1PQWA

Putative enoyl reductase domain of polyketide synthase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
183
structure length
183
Chain Sequence
NEAATFGVAYLTAWHSLCEVGRLSPGERVLIHSATGGVGMAAVSIAKMIGARIYTTAGSDAKREMLSRLGVEYVGDSRSVDFADEILELTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFIELGKKDVYADASLGLAALAKSASFSVVDLDLNLKLQPARYRQLLQHILQHVADGKLEVLPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Putative enoyl reductase domain of polyketide synthase
rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords polyketide synthase
total genus 56
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.1.41: Beta-ketoacyl-[acyl-carrier-protein] synthase I.
pdb deposition date 2003-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pqwA00
1DIAA 2BI7A 1ARZA 1LRLA 3W4IA 4QECA 5BNIA 2X1HA 3O26A 5DULA 1PJQA 4AICA 1YQDA 5TT0A 1AHIA 3BIOA 4OM8A 2J5KA 3ZU2A 4J1SA 2VUSA 4WK6A 2C5EA 3IUPA 1U3VA 2EEZA 1I33A 3BMNB 5T67A 2PD6A 2VHWA 2H63A 2X5OA 1E1MA 1YDWA 4J1TA 2EP5A 4PFJA 1FJHA 4RVDA 3PQEA 1VJTA 3K8ZA 1MLDA 1AN9A 2VHXA 3D5QA 4LCJA 4BO7A 4TRNA 3TL3A 1VSVA 1BDMA 4ZICA 2HU2A 4NJMB 1PQWA 3EC7A 3RC7A 3PDJA 2JD0A 2BFOA 3DQPA 3K2EA 4RO0A 4YQZA 2HCTA 1A27A 1XIVA 1XSEA 3PQDA 1EQ2A 2AEMA 2B0JA 4DVJA 4WLVA 2G76A 3HN2A 4EJ0A 4OAQA 4P22A 1T4BA 4QO7A 2Q1WA 5CP8A 3WQRA 4D0RA 4F6CA 3ANNA 4GSKA 5T64A 1P31A 4OO3A 4P4NA 3JQFA 2OL4A 5TF4A 3S2FA 2GN9A 2Y67A 2FPGA 3GNTA 4J7UA 4NH4A 3EYWA 1EVIA 2VYVD 3E9QA 1MXHA 1NNUA 5F3RA 3RU9A 3UHAA 1GPJA 1VPDA 1BSVA 3MCVA 3VH1A 2NWQA 3IUSA 4IPTA 4WLEA 3RROA 1CQIA 2WEKA 2EJWA 3S1LA 4XB1A 3OBBA 4XA8A 2NM0A 4CMKA 4KWIA 1Q7GA 4DUPA 1ADCA 1M6HA 1GL3A 3IQDB 3RBVA 1NAIA 3FNHA 5I7SA 3RC1A 4BMNA 3LC2O 4PG4A 2NQTA 2D3TA 1E7WA 4DC0A 3OIGA 3C7DB 4YJGA 5FEUA 3U49A 2G82A 5TSDA 1NQTA 3ANLA 3IMFA 4N54A 1I2BA 4FW8A 3ZV6A 1UXJA 4BO2A 7MDHA 3HFSA 2FZWA 1RM4A 1C14A 1O95A 3I9NA 3LLVA 3WBBA 4XR4A 1LLUA 9LDTA 1UP6A 1TB4A 2YFHA 3E8XA 3GNSA 4ND4A 2NACA 1GUZA 4BO5A 5JC8A 2JL1A 3PVZA 3HDYA 2J3KA 1ENYA 1ENZA 1DC6A 2JCYA 2GN8A 3DAFA 3H5RA 4ALIA 3K31A 4CQMA 1LNQA 1DIRA 2B83A 1BGVA 2YUTA 3NTRA 5GZ6A 1NFRA 2ILTA 3WNVA 3CINA 1PZEA 1YXMA 3RKRA 5CDYA 5THKA 5KKCA 3GAFA 3GGPA 1Q0QA 1IY8A 1SO8A 3EDMA 3P2YA 5B37A 4LCEA 2V6MA 3U4CA 3WLEA 1CQJA 2BI8A 2BF7A 2VQ3A 4A7PA 2DBRA 5CEEA 2I3AA 3P5SA 3E48A 5C3MA 1ZMOA 3WQQA 3B1FA 1Q7CA 1VKNA 4JP3A 2ZTVA 5T57A 1GR0A 3M1LA 3ZW9A 4RDIA 2O3QA 1ZMTA 4CV2A 1SEVA 4OOFA 5A4DA 1NAHA 3H9UA 1HE5A 2PD4A 1RYEA 2D5CA 2NVWA 4EUHA 2OP1A 3MOGA 5EQDA 4HUJA 3WX0A 3RC2A 3BAZA 1P0FA 1QV6A 2ZYAA 4AJNA 1OC4A 3I9MA 3P2OA 4RORA 1U2DA 4TSKA 4FBGA 3DBRB 3VTZA 3V2HA 4RPHA 2LDXA 1RKXA 1O8CA 4AJHA 1A9YA 5HM8A 2EF1A 1U8FO 5ICMA 1PSDA 2V65A 5BT9A 2RHCA 5AQ1A 3JQEA 1NBOA 3LC7O 1E3JA 4D46A 1GEEA 4Y9DA 4M1QA 3WOHA 4CR6A 5K6AC 5ENVA 3V2GA 2J5RA 1PL8A 1JKJA 3WS7A 1GPDG 2O50A 2X4GA 4JLWA 4E6PA 2Y1GA 4F3YA 4DLBA 2A92A 3I5MA 4CM4B 4MIYA 1LBEA 3H9EO 3LDHA 4YJGB 1EFLA 5DP1A 3AOGA 2YV3A 1HT0A 1AXEA 1KVUA 3E9MA 3ZWXA 2UYYA 5IN5A 4PGFA 4GLOA 1QORA 2DTXA 4EBFA 2ZTMA 2HO5A 2EXXA 3DO5A 3CXRA 2POQX 2WMDA 1NVMB 4ZQBA 2AMFA 3JQBA 3VH3A 3JD0A 1Z6ZA 4MVJD 3JQGB 3ZV3A 4CV3A 3DEYX 1ORRA 1DRUA 1U4OA 1LDNA 2HK7A 4HNGA 1H9BA 1C0LA 2BH9A 2OORA 1CWUA 2HUNA 4RVUA 3WGHA 4DL9A 3ETDA 4CV0A 3JQAA 4H7PA 3SJ7A 2FPPA 4MVJF 5F5LA 3PGJA 3GPIA 2YJZA 2WE7A 5EERA 5LCXA 3EGOA 3E6AA 4E21A 4BNHA 2HK8A 1GUYA 5EN4A 5I7EA 4GVXA 5CG2A 3HADA 1QV7A 3KYCA 8ADHA 2X9NA 4YAJA 1YL7A 3PFFA 4INAA 4IGEA 1V3TA 4CODB 4WE3A 2I76A 3UF0A 2DC1A 3MWDB 2X86A 5A9RA 4I9HA 4WKGA 1ZSYA 1TI7A 2WD8A 3QIVA 2EHDA 4ZQEA 2X0RA 3QE3A 2EV9A 3KEQA 4N5NA 1YB4A 4Z0PA 1XQ1A 3LC1O 3OECA 2W98A 4BB6A 3GFGA 4PLWA 4BIIA 2NNLD 3E5RA 3CUKA 1UP4A 4N7RA 5DBIA 3ZHBA 3WFJA 2AE1A 3DWFA 3RWBA 2FMUA 1KY4A 1WWKA 3OJOA 5DT9A 2AQKA 1T2CA 1I3KA 4FFOA 5L51A 1EBUA 1I3LA 4JCOA 3SXPA 1WPQA 5DF1A 4RLSA 4P4LA 3ONDA 3ZWBA 1JDJA 1LXCA 4L4XA 5J23A 1JQBA 4RVGA 3ICPA 3ZWCA 4P38A 3T7EA 1A4UA 3DTTA 4IM7A 3W6UA 4AG3A 3FNEA 4TROA 4AJEA 1ZK1A 5KJEA 3VDQA 1WAMA 2AXQA 4NFYA 1WDMA 1X13A 2VNAA 4GLLA 4FR5A 2ZQZA 4OYRA 2A94A 2BD0A 2BLLA 3Q1LA 2D4AA 5JPIA 4YR9A 3QVXA 4CLHA 4M49A 4BHTA 3P19A 1IB6A 3Q3CA 2UDPA 5JCXA 2PZMA 3LK7A 3INRA 1KEUA 4NNJA 1M6WA 2R6JA 5JO9A 2PK3A 4U8GA 3HHPA 1UZLA 5H82A 1M75A 2PFGA 2W90A 4II2A 1HWYA 1YQGA 3NGXA 1E1NA 2DUWA 2Y93A 3PHJA 5JAQA 4TZTA 4EGFA 3JQGA 1B3BA 4LN1A 1NXQA 3JCZA 2I3GA 1I24A 4MINA 3BYZA 3LSYA 3PWZA 4JROA 3ENKA 3IKTA 2O48X 4A26A 4WECA 2X5KO 4ALKA 4RF3A 4PLVA 4HFRA 3C1AA 2Y1FA 2RH4A 1NM5A 2PH5A 4JXKA 2RHRA 2W4QA 3NEPX 4MKZA 3IL2A 4TWRA 4J90A 3F6YA 3WYEA 5G4KA 1LDMA 3TZQA 1CERA 4KP7A 2VN8A 1E7YA 1JAYA 1SNYA 4YCAA 3VOSA 1X15A 3K9QO 1I8TA 3L9XA 2VTEA 1F12A 1N1EA 1QG6A 1YL5A 3G17A 1X7GA 3WWYA 4ZHSA 1NHGA 2HRBA 4J7XA 3DBRA 4HWKA 4ZQFA 2YV1A 2FHSA 2CVQA 3JQ9C 2BHLA 1HZZA 2VYVA 4MP3A 4NHEA 4R69A 1DXYA 3C1TA 5G0UA 3ULKA 1LU9A 3BTOA 2X23A 5FWNA 1UP7A 1PWZA 5BSGA 4H3VA 4CUZA 4CLXA 1ZZEA 3WGGA 3VH2A 1ISFA 3M6IA 4B8ZA 4JN6B 3OA0A 5A1TA 2E48A 3OQBA 1R15A 3WGIA 5KVQA 4BMSA 3LU1A 2EWMA 2JFHA 4FGWA 1PQUA 2VZ0A 1ZSVA 4C7JA 3FBTA 2ZB3A 4F6LA 4IDCA 2EERA 1Q0HA 5ENDA 3ZI0A 1B15A 1R66A 2NLOA 3NDJA 4RQTA 5HRUA 1SB9A 2P4QA 1JWAB 1LLQA 1DC4A 4XRGA 5JFOA 2Y1DA 3PYXA 4XCVA 2NU7A 1B14A 1Q7BA 3CZRA 4BO0A 4HADA 1Z7EA 4BMVA 2PY6A 1ZFNA 3DOJA 1WW8A 3C1OA 3KO8A 2HMWA 3ROKA 3WJ7A 2RAFA 2Q2QA 4LK3A 3ENNA 2Q1TA 4BNZA 1Y9EA 4O59O 2UAGA 4O0LA 1YJQA 3LT4A 3UUWA 3CEAA 1YOVB 1FF9A 4EZBA 3I83A 4NR0A 1N8KA 2X6TA 5COAA 3TFOA 3U0BA 4IUYA 5IZCC 5JDCC 4Y6RA 1CJCA 4R4JA 3LT2A 2DFVA 1DPGA 5L9AA 4RVHA 3U62A 3C24A 4FJ1A 3WWZA 5G2OA 2V6FA 3FRJA 4PLPA 1SC6A 3TL2A 1A7AA 2NV6A 4TKMA 5IDYA 3VVCA 1BW9A 3PZRA 4BNTA 4JJFA 4ZD6A 4DA9A 3NX4A 1N9GB 1QRRA 2BGLA 1RYDA 2GLXA 3VZSA 2C7VA 3OSUA 1LX6A 1PR9A 3WG9A 2Q1SA 3G49A 4D3FA 5LDGA 4DIBA 4YPOA 2X58A 1FDWA 1P3DA 3I9LA 4DLLA 1F14A 1MA0A 4WCDA 2PA3A 5KJ1A 2GPTA 1IPEA 3H8VA 2JCXA 5JYDA 1O89A 4DBVO 1NQAO 1ZO8A 2X0NA 4M89A 3ETGA 3D4OA 2B5VA 4QFCA 2BFAA 1D7OA 2RH8A 5IXYA 5KTKA 3FWNA 1RPNA 4KUGA 3DAPA 1GZ6A 3JD4A 2AQIA 1EQUA 5BSEA 1XKQA 3CMCO 4W9NA 1GQYA 1P1IA 1PR3A 5IZ4A 5JCJA 4DC1A 3QLJA 3WSWA 4OXYA 2W8ZA 3NJ8A 2PD3A 5KIAA 5K6AA 2HMSA 2FSVA 2VT3A 3KBOA 5G0SA 3RFVA 1M76A 2GERA 3OJEA 1O0SA 4CMBA 3AUUA 3L6EA 4J0FA 1IOLA 1PS8A 3HWRA 1LQUA 4IJKA 5G0TA 5TLSA 1DFGA 2VYND 1IZ0A 1EE2A 4PRLA 1DO8A 1U5CA 3GVXA 3JQCA 4XYEA 4PG6A 3JYQA 4R68A 2VRCD 1VC2A 4U6SA 4DLAA 5TJ9A 3E82A 3LZ6A 1K6IA 1U7HA 3E03A 4Q3NA 1T26A 4D41A 1HE2A 1PTJA 4PVDA 5JBIA 3DBHA 1EEHA 3QVTA 3ZU5A 1QMGA 3V5NA 1R4NB 4IDGA 4YTEA 2BFPA 4OIMA 5L4SA 1T2AA 1GV1A 3ZWNA 1E7QA 4Q3AA 5IDXA 1E77A 1HL3A 2XF8A 4E2YA 4BNXA 3OMLA 5L3ZA 1PGQA 5TC4A 4AJOA 3RQSA 3MJSA 3TZCA 4IZHA 3A28A 4MVJE 1UR5A 2HQ1A 4L4SA 2IODA 3VPGA 4ITUA 2AG5A 4TQGA 1TLTA 3ANMA 4MP6A 2DAPA 1WZIA 4R51A 2VZ8A 1DEHA 2GF2A 2YW9A 1P77A 5KJFA 4DWVA 1SOWA 4URFA 4ALLA 2NQ8A 1JWBB 1E6WA 2VRCA 5L40A 4FFNA 4YT4A 3H3JA 2EKPA 1N9GA 5I8ZA 1BHSA 3L4BC 1YRLA 1LSUA 1TEHA 2C54A 3GRKA 3F5SA 3JQBC 3TJRA 4BB5A 3HDJA 1PJCA 3CPSA 3LVFO 2C20A 1E7MA 3I4CA 3H5NA 5FFFA 2XAAA 4XRRA 2Q4EA 2UUOA 1F8FA 3QVSA 3IJPA 1XELA 1H2HA 1DB3A 3RBZA 2F1KA 1M2WA 4OH1A 1ZJZA 4UULA 2OBNA 1ML3A 4AJKA 2IXAA 3GVCA 4IJUA 2Q49A 3FNGA 4H15A 1AUPA 3WGQA 4FFRA 4YJDA 3STHA 4PLCA 4ZA2A 4HP8A 3RCBA 1PGJA 3OP4A 1L7EA 3K2BA 1P9LA 5I9LA 2NVUA 4BNMA 4LMPA 3BHIA 1KC3A 2I67A 3QW2A 4E5NA 5JW6A 1PL7A 5GZ3A 4WOJA 1N7GA 5H81A 4BKQA 4LMRA 1YVEI 5TIIA 1T24A 2DT5A 3WGYA 4YRBA 2Y1CA 3ZNPA 4R16A 5DP2A 3EAGA 1XR3A 1GZ3A 3VZRA 4KTVE 5EESA 2R00C 4ALNA 1FK8A 4GSLA 2F00A 2IDZA 3H9JA 2GNAA 1VL6A 1YOVA 4DYDA 3DZIA 1FDSA 1TA4A 4L76A 3IC5A 2OHXA 4D7AA 1E3WB 3GA0A 4BNVA 3GMDA 3SLKA 4I9UA 3SLGA 4CM6A 3K92A 2Y99A 5CEJA 2OXIA 1OI7A 2I6TA 1E3WA 3FHLA 2R2GA 4RPGA 4PG7A 1PGNA 4M8SA 4BO1A 1T2EA 3NJ4A 5ER6A 3TQHA 4UVDA 3NGLA 1B0AA 4I08A 4IDBA 1DIBA 4L8VA 4NK5A 1MV8A 2P68A 5T6BA 3GF4A 4OXKA 5DDIP 1W0CA 1T4DA 2I65A 3ST7A 4YAGA 4IMPA 4BOYA 5A9SA 4MDHA 3TZKA 2CNBA 4GL4A 2FRDA 2OUIA 2G1UA 4CL3A 3H65A 2X7HA 3RU7A 1MG0A 5A3JA 1YGYA 1Y8QA 5G4LA 2ZQYA 3JQDA 1DC5A 3L4SO 3H5AA 3OHSX 4E31A 1T2FA 2GASA 1HLDA 4AJLA 4XYGA 4QO8A 4KUEA 2YY7A 1UAYA 2C0CA 4YJHA 1S6YA 4EUEA 3GT0A 3IDSA 1NTOA 3KLMX 1Q2XA 3D3WB 4CM8B 5I9MA 1KVSA 2VWQA 2C5AA 4FS3A 4GKBA 4UREA 2Y66A 3V1YA 4U7WA 4A73A 4KTTE 3RASA 4ALJA 2NSDA 1E3SA 1HE3A 3PLRA 2FPIA 3LT0A 4BNKA 4G81A 4PLFA 4OSOA 1J49A 4CM7A 1EDZA 2NU6A 1EDOA 2HRZA 3K6JA 1YONA 3QJ5A 4Z9XA 2SCUA 3B6ZA 5C37A 2EW2A 4NI5A 3DZFA 3WR5A 3JD1A 1WMBA 4GAEA 2Y0CA 3GPDG 1N1GA 4I5GA 4NPCA 3DZGA 3TF5A 1SPXA 1J6UA 4NBUA 1I32A 3FF4A 5KNLA 4M86A 3JQ8A 1K2WA 4E4YA 4YYZA 1T25A 4NG5A 1V3VA 1HYHA 3PYLA 3QSGA 1F8GA 1GZ4A 3NTOA 1SAYA 2QQ5A 2P5YA 2CZCA 3F9IA 3BA1A 4EI2A 4DMMA 3PHHA 4MP8A 3W4JA 5CHEA 4DPKA 4JQCA 4EUFA 3U4IA 4L74A 3GVIA 3OEYA 3GZNA 4R1UA 3WLFA 1HZJA 1MX3A 2IZ1A 4X54A 4HX5A 1FDTA 3JYNA 4YA6A 2FP4A 3H2ZA 3K73O 1EUDA 3EZYA 4WGGA 4KDFA 4NJMA 2IZ0A 1OZAA 4GI2A 3IAHA 2OMEA 2YFQA 2HDHA 3V2UA 2CVOA 1PL6A 1PGOA 2J3HA 4XDZA 2X8LA 4XZ3A 2EP7A 2O2YA 3OQ1A 1UXIA 4R41A 4W99A 4ZQHA 4B7UA 1Y6JA 4W82A 3MOIA 4Q3CA 5BNTA 2DBZA 5K0ZA 1B2LA 3AM4A 3U5TA 3IKVA 3CE6A 2ZB8A 4Y8VA 2E4AA 3OJLA 3ONEA 2WDZA 5CDUA 3ITDA 1MFZA 4CLRA 5ES3A 4B3IA 4TRJA 1UXGA 4E13A 3GDGA 2HAEA 1H93A 1GQQA 4BNFA 4E32A 2VWGA 4XGKA 3HDQA 4R01A 3ZDFA 1DJQA 1H6DA 1I10A 1N92A 1BRMA 2AA3A 3DZHA 3IP1A 1H9AA 1Z82A 3WFIA 3PQFA 2Q46A 4OGWA 4RZHA 4XGIA 2IEDA 4K6FA 4I5FA 1G6KA 2NTVA 1NP3A 1Y5MA 1ZSNA 1V0JA 2EW8A 3MTGA 5MGBA 4I1IA 3K30A 1KC1A 3D0OA 2B35A 3RFTA 1A9ZA 1C1DA 3E9NA 1OMOA 1B8UA 4TMFA 1RM3A 1V6AA 1HDOA 1VJ0A 4WLOA 4LSWA 4IY1A 4J9VA 4S1VA 1IULA 1DFHA 3PXXA 4EEZA 1BWSA 4GVLA 4E33A 3O9ZA 5JAZA 5C7LO 4IJWA 4QT0A 3GZ4A 1TVEA 5AXDA 3V1TC 1AE1A 2YV2A 4E0BA 1ZVMA 3WYCA 4CLOA 3VVBA 4NZ9A 1YH3A 1UZMA 3W8DA 2X22A 1B8VA 1X0VA 3FR8A 3KXDA 2I9PA 1LJ8A 3WJAA 3A06A 4PG8A 5BSFA 2V6BA 3I52A 4FJ2A 1MP0A 3VPHA 1VM6A 4XWYA 3I9OA 4QEDA 1ADFA 3GVPA 4CLEA 2DQ4A 2TMGA 3RSHA 3L4BA 3I6IA 1V35A 4RDHA 1Z73A 3BTUA 3SJUA 3KSUA 1KS9A 1K89A 4RVFA 4UAGA 5HWSA 3TOZA 4WEOA 2CMDA 3F4LA 1Y8QB 3FWZA 1EVJA 1BVUA 3O4RA 1QR6A 1XDWA 3C8MA 1GYQA 3UN1A 2H5LA 5U1PA 3GY0A 3AI1A 2DPHA 3OETA 3WGOA 1BXKA 2CDCA 4ZGWA 4PCVA 1BG6A 3I9KA 4A2CA 4EYEA 4BNIA 5ADHA 2FWMX 2HJSA 2PV7A 4J9UE 1XG5A 4FOOA 1B7GO 1HE4A 4IXWA 3FTPA 3MTJA 1XWFA 3OF2A 1CYDA 4BUCA 2OOSA 1KIFA 3RI3A 3Q9NA 1XGKA 5JY6A 3O38A 3VKVA 3NT5A 2B4QA 1X14A 3SC6A 3KTDA 3FR7A 3OQ6A 3L0DA 1TT5A 4PRKA 1B3RA 5F1PA 1KY5A 3DBLA 2I99A 3ZU4A 2CDBA 1LLDA 5JDIC 2XXBA 1HDGO 3LLSA 4RQUA 2IEBA 1ZK3A 1QYDA 1NR7A 3COSA 4RJTA 1YWGO 5CDTA 2QIOA 2LDBA 4JJIA 5DNAA 5CEFA 5U9CA 2GN6A 3JQ8B 1H0KA 1K6JA 3C85A 2CUKA 3WXBA 1E1KA 4YVFA 1Q1NA 4CQMB 3JQ7B 4RCVA 5GMOA 5A9TA 4D44A 5CPFA 4EJ6A 3F5QA 1K6XA 4RF2A 1DRWA 1AHHA 3A1NA 1LA2A 1ZW1A 3INTA 5L7TA 1EK5A 2ZTLA 3AU8A 4XYMA 3GVHA 3RD5A 2NU9A 3DMTA 2O23A 3GZNB 4WCFB 2ZJ1A 3DOOA 1WXDA 5L4NA 3BHMA 2DM6A 4XQCA 1P44A 3QVOA 4TVOA 1M66A 2WYUA 3HE3A 3F46A 4JIGA 1U2GA 1GU7A 1A4IA 1X0XA 2Y1OA 3S2EA 3GFBA 4Z0HO 4KQWA 3NKLA 9LDBA 3BMOB 3DFZA 4QFDA 4DXHA 1SB8A 2ZJ0A 3AOEA 2P9EA 2OBYA 3CMMA 5T5QA 4M54A 4R5MA 2VT2A 3QHAA 2OO5A 3D7LA 4L75A 1R4MA 3LF2A 2Q3EA 4J0EA 3MJ4A 5TNXA 3Q2IA 1AXGA 1IPFA 3GN2A 4H16A 3RVDA 3UOGA 3RUIA 2A4KA 5JS6A 3PLNA 1PJ2A 4J6FA 1VE9A 1BXGA 1HEUA 4IINA 4BGUA 3A9WA 1LI4A 3KRTA 4CQLA 1B26A 5L53A 4QQRA 4FC7A 4EJMA 1XCBA 3AUSA 4HFNA 4UEKA 1U3UA 3PK0A 1KVRA 4FCCA 3ZNQA 4CQLB 4D43A 2YZ7A 3AWDA 3D4NA 2BGKA 5A02A 4J49A 1XHLA 4PVCA 2PZKA 3ZWMA 5HS4A 4Q9NA 3WSVA 1JKIA 5KVCA 4ZN6A 3D5TA 4RPJA 5TS3A 3QWAA 4XJTA 3I23A 5T8KC 1U28A 2Y1EA 3BTVA 4W7HA 5AXBA 3JQ7A 3JD2A 2ZKLA 3FI9A 4DBZA 4AJPA 2WYVA 4YDRA 2HLPA 2WD7A 3VDRA 4E5PA 1OAAA 3KLPX 1X1EA 2WWRA 3EW7A 3GUYA 3SEFA 1PZFA 3Q9UA 4BKRA 4XJSA 1WP4A 1H2BA 3HN7A 1BVRA 1NR1A 3BMQA 2B5WA 3KYCB 4OJNA 3TPCA 1VL0A 5JCJD 5TGDA 1R0KA 3X2EA 4XIYA 1TXGA 4DTIA 1EK6A 1Z74A 4LVUA 3GHHA 4NBWA 1JVSA 3GGOA 3H2SA 2YQ5A 3RJ5A 3UVEA 3IIEA 2NUAA 3ZHZA 5JMWA 4CMAA 3CTMA 3SC4A 1LQTA 4RF5A 2O3JA 2PGLA 1B16A 4FFLA 2NU8A 2AEFA 1Y81A 5A05A 5TRTA 3UCXA 2WSBA 4GGOA 2PKQO 1PEDA 5JNLA 1PQPA 3HSKA 4OKNA 3KOUA 4YQYA 3JYPA 5CPBA 2Q2VA 4JGBA 4GX0A 1Y7TA 1GEGA 2JFFA 1R4MB 2IE0A 3I3OA 3S55A 4S3MA 4A27A 1QKIA 3RUFA 4BV8A 3FTNA 1JA9A 4ILKA 4P8RA 4IS2A 2H1SA 4YAKA 2Z5LA 4XIJA 1JAXA 1ZBQA 3GNQA 5IFLA 4II3A 2WE8A 3KYDB 4GGPA 4Q3BA 1HYGA 3PDUA 2YHIA 2WJPA 3KM0A 2VRBA 4XEHA 4BQRA 1GTMA 1VKOA 3M2TA 4CR8A 3GLQA 4D3SA 4Z9YA 4BO9A 4OL9A 4MVJH 1HKUA 4OQZA 1NWCA 3OM9A 4UUMA 5IN4A 4E2XA 5JO0A 1HDRA 1E7RA 1PX0A 1Y9AA 4IIVA 4CMHA 1SEPA 2UV8A 3ITKA 2CVZA 3M1AA 2P9CA 4NK4A 4E2WA 1IZ9A 4KMSA 4CLOB 1MGOA 1TT7A 4KWHA 1W4ZA 1FXSA 2OP0A 4PG5A 4UUOA 3PYMA 1LSOA 3R1IA 4AJ1A 4B4WA 1ONNA 1G0OA 1K0UA 3GR6A 4NU6A 2X9VA 3FCOA 3LF1A 1GD1O 4MVJI 1U3TA 2P91A 4B3HA 5DCYA 3T7CA 3ROPA 4ND3A 3INGA 1QYWA 4NIMA 2B4RO 4NFSA 2YHUA 5IF3A 4CMEC 1QP8A 2WD7B 4QUKA 3SVTA 2JJYA 3HZZA 5IDQA 2Q99A 1W6UA 4A03A 3WIDA 2HMVA 1C1XA 1JN0A 5DN9A 1O94A 1ZXLA 4KDEA 4AFNA 3VZPA 1P1RA 1R6DA 2HKIA 2DKNA 3PFWO 4YXFA 5GY7A 2Q45A 3GDFA 2B36A 2FZEA 2VHVA 4CL8A 4E30A 3HQ4O 5ITVA 1GY8A 3B1JA 2P5UA 4A10A 3DZBA 1XLTA 4I5DA 3ZWYA 3AY7A 2QRJA 2PR2A 4MPDA 3JD3A 4Z0TA 4DGSA 1I3MA 2PZLA 3PIDA 1JU9A 3EUWA 3R3JA 4XX0A 4XYBA 3TNLA 2QRLA 1MXFA 2JCVA 1CEQA 4CM4A 3JQAD 5I8WA 4IS3A 1XU9A 5FYDA 1BXGB 1LSJA 1UDCA 3DXFA 1N5DA 1PJBA 2Q2WA 3DBLB 3OEWA 4ZRNA 1UDAA 3JQFC 3AM3A 4BKOA 4CMIA 4YT2A 1LDYA 5K9ZA 1ZCJA 4CPDA 2I5PO 1EFKA 2DU8A 4XQEA 3AM5A 4BO4A 4YJFA 5C7OO 5GZ1A 4QX6A 5U4QA 1D1SA 3W1VA 4U0JA 1YB1A 1LSSA 4PLYA 1DDOA 2FOIA 1GYPA 1QYCA 2GRAA 3H3FA 3H7AA 1XA0A 4YJFB 1ZK4A 2VNSA 1EMDA 2QW8A 4QSMA 5JAIA 1DHTA 4PN3A 4YT5A 4A5OA 5T8KA 3GMSA 3KYBA 4F45A 4NFHA 2Q50A 4WLNA 5B1YA 3DDNA 3LT1A 1QSGA 6ADHA 2QG4A 1ISMA 4E5KA 4IDFA 1A7KA 3AUAA 2O3RA 3ZH2A 1UUFA 2D0IA 4FPXA 1BW9B 3JQ6A 3QWFA 4JNKA 1HF3A 3KVOA 4QTZA 2AQHA 1V3UA 2EKLA 3L6DA 4TZKA 1I2CA 1HETA 2ET6A 3ZV4A 4CM3A 4XR9A 3PGXA 3DOCA 3EZLA 3JV7A 4YEDA 1P0CA 3VPFA 1C0KA 3ZCXA 5HTOA 3I4FA 1E5QA 5TQVA 1G0NA 3CSDA 5AYVA 3ASVA 3DMYA 3H6KA 4BVAA 5JDIA 1NPDA 4CJXA 4W7IA 3JTMA 3HNPA 3MEQA 4WEQA 1H5QA 2HMUA 2H9IA 2Z1NA 3S2GA 1FDVA 1UAGA 3AU9A 3ZWAA 4I8XA 1NYTA 2PTGA 3PJEA 3JYOA 3WGZA 5BR7A 3MJVA 4GX1A 4FQ8A 1ZEMA 4RV9A 1GCUA 1WDKA 1KOLA 4WJZA 3WNQA 1M67A 4WLFA 2IZZA 1E3EA 2YHIB 3C7CB 5ER9A 4U6QA 5L7YA 5KWEA 2GUGA 1F0YA 2Q1UA 4PZDA 4BNWA 2C59A 4EW6A 3R6DA 4R3NA 3WTCA 2D2IA 5A06A 4R9SA 1KYQA 4CUKA 4D42A 2FN7A 1H94A 2ZIZA 1OBFO 4Y98A 4B79A 2NADA 4MO2A 2QHXA 2WTBA 5A5EA 1E3LA 2AHRA 5JSFA 2OZPA 3GG2A 2AG8A 2VOJA 2DFDA 3QV1A 5TX7A 3ZU3A 1MUUA 1DRVA 1E5LA 4BS9A 2FSSA 1GUFA 1OFGA 2EGHA 5AVOA 1IHYA 1A71A 1O9BA 3EK2A 4IDEA 3PP8A 3PJFA 3F1LA 4R54A 2DBQA 3VKUA 5B4VA 4R5HA 3P7MA 3SBOA 1BTOA 1KEWA 4B3JA 4R1NA 1XEAA 2V6GA 4GX2A 1LUAA 1I2ZA 1NHWA 4DREA 3WBFA 1YO6A 1SMKA 1ISHA 4CM1A 1WDLA 3AI3A 3GDOA 3TDKA 1K3TA 5HS6A 2A35A 1KEPA 3NT2A 2GZ1A 4BO6A 1L7DA 3ROQA 1UH5A 1MB4A 4WPGA 1XU7A 2ZK7A 1NVGA 2IYPA 1NASA 3NDIA 3PI7A 4ID9A 1MFPA 4L9RA 1Y8RB 3GRPA 3WB9A 5F1KA 3ZWOA 4ND1A 1DLJA 3WMXA 4I9NA 4ZVVA 3KHUA 1R37A 1Y8RA 2W2LD 3GEDA 5HA5A 2GGSA 1UXKA 1U7TA 1E0DA 4IQGA 4Y6SA 3Q2KA 4YAIA 5DCUA 3NT4A 4UUPA 2XOXA 8LDHA 2VUUA 4BO3A 1VRWA 2J3JA 3I1JA 1N7HA 4WUVA 2J8ZA 1D3AA 2AEJA 3U09A 2B69A 4PLTA 4IJVA 3GN1A 1CRWG 4BGIA 2NVUB 1GAEO 1T1SA 2EIHA 3DTYA 3W8EA 4LW8A 4KUHA 1ENPA 3W6ZA 3EVTA 4LGVA 4CMIB 2Y0EA 3FBGA 2E6UX 4HFMA 3IOYA 5IZCA 1ZUD1 4UEOA 1LDEA 1PS9A 1EE9A 3FSRA 4RPLA 2AE2A 3DBHB 3ABIA 4BNLA 1W8DA 5DCWA 4E2ZA 3G79A 3EY4A 2VOEA 1KETA 4PLHA 1YBVA 4ZQGA 3RC9A 4A0SA 2O7SA 4YBZA 3PWSA 2C2XA 3ZGYA 1DAPA 3C7AA 2G17A 1NQOA 1I30A 1MC5A 1YS4A 2FR8A 2Z95A 3GUCA 1PJ4A 1Q0LA 1U4SA 3HFGA 2ZTUA 2RCYA 1I36A 2PLAA 1DC3A 2GYYA 4HY3A 1PU2A 3ADOA 4EDFA 4ZU3A 2G5CA 4RPKA 3ADPA 3KB6A 2TMDA 3D3EA 3HG7A 4OOEA 2PKQP 4UUNA 4AJ2A 1X1TA 5TT1A 4XGNA 2GO1A 3PEFA 5JLAA 1QYVA 3NTQA 1YJ8A 3DZKA 4LRSB 2RBEA 2UVDA 3DHEA 2ZATA 1IL0A 2GZ3A 3ZN2A 1HSZA 2O4CA 5G4KB 3AY3A 1AGNA 3GAZA 1SBYA 3I9JA 3KZVA 4MVJM 2O3UA 1MG5A 1VSUA 2FY8A 2VZ9A 2C2YA 3F47A 3RJ9A 4RLHA 1T1RA 2GCGA 1ZXBA 4OSPA 3DMTC 1PS0A 2DLDA 1YE3A 4I5EA 5AOVA 5EPOA 3DHNA 1GFSA 3UH1A 3VTFA 3B20A 3PHLA 4J7CA 1N2SA 3PJGA 4O6VA 2NVBA 4J2OA 4K1LA 3QY9A 5KJCA 3TRIA 1EVZA 4F46A 5COBA 2EJVA 1W73A 3AUTA 4XQ9A 3B70A 4KZPA 4OMUA 3G0OA 2AW5A 3L9WA 1P33A 2DVMA 5C5IA 3CZMA 4J1NA 3UCEA 4XDYA 3GHYA 4CV1A 4GWGA 3DL2A 3L6OO 3HDHA 4WCFC 1EUZA 5IXSA 3AW9A 2X0JA 4JBHA 5EMHA 2H6EA 5A3VA 2W2LA 1D8AA 1R4NA 4IIUA 3DR3A 4UVIA 2YDYA 3WQSB 5DOVA 4B4UA 4HFJA 3ASUA 2VHYA 4WOKA 4MVJP 4B7XA 7ADHA 2E82A 2PKRA 2D8AA 2WM3A 2HJRA 2JHGA 4C7KA 3E18A 1H6BA 1PGPA 1UXHA 3EVNA 1P74A 3DFUA 4K28A 4RZIA 3KSZO 3UICA 1JTVA 4KQXA 5KVVA 4MVJA 5THQA 2HMTA 1NX6A 4AJ4A 3MZ0A 4YRAA 4M87A 4J1QA 3QQPA 2UUPA 4FIZA 4K6CA 3UKOA 3PHIA 4WLUA 1GQ2A 3BXXA 1PZGA 2YQ4A 1U8XX 3FPCA 4FFPA 3ZWPA 2Z1MA 3PHGA 4UVGA 2IRWA 1ENOA 3RBXA 5A5FA 1P1FA 4IBOA 4GMGA 3NYWA 1I01A 1RWBA 5H83A 4G2NA 3UW3A 5C7IO 1WZEA 2JHFA 2CF5A 4B4VA 4Z3KA 3NV9A 2WYWA 3PZBA 1EVYA 2E37A 4RVSA 4DQVA 2QZZA 4HXYA 1LDBA 3GQVA 4ZJUA 3AJRA 3IP3A 5F21A 4MIEA 1BDBA 2GDZA 1F17A 1KBZA 4J43A 1NFQA 1YB5A 3KSDO 5JDCA 4IZIA 1CETA 3O8QA 4FSHA 3Q0EA 3VH4A 3H9QA 1R0SA 4PLZA 3G1UA 1QLJA 3UFXA 1CF2O 3QRWA 2J3IA 4GBJA 4M55A 4G5HA 3O8QB 3VHRA 3DBVO 4HKTA 4BNJA 5B4TA 2CF6A 2P2SA 5JAMA 4IQ8A 1P1JA 1OC2A 4RL6A 4GH5A 1RM0A 4ND2A 1CDOA 3FD8A 4DRYA 3GH3A 2B37A 4CMJA 3TSCA 4WNCA 4BKPA 1WVGA 1RJWA 3KETA 1SCUA 1DAOA 3BTSA 4OKIA 2C29D 1KERA 2PNFA 2Y05A 4J3FA 3UAGA 4CMGA 5B4UA 4CM9A 4L4RA 4MKXA 5FI5A 4D3DA 3F3SA 5JC1A 2PGDA 4MJLA 2P9GA 1U3WA 3PTZA 5JYEA 4BNYA 1BMDA 2GD1O 1IHXA 4IQ0A 3D1LA 3TZ6A 3C3XA 4TRMA 3WGTA 1OOEA 2GZ2A 2C7GA 3Q6IA 2BFMA 1DBVO 2BKAA 2R00A 2QZ9A 2X9GA 1E6UA 4L0QA 3IS3A 3PPIA 3BMCB 4YAEA 5COQA 2W2KB 1L1FA 1Y1PA 3AFMA 3QP9A 2ZCVA 1HDYA 3MJCA 5L4LA 1JVBA 1GV0A 1QXSA 4K26A 3RUEA 1QYXA 5CDSA 4MVJG 2IYOA 1C0IA 2VWHA 3TZHA 5BSHA 3VPSA 4Z6KA 4OXNA 4DYVA 1YQXA 4DQXA 3D64A 3R3SA 3ZHYA 4YJHB 3W4KA 1SZJG 3QWIA 4Q39A 3V8BA 4FDAA 1LC0A 1LC3A 5F5NA 4BV9A 4AVYA 1K5HA 3ZHXA 1DLIA 5G0WA 4ND5A 5B12A 1ZIDA 2QYTA 4CQMD 4XD2A 2DTDA 1WNTA 3H4VA 5MDHA 2PGJA 3DHYA 4JBIA 1ZK0A 5LDHA 1UJMA 3NRCA 5L45A 1J0XO 4Y67A 1DSSG 1U5AA 2I66A 3KUXA 4CR7A 1B8PA 4PIVA 3RKUA 1ISGA 4D0SA 1UDBA 2J5QA 4GMFA 2C82A 3OJ0A 1KVTA 1PJ3A 3FNFA 4W9NC 2EKQA 4BNUA 2RIRA 5JMPA 1Z45A 4FJ0A 5IJZA 1HRDA 3WDSA 3AI2A 1WMAA 1NPTO 3FN4A 1PIWA 4NQZA 1R16A 2VHZA 1HSOA 5EJ2A 3AOEC 3OJFA 3QWHA 2YYYA 2FR1A 4EEXA 4N5MA 1ADBA 3PRJA 1VI2A 3ONFA 4JBGA 3U4DA 2YDXA 4HNHA 2ZCUA 2G0TA 4EITA 5FF9A 3ETEA 4AL4A 3A4VA 1WLYA 4KOAA 2HSDA 5ITWA 2OGUA 5DZSA 1C3VA 2XPCA 3RUAA 5EL0A 1EZ4A 1NQ5A 1NVTA 3DB2A 4J91A 4JJGA 2GSDA 4U0KA 1PJLA 3H9GA 1HTBA 2D5AA 1X7DA 4MOWA 4JX8A 1FDUA 4PZCA 2VCYA 1ISIA 5ICSA 3PIIA 2XXJA 1BXZA 1E3IA 1GADO 3O03A 4BGEA 1YL6A 4HBGA 5CDGA 3F1KA 4JP2A 4J4BA 3T4EA 1ULUA 3BMCA 5I7VA 1J4AA 1VL8A 1O5IA 4PZEA 2W2KA 4U5QA 3NAQA 3BMQB 4IMRA 2ZB4A 3FPLA 4FD3A 2DBVO 4BKUA 4GPD1 1JLLA 4YACA 3OH8A 4IXTA 1VJ1A 2CSUA 3GEGA 3BMOA 3RAJA 1HDZA 4LSMA 1ONOA 3I6QA 2DUUA 4FGSA 3QA9A 4NBVA 5KKAA 1LLCA 3HB5X 2JAHA 3Q11A 5HBRA 3ZWWA 4Q3DA 2CY0A 3DC2A 3BHJA 5ILOA 4XYLA 4B4OA 2A9FA 1D4FA 4ALMA 4R9RA 4HV4A 3DAGA 1XYGA 2X0IA 3ROMA 5BQFA 3PJDA 4NBTA 1YDEA 3IJRA 1U9JA 1ID1A 3D3WA 4CM8A 4RF4A 4G65A 1I5RA 4L73A 1HLPA 3QVWA 1FMCA 3N58A 1S7CA 3HUDA 3U3XA 1JW9B 1ONPA 3GK3A 3TOXA 3GOHA 3MJTA 1PWXA 4FFMA 1ZJYA 3S2IA 2JFGA 1PJSA 4UEJA 4DIOA 3KYDA 1ZK2A 4R3WA 3LQFA 3ZZNA 2FR0A 2Y0DA 5TJHA 1RM5A 1GDHA 3VC7A 2D59A 4DMLA 3AK4A 3VAZA 2O3SA 1XQ6A 4MIOA 2QX7A 4BNNA 2BGMA 5AXAA 2IXBA 3OIDA 3X2FA 4AJIA 3NUGA 5DOZA 4GX5A 2GR9A 5DBGA 3B1KA 3BMNA 4W6ZA 3E5MA 1YBMA 3OFSA 3TN7A 4OQYA 4Z3DA 1NPYA 3JYLA 3UXYA 2CDAA 3ZNOA 3NDRA 1O6ZA 1G1AA 2OFPA 4FN4A 4FB5A 5KCZA 4BNGA 5IAAA 3UCFA 3MWEB 3RFXA 5IDWA 5G0VA 4CM5A 5FI3A 4E5MA 3VPXA 1DIHA 2JKVA 2ZYGA 2JD2A 3GC6A 1Z7BA 5A03A 1PZHA 4R1TA 5I7FA 2EG9A 1H6AA 1X7HA 1I0ZA 4D45A 4K9DA 2JAPA 4O1MA 3U9LA 3V1UA 1A5ZA 5ILGA 4E12A 4CMCA 2V7PA 5CG1A 2PH3A 2VTDA 1EUCA 2X5JO 4YB8A 3TWOA 1C1XB 4B7CA 4CMEA 5A9SB 3MJEA 3DZJA 1SOVA 3K96A 4XB2A 1ADGA 3BZUA 2J6IA 4IGFA 5I9NA 3VZQA 5BNFA 1Y5RA 3L77A 1H6CA 4DIFA 3EMKA 2CFCA 2O7QA 2DTEA 4NMHA 3GEMA 1D1TA 4BQPA 5EQFA 4UVHA 3WICA 5CAEA 3L07A 3E1KA 3N7UA 4IDAA 1KVQA 2JD1A 2B4TO 4W4TA 4CLRB 4GQAA 1E6EA 1A72A 3KV3O 1T2DA 1TT5B 4ESOA 2CD9A 1MC4A 1ZEJA 1GCOA 3G3EA 5JXWA 5L95A 3N74A 1ZKMA 4YT8A 1I3NA 1CIVA 4NU5A 4BGVA 4DPLA 3G1TA 3RUDA 1NFFA 1KEVA 1LTHR 3WIEA 3KEOA 4RGBA 4LVCA 1GYRA 4N18A 1P45A 3JQ9A 2O3TA 4YRDA 4B8WA 1HDCA 3WMWA 1HXHA 3R0IA 3ZWVA 1QLHA 2NTJA 3W8FA 4JK3A 3GG9A 2Q4BA 1P1HA 1UZNA 1PJTA 3HB4X 4NJOA 6LDHA 4CUJA 3U4HA 2ZB7A 2PZJA 1C1DB 3OIFA 1IUKA 1ULSA 3S8MA 3ZV5A 3GGGA 3RIHA 2VYNA 4P4GA 3ICCA 4WASA 4NDNE 4BO8A 4Q3EA 1E7SA 5L7WA 4Z9FA 5EIOA 4UVEA 3K5PA 5CFZA 4GWKA 3OICA 4WCFA 3CIFA 4BL5A 4TRRA 4O5OA 1V8BA 1ZNQO 1Z75A 3WYBA 3HJAA 1F06A 3ON5A 5JE8A 5A04A 3JQAB 1YKFA 3RUHA 1R0LA 2GN4A 4C4OA 4J4TA 3QWBA 4ZRMA 3A14A 1DJNA 5F1OA 4E3ZA 2BELA 2QRKA 1LRKA 1NWHA 3DONA 3D4PA 4QXMA 1DFIA 3ZW8A 1DHRA 2DPGA 1E1LA 2BRUA 1JKFA 1ZH8A 1VLLA 3JSAA 3CKYA 3ORFA 2E49A 2O2SA 4O63O 4PLGA 5LC1A 4DPMA 3AFNA 4AJJA 1U1IA 4LISA 4MKRA 2EGGA 4XQGA 2ZYDA 1V9LA 2QYSA 4FOSA 5DBFA 3TFQA 1EBFA 3AY6A 2PWZA 3M2PA 3T4XA 4IDDA 4LRTB 1DOHA 1P1KA 4CLDA 4E5YA 5IG2A 1LRJA 1YBAA 2NTNA 3OA2A 1IE3A 1E92A 4J4HA 4D79A 5KOIA 1LEHA 1HYEA 5JY1A 1HDXA 1R12A 4ONEA 4TKLA 1ISJA 4TVBA 2P4HX 3EHEA 3UGKA 2AQ8A 1J5PA 2BMAA 4GKVA 4FC6A 3SX2A 2HK9A 4Y6PA 3RUCA 4DQUA 4N5LA 3WTBA 3F4BA 5KVSA 3LYLA 2VWPA 5KJ6A 1C0PA 4NBRA 2D1YA 5EINA 4J16A 4CM9D 1DIGA 4XKJA 3ZNNA 1IYZA 1LDGA 4OHUA 2O4UX 3PWKA 3CH6A 4R1SA 4WNIA 4YWJA 2C07A 2Y68A 4J2HA 4ROSA 2VUTA 5AXCA
chains in the Genus database with same CATH superfamily
1DIAA 3MBIA 4W6QA 3WO1A 1IJBA 2CNLA 5CYFA 3W4IA 3HXMA 2FV8A 2XA2A 4TXNA 3O26A 5TPZA 3M1YA 1CG6A 5FBWB 1Z2EA 5EJAA 2AR7A 2XDQA 3MINB 4YDHB 1ABBA 3HU5A 5TT0A 4D9EA 1ICIA 2G5GX 2J5KA 1VGQA 3ZU2A 4B3TB 1TYDE 4J1SA 5CH3A 2NMVA 2VUSA 2G88A 3CNLA 2WM2A 2XUJA 2HXYA 3KTOA 3ZCVA 4Z8YA 4PO9A 4CT0A 2PD6A 2VHWA 5C35A 1YDWA 2VYFA 4NOKA 4QSHA 2HMYB 2I29A 1NULA 2C00A 3ABZA 1PFYA 1YHZA 4GR5A 4MQBA 3I37X 3LX5A 1VJTA 2BVNA 4EVRA 1E63A 2QTNA 3HYCA 4TUYA 2VHXA 4MVXA 5K0BA 2QJFA 3PC6A 4Y1EA 2O2JA 3ROTA 3O1HB 4CCWA 5JSYA 3IMCA 1VSVA 1VMIA 3GAAA 4MRSA 4PRYA 3EZXA 1RZVA 3I53A 4P0TA 5M7EA 2JHPA 4NJMB 2NXNA 1Z5WA 2JD0A 3CCBA 3DQPA 2DPLA 4QPNA 4QTXA 4ZT6A 5F2EA 3UMSA 4BE7B 3WAJA 1XTJA 3AX6A 2G7MC 1KE2A 4Q3OA 4LWPA 3OOEA 4OAQA 1N6KA 1UIMA 2W93A 3VO8A 3IH5A 4QO7A 4D0RA 4ZI7B 5JS7A 2XGJA 4EG7A 3VFDA 4IFIA 2IFTA 2C9ZA 2HHJA 3BJMA 1YRYE 3FUTA 3KVVA 2IOHA 3HSSA 3QENA 3TNYA 3DWIA 5DX0A 5TF4A 4G97A 2GN9A 3CLSC 2FPOA 3GMTA 3EYWA 2F55A 1EVIA 1SZCA 3GB9A 4OBXA 2VYVD 3B9PA 3C3PA 3E9QA 3T3NA 3DL4A 2IHNA 2ZITA 3N05A 4YY3B 1MXHA 3E4DA 3UJ7A 1YJBA 1AY0A 3Q7SA 3UHAA 1E9FA 4D26A 2WIBA 3E9RA 4Y6GB 2NYAA 3IUSA 4IPTA 3FPEA 3HCOA 1C5KA 1K63A 2WEKA 3R9XA 2EJWA 4RHCA 3QV2A 4YUXA 5D6NA 3JAWB 2JI7A 4XA8A 1T8YA 3L92A 4XB1A 4CMKA 1KTIA 1Z2PX 2VH5R 3K0FB 5BPHA 1RKBA 2UKDA 3H75A 3RBVA 1YQTA 2VNHA 2YVAA 5I7SA 2PN1A 3L18A 1QR2A 2P9QA 1G7RA 3CU5A 1MPXA 3GO4A 3O92A 3PNSA 2OGSA 3OTIA 1XJQA 4MUKA 4L15A 1Z2OX 3C7DB 2RGYA 2PH1A 2G82A 1DBWA 1Y4ZA 1E2GA 2JBHA 3PPYA 3IQIX 1U6JA 3OM0A 3ANLA 4B76A 3PTLA 3OM1A 2WHYA 1NW6A 3ZV6A 3L7AA 3PR2B 2RMKA 3R8CA 2FUG1 2VT6A 4L02A 1PWHA 1KMQA 3UJDA 4EUNA 2JGDA 1Y1RA 1NURA 5KDLA 3KHKA 2EBHX 3KKZA 3P9QA 3HKBA 3DLCA 1RADA 3GNSA 2QV0A 4BO5A 1Z4QA 4HB2A 4I50A 1L7OA 5FOWA 2OFXA 1A5SB 3HDYA 4IG4A 2PEYA 1J25A 4YHBA 4MI3A 2I22A 1EIZA 1F4LA 3RRFA 2WVAA 4Y2TA 4HX9A 3M6MD 4REQA 3BE6A 3ROGA 3UJ3X 4CQMA 1DIRA 1OPXA 2B83A 2C8LA 2QWXA 3MW8A 3A1UA 5GZ6A 1TJNA 4H60A 4HDMB 4PC6A 4EECA 3GLHE 1JFSA 4MMZB 1KKMA 3VU1A 3RKRA 3REFA 1WR8A 4LXQA 1Q0QA 1IY8A 1DP4A 1XB2A 2VATA 1RNLA 2V6MA 5CK5A 2PSDA 3C39A 3WLEA 2GXQA 2DR2A 2BI8A 3ESXA 2VQ3A 4A7PA 2DBRA 4KE7A 4TV9B 2C9YA 1P5ZB 3A9VA 3SYMA 3SNKA 3FE2A 3P5SA 4DWOA 4UAJA 3AHFA 3D1VA 4P08A 5J2TF 2PRYA 2W2XA 1RXIA 3BRQA 5C3MA 2HHLA 2AFHA 1Q7CA 3B1FA 3A6EA 3GLTA 2JJMA 4F4UA 1YKSA 2IHUA 4R2JA 5K3DA 4RDIA 3K71B 5MN6A 2OFWA 4AKSA 3GLFA 4BLWA 5CITA 4OOFA 1QK5A 1X8LA 5A4DA 5AVUA 5EJ9A 4D6XA 1TYZA 4JT4A 4EL5A 4UFOA 2D5CA 2WHPA 5G1OA 1TVMA 2OP1A 5EQDA 3I2YX 5EZYF 1SQFA 1E2EA 1YNSA 3AJ8A 5TMDA 3RC2A 3TKAA 1JIIA 4RC9A 2ZJ3A 3RS2A 1QV6A 2ZYAA 4QE3A 5TGTA 3V3KA 3K4QA 1U7UA 2H18A 2UZIR 5JSUA 5KS2A 1AVTA 3I9MA 3KQOA 2WOJA 4PPQA 4RPHA 1DGQA 1UPXA 2EU8A 1GHTA 3B1VA 5GOZA 1E18A 5CTJA 3RRYA 1RKXA 1O8CA 1X74A 1A9YA 3DW3X 4AJHA 4EA6A 1GM5A 1WTAA 2EF1A 4HLNA 4S12A 1D09A 1Q74A 3A3YA 3BJZA 5E7MA 1FS4A 1X1CA 1ZA2A 3T3GA 1NJ6A 3QPAA 3WIBA 3LYHA 2HNKA 4MW6A 1ZICA 1PFWA 5KTRA 4UMEA 4ENPA 4HX2A 2CYAA 2XADA 3IR6A 2UVPA 3BFJA 1P2FA 4RCYA 4EGQA 2EG5A 2ORVA 5K6AC 1NN5A 2ZJ7A 4HNRA 1PL8A 1JKJA 2YASA 4ND8A 1WSWA 2VJPA 2X4GA 2R4UA 3TQIA 2A92A 3I5MA 4CM4B 4R2KA 3AEUA 4MIYA 2BEVB 5SYMA 1V39A 4GP6A 5DP1A 1XYVA 3ET4A 3K6RA 3AOGA 1EHCA 1HT0A 5KNBA 1DINA 1L5ZA 2HSJA 3ZWXA 2UYYA 3KFXA 1KP3A 3DOIA 4HDRA 2WBLC 2XV1A 3OIVA 2DTXA 3REQB 1V8PA 1QGUA 2I2BA 5JSHA 4I4TB 1NVMB 1TUBB 3AHGA 1Z6ZA 4E5VA 4IKOA 2IK8A 4I3HA 5AR1A 3U37A 5CB4F 4HNGA 2HK7A 2OM2A 1H9BA 3DVSX 1EDEA 4TMVA 4U3JB 4BP1A 1YZTA 1JE0A 2AMVA 4GPAA 4PZ0A 5EWLA 2ZANA 4E70A 5ABPA 3WGHA 1NDHA 2YZNA 3N2ZB 2F62A 3A0UA 1NXOA 4CG0A 4REQB 2JW5A 1OYVA 2PJDA 2QSUA 3N2LA 2H7CA 1A77A 3MRXA 4YWHA 3NNDA 1UFQA 2DWCA 3PGJA 1TO6A 4G37A 4HMQA 1H8ED 1G8MA 2XCIA 1JEQB 5LCXA 2BM8A 5K01A 3WGMA 2P2NA 4GYKA 4E21A 5KNDA 5JJBA 3HJFA 3IQEA 1RHUA 1OXBB 4ZZ3A 5CG2A 4CEHA 1QV7A 3KYCA 4IWYA 3RVBA 4ZI3A 2JFVA 1UXOA 1XTBA 1P2VA 1M33A 1V3TA 2FX3A 3L0PA 1X94A 4HRVA 2I76A 1Z17A 2QNRA 1XZAA 2ZIUB 3GWZA 4WE3A 2WVJA 2X86A 3TB4A 4DADA 4M60A 4QOHA 3I2JA 4IEIA 5EMLA 1UBGA 4WKGA 2Y1KA 4LBZA 4RWEA 1SXPA 2C7QA 4KAFA 1IMOA 2X0RA 4LRYA 2GYVA 2RI1A 3FOWA 5DH9A 3T7IA 4PGHA 3UPDA 5E3HA 4DSTA 1XQ1A 3N2KB 3V7WA 4W5RA 1I94B 2FPWA 2XQVA 1HTWA 2IX9A 5FQNA 1W2GA 3NKVA 5K0LA 4BYMA 1A2OA 4WXRA 2JIZA 5KINB 5AFSA 2NNLD 3LK6A 3CUKA 3FDFA 1SCJA 4BCBA 4X1YB 3ZHBA 3H3XA 2AE1A 3DWFA 4JYZA 2FMUA 1KY4A 1ND6A 2HX1A 3E3AA 5EMKA 3U5ZB 3M7IA 2H00A 5L51A 1E98A 1N3LA 3U44B 5HCNA 3T5CA 2PBLA 4Z2YA 1KY2A 4RLSA 4K03A 3GUUA 1H42A 5F3WB 4C0SA 4OLBA 4QVKA 1JQBA 1DCMA 2CD7A 5A0FA 4F5EA 4NULA 3ZDYB 3ZLJA 4JL5A 4KLZA 3WGLA 2XOKA 3PDIB 4G0QA 4ZO8A 3BJEA 3ZWCA 5EJ5A 3T7EA 1EVKA 3W6UA 1KJ9A 4L85A 4NFYA 5BMOA 4HHEA 2UVPB 1WDMA 4DE5A 1X13A 2VNAA 3LOUA 1VPVA 4FR5A 2CFOA 3IAFA 2NIPA 4OYRA 4UPEA 1WSAA 1QJCA 2BD0A 2D4AA 2CHEA 2GCEA 3G2QA 4OIFA 4PO8A 1A7UA 3IUYA 3P19A 3IKJA 1O87A 3NNNA 3SDSA 5CLGA 3SIRA 4L1KA 1INLA 2JDID 5E6SA 3SZRA 4BFTA 4M98A 5CA0B 5JCXA 2PZMA 1YB2A 4CG1A 5HOEA 1KFKB 1QHNA 2WWXA 1M6WA 1YSCA 2J5XA 4IRUB 1A5AB 3QYFA 5B58T 1KQOA 2IY8A 4NL4H 5H82A 1Q1QA 1SUPA 3I58A 3UK2A 4TTRA 2PFGA 2W90A 2WIAA 4ZMSA 2GXAA 4W5OA 1KSFX 2Y93A 3NGXA 4FYVA 3EIHA 3RVLA 1D4ZA 3K9HA 3O8NA 4MHOA 4O2BF 3ZE2B 1NXQA 1U2EA 1WS6A 2A1UB 4BCDA 2I3GA 3ETJA 4LWQA 1T8WA 1IOVA 1PF7E 2PVCA 2WYIA 2QKYA 3BYZA 3NTUA 1J9EA 1QAMA 3FUXA 4PX2A 4X1KB 4N7MA 4JSYA 3ENKA 1DCTA 4JJ7A 2BKXA 3L8ZA 2BMWA 2PV0A 1QWSA 2YV5A 4G5XA 3AZOA 3WLIA 1WXHA 2CBGA 2AMLA 2PSHA 2XH8A 4L0DA 4GNKA 4A0FA 1C3OA 2C99A 2NO9A 4BUJA 4W5TA 1M7GA 2B2CA 4FE7A 3ZC3A 4MKZA 3IL2A 2OHIA 2WWHA 2C7BA 3Q0IA 1IJEA 3B3FA 4LHVA 4J90A 4BTLA 1QC5A 5K4GA 3R7FA 1LDMA 2AKAB 1EUQA 3EXIB 3VJLA 4MQEB 1T1JA 2IQIA 1ZQ1A 3M3PA 4AF6A 1F2TB 1ZD9A 1CUSA 1SNYA 1ESDA 1F3OA 2I6UA 2POCA 1SUWA 1PEYA 3UENA 3IP8A 3QVLA 2WTAA 3OY2A 4HWSA 3L9XA 5JRZA 1YCFA 2SICE 2ODBA 1YL5A 2R4QA 3LPCA 4PYRA 3G17A 5IFKA 3Q1KA 1ZGJA 1Y9ZA 3AR6A 1BQEA 1QQ5A 2H1VA 3H1PA 2EFEB 3WO0A 1SCAA 4H4DA 4WZ6A 3OZEA 2IZ6A 3CWCA 3L5OA 4MP3A 3E9YA 4QWMA 1DXYA 2WUVA 2JF0A 3C1TA 4RIEA 2CWDA 4E4TA 4LHZA 5DM2A 1U1DA 1GRQA 1UP7A 3FFTA 1S9DA 3QLVC 3DCIA 3B6IA 3O8OA 1YR6A 4HB0A 4RS4A 3U4GA 3ZY4A 3WGGA 3FSGA 1K08A 2GD2A 3C74A 2OYSA 1RKVA 2F48A 2X5NA 2YIJA 3OT1B 4Z86A 5AVTA 4DCGA 5K99A 4NZNA 3OA0A 1JQ5A 3B5EA 3H4IA 3M81A 2H4XA 1SIWA 2H3HA 2IUSA 3PITA 2H8KA 5KVQA 3AW8A 3R6TA 2EWMA 1ZINA 4FGWA 2W6NA 4QJIA 1K88A 1DCKA 1Q92A 1V1MA 2BFBA 1QKJA 2CXSA 3D6HA 2XZDA 3PNBA 3R0VA 3FBTA 2DHEA 2G8NA 4TLBA 5HBGA 5EE3A 5JD4A 1EUYA 2ZE8A 2P75A 1DRKA 1QH1A 4FN5A 4INJA 2HIAA 2NLOA 1R66A 3NDJA 4OXXA 4P53A 3ZE1B 4A82A 2ON6A 5DI3B 3TE6A 4EJSA 4BN0A 1IY1A 1LLQA 1DC4A 2JBAB 4MB6A 5F73A 4DIUA 2Y1DA 3PYXA 3VHXA 1KMIY 4XRGA 2NU7A 1GL7A 2JK1A 1CLUA 2AG1A 1B14A 3ZZ1A 3NYRA 4WOPA 4YRGA 1V6SA 2F67A 2V97A 2BMDA 4HDNA 2PY6A 1X7WA 4OHXA 3RBAA 1E9RA 4ZGGA 3GJQA 4MR7A 3TEJA 2XEDA 2Q2QA 2RAFA 3NBAA 4QHTA 1L7PA 3ENNA 2Q1TA 3WJ7A 4B44A 4LEIA 2QY6A 2UAGA 3EUFA 3IXQA 4O0LA 1YV9A 3SHTA 1YOVB 1FF9A 3I83A 4BQIA 4F9TA 3E5NA 4ZDKA 1GG2A 1T9KA 4HQFA 1CJCA 3JPWA 4NSNA 5E4FA 5CURA 5L9AA 1DPGA 1I2DA 4WACA 4RVHA 4QWWA 2QROA 2PQ2A 4FJ1A 4WZBE 1GNRA 5G2OA 4KQ2A 3FRJA 2FLWA 1UK6A 1PDWA 3AFIA 4HD8A 1A7AA 2CLDX 3KKNA 1L5QA 3QKSA 3VVCA 1XPJA 1Y1QA 3PZRA 1OH8A 3E2MA 3HLKA 5DGTA 3ZY2A 2HO4A 2O8FA 1G3UA 3NDPA 4ECEA 2VP9A 2C2OA 1RP7A 2QZJA 4R84A 1PR9A 3VNQA 4D5GA 3H0EA 2WNSA 5LP6C 2D0PB 1IQRA 4D3FA 4DIBA 1EHIA 1FDWA 3I9LA 4W5QA 4AQYB 3GBSA 4Z4GA 5AW3A 2ASEA 2CZGA 2P9ZA 5JAPA 3MTEA 4IJMA 4AIIA 1IQUA 3UM9A 4QQFA 1AUOA 4Q00A 1GGVA 4HH4A 3P2KA 5EA2A 4J03A 1CSEE 1NW3A 3D0KA 2RHGB 5JYDA 2R2AA 4MQFA 4K05A 4DBVO 2WU1A 4YC7A 2X0NA 3OFJA 1UPAA 1YQEA 2B5VA 2P9TA 1XBTA 1A9QA 2BFAA 2RK3A 3BN3A 2I2AA 3M9XA 3QKRA 4HVCA 4KUGA 3JD4A 4C0HA 1XEXB 3S2ZA 1DAGA 1Z2NX 4L8WB 2QAGC 1VKRA 1GQYA 1PR3A 5AUPB 4DC1A 2ZSEA 3TQOA 3KALA 4H1UA 1D2HA 1QQTA 1OB2A 2O19A 7GPBA 1C9DB 1UZAA 2MHCA 1FDOA 1WUJS 4XB6B 3ZY3A 2W2VA 3B3QA 4LOAA 3R7LA 1M76A 4Z7JA 3CLRC 1NMZA 1YI1A 3L6EA 2BMVA 1II8A 2BEVA 1LGYA 1IOLA 2GTPA 3KKOA 1LQUA 3PT9A 1KO1A 2DY0A 3BL8A 3QNWA 4JGIA 2VDMB 2FF5A 3DT8A 2ZAIA 3HVKA 3N07A 5B3JC 2BM1A 4B2LA 2X2EA 3OJCA 2PFSA 3RS9A 2QE6A 4U7GA 4TM8A 3H86A 2VRCD 4U6SA 4B47A 1L1EA 3FY4A 4M83A 1SKAA 5HQ3B 2EZ9A 4XW2A 5TPZD 2I2CA 5HIMA 3IUEA 3M4NA 3SCZA 1T3GA 5AM5A 3ZHVA 5I7HA 4ZVMA 2PSJA 3WHIA 1PTJA 5JBIA 4PVDA 1QTQA 1TTTA 3PF8A 3W6NA 1MJGA 1YZQA 1Q0TA 1CZLA 1VMAA 1Y0BA 3QVTA 3AR9A 4MZXA 3U1VA 3V5NA 3X1WA 4BX3A 4KMRA 2BFPA 5SICE 3MVEA 2ZTSA 5FOQA 4Q3AA 5IDXA 4WW0A 5D3MB 1TAGA 3WLTA 4BGDA 2OQRA 1T6YA 1HL3A 3HFRA 2ZBUA 2AFIE 3PRHA 5A9RA 1A9XA 3IGFA 1M5UA 3WGJA 4DRZA 5JXGA 1MT0A 3U80A 4E2YA 3OMLA 1T3LA 4TLEA 1PGQA 3NO4A 1L5LA 5BR1A 2F3PA 3TZCA 5BP7A 3A28A 3FX2A 3VA7A 3IULA 4MVJE 3VR0A 5ICEA 4L4SA 1E5TA 1PRYA 2IODA 2JAOA 4ITUA 4C22A 4CWAA 1ESCA 3A3KA 3ANMA 4K40A 3SDBA 2J41A 2QR5A 3M83A 2DAPA 1DOZA 4R51A 1RYFA 3L0SA 2WUGA 3I9FA 5EE1A 2CJFA 1JWBB 2ACKA 4WKCA 3FVRA 1N33B 1KDRA 1EG7A 3MCUA 4YT4A 5L40A 3W5BA 2GT1A 5SYNA 2EKPA 2UXDB 1BHSA 1WA5A 5CNMA 2V4MA 1KMNA 3L4BC 1YRLA 2GEKA 1RVDA 1NVUQ 4IF4A 4DV1B 1WXEA 3TJRA 3HDJA 3UAYA 4ZKEA 2HLDD 3LVFO 1U3CA 4B31A 2Z6QA 3RJMA 3C48A 3I4CA 1QTIA 3BIFA 4Q9IA 1U7XA 2XAAA 1G42A 1QE0A 4X45A 4UJ5A 2UUOA 1QHXA 2RC6A 4B35A 1U0GA 4BE9A 1KRHA 2XR1A 3IJPA 1PN3A 2XI4A 4EB6B 4BLUA 3CNQS 2F1KA 3LQYA 4C0WA 3H04A 3KP1A 2OBNA 3V7YA 2FSPA 2QDKA 3GLIE 1SURA 4XUGB 3V34A 1Z5UA 4NAVA 1E9SA 2QTHA 3VNSA 5IYZB 1TRKA 3GVCA 1YU9A 3QKRB 1I7SB 3Q5EA 3VM6A 3O8OB 3WGQA 3ZJ4A 5HYVA 4Z4HA 4POOA 2HRCA 1AKMA 3GCZA 3TGLA 2GAJA 1Y3FE 1ISSA 4OPMA 1EGAA 3NHSA 5DASA 2V98A 4IV5A 5EJ7A 3G5MA 1F2UB 1NQUA 4B87A 1T0BA 2PHZA 1WV0A 5CK4A 5C2JB 3MT7A 1J23A 1W9HA 1MABB 4EARA 4YJ2B 3SE0A 1EKXA 1SG9A 3I39X 1XZIA 2MTBA 4IZ6A 5MFPA 1AN0A 5GZ3A 1KL7A 2WSIA 1YFKA 3M9WA 4LMRA 3TXYA 5JZSA 2JJ1D 2XYPA 1YVEI 3FCEA 1L2TA 1T24A 1TQDA 2WT4A 1CUVA 3AQ4A 4JBXA 1GGMA 2HJVA 4MV8A 4WMLA 2Y1CA 2J7PD 3UTDA 4YRBA 1W75A 2BTQA 4ZO9A 1SUDA 1CHDA 1XR3A 1GZ3A 1UEIA 1JEOA 5EESA 1H8EA 2R00C 1X1BA 4NCNA 3OJXA 4ALNA 4QU8A 4JI4B 1W49A 4Z4IA 3PV0A 1C1HA 2MDTA 1IPHA 2Q62A 4S1OA 3ZIAA 4C0LA 3MM4A 4JXJA 1YOVA 3E2IA 4MICA 3DZIA 1FDSA 3FTCA 4GXNA 3C98A 4Y1RA 4US1R 5FPHA 3VR6H 2OHXA 3G2JA 1V4NA 1YBFA 4MV6A 2VL7A 1FFXB 3TIGA 1G8KA 2OKCA 1DNPA 2OCLA 3NATA 3KJHA 2FLVA 3SLGA 4RELA 4CM6A 2ODAA 3VC1A 1BZYA 4WZAB 4F3CA 3ISTA 1EFUA 3C6ZA 1OI7A 2G40A 3S2YA 4FDUA 3IQGX 1E3WA 3FHLA 1RFLA 3KKMA 4EF4A 1J56A 2HA3A 3O1LA 1W9MA 2YCBA 4A23A 1GWNA 2QTRA 1G5IA 1T2EA 3A05A 2DR0A 4H4CA 1TMYA 3T3PB 3TQHA 3VR2A 1R4AA 3OPYI 3RFCA 3JR7A 3FAKA 4DJJA 5DTJA 1DIBA 3H0CA 2P68A 4O1HA 3GF4A 5DDIP 2CMKA 2I65A 4JLOA 1Z36A 4E07A 2VDWB 3OLWA 2CNBA 1FY2A 2MYUA 2P6UA 1XXHA 3GUVA 4B84A 5K8VA 3ANXA 5K0EA 2AF3C 2ZI3A 4I3FA 5G4LA 2AC7A 2JI4A 4ZVOA 1TVKA 1L5VA 3GGCA 1P4JA 3H5AA 1GTRA 2QTGA 4AJLA 721PA 4MWOA 4XYGA 4QO8A 4HDOB 1LS1A 4KUEA 5ALKA 2VQ6A 3GLKA 2C0CA 4YJHA 5K3AA 4OYHA 2JJ8A 1MC8A 3X1YA 2IIBA 5K51A 1TQHA 1ZHHA 3D3WB 3FRIA 2OENG 5I9MA 4RLQA 4OHZA 3SZGA 1SA0B 4FX2A 4OLFA 3JALB 4JI1B 4OK3A 2E5LB 1MVLA 4UREA 3RVOA 2PWBA 3TLKA 2FZ4A 3QZUA 2AX3A 4KTTE 4MTLA 3S5JA 3WWPA 3WFZA 4DLYA 1I5OA 1RTKA 2BR3A 3FSGD 1HE3A 2OV8A 3ONNA 4NZPA 4NF2A 5CA0F 4N3BA 1DKQA 1GPNA 2LIVA 3LT0A 3QVGB 4FE4A 4BNKA 4PLFA 2DERA 2I6QA 1EDZA 1TK3A 2FF7A 2UVQA 5FO1A 3FMFA 3QJ5A 3TLXA 1ODCA 1W59A 1N7IA 1OV4A 2IYRA 2P30A 3ITNA 4GXRA 5EFOA 2PE5A 3ICEA 2HWYA 1N6RA 5E2AA 4BRZA 2VQEB 2Q3BA 2F9FA 2ZIXB 5LQNA 3S8YA 3U2QA 3FNRA 1CCWA 3THXA 3M6XA 3WR5A 5B2FA 3CEPB 1CXZA 1QX3A 3KKPA 5JAOA 2QVBA 4NBUA 1I32A 1X1QA 3N2EA 5J1SB 3I28A 1CUYA 1HA3A 3JQ8A 5EY5B 4E4YA 1T25A 1V3VA 3V8EA 4QL3A 2BEUA 2YWBA 1X86B 3NTOA 4MV7A 1J5EB 2CNDA 3A37A 4Q6WA 1TZJA 1MF7A 4OQFA 3ZOZA 2J3QA 4EI2A 3UHPA 3DPSA 4TMKA 4KX3A 1CUHA 3PHHA 5D5HA 1ST2A 5HF5A 4A1FA 2C42A 4PZLA 4UNNA 3G0DA 4V0NA 4EUFA 4F5WA 3GVIA 4ZREA 3HU2A 1G4HA 3C5WP 4Q1BA 4R1UA 3WLFA 1MX3A 2GNPA 1N0VC 2QU7A 4HX5A 1FDTA 2PRIA 4GG1A 3UK1A 1ETHA 1J0CA 1E6MA 2HWKA 2Q9BA 3F71A 3H2ZA 4LQCA 1S2OA 5EVCA 1NBMD 5H3LA 4IYJA 5AVZA 3A6KA 3FCUB 5IP5A 2ORWA 2IZ0A 2HLNA 4GI2A 3IAHA 2WPDA 3NDBB 1N2XA 2VQDA 4ODIA 4CL0A 3MN1A 1J2UA 2ZU0C 1J1IA 1Y89A 4O29A 2X8LA 4XDZA 1TLFA 4EY4A 2ZJ2A 3SX4A 1DX4A 1UXIA 3OQ1A 4R41A 1QIEA 3FYUA 1AB6A 1VG1A 2DWOA 3MOIA 1IM8A 1KAHA 4IHKA 1J5XA 2DBZA 4GOJA 4JOCA 1XO1A 5BNTA 1CD5A 1LQ2A 4GBED 1ZM2A 3NOQA 4FHDA 2RFLA 2IKSA 3U5TA 3FUUA 1ZRHA 1N6HA 3IKVA 3LHSA 4E6EA 1W0JD 2ARKA 2BMJA 4HR7A 2E4AA 3OJLA 4Y8VA 5TPWB 2ZRMA 2TECE 1X42A 1MFZA 1VMEA 2RJOA 1XCPA 3T4PA 2VS1A 1RWMA 1UXGA 4JB2A 3GDGA 4TRJA 3UFXB 2HAEA 1U0EA 2IYNA 4MYHA 5BW4A 5TQ2A 2NV0A 1E96A 3OAAA 4BB9A 4RSMA 1BMFD 3NTVA 4B09A 4EX7A 3D6UA 3FOBA 1N92A 2AA3A 1EP1B 2Q7OE 2XDAA 1D0SA 1H9AA 3WAGA 2MT9A 3TM4A 4RZHA 4MWEA 4K6FA 2Z2ZA 3LD9A 4JYMA 4MS1B 3OTHA 4RH3A 4LGYA 1ZSNA 2R7NA 1V16A 3DVRX 3SGLA 4CRWB 5K8JB 3K1YA 4H7EA 1U63A 3IMKA 5EJIA 2XMGA 1V41E 1LF0A 2W2NA 2B35A 5CVJA 3RFTA 4N0QA 1N5IA 1U0LA 1OMOA 1YRQA 3DTVA 2CUTA 3OCYA 4TMYA 1E9EA 4RY0A 5FB3A 3VSAA 4WLOA 3R9KA 1NL3A 4DBLE 1JDPA 3TH5A 2Q29A 1U7PA 1FSGA 3L2OB 5J4HA 5JV5A 1G5RA 1IULA 3EEYA 2RKBA 3CR3C 4PS0A 1S3IA 3FZEA 4I8DA 4I4LA 5JAZA 3IX7A 1FA9A 4E1AA 2X4LA 3X1XA 2YV2A 2MSEB 3OZAA 1M10A 1ZVMA 4CLOA 3NZEA 4YMIA 1WBJB 1Z0JA 1GILA 2ESRA 4O4JB 2O8DB 4PGMA 1X0VA 4G1UC 2EFYA 2JH3A 1TZCA 4C7OB 1VYTA 4UFPA 3AUXA 1A4XA 2G77B 1B6GA 4DDUA 3EULA 3KR1A 3RLIA 5EIXA 1VE6A 4PG8A 3AEZA 1G3MA 1E79A 3DHWC 4K9MA 4NENB 1SPBS 3IRVA 4BVEA 2B78A 4A0HA 4ZHQF 1BU8A 5EXSA 5ALJA 1ADFA 1RWQA 3BEDA 5UKDA 1K75A 3WY9A 3AFGA 1SCQA 2EFHB 1Q12A 2E87A 3LBIA 4XEUA 4B6OA 4WDQA 2O54A 3MIIA 4BLTA 5K8UA 3VR5A 1OX5A 3W9UA 2KWIA 3SJUA 5EMNA 3KSUA 3CN7A 4IIXA 5E6RB 3KSBC 4LJYA 4IKEA 4UAGA 3OX2A 1L5HA 5HWSA 2PANA 3TOZA 1JZTA 2O06A 4RV5A 3WLMA 2CMDA 1OQAA 1Y8QB 3HYSA 4MS4B 2PXXA 1QHHA 3EMDA 1BVUA 1EYZA 3KDSE 3O4RA 3SAJA 4KAJA 4EABA 1XDWA 5KHOC 4P92A 5K3CA 1KNXA 1YUMA 5DIZA 5DU2A 4H18A 4Q19A 4ZCQA 2DGDA 1HUQA 3IXLA 3IOBA 4MR8B 4HLQB 1QJ4A 1Z0UA 2OV4A 1C9EA 3L46A 3EVBA 2ZP1A 2QRUA 3AG5A 4WL0A 4BNIA 4BX9A 5ADHA 3BGVA 1HFJA 3CLKA 1TC1A 4A6DA 1IM2A 2F43B 4O8CA 2I8LA 2GI4A 5K0TA 3ZK7A 3FTPA 5AW8A 3MTJA 1XWFA 2Q2OA 3IUMA 4MAMA 4BUCA 3K2QA 3OOWA 1XGKA 3SYLA 2WK1A 1KJNA 4P4TA 3QUCA 2O1EA 1BN7A 5REQB 3NHJA 4MUGA 2IV2X 1T8RA 5AW5A 1HQKA 3EWNA 4K5QA 5C5CA 3BQ9A 3FR7A 4KRFA 1UKZA 3BXGA 4JJ8A 1KY5A 5KWJA 4MUJA 4HNVA 3T7JA 2X8AA 1R9NA 3NOOA 4OMCA 1JJVA 2D1RA 4C2UA 1R10A 4GP9A 4MPPA 4CFZA 2I87A 2F8LA 2IEBA 3BRWA 1Z15A 4LF4B 1RYNA 2JFWA 1PQ4A 5T3UA 1YWGO 2DPYA 2FZGA 4P3YA 3G0HA 4CIDA 5EIEA 2FSHA 2R7MA 3OZFA 5BVHB 3VNBA 5DK6A 3IKMB 5HF9A 2XBLA 4ZODA 1G64A 1BFUA 3EC2A 1MQ8B 4RCVA 4EA7A 4G1EB 2R6R1 3E3NA 4OXIA 4XTRA 5CPFA 4LZAA 5EMMA 5A9TA 2R5WA 1K6XA 2I3ZA 4NV0A 1RCTE 2GBLA 1AHHA 1LA2A 3BB3A 4M21A 5HNKA 3GEIA 4PHGA 2DBYA 1CQJB 1E2HA 4JQZA 3GARA 4UEWA 4DMFA 5CFLA 1TIKA 3VKWA 4KN5A 5LYJF 4V0LA 1UBOS 1GXSB 3DE0X 4ZOBA 5ALHA 2X13A 3LXUX 1RJFA 4RFVA 1BA3A 2VPWA 3RVSA 4YP1A 3RRNA 4OMFG 4FYHA 1BVYF 3DOOA 3U39A 5ELLA 2G6BA 1ICEA 1DADA 2NGRA 3QPUA 4LKRA 4Q47A 4Z4EA 5KOHB 2VDWA 1M66A 1OXUA 1YS7A 2CEKA 2WYUA 1OUMA 1GU7A 3KVRA 1XUOA 3HKCA 2UZ3A 4LZZA 3VR2D 1GGJA 4YCBA 2QVYX 1VGRA 3ZGXA 2RDMA 2JJ2A 3VC3A 4FYPA 3VZDA 4V03A 1CRQA 4IL5A 2IWHA 3QEMB 1SB8A 4DXHA 1C0EA 4CKZA 2ZJ0A 1SVKA 3T5AA 4V39A 2GHQA 2EJTA 4M0MA 2P9EA 3GLSA 2O7RA 5EWMA 1U2GC 2ZVPX 2MR6A 2VT2A 3KFLA 3QHAA 4H2DA 4PANA 4KR7A 3TW8A 1EG2A 3QW4B 5EP1A 3FROA 1R4MA 4L75A 1M1YE 2ECQA 1B42A 2FWAA 3JZFA 5ITZA 2XZTA 4S04A 3K1ZA 4LNHA 1AXGA 1IPFA 1XA3A 2ZDQA 4QD3A 2I4RA 2H65A 4LTDA 3MTAA 4P7JA 1I1OA 2ZBPA 1EIWA 5KYYA 1PJ2A 1VE9A 3U4AA 1BXGA 2A30A 4IINA 5AK6A 3F67A 1XMSA 3W5CA 5H4HA 4BGUA 2PUFA 3OPNA 2F3SA 4E11A 3IJ5A 2J31A 1B26A 2HNBA 3GD5A 3JPYA 3M6AA 4DSUA 4E5SA 1N3BA 4FC7A 5KYNA 4HFNA 1P2GA 2WZCA 4B83A 4NXMB 2XB6A 2YY6A 5B1HA 5K2MA 2BDEA 3ORYA 4GS5A 3UT6A 3ZE7A 1A76A 5CXUA 5LPNA 1VL2A 1X80A 4CQLB 1XMOB 1P1CA 2HJGA 1CEXA 1ZNXA 2ZR7A 1FS5A 2YZ7A 3AWDA 3GRVA 3D4NA 4IRXA 1X7YB 4XFDA 4ZJZA 3CVWA 5GJBA 1HT3A 4IGAA 4IDOA 5LB4A 4ZPXA 1NYRA 2OCDA 2WWGA 3UYLA 4UEQA 4MJ3A 3O2JA 4GZ5A 5KVCA 4KSBA 4QOSA 5ISMA 2R87A 3D5TA 1T5TA 2RARA 3CVYA 3L7JA 3HUEA 3I23A 5HFJA 3TCNA 3LBAA 4MRVA 4KO3S 4LY0A 3A9SA 2GVDC 3ITEA 1TQ4A 4GM0A 1Z28A 2WYVA 4HN4B 3KD3A 4YDRA 2Z58A 3RGWS 1JL3A 1OAAA 4M9UA 1AC5A 1FTGA 2VDPB 1X1EA 4RNCA 4U8HA 3EW7A 4JLPA 2A0KA 3EA4A 4BKRA 4XJSA 2DX7A 2OXTA 1WP4A 1P19A 1P80A 3HN7A 1BVRA 1NR1A 2B5WA 4OU4A 4Q4JA 3SC3A 2I1LA 1JDVA 4FMDB 3Q7QA 1R0KA 2JLBA 4AURA 2XCRB 1PFKA 3WI7A 1TPYA 2WJAA 3WLRA 5TQ0B 3KQHA 4UTVA 5FA8A 1YS6A 2HF9A 4AYXA 3GGOA 4LQDA 4FFVA 1MB3A 5H0IA 3RW9A 3K05A 5AIBA 1OF1A 4UHBA 4YFYA 3ZHZA 2GRJA 2OZLA 3BWDD 3A04A 1P3Y1 4FFLA 5JHHB 1M54A 5IXJA 4JDUA 1PD1A 3HJRA 3RGGA 5HKKD 3KKLA 1ZL0A 2OG1A 1Q21A 1QAOA 2H2FA 2V59A 2YW2A 2XB9A 4ZOEA 5F9MA 3FYTA 2OV3A 1LPAB 1YIAA 1FFCA 2Q4TA 4AZWA 5BUZA 5JNLA 4HAXA 3NWJA 3R40A 3KOUA 5EIHA 5AJTA 4ZXFA 4GX0A 4QYWA 4JC0A 4C1NA 3LVRE 2HA5A 1R4MB 1T0UA 2HK6A 2I6FA 2IE0A 1XLTC 2R5FA 3B51X 4Y9RA 5FI0B 5L3VA 3S2UA 2EJBA 1HLGA 4A27A 3RUFA 1T3SA 1L5WA 5EPUA 3OFKA 4IS2A 1HEYA 2D1FA 5IAEA 2ZGVA 5K0SA 2Z5LA 4LF8B 1BS1A 4JJ6A 4Z54A 2WE8A 3OD1A 4GGPA 5KYYB 5HSGA 5J2UF 2WJPA 3UJHA 2VRBA 1USUA 2VJQA 1VIMA 3G59A 4KGXA 4Q4AB 4CR8A 4OY3A 1DJMA 3BCRA 1M34A 2YNMC 4RK1A 1CZUA 1N6OA 1TJYA 3N2YA 5DLDA 3VXKA 4YJ3F 1HKUA 3ZJTA 2W0SA 1NI4B 2BFFB 3OM9A 1SCKA 4UUMA 4B3GA 2H1CA 1G21E 4JKOA 1HDRA 1JGTA 2W37A 4CMHA 3DJFA 3ZE6A 5JHGB 4E2WA 5LR6A 3B9QA 1MOPA 3OE7D 1E2IA 2C2BA 1PJAA 1G2OA 2KMLA 3KZNA 4H1HA 4TWJA 5KX5A 2QLBA 4OHYA 4GPEA 2YS7A 3KUUA 3LKBA 2AVNA 1U7OA 1J2EA 3PFIA 3R1IA 4QU5A 3VI4B 3U1BA 2BDTA 2VJMA 4TV9A 3QTTA 3LUKA 1GPWB 1RI1A 1AQ6A 3QUAA 3EG9A 2VIIA 5DGXA 3ZQJA 4B3HA 2L19A 4DNPA 1NF8A 5DCYA 1CTQA 3FI0A 3HBFA 1EWQA 3DGFC 4ND3A 2AYZA 3E1GA 3HKEA 4DYDA 3AP1A 1G9TA 5HGXA 2REQA 2VR1A 1QBGA 2NU9B 2CHVA 2XD4A 2XEXA 2WFMA 2IGBA 4KIUA 4CMEC 5EJ6A 3KQNA 1QO7A 1P7YA 3HZZA 3IPXA 5IDQA 4WX2B 1FLVA 3LZDA 1AKRA 1HG1A 4HAIA 4HI0E 2EOAA 3RAGA 1W30A 3KQSA 4GR9A 3IHWA 6CHYA 2I9KA 1L5HB 1R6DA 5DHRA 2I4IA 2HKIA 2DKNA 2JI6A 1EWVA 1GARA 1J8QA 1GLNA 1KYZA 3BZBA 3CLTD 3GDFA 3L05A 2FZEA 3DE2X 5FBLB 4DIKA 2C4WA 4UD2A 4OTZA 4R3UC 4E30A 1I7LA 3HQ4O 3P0JA 3TQCA 5I45A 3B1JA 2PWAA 3F6EX 4M9XA 3DZBA 1XLTA 2ENUA 2YJGA 2K7FA 3ROXA 3HVHA 4HAOA 4OUDB 1C1YA 4AN0A 4W5NA 5IAOA 1MQAA 4DGSA 1DAIA 4NPAA 4BRUA 3NEJA 3EUWA 3TMAA 3HL0A 1Q0UA 1CUEA 4XX0A 4TS1A 4XYBA 3V6LA 3TNLA 5ALQA 3ZK9A 1P1BA 1NF9A 2X2OA 3EEQA 1MXFA 3QNMA 1J07A 4MCAA 3IT3A 1H66A 4RFLA 5JPCA 4LFBB 2XIJA 2XMPA 1IZ7A 1CB0A 2GLTA 3C6YA 3UWKA 1W48A 3NU1A 1OX6A 1Z88A 2IEGA 3WYFA 2WTMA 3X1MA 4HNTA 1Z8NA 2A58A 3TUJC 4FWIB 2Q2WA 4ZRNA 1A96A 4QATA 1ZCFA 2PBFA 2V7QD 4CPDA 7AT1A 2ACEA 4ENSA 2I5PO 1POWA 2ZOSA 1EBBA 1TZKA 2NAFA 3EWSA 3L8YA 5CGZA 1ORTA 3L8EA 4YJFA 5C7OO 2JB9A 3RSSA 1A8PA 5U4QA 2REBA 1K8XB 3QUQA 5LUAA 2H1OA 2C83A 3IP9A 2NO6A 1LSSA 1DDOA 2ZIEA 5C31A 1UBKS 3ZBQA 10MHA 2BFFA 4Y2QA 4BVHA 1GDTA 4G07A 1JB1A 3IE0A 3UT5B 2Y8EA 4PO1A 2PZEA 1PVOA 3I1YA 3FPGA 2QW8A 3TBFA 1N0UA 2OHVA 4IICA 3A6DA 2XMCA 3RRZA 1VIVA 3GMSA 3QU7A 1B43A 1CNFA 3RRJA 1G2PA 1QSGA 2OHJA 1ZOPA 6ADHA 1L1QA 3FWKA 4LNUB 5CCBA 2AB0A 4IDFA 4MRAA 4HLUA 1UUFA 4DQKA 1SHTX 4W1PA 4KYTA 1J70A 3PCXA 3PX2A 4M1OA 3C8HA 3HKEB 1QC5B 4Y0AA 3QWFA 5EMJA 4EZEA 4IYRA 2HT1A 2WF6A 2HYDA 4A8TA 2XZPA 4ZK2A 3ZUPA 1JECA 4G1FA 3AILA 2JFUA 4V1CA 1XA4A 2WF7A 1IC6A 2AQHA 1IZZA 2EKLA