4A8TA 3W6UA 4B46A 4BLSA 4OD0A 4LHVA 4OQ4A 2YCBA 3I09A 2VLIA 1TFRA 3OD1A 3N2KB 4EHJA 1BW9A 1D5CA 2V74B 4YYZA 3UENA 1KAMA 2G25A 3N53A 5C5DA 4V0ME 3HZRA 3GOQA 3PVSA 4R40A 5CLHA 4PNEA 3LS2A 5I3ZA 5KEIA 3OESA 5FAXA 1Y6GA 4NVRA 4U7PB 3ZHUA 4DOMA 5C3UA 4JMLA 4WOJA 2FJPA 4YMIA 4WKOA 4QTXA 5HP4A 5CEEA 2PZJA 4KQ9A 1XDZA 4ZOLB 1TMGE 2AOUA 4OBWA 3L4JA 5FPYA 2AZDA 4BNKA 1Y9JA 3GLHA 3Q8WA 2FEWB 1CNMA 3R41A 1PZNA 1JDNA 2WYOA 4CEJA 3NT2A 4B79A 1JXMA 1DKRA 1UCFA 2W0MA 1UT5A 3LSTA 4PBRA 5ESXA 2NW6A 4R31A 4ZVRA 5E7IA 5IDYA 2EATA 2C2HA 4KFRA 1WQ4A 2ZAGA 2P7HA 3KLPX 3P2IA 4FN5A 1O95D 4AS2A 5AKEA 4GYKA 3CPSA 3K72B 2MR5A 4F11A 1OGIA 1CZOA 1QF6A 4OHYA 1H22A 1Z6ZA 1UM9B 2YH2A 2EZTA 1G7TA 4L8GA 3D64A 1GL7A 4YMTA 4G09A 1UDWA 4WN3A 1NI3A 1LI7A 1SUAA 3LUHA 3LXUX 4DCOA 4HPJB 3TBKA 1CDOA 1BW9B 1JAYA 1NG1A 2VAXA 4XYMA 5TSDA 3JX9A 4R1TA 2NXWA 2JGDB 2P79A 4CTKA 1D1SA 3NG1A 2VQEB 1IM2A 4IW3B 2JCYA 4DQVA 5BNFA 2J7PA 2PWBA 4YH1A 4WA8A 1VM6A 4H0FA 3UOAB 3ORHA 4DC9A 2EL7A 4QDJA 1HZJA 4RKFA 5H4HA 4MDFA 3C6YA 5CLJA 4XH9B 1KYVA 1EK5A 1MVNA 2ATEA 1RBMA 2NTEA 4JGIA 5CVJA 2V6BA 3G0CA 1Q92A 1VECA 1EH5A 5F5LA 3DE7X 3F5SA 5DBGA 2FR8C 5B53A 5ES3A 4E94A 4OXIA 1OSNA 5EFZA 2R25B 3HRHA 1NULA 3HEMA 1N33B 1N2OA 1HE5A 1T35A 3JQ9C 3KK0A 2J9RA 1VMEA 4X64B 4PVCA 3UWPA 5BYAA 1C4KA 4UE3S 3OFVA 2IYXA 1VMIA 4IIXA 4C01A 5AW0A 1MVOA 5FL7D 1MB2A 2VDUE 5IARA 2HYDA 3GZ4A 3SVZA 4D5EA 3EDRA 1HTBA 1L7AA 3BMCB 2B4RO 3TB6A 5ICFA 1M2HA 4TQGA 3KXKA 3EBOA 4OHCA 1TZCA 4WLFA 1D7AA 4A4DA 4MQUA 4YT4A 3ED5A 1NN3A 2VXOA 1KQ3A 2PD4A 4FU0A 3R7LA 3CIFA 1UPTA 1ZKMA 2YWCA 3KSAC 3LOUA 1W88A 5G0SA 1HY3A 1XQXA 4O0LA 4NV0A 5LQKA 4ZT2A 1WCIA 5JUWA 3FUVA 2VCHA 2G1JA 4L78A 3OIUA 3JQRA 3SX0A 4BLWA 4MQ6A 4BNDA 3HNOA 3ZNNA 5KQSA 3SHWA 1PT6A 1UPFA 4BX9A 1TZMA 5FTWA 4E5DA 1W30A 1PVVA 1C4WA 1SQFA 1Y1QA 2PGOA 2Q3BA 4YBZA 4Y98A 2FEOA 4LDRA 2ZUBA 1MIOA 5DYNA 2O23A 1KVSA 2QU8A 3FH0A 4OSEA 1PK9A 1V3UA 3UJAA 5JCZA 3IE1A 4N3AA 2QSUA 2W70A 4BB0A 4C6TB 1QE0A 1NN5A 2XE4A 1PJBA 2XNKA 1NW9B 2GKSA 3C4VA 3OCVA 4M0FA 1F8UA 5EESA 2VXYA 3CGGA 2O48X 1NMEA 1PX0A 4D4IA 1X9GA 3E81A 3FA2A 5GVRA 2F4VB 4B85A 4BBPA 4CPDA 1EYZA 3EAFA 2XRYA 4LNUB 4G6ZA 3OOEA 2OA0A 2J5RA 3OFND 1Z0FA 4LV5B 4NPHA 1J6UA 2XWSA 3KWFA 5CCBA 4I8DA 3TQTA 4BPRA 2HWWA 1RLIA 2FRDA 2Q21A 4AIIA 1T2VA 1T2AA 4DBLE 2GNOA 1YS9A 3ES9A 3AXSA 1DX6A 3G13A 4XOUA 3CINA 1T0HB 4XGNA 1WIWA 3NYRA 4MEAA 5FBLB 4BO4A 3U60B 5ALJA 1RM0A 3U3XA 2IITA 1TL7C 1QFSA 3W34A 1HMYA 1YU6A 2ZE7A 5KAPA 3RS7A 2Q1YA 5FBHA 5K6AA 3IQDB 3OQIB 3FMVA 3OCYA 4RVHA 1PR6A 5E0KB 4CV0A 4FZ5A 3EGEA 1WLYA 4PYLA 2HSZA 2VBIA 3WHIA 1V2GA 1TK3A 1WBBA 2EQ5A 2CXHA 4G84A 5EGNA 1U1DA 1ZAKA 2QRQA 3I23A 3KOMA 4NYIR 3ZIAA 2CUZA 3I9V1 4UM8B 1AKWA 2ANBA 1MQSA 1JPNA 3OSZA 4BAGA 1KAOA 2LD4A 5KYYA 1G4HA 2D1QA 5DNCA 4X92A 5EXXA 2ZSIA 3AERB 1Y33E 4D25A 1H2FA 1R15A 2O7SA 2OORC 3EQ9A 4KACA 3WIEA 4N82A 3HV2A 5BT8A 1XWWA 1XZIA 4RVOA 3BYZA 4UNIA 5DK4A 5IP5A 4JA0A 1JIUA 3C98A 1OI2A 1H0SA 4BNVA 4BCBA 1GEGA 3GK3A 2UVPA 3SLGA 4Y2UA 1IVSA 4LOAA 4BX0A 5EZ5A 1SQGA 3WTCA 1WUTA 3BKXA 1KFCB 2KWIA 1LX6A 4N7RA 2R48A 2JZNA 4O2AA 1CUIA 3RSGA 3V4FA 1TF2A 1WWKA 3WKDA 1KETA 2UAGA 2R4UA 4Z7OB 2XUKA 2HGZA 1O6BA 2ON6A 3KXDA 1NKTA 4UCQA 1PZHA 1VHWA 1V9SA 2ZE8A 4MA4A 4X3OA 4F21A 3WNCA 1M74A 2KHZA 3O3MB 4OHXA 1PQYA 3D59A 4B0PA 3SX4A 1CV2A 4GX2A 4BVJA 5C1IA 5A4KA 1KOFA 1TX4B 1OXXK 1Y4AE 1IN4A 1J24A 1ZSYA 2VPTA 3DQQA 3GFSA 3M1AA 1ZMRA 4FQ7A 2I67A 4JU8A 4HZGA 5GTDA 2Z4RA 2B3TA 4ZOLA 2WAXA 2R62A 3HADA 5CVVA 4ROTA 1FVFA 2JNWA 4RV5A 4DUGA 1EM8A 3B7GA 2PX0A 1Y8RB 2SHKA 1E96A 1GV0A 1O87A 1GT6A 3AQ4A 3K1TA 3MGKA 5HPYB 2M1XA 5JS1A 4CL2A 4EPRA 4AQ7A 2CW5A 1MAVA 3O2NA 5JT1A 1H5QA 2PT7A 2Z5FA 3MXOA 1G60A 2WHEA 1YQUA 4YVFA 1MQ9A 3KQMA 4E4TA 2YHIA 3E22B 1P62B 4BQPA 5YASA 4DA0A 821PA 1T9BA 4M1EA 3MT0A 1RWWA 3QBDA 4HQ6A 2YW9A 1XMJA 1E3SA 2ID7A 1NNI1 1PL7A 4HJRA 4LWQA 2CDAA 5IKOA 4ENUA 3EP6B 4U2BA 3R3XA 4OF4A 1JSZA 5CR9A 2C5HA 3L07A 3T1OA 2QVBA 4KXVA 1RD4A 1SKUA 1ZJ4A 1RP1A 3OVMA 1KKMA 4MB6A 4WZAE 4V0QA 4YUAA 4V0OA 1UWLA 3Q3VA 1IFXA 2BGMA 1GZ5A 3FWKA 1QIKA 4MS1A 1VPVA 1DC8A 1WB5A 3H18A 3UKOA 3NQ41 4INJA 1BZYA 3H2GA 1R12A 4G0YA 2AJTA 2I6QA 2WLSA 1G21A 2VZ9A 2YOHA 3JCZA 3N8HA 3MTAA 5A7HA 3QVSA 4MW7A 3OETA 3ZE8A 4EB0A 2VKQA 3IE0A 3U1VA 5BUSA 3WISA 1PR2A 1DE0A 3ZY3A 1PUIA 1VMDA 3FLMA 4EKDA 1QORA 4BMDA 1QOZA 5E6UB 1JV2B 3SG0A 2ZRGA 4R98A 1HQCA 5G0UA 2PQ0A 5AOVA 4BU1A 1X1RA 4C7BA 1FFAA 2PN1A 1KP9A 2DQKA 2PO5A 2VDQB 3OZVA 1R3UA 1ONBA 4TT3D 4ZHQA 4NJMA 5H9WA 1XX6A 4HADA 1ZBDA 221PA 4HL6A 5IXYA 1DEXA 2Q0SA 1AQIA 3TYXA 2CJYA 5EHZA 3WQRA 1AGXA 1Y8AA 4PG7A 5K0EA 2C7GA 2WWTA 4WH0A 3GGPA 5HUHA 3RYCA 4HVCA 5ISMA 3HKCB 1YA6A 1XQ1A 3U3KA 1GA4A 4AJOA 3EVTA 4KAXA 5EZYF 5KQPA 3Q1LA 4RFSA 3L7YA 1Q17A 1ILWA 1L5RA 1QV7A 2SCUA 2ZSFA 3HS3A 2FZWA 5L45A 1CKEA 1LSJA 1QVVA 3T3OA 1AXGA 5FUMA 3CEJA 5JZSA 4B3RB 2A1TR 5DTIA 3FOCA 2PUCA 1O5OA 1UPAA 1IBMB 4YP7A 1KDOA 3M82A 1S6YA 1Z13A 1SWVA 3C3PA 1RXUA 5F21A 3IFSA 1XU9A 4RMGA 3S1AB 3VTFA 1T9CA 1JSCA 1EBBA 2R8PA 3FZQA 1N6RA 3GBSA 4O1IA 4BE7B 4TSFA 1Y1TA 3D0OA 3KSBC 2IZ6A 3CVXA 5CITA 1WAMA 4UU1A 4ER6A 1P1KA 1UDBA 3F8SA 2IYUA 3KCQA 1Z5UA 4W99A 2G6BA 4OM7A 4Y2SA 3U4HA 4RZXA 3AF6A 1AF7A 2DWCA 5FFFA 5AVQA 1X6VA 1XQ6A 3FPKA 4GP9A 3FETA 3L8GA 1MJ5A 3F9IA 1M2OB 2Z1MA 4LZAA 5IDVA 3EN0A 3IAHA 4DLXA 1KEEA 1AS2A 2PQ2A 2JC3A 3U4AA 4OI0A 4M55A 2ZTHA 4D6XA 3LF1A 4KBGA 1GR0A 1US8B 2OV8A 4PSVA 1LTQA 3LRTA 2QAGA 3C5CA 3JD2A 2BZSA 1ZMOA 2OC4A 4V3BA 2NVUA 1XZAA 3DMDA 5AW1A 2I5PO 1VB5A 3DDSA 1ZXLA 4CVNA 3DL4A 1PVOA 3WB1A 1SK9A 2Q3JA 4L5YA 5D84A 3CKLA 4Q9KA 2NVBA 1T8UA 2VIIA 4CCYB 4QTYA 2AZ4A 3FSGD 4TQUS 4MGHA 1VG1A 4JLOA 3D0QA 5BMVF 2C7RA 3T4UA 4TYQA 1BA3A 3FDFA 3EARA 4MIOA 5ITVA 3UFXB 3OLYA 3A1FA 1U2GC 3KJIA 4C1BA 1YA8A 1HFJA 2ZYHA 4ALIA 4MWTA 4RIHA 2VJMB 1K3FA 3HABA 2W42A 1W7AA 3IP3A 1SELA 3FHJA 5HS6A 1OREA 2QA5A 4TKMA 3RIXA 4XVQA 1KO8A 2GMWA 1LD3A 3CUEF 3NHFA 5K8TA 4M0CA 3HACA 3T9CA 4GRIA 1WHTB 3DWIA 2ZEJA 2ZVJA 2CLOB 3K4QA 1P75A 4JLVA 4NSNA 4R2WA 4R01A 4F71A 5AW6A 1XZDA 1IAQA 3KLNA 4KVGA 2VDJA 3KDAA 1S2IA 3KQSA 5GM1A 3SBDA 4DSNA 5BVHB 5BP7A 4P86A 1B8PA 3WLHA 4BNMA 4RVDA 3WWEA 4Y2GA 1QVWA 1MH9A 3WGHA 4HP8A 4KQMA 4QRDA 1VPWA 2VKTA 1V6CA 4WXYB 3GRAA 1OH6A 3ZQJA 1KOGA 1UJ6A 1U2GA 4L4YA 5CJPA 5JMWA 3OLXA 1BDJA 2GK7A 3AUAA 4X20A 1EWQA 2GH1A 2NZJA 2YIJA 1W34A 2OAP1 2EW8A 4BU0A 4FS3A 4DMFA 2HMUA 1FUIA 1H2ZA 3B5JA 3EB9A 4RENA 3CVWA 3TM4A 1HORA 4V24A 3DHYA 3OLZA 3VTKA 1SZCA 2EFJA 3N7TA 4R2MA 3EHDA 4GH5A 1G2PA 4US1R 4V02A 2Q0QA 3B1ZA 3HA5A 3Q2OA 1OA0A 2OTCA 2DFLA 2WTAA 4LXYA 4G67A 4X6UA 2GCGA 4D9KA 5IKMA 4II3A 2NU8A 2FK7A 3DZDA 4B6RA 2Z6QA 3DOFA 3O4GA 2ZZKA 1RM5A 5ICGA 1K7FB 1JVNA 1TPYA 3NWBA 2X0KA 4CKWA 3D54D 1CQXA 1LDEA 4G8CA 1ST3A 4BO2A 3I92A 3PNVA 5FF9A 4L8YA 4MVCA 4QT0A 5GONF 3UPTA 4LFBB 2HREA