1PR3A

Crystal structure of the r103k mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
371
structure length
357
Chain Sequence
b'MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALKMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNCTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate semialdehyde dehydrogenase
molecule tags Oxidoreductase
source organism Haemophilus influenzae
publication title The role of substrate-binding groups in the mechanism of aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
total genus 118
structure length 357
sequence length 371
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1pr3A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pr3A01
2D0IA 3DBRB 3GGOA 1M75A 1MG5A 3VH4A 1PSDA 4TQGA 2VHWA 1VE9A 5IN5A 1Y5MA 3H5NA 4CLOA 2RAFA 4WUVA 1NQAO 1DHRA 3ZU4A 3BAZA 5IN4A 1FXSA 2AEFA 1HWYA 4R01A 5JCJA 3W4KA 4CLOB 4PLYA 5KWEA 2ZB3A 3KVOA 3DBHA 4PLPA 4ROSA 2FZEA 3BYZA 4YT5A 4BQRA 4AJ1A 2EGGA 4TRNA 1E0DA 3P19A 4E21A 5K0ZA 4YJFA 4D7AA 1YVEI 3DBVO 2FY8A 1N92A 1IZ9A 4HFMA 3JQ9A 3DHEA 3R1IA 3DZJA 1UH5A 3L07A 1E5LA 3H9UA 5K6AA 1NVGA 1VL6A 1YL5A 4IS3A 1H93A 1QKIA 4IPTA 1MG0A 4UVHA 3QV1A 4RDIA 3H9QA 2Q1WA 1E7SA 3VTFA 3NUGA 3DDNA 3G1TA 1ISMA 3RUDA 3WLEA 1X0XA 4KQWA 4DQVA 3R6DA 4O59O 1AHIA 3IOYA 4MVJA 1ENPA 3QW2A 4OYRA 2O3SA 3STHA 5TS3A 4CR8A 5C7IO 1UXJA 3JQFC 5F5LA 4P8RA 2VHYA 3K5PA 3VZPA 2OUIA 4CL8A 3R3JA 4DBVO 5JLAA 3ZWVA 1K6XA 2DBQA 4R69A 3JQ7A 5CPFA 2A92A 4I5DA 1CYDA 4HKTA 1VSUA 4J7CA 4XR4A 4UUMA 1R4NA 4OQZA 5DOVA 1HYGA 1PZGA 3HWRA 4RORA 1SOWA 4HADA 2Z1NA 4FPXA 5THKA 1YH3A 4A10A 4NK4A 1KS9A 3ZWMA 1KEUA 2VZ0A 1W8DA 5L4SA 1S7CA 3GLQA 1PQPA 1AXEA 2ZYGA 2ZYAA 3WGZA 3UHAA 1HE2A 2V6BA 4QQRA 3JD4A 2F00A 3ETEA 3ICCA 5CG1A 1NNUA 1A71A 3MWDB 4FFRA 1E3WB 2HRZA 3UOGA 1DFHA 1IE3A 1A27A 3G17A 4UVDA 2NWQA 5C7OO 1T2CA 4QECA 2D5AA 3RUAA 3PLNA 3C7DB 3CXRA 4XDYA 1C1DB 1MP0A 1L7EA 1Z74A 4CM5A 2Q4EA 3JQ9C 3NYWA 2BGMA 3RSHA 2ZQZA 5JYDA 2EP5A 1B3RA 4EJMA 1IOLA 3QVTA 3JYNA 3CINA 5JXWA 4J3FA 1WLYA 5T8KC 1I30A 1N5DA 1SCUA 4MOWA 2BMAA 2BI7A 1Q7BA 4NMHA 3RD5A 4FS3A 4KDFA 3AUUA 1ZK4A 3HADA 4II3A 4U6SA 4B7UA 2X86A 5JY6A 1NPTO 1YWGO 1BHSA 2QYSA 2UUPA 1CWUA 4XA8A 3FN4A 4C7JA 4E6PA 5KKCA 4PVCA 1DRUA 4XD2A 5MGBA 3E5RA 2GD1O 1ADBA 1EZ4A 1GCOA 1I01A 3IP1A 4NZ9A 5T57A 1RM5A 1DJQA 2BELA 3ITDA 1N8KA 4LMRA 1XG5A 2E82A 1SB9A 4ONEA 3ZV4A 4OAQA 4Q3EA 4TMFA 4J1SA 2PGDA 3PTZA 1ZUD1 3X2EA 2I66A 4II2A 5A9RA 5AQ1A 4OO3A 3GEDA 4XKJA 3LC2O 1E6WA 2O48X 1RKXA 3BMQB 5KKAA 5A5FA 2IXBA 2A4KA 3RAJA 1H2HA 1E7RA 3TPCA 4R9SA 5F1PA 1WW8A 3K73O 4GLOA 1CERA 2W2KA 2J3KA 1HF3A 3PJGA 3HHPA 4XQGA 3WSWA 4K1LA 5EESA 4MDHA 5BNTA 1B26A 1ZK0A 2BD0A 2I6TA 4R16A 3M2TA 3HB5X 1QLHA 2E4AA 1TA4A 3FBGA 2Y0DA 3OIFA 1R4MB 2HAEA 4L8VA 2P68A 2IYOA 1I3KA 3SLKA 3GEGA 4W9NA 5IJZA 5KOIA 3QE3A 5FI3A 1KVSA 2DT5A 2Q45A 4WOKA 3VDRA 1GYPA 3CMCO 1IL0A 5B4VA 1FDVA 3LF2A 4NBRA 3QHAA 1LC0A 3RASA 3V8BA 1TEHA 1E7WA 3QVWA 1QORA 2C59A 1ISJA 1X7GA 3PRJA 2HMVA 5ES3A 4IMPA 4E2ZA 4EEZA 4YT2A 1ZMOA 4Q3AA 4MVJE 5KIAA 3SEFA 1C1DA 3ZWNA 4UVIA 1SPXA 1I0ZA 1I33A 3F46A 5M6DA 4HP8A 2OFPA 4D42A 4FJ1A 1DC5A 5KJ1A 2AQKA 2HJSA 3AI2A 4DA9A 3AOGA 5CEJA 4B4UA 1YGYA 5HRUA 4D45A 1NHGA 3SVTA 2NUAA 1IYZA 3U3XA 3Q2IA 5CDGA 3H2SA 3GMDA 4MP3A 5TT1A 5B1YA 1QYXA 1Z6ZA 2Q99A 2V6GA 4BNWA 2HMTA 4DC1A 4L0QA 5JY1A 1BDMA 3KHUA 2VTDA 1DFIA 4YJFB 4J1NA 4NU6A 1PJTA 2WSBA 3ZHXA 3NX4A 5FF9A 3AI3A 2O3JA 1YOVB 4I08A 4XX0A 3D3WA 1Y9AA 1X13A 3KOUA 5GMOA 4XGNA 3V1UA 3C7CB 5H83A 4BO9A 5KVVA 1SAYA 2VNSA 4CUZA 3L77A 1E1KA 2O50A 1AHHA 1VM6A 3OECA 4GVLA 4TVOA 4Z9YA 2DVMA 4CLRA 3NDRA 4J4BA 1C0KA 3GZNA 3HDQA 3JQ8B 2Q2VA 4BL5A 3GHYA 4YJHA 3DL2A 4YACA 4DMLA 4XJSA 3GDFA 5IXYA 3GDGA 1NQTA 4NG5A 4O5OA 3QWIA 3I5MA 4IZIA 4I8XA 4R3NA 3TL3A 2VCYA 3JQAB 3DFUA 3OJLA 3AM4A 1E77A 1PIWA 3GEMA 1LBEA 1FDTA 1XLTA 3ZWPA 4FC7A 4Z9FA 2GCGA 1HYHA 3B1FA 1RYEA 1E7MA 4NBTA 4J16A 2C2YA 3DZBA 1IPFA 4EEXA 2O7SA 4NU5A 2QZZA 4CMEA 2ZB7A 3NTRA 2EEZA 3GZ4A 3IKTA 1BTOA 4LMPA 3HSKA 3ZU3A 1A5ZA 3TWOA 2NACA 3D5TA 3D4OA 5C37A 1O6ZA 3PQFA 3PDJA 4IY1A 2BGLA 2Y93A 3DB2A 4PCVA 1N1GA 1MB4A 4M86A 4RVUA 3ZNPA 4CM9A 3TZQA 4Y9DA 2DPGA 3QJ5A 3OIDA 3CTMA 1DXYA 3KXDA 3IL2A 3OA0A 5CP8A 5BR7A 3TSCA 1QYVA 2AQIA 4CMEC 4RPKA 2C5EA 4PGFA 4XRGA 3RUEA 4ZD6A 4N5NA 3RUIA 1E1LA 2PZLA 3S2GA 1CETA 1ZXLA 1D7OA 2EKQA 4NI5A 5MDHA 1OMOA 1IZ0A 1DIAA 4J43A 4DMMA 1EVYA 4XR9A 3O26A 3UICA 3UKOA 1DRWA 3LK7A 4J0EA 4BB6A 3DOOA 2X9VA 2C5AA 3ZWWA 1YKFA 4R5MA 5TLSA 1MA0A 3SC4A 3GUCA 1D1TA 1V8BA 1ZEJA 4BV8A 1V9LA 1X15A 3K31A 4FC6A 4WASA 2FOIA 4YRBA 2BFAA 3FBTA 5TGDA 3FNFA 4RZHA 2X22A 1ONPA 3I9LA 3PQEA 1PJ4A 2PA3A 4A27A 1AE1A 1Z73A 4C4OA 1F8GA 1PR9A 1HL3A 1I10A 1LRKA 3F4LA 2JFHA 2GPTA 3ZI0A 5CDYA 3NT2A 2CF6A 2OGUA 4C7KA 3IIEA 2HMSA 2GZ3A 1XQ1A 4BNMA 3KTDA 3G0OA 3L6DA 3UUWA 4RF2A 1SC6A 1MXHA 2VHXA 5EJ2A 4CUJA 1O95A 3AM5A 4GX2A 1OBFO 2JAPA 3D4PA 3KO8A 1LUAA 3L4BA 3LT0A 4UULA 2X7HA 3H5RA 3WNQA 4MVJH 2F1KA 3E9MA 4JLWA 5DBIA 2D1YA 1PWZA 3QSGA 4K6CA 3HDJA 3K2BA 1XSEA 4YAGA 4RVFA 1O8CA 3F1KA 1P3DA 2ZYDA 5JMWA 4JBIA 3T7CA 5L7TA 1LLUA 3ROMA 2D4AA 3X2FA 4E5KA 3T7EA 3DZFA 4UEJA 4ALJA 4BO8A 4CM7A 4D3SA 4WCFA 1E1MA 2WJPA 5CEFA 2NU9A 4IDGA 5IXSA 4RQTA 3S8MA 2I9PA 1DJNA 3JYOA 3W4JA 4IIUA 3AK4A 1XYGA 4E32A 1KY4A 1WPQA 2HU2A 2VZ8A 3K8ZA 1I5RA 4UUNA 4IXWA 4GKBA 1J49A 1WZEA 1PS0A 3ZNNA 2DLDA 1EE9A 4E12A 3KRTA 4TWRA 5U1PA 4AJJA 5U4QA 3ZW9A 1BVUA 2PD3A 2QG4A 3K2EA 1NAHA 3HN2A 2ZATA 4Y8VA 2O23A 3DEYX 3C3XA 3GN1A 4J7UA 2X58A 4J9VA 3ZV5A 4E5PA 1LC3A 2YV3A 2JCYA 3NDIA 1ZK1A 2GASA 3AUTA 4XYGA 2FSVA 3GVXA 4WGGA 4MVJD 2FZWA 4YJDA 1X0VA 2Q46A 2YHIB 1YRLA 1MUUA 3V1TC 4ND3A 2DUUA 1AGNA 5I9NA 1N9GA 4HY3A 4ESOA 2NU8A 1E3EA 5TC4A 1NFFA 1GYRA 1SNYA 1FF9A 2OHXA 5A06A 3AY7A 3FR7A 3ONFA 5IF3A 4JQCA 1JVBA 5K6AC 4NHEA 1QV6A 1B16A 1PWXA 5GY7A 1GDHA 2EW8A 3EC7A 3JYLA 1JWAB 3FNHA 3KYCB 2ILTA 4IDFA 3NRCA 5JDCA 5GZ6A 3SC6A 1BDBA 4U5QA 2P9CA 4W4TA 4BNVA 3KUXA 1ZFNA 1ULSA 4JGBA 2VUTA 3FTPA 3H9JA 3UAGA 3WGOA 4WLNA 1DBVO 1WP4A 2X9GA 4Y6RA 3RWBA 1GU7A 5KVQA 2HO5A 1EVIA 4JXKA 3EYWA 3KEOA 1YOVA 1VJ1A 2CFCA 4MINA 2V7PA 4KUGA 3H5AA 4BHTA 2VOEA 2VYND 3RVDA 4NK5A 4TKMA 1H6DA 2POQX 1M6WA 2P4QA 1DRVA 3ZHZA 4E5NA 3C85A 4BQPA 1NPYA 3O8QA 1M67A 2B69A 3O9ZA 2DPHA 5EPOA 4AJKA 1Z7BA 2Y05A 4JBGA 4BOYA 2X0JA 4IINA 3RKUA 4D41A 3WLFA 5CDSA 2GO1A 2LDBA 2Y1GA 3BMQA 4XZ3A 1TT7A 4R1NA 4E3ZA 1RM0A 1U7TA 1ZK3A 1KEPA 4U8GA 3TL2A 3MOIA 3TF5A 2QRJA 4RO0A 3V2HA 4CODB 1Y7TA 1CJCA 1N9GB 3GNSA 3RBZA 5T5QA 4YAJA 2TMGA 1O89A 1YS4A 4XB1A 3RC2A 1PL6A 3H3FA 4J91A 4PVDA 3Q3CA 3KBOA 3QVSA 3HDYA 1P74A 4G65A 4QSMA 5A03A 3LYLA 3FCOA 5AXAA 5IDWA 3WYCA 2GGSA 3GGPA 5AVOA 1GD1O 3OJ0A 3UW3A 5DNAA 3EMKA 3PLRA 4L4RA 2W4QA 1QRRA 4BNUA 5L51A 2Q50A 3RQSA 2Q22A 4ZHSA 4RGBA 5TQVA 5A5EA 5DP2A 1I2BA 4GGPA 4YBZA 3WYEA 1HZZA 2WD8A 3S2IA 1JAXA 4UUPA 3ETGA 3F3SA 4TKLA 3M1LA 4JK3A 3GAFA 4M87A 4OGWA 4R4JA 3DAPA 4CLDA 3ENNA 2HK9A 4KP7A 1AUPA 2DKNA 5A9SA 1GFSA 4IDEA 1U5AA 2ZIZA 2QHXA 1P9LA 2PGJA 3AI1A 3F5QA 1KY5A 2YJZA 4J9UE 4XB2A 4P4LA 1ZCJA 1JTVA 1PL8A 1H6CA 1ZH8A 1LEHA 3ZHYA 5ICMA 1NFRA 4KDEA 5AXCA 1KOLA 3O8QB 3TFOA 4E2YA 4TRRA 3H8VA 3JQAD 4WCDA 4FFNA 5IDYA 3W8EA 3ZV6A 4KMSA 1PEDA 3BTUA 5BQFA 2OBNA 3TOZA 5BSGA 3BHMA 1YL6A 2X0NA 1E3LA 1Z45A 4JP3A 3WDSA 4WPGA 3OMLA 1DHTA 3BTSA 1K3TA 5GZ3A 2C2XA 2DQ4A 1RM3A 3PHIA 4FFLA 1HDXA 4QEDA 3WWYA 2DC1A 2QW8A 3A9WA 1ZXBA 3LT1A 4D0RA 2YY7A 4KQXA 1LLDA 1NM5A 4WCFB 1ZBQA 5CG2A 5C7LO 4ALLA 3OSUA 3M2PA 1YDWA 2ZTMA 4YJGA 1K5HA 2ZB4A 3TQHA 3UGKA 2B4RO 3MJCA 3CIFA 4Q9NA 2NTJA 1PGPA 2ZTLA 3KEQA 1B8VA 1UZMA 1QMGA 2A9FA 1BXGB 4E2XA 3SXPA 4ZJUA 4EYEA 4FQ8A 4QT0A 4ZQGA 1A7AA 3BMNB 3I6QA 4I1IA 2FR1A 4XQ9A 4DLBA 4JBHA 4CM8A 3QQPA 2VTEA 3S55A 2AQHA 1ADGA 1MC5A 1GR0A 5KVCA 4R51A 2VWHA 4TZTA 4EDFA 2P9GA 4CQMA 3RFVA 3PP8A 2AE1A 3DR3A 2RIRA 1S6YA 4IQGA 2NSDA 3DOJA 2B37A 4AG3A 4MO2A 3AU8A 5L4LA 3H65A 1L7DA 3AM3A 2VYVD 5AOVA 4R68A 3LC7O 3WWZA 2XOXA 3ANMA 3AUSA 3FNEA 1Z82A 2C29D 3ZH2A 1E3SA 3C1TA 5I8ZA 4JN6B 4OXKA 4W7HA 5T6BA 2GSDA 1TI7A 2FP4A 4MPDA 4I5GA 5CPBA 4BNLA 4B8WA 3DMTA 4NQZA 1PZHA 1ZNQO 2NQTA 1KYQA 3TNLA 2NQ8A 5A3JA 3PXXA 4NH4A 1G6KA 2EG9A 4IQ8A 1BGVA 2J5RA 3D5QA 1T2AA 4BIIA 5BNIA 3E8XA 3ST7A 3C8MA 3PZRA 4KUHA 2NU7A 3JV7A 3D4NA 4YVFA 1H9AA 3KZVA 4BS9A 3INGA 1JLLA 4OIMA 1SMKA 4YWJA 2VOJA 2VWQA 2HDHA 2VNAA 3ZHBA 3C1AA 4BKOA 2ZB8A 2HMWA 1H6BA 2GYYA 2GZ2A 3E48A 1WMAA 1OZAA 3VVCA 1NWCA 2CDBA 3ZGYA 1BW9A 1U7HA 1VLLA 1M66A 4GBJA 1TB4A 4F46A 2EF1A 3I9OA 3VPGA 4XGIA 4KOAA 4Z6KA 3KV3O 3KB6A 4N5MA 3CUKA 1ZW1A 2QYTA 1LLCA 3W6ZA 1JA9A 4ZGWA 3PPIA 4GH5A 2OMEA 4Z3DA 3GVHA 1J5PA 4UREA 2E49A 4CM3A 1GV0A 4OM8A 5BSHA 3IAHA 5IZ4A 4BMSA 1T26A 4KWIA 1GCUA 1LXCA 2D3TA 4D46A 3MJEA 1LDGA 3IKVA 3IMFA 1ZSYA 2GZ1A 5KJFA 4DLAA 1VKOA 1BXGA 1DFGA 1LDMA 2CUKA 4I9NA 2X9NA 5ICSA 2AEMA 2GRAA 2Q3EA 3WJ7A 4BNFA 3EHEA 1I32A 4L75A 3LT4A 3U49A 5JS6A 4QTZA 4DBZA 3KLMX 3JCZA 1ZJYA 5EQFA 4IIVA 3L0DA 3KM0A 4OHUA 4D3FA 3DTYA 1RJWA 1NASA 1QYWA 4O6VA 2O3UA 1R37A 2Q49A 4HNHA 3OH8A 4BO2A 1LNQA 1OOEA 4A5OA 3U09A 1UDBA 2C0CA 1N7HA 4DIBA 3O38A 5DULA 1M6HA 4MVJM 1E7QA 3E82A 1D4FA 4AJ4A 4HXYA 3PHLA 1HDRA 1A9ZA 1KVUA 1F17A 4S3MA 4EITA 4E31A 3NT4A 4ITUA 5F5NA 4LCJA 1N7GA 1LU9A 3DC2A 1U3TA 1Z75A 4HV4A 3EZLA 1GZ3A 1XCBA 3AY6A 1Y8RA 4HFJA 5BNFA 3PZBA 3Q6IA 1K89A 1P44A 4LW8A 1GZ6A 1X1EA 3RJ9A 2LDXA 3BZUA 3AY3A 2PK3A 1VI2A 2H63A 2PV7A 4J2OA 3NJ8A 4FFOA 2VRBA 1BW9B 1JKJA 1EE2A 3L4BC 1BMDA 4OH1A 2NU6A 2VUSA 4I5FA 2AE2A 2VQ3A 5TNXA 5CAEA 4AL4A 3U0BA 3F6YA 2ET6A 2WD7A 1PX0A 3IJRA 5EL0A 4D43A 5H82A 1ID1A 3QVXA 3HG7A 4XYEA 4YQYA 4B4VA 1FDUA 4MKRA 4RV9A 4DRYA 3OETA 2WWRA 1YJQA 2V6MA 3Q9NA 4B79A 4BMNA 5KTKA 4UVGA 4FDAA 4RF3A 3PI7A 3JQAA 1I36A 2GR9A 5IZCA 3GG9A 4QO7A 2JD1A 5HBRA 5JSFA 1Q7CA 4BO0A 3GH3A 4JJGA 1NR1A 5T64A 5I9MA 2EJVA 1HE3A 2IXAA 4RZIA 3OQ1A 1F06A 2OBYA 3GZNB 2JCXA 1U8FO 1CDOA 1UP6A 3PDUA 4J6FA 3ZNQA 5CDTA 3JQGB 1EBUA 5ITWA 4Q3CA 1MX3A 4PFJA 4YEDA 1IULA 3AFMA 2J6IA 3BTOA 4OOEA 5L4NA 4J7XA 1UXKA 2P2SA 2PKQP 4E13A 3DONA 4OQYA 2W98A 3GGGA 1K6IA 2IEDA 4R1SA 1VL0A 1LSOA 2NADA 4QFCA 4ND1A 1IUKA 3VAZA 3GR6A 1O0SA 4B4WA 2OXIA 1ZEMA 1Y9EA 3DZGA 4FSHA 4W9NC 4HFRA 1H94A 1HSZA 3JQBA 1T1RA 4PG8A 1C1XA 4HUJA 4L76A 2C7VA 4ILKA 5I7FA 5K9ZA 1YQXA 3RC7A 3PWZA 1PU2A 3K96A 3RC9A 3TZ6A 4Q39A 1PJSA 3T4XA 3E18A 2AQ8A 3VPFA 4BGUA 2I65A 5G4KA 4Z3KA 1C0PA 1GPJA 3WIEA 1Q1NA 2I76A 3WNVA 2IYPA 3GUYA 4HFNA 5G2OA 4UEOA 3L9WA 4IDBA 5HA5A 1B14A 1H0KA 1HXHA 2BRUA 1H2BA 5EIOA 4GWGA 4ID9A 2VYVA 3OFSA 4ALNA 1BRMA 4JJFA 4CMKA 4WNIA 3VZSA 3FF4A 3RBVA 5AXDA 3RC1A 4NIMA 2CF5A 4YQZA 2X23A 3LDHA 1YBVA 2C82A 3BHJA 4GVXA 4CLRB 1JWBB 4Y6SA 2PNFA 2D2IA 3F1LA 1UJMA 2IDZA 3AJRA 2XF8A 3GK3A 5T73A 4MP6A 4NBUA 3UCEA 1PS9A 3QA9A 5TX7A 5A1TA 2W2KB 2PH3A 1DC3A 4R41A 1PJQA 4RL6A 4XDZA 3ROQA 1SO8A 3BXXA 2WDZA 1DIBA 3P2YA 3PHJA 3C24A 4DWVA 4M1QA 5DCWA 4L74A 5JC8A 2G82A 1QR6A 4Z0TA 4AVYA 2QQ5A 4FD3A 4K9DA 1B0AA 1ZMTA 3UCFA 4DC0A 3WB9A 4BNJA 2GN8A 5THQA 4ZU3A 1GEGA 4FN4A 3WTBA 3ICPA 2C07A 5G0UA 2B83A 1YXMA 3UCXA 3EW7A 3OQ6A 4IDDA 4ZVVA 3V5NA 3DWFA 4PG7A 1DIRA 1WVGA 4NJMB 4L4SA 2JCVA 3JQ7B 4FOSA 2RBEA 4B3HA 4YRAA 2PR2A 3VTZA 1E6EA 3QIVA 4G2NA 2P91A 1EK6A 1GADO 1FDSA 1Z7EA 5HWSA 3AOEC 2W8ZA 3RFXA 4YXFA 3L9XA 1E1NA 2AA3A 3WGYA 3P2OA 4F45A 5COAA 3MJTA 1PGQA 1KVRA 3ADOA 3D64A 1DLJA 2OP1A 1KC1A 4D0SA 1OFGA 2CD9A 5JMPA 4PLTA 4GI2A 1T24A 2FN7A 4NJMA 1ZJZA 4N54A 7ADHA 3PYMA 2RHCA 3EVNA 3CEAA 4BNYA 5BSEA 3B20A 3DMYA 1X1TA 1HEUA 1F14A 2JKVA 3I6IA 4PG4A 1C1XB 3KYCA 4RCVA 4ZQFA 1U4OA 3AOEA 3S1LA 1PJCA 4N7RA 3ANLA 4B7CA 2VRCD 1A4IA 1BVRA 4RPHA 2NVBA 3I52A 2J3HA 3O4RA 3Q9UA 2Q1UA 4P38A 2Y1EA 3V1YA 4EGFA 3GA0A 2G1UA 3LSYA 1XU7A 3QY9A 2EXXA 4GSLA 4RDHA 1R4NB 3R0IA 3KSZO 4HNGA 3WGTA 2PFGA 2CVQA 2EHDA 3H2ZA 5JDIA 1IHYA 2NTVA 2ZQYA 3DBLB 3UFXA 2WM3A 2B5WA 2WYUA 1LI4A 5FYDA 1MLDA 1HSOA 1XHLA 5BT9A 3OJFA 4W7IA 1BXKA 3ZU5A 3KSDO 6ADHA 2X0RA 1GQQA 4OXYA 3UH1A 1EFLA 4XWYA 2B0JA 3I83A 1WXDA 3LF1A 1LSSA 4GX1A 1WMBA 1GEEA 1I24A 2DBVO 1J4AA 4JP2A 4B3IA 3FTNA 2VYNA 3QWAA 4IBOA 3VH3A 4PIVA 2FPPA 5JDIC 1MC4A 1D8AA 1YONA 4XQCA 3MEQA 4EZBA 3I9MA 4PRKA 4H15A 3WG9A 4ALKA 5L53A 4J4HA 4MVJI 4F3YA 3MCVA 4QUKA 1T2EA 3PWSA 2WE8A 3C1OA 4BNZA 3BMCB 1BWSA 5DCUA 5COBA 4K28A 1P1IA 3GOHA 4DVJA 1NXQA 3JQBC 4YR9A 2JFFA 4BNNA 5TSDA 1WWKA 2Y66A 2BFOA 3ROKA 2JL1A 4XEHA 3ZU2A 4IJUA 4I9UA 1NR7A 4CV0A 4CV1A 1UXIA 2PKQO 1QLJA 3OF2A 5ENDA 3GDOA 4MJLA 2I3AA 3ON5A 2J3JA 1JU9A 1EDZA 3MJVA 4ZQBA 1LQTA 2VUUA 4UAGA 1J6UA 1DO8A 3MOGA 3N58A 3EGOA 4MIOA 4J4TA 2JHFA 4RLSA 1TVEA 2C20A 5DCYA 1H6AA 2B36A 4D3DA 3AUAA 1V0JA 4CJXA 2CZCA 4NNJA 3GT0A 1WNTA 4RPJA 1R6DA 3MTGA 3W8FA 3CE6A 1V3VA 1VC2A 3F9IA 4PG5A 3DTTA 4AJEA 2DM6A 4F6CA 3TDKA 2O3TA 1R0KA 2OL4A 2RH4A 1U28A 1QP8A 4AJ2A 1UDCA 1C3VA 2Z1MA 3GVCA 3NV9A 4LVUA 2Y1FA 3I3OA 5IZCC 5JO0A 4D79A 3L6OO 5A02A 4O1MA 1Q0QA 3NEPX 3GPIA 4R1TA 4BO6A 1JVSA 4TVBA 2UV8A 2GUGA 3S2EA 2DU8A 4YTEA 4UUOA 2VWGA 1G0NA 4I5EA 2CVOA 3PIDA 1JAYA 3B6ZA 4OKNA 1GV1A 5ER6A 3PWKA 5A9TA 4FBGA 1ORRA 3DO5A 3ONDA 3PJDA 4D44A 1HKUA 3AW9A 4H16A 1W73A 2FSSA 5TIIA 2W2LD 2UUOA 1ZZEA 2X1HA 1NPDA 3MWEB 1KVQA 4J49A 3KYDB 4BO4A 2ZKLA 2P5UA 4IDAA 3H6KA 4L9RA 3WQQA 4E5MA 3PEFA 3PFFA 1GL3A 2AXQA 2VHZA 5HM8A 2YV1A 1JN0A 4MKXA 1XQ6A 4LSMA 1A7KA 4BNGA 4CQLB 4BUCA 2W2LA 3TZKA 3FRJA 4WK6A 3U4IA 3DBRA 5A4DA 5KCZA 5KJ6A 1QSGA 4U7WA 1DPGA 4BVAA 3WXBA 5H81A 3TZCA 1Y6JA 1ZKMA 1P31A 3A28A 3RROA 2HLPA 1DEHA 2XXBA 4CV2A 3RUHA 1M2WA 4J0FA 1FK8A 2Z5LA 4RPLA 5FWNA 4YJGB 3UN1A 3DHYA 3WGIA 1R12A 4GGOA 4DGSA 3UVEA 4RVSA 4INAA 4P22A 5DBGA 3ROPA 3F47A 5G0SA 3WS7A 5I8WA 3ZWCA 3L6EA 1Q7GA 4WOJA 2FR0A 1U9JA 3LQFA 2YFHA 3K30A 2EJWA 4PZEA 2Z95A 3Q1LA 5DF1A 4J1TA 2YHUA 2P5YA 3W6UA 3VDQA 4Q3DA 1GQYA 3GY0A 1PJ3A 4FFMA 4E5YA 4RVHA 4EBFA 4W6ZA 3FD8A 3WMXA 1XWFA 2E37A 1U3UA 1ISHA 3WBBA 4MP8A 4IJKA 1HDGO 4YRDA 3ETDA 4K6FA 4LRSB 3RCBA 3TZHA 2Y1OA 4AJNA 2CSUA 2VHVA 1P1KA 3D3WB 4CM1A 1ZSNA 4MVJG 5JAMA 4AJHA 4CR7A 3KSUA 1IPEA 1P1RA 3OEYA 4E30A 1DIHA 1RWBA 4TRJA 4DPLA 1ZO8A 4PLWA 5DT9A 4Z0HO 2PLAA 1LX6A 1EVJA 5HTOA 2X8LA 2Y99A 3DHNA 4IS2A 2G5CA 1VSVA 3ABIA 1NTOA 2PD6A 4DIOA 1EQ2A 4CQMB 4ZN6A 5A9SB 2HKIA 1U8XX 3WIDA 2AMFA 5CEEA 1GUZA 4ND4A 1B15A 3WQSB 4AJOA 1KETA 2ZTUA 4NBWA 3W4IA 5T67A 4PZCA 3P7MA 3RU7A 2GDZA 4ZICA 2H5LA 2JHGA 5U9CA 2O4UX 2G17A 2P4HX 1YBMA 4EUEA 3VZQA 4GSKA 2YV2A 4M49A 5ITVA 5TRTA 2Y0CA 2J5KA 2I3GA 2IRWA 2BF7A 2Q1TA 3QLJA 2DBRA 2RH8A 3FNGA 3JYPA 4GKVA 3VC7A 2QX7A 3G49A 3G79A 5FI5A 5KNLA 1EVZA 1PJLA 4JX8A 4E33A 1NYTA 3GG2A 1P0FA 1E3JA 3TFQA 1B8UA 2NVWA 2AEJA 3ASVA 1R4MA 4LGVA 3DBLA 2GLXA 2NLOA 2RCYA 1T1SA 1N1EA 4XQEA 2PY6A 4A7PA 1DB3A 3EK2A 4IM7A 5JFOA 1H5QA 3GVIA 3BMOB 4E4YA 4YCAA 2QIOA 3E6AA 2DFVA 4EJ0A 2O2YA 2EW2A 2HMUA 4BKQA 3H7AA 3U62A 1BXZA 1X7DA 1MXFA 2NTNA 4IXTA 1G0OA 3QWFA 1SZJG 5CHEA 4RJTA 4OOFA 4XIJA 2FWMX 1TT5A 5DDIP 1XU9A 4Q3NA 3IUPA 3OBBA 4FCCA 3RKRA 3VOSA 2FHSA 4CMIB 4G5HA 1JKIA 1JKFA 4LN1A 4N18A 1FMCA 3EVTA 3CPSA 1T25A 1BSVA 3I9KA 4DL9A 5JDCC 4WKGA 1JDJA 1NWHA 3KYDA 1GTMA 3ZNOA 4MVJF 2X4GA 1B3BA 3GF4A 2XAAA 2ZCVA 2YZ7A 5JAQA 2WTBA 3K92A 1L1FA 5JBIA 2JAHA 4Q3BA 2OP0A 3PGJA 4CMBA 4M89A 1CRWG 2WEKA 3CH6A 3F4BA 4OJNA 1UAGA 3IC5A 4BNXA 3WFJA 1ULUA 4BKRA 2AHRA 2EKPA 5EN4A 2IZ1A 2RHRA 1HYEA 3D7LA 1T4BA 3IQDB 4PRLA 4XYBA 4OL9A 1ISIA 1UP7A 1PQWA 3E5MA 4FW8A 2HK8A 3RIHA 1WZIA 1WDKA 1JQBA 3F5SA 1Q0LA 3DOCA 3CMMA 5BSFA 3FWZA 1P0CA 1PQUA 3PVZA 1QXSA 3TOXA 1RM4A 5JC1A 3MZ0A 1UDAA 1HE5A 2B4QA 3B70A 4LSWA 4IMRA 3HJAA 4FJ2A 1DAPA 5F1OA 1ARZA 3JD2A 1G1AA 2Y1CA 4XIYA 3QP9A 4CMIA 2IEBA 4B8ZA 3ZN2A 3BHIA 4YA6A 3IUSA 2AW5A 4YT8A 2I5PO 2JD0A 5JYEA 4ND5A 2ZCUA 5C3MA 1XIVA 1MV8A 3VPHA 3T4EA 4WLEA 4PLFA 3PGXA 3LC1O 1UUFA 1YDEA 3ZZNA 1I2CA 5I7VA 1NFQA 3UF0A 4XJTA 4OKIA 4AICA 3TN7A 2X5KO 1HLPA 1OI7A 4DYDA 4GLLA 4A73A 3BMOA 3FPCA 7MDHA 5DBFA 1Y8RB 3B1JA 1SOVA 3HDHA 4HBGA 4FFPA 2WYVA 3MJ4A 4KUEA 4DQXA 4NPCA 3JQEA 3N74A 4ZA2A 1EUDA 2VT3A 4FOOA 5AYVA 1U2GA 3SJUA 1NVTA 4ALIA 1EQUA 1PZEA 4MVJP 4FIZA 3OA2A 4PLCA 3GPDG 2ZK7A 4B4OA 2YFQA 3HZZA 4CLXA 3PIIA 4X54A 2I67A 3HE3A 2AG5A 2O3QA 4YPOA 3BIOA 3ANNA 3HQ4O 4QO8A 1LTHR 3LT2A 3FI9A 4PLVA 3U5TA 1GPDG 3WYBA 1O9BA 1PGOA 1YQGA 2J5QA 2PKRA 2YYYA 3GNQA 2BLLA 2GNAA 4GX0A 4PLZA 3SJ7A 3PFWO 4IQ0A 5TJ9A 2DUWA 4DREA 3JQFA 1EUZA 3QWBA 3ZDFA 3N7UA 3EAGA 3ZWYA 3D1LA 1VJ0A 3VZRA 1ZVMA 4WECA 1QG6A 1Y81A 5JCXA 2CY0A 3CZRA 3LZ6A 3JQCA 3WSVA 2YHIA 4LCEA 3I23A 4IJVA 4WE3A 1KVTA 1I2ZA 1HZJA 4R5HA 3VKVA 1KIFA 4ZQEA 2G0TA 3WR5A 4DYVA 2X6TA 3LVFO 4KTTE 1PL7A 1ADCA 4BMVA 5L7WA 3RI3A 1NVMB 5ER9A 4BKPA 3EY4A 4L4XA 4CPDA 3RBXA 3EZYA 3QRWA 2GN9A 1YJ8A 2FPGA 2TMDA 4FJ0A 3K9QO 1U3WA 1DSSG 2H1SA 4ZQHA 2J3IA 1GZ4A 4EW6A 1YO6A 5AXBA 3B1KA 2WD7B 3ORFA 3FSRA 5EQDA 2R00A 1C0IA 3DAFA 2YDXA 3JQ6A 4AFNA 4BGEA 2EV9A 2BHLA 3NJ4A 4PN3A 3C7AA 1YB1A 3GFBA 3ZWXA 1KERA 4BO5A 3GNTA 4HX5A 3H3JA 1YQDA 3CSDA 3OEWA 4MKZA 1EMDA 5KVSA 1I3NA 3GAZA 3QWHA 3RUFA 5G0TA 1R16A 1ENYA 1X14A 2X5OA 4WJZA 5A3VA 1HLDA 3DZIA 4FGWA 4CL3A 1T2FA 3CKYA 4BV9A 4CMCA 1ZSVA 1LSUA 4XCVA 1HDZA 2HCTA 2O3RA 3HFSA 1Y5RA 5JO9A 1Y8QB 4ND2A 1X7HA 3TJRA 2UDPA 3RU9A 3WQRA 1CQJA 4NJOA 4URFA 1QV7A 4UVEA 4CMAA 2GN6A 5LDGA 4F6LA 5FEUA 3FPLA 3BA1A 3LU1A 3SBOA 5I9LA 3LLVA 1LA2A 3PQDA 1P1FA 3GHHA 3FHLA 5L95A 2Y68A 2C7GA 4CUKA 5COQA 3GRPA 3OJEA 3FWNA 4E2WA 1RPNA 4MIEA 3QVOA 2B4TO 2A35A 3ULKA 4DIFA 1HDYA 5B4UA 1UZLA 2Q4BA 2ZTVA 4GMGA 4WEQA 1HETA 1XGKA 2ZJ0A 4JCOA 4BNHA 1R15A 3KLPX 1P1HA 3WGQA 1MFPA 3OHSX 2E6UX 2WYWA 2A94A 3IJPA 5LCXA 2EP7A 5A05A 2CMDA 3IDSA 1P1JA 5LDHA 4CR6A 2HJRA 3ZWBA 1P77A 3DQPA 2O7QA 3BMCA 3OQBA 4CLHA 4RF5A 5ENVA 1LJ8A 3SLGA 1HRDA 5JAZA 4EJ6A 1SB8A 1IY8A 3O03A 4KTVE 1U2DA 1PZFA 4WCFC 5KJEA 2BKAA 5F3RA 3VHRA 2BH9A 1GY8A 1ZK2A 2XXJA 4NFYA 4CMHA 3VPSA 1GYQA 3DMTC 3GVPA 4LRTB 4R1UA 4AJPA 1YB4A 2X0IA 1W0CA 3DZHA 1V3UA 3MJSA 2D8AA 2GN4A 3NDJA 3ONEA 4RPGA 5G0VA 4WLOA 4TRMA 2EIHA 5IAAA 3GRKA 3U4CA 4LK3A 2PTGA 4B7XA 2V65A 4WLVA 5EINA 4RQUA 5FFFA 1HE4A 4LVCA 4BNIA 3Q0EA 1F12A 4WNCA 2GERA 3G1UA 1XKQA 4XYLA 3E9QA 3BTVA 4K26A 4BO7A 2BFMA 4O0LA 2PD4A 3ZCXA 1HT0A 1ZIDA 2OOSA 5IFLA 3GC6A 3RUCA 1WDMA 5I7EA 3S2FA 4P4NA 1PS8A 3NT5A 2BFPA 4O63O 4A03A 3WFIA 5JCJD 4CM4A 3GMSA 5L40A 3WOHA 1E92A 1O94A 3JTMA 5EERA 4B3JA 2HQ1A 3P5SA 4ZRNA 3TRIA 3JD0A 3U4HA 4FB5A 4H3VA 3M6IA 5ILGA 2DFDA 4OSOA 5TF4A 1K2WA 4PLHA 3COSA 4GAEA 3PHHA 3JSAA 1ISFA 4R3WA 3PK0A 3W1VA 1ISGA 2IZZA 3JD3A 1I3LA 4WEOA 4BGIA 1A72A 3VPXA 2JJYA 4R9RA 1GUFA 3WJAA 2YW9A 4Y6PA 1LLQA 2EGHA 8ADHA 1I3MA 2PH5A 4J1QA 1K0UA 2VN8A 1XEAA 2HSDA 4QX6A 4IGFA 1GUYA 1PGJA 3A4VA 1KEWA 1B7GO 1B8PA 3INTA 1EUCA 3NAQA 4NDNE 1U3VA 1DC4A 4XGKA 3V2UA 4DPKA 2NV6A 4CMJA 2EERA 1YBAA 2NVUB 2R00C 4HWKA 8LDHA 1U1IA 1XA0A 1IHXA 1PR3A 3WBFA 1DDOA 1WAMA 1D3AA 3VH2A 3K6JA 4CLEA 3ZWOA 1R0LA 4JNKA 2H6EA 1NBOA 3RJ5A 1NQOA 3W8DA 5IDXA 3PYXA 2PZJA 4KZPA 3DXFA 2B35A 2JD2A 4BB5A 5G4KB 1PGNA 4PLGA 1A9YA 5JNLA 6LDHA 4RVGA 3HN7A 2HRBA 5HS6A 1C0LA 1QYDA 4NBVA 3BMNA 2XPCA 5JE8A 4BKUA 1YL7A 3E9NA 2NVUA 2VZ9A 3U4DA 3AFNA 5C5IA 1DIGA 4EI2A 5JYFA 3SX2A 3PYLA 4IGEA 2FR8A 4R54A 1SBYA 4Z9XA 4CM6A 1AXGA 1MFZA 4YAKA 1OC4A 4GL4A 4OMUA 4E0BA 5L45A 1VRWA 1CIVA 1JW9B 1GQ2A 1KBZA 1AN9A 5CFZA 4IDCA 4YAIA 4A2CA 5J9GA 4OXNA 1VKNA 3ITKA 5T8KA 1C14A 4YYZA 1M76A 3V2GA 4QXMA 1V6AA 2FMUA 3AWDA 2HUNA 4M8SA 3LLSA 1LRJA 2YQ4A 3I4CA 3ASUA 2FPIA 2EWMA 3M1AA 4RVDA 3OJOA 3E1KA 3HNPA 2DTXA 1UR5A 2UVDA 4M54A 4N5LA 4BNKA 4NFSA 1DC6A 2R2GA 1ONNA 1ONOA 3IS3A 3NGLA 2YQ5A 4PZDA 5KJCA 5F1KA 1E3WA 4YAEA 3A1NA 4BO1A 2QZ9A 1BG6A 2WE7A 4TSKA 4W82A 1F8FA 1QYCA 1UZNA 4CQMD 4GQAA 2BI8A 3ENKA 1YB5A 3GN2A 1EFKA 2DAPA 3I9JA 4DQUA 5G4LA 3PJFA 1E6UA 3DZKA 1TT5B 3WMWA 1LQUA 4EUHA 4YDRA 2DTDA 2Y67A 4A0SA 4JJIA 4DUPA 3OICA 1OC2A 1U4SA 1EBFA 3AU9A 4AJLA 1VJTA 4J90A 1A4UA 1KEVA 1I8TA 3JQGA 1XR3A 2O2SA 4S1VA 4YJHB 4CM9D 3GFGA 3WICA 2GF2A 1P45A 4W99A 4DPMA 1SEVA 1WDLA 4NFHA 4FR5A 1VL8A 4Y98A 1R66A 1J0XO 3GQVA 2IE0A 3R3SA 5ILOA 4H7PA 2Y0EA 5TT0A 1Q2XA 2IZ0A 2OORA 3WX0A 1EDOA 5JAIA 2R6JA 1T2DA 1W6UA 5I7SA 3OM9A 1NHWA 1ENOA 5TJHA 1HDOA 3KYBA 4OSPA 4ALMA 1KC3A 4IJWA 4ZRMA 3PHGA 3WGGA 3WTCA 5ADHA 1CQIA 1TLTA 1EEHA 1V35A 1VPDA 2H9IA 3HFGA 2D5CA 2VWPA 3ZW8A 4CQLA 4GWKA 4GMFA 1HTBA 4QFDA 4KWHA 1E3IA 4DLLA 1T4DA 1B2LA 3HB4X 5J23A 4YB8A 1PJBA 2IODA 5JPIA 1PJ2A 2WMDA 1N2SA 1NP3A 2NNLD 3DAGA 4WLUA 4WLFA 4MIYA 9LDBA 3OP4A 1CF2O 4U0KA 3VH1A 3D3EA 3NKLA 2OZPA 1LDNA 4U6QA 3U9LA 1IB6A 4P4GA 3INRA 3I1JA 4DXHA 3H9EO 1Y8QA 2CVZA 3NGXA 1Q0HA 3EDMA 4I9HA 1CEQA 3D0OA 1W4ZA 5L9AA 4JROA 2CDCA 3ZWAA 2Q2QA 5JW6A 1FJHA 4UEKA 3L4SO 3E03A 3I9NA 1NX6A 1E7YA 2V6FA 5DN9A 3HUDA 5DOZA 4IZHA 2UYYA 1LDYA 2B5VA 3A06A 1DOHA 4RF4A 1E5QA 5GZ1A 1XDWA 5EMHA 1K6JA 4EUFA 2VT2A 1ADFA 2FRDA 5F21A 2E48A 2C54A 4Y67A 4RLHA 4NR0A 5A04A 4GX5A 1TXGA 1F0YA 4PG6A 4J2HA 3IP3A 1NAIA 5LC1A 2ZJ1A 5B37A 1P33A 2DBZA 2G76A 2PZKA 3FR8A 3WGHA 2YDYA 1PTJA 2PGLA 4L73A 1YE3A 2PWZA 2BGKA 2CNBA 5L3ZA 1H9BA 3JQ8A 4CM4B 3H4VA 4YT4A 2P9EA 1LDEA 1OAAA 2J8ZA 4AJIA 1SEPA 4JIGA 4XRRA 2OO5A 1DAOA 3G3EA 2UAGA 5B4TA 1LSJA 2X5JO 1XELA 5IG2A 4BNTA 2AG8A 2YUTA 2NM0A 4LISA 1UP4A 9LDTA 1U5CA 5HS4A 1ML3A 1EK5A 4IUYA 4U0JA 5DP1A 1GAEO 5IDQA 4Z0PA 1UXHA 2JFGA 3ZV3A 4M55A 2O4CA 2QRKA 3JD1A 3UXYA 3EUWA 1NQ5A 1R0SA 2Q1SA 4A26A 3DBHB 5CDUA 4BGVA 3PJEA 3MTJA 1LRLA 5G0WA 1MGOA 3Q2KA 2Q2WA 3RFTA 3Q11A 5JYAA 4DTIA 3NTOA 4TROA 3JQDA 5L7YA 3VVBA 1ENZA 4CMGA 3OIGA 4XYMA 1DLIA 1LDBA 2W90A 2CDAA 2VRCA 2D59A 3JYQA 5DZSA 2QRLA 4BO3A 2Y1DA 4G81A 1O5IA 4FGSA 5B12A 1D1SA 2EKLA 2PZMA 3NTQA 2DTEA 4GPD1 3I4FA 4CM8B 4CV3A 3H9GA 3DFZA 1Y1PA 1HDCA 1V3TA 2SCUA 4TZKA 1FDWA 2HK7A 1UXGA 1UAYA 3CZMA 3A14A 2I99A 3ADPA 1RYDA 3VKUA 3KETA
chains in the Genus database with same CATH superfamily
2D0IA 3NNDA 3U6KA 1ZHHA 4QNRA 1H2FA 1W5BA 2D1QA 3M7IA 1ORVA 1R27A 3AH8A 1RAAA 1Y5MA 4CLOA 1JJIA 1FDRA 4OGKA 1ND5A 4BLQA 4X94A 1BGWA 4DIKA 5JCJA 3KD2A 5ALFA 5PNTA 2ZAIA 3VYUB 2W2PA 3EGIA 2VT6A 3F78A 3M82A 3QVKA 3DL4A 4EGCB 1KP2A 4DJTA 1TQ2A 3VHXA 1V5FA 3BYZA 4ARUA 1S3SA 4YT5A 1VZ2A 1TO1E 4WY8A 3ZE0B 1U1DA 3KJXA 2R7MA 1E0DA 4AJ1A 4E21A 5JNTA 1YD7A 3JARA 1VIYA 3OUZA 4FYMA 4P35A 1YVEI 5FADA 4A0GA 5LVAA 1IZ9A 3JQ9A 1EFVA 5ERGB 3BDAA 3DZJA 3IO3A 4XVQA 1YI0A 3H9UA 4ZHQB 2Z6AA 5HKKA 3NRJA 1Z36A 3VAYA 3CLTD 3RPEA 4QARA 4EMBA 3OKPA 1KTVA 3AB3A 4IPTA 2QVXX 2ZRBA 4S04A 3DHVA 5LXTF 1RRVA 1R74A 3FNRA 2MCFA 1GG2A 4ZMBA 1J1UA 3LPDA 3DDNA 2VI5A 1SCKA 3DF9A 4XOIA 3BD6A 1NNI1 1VOTA 1CR0A 3ZR4B 1RYZA 2HGSA 4KQWA 4GXNA 1J1IA 4DQVA 4O59O 3ZOKA 4C4PA 1GAJA 2PV0A 4TV8B 3W90A 4MLCA 1N0VC 2Y9PB 3JVVA 3IOYA 4MQFA 4OYRA 5SZIA 4WW0A 1LJLA 4JU8A 3JY6A 3GQBA 1UM8A 2XY4A 1E8NA 2J33A 3I5YA 3JQFC 1QE0A 2AIRA 5F5LA 1E2NA 5DYNA 5JRDS 1QPZA 2VHYA 2FOLA 1TKAA 5B58T 4OAOA 2PX8A 4JI5B 1K6XA 1T5IA 5DISB 4GE0A 3LPLA 4R69A 5AVJA 2AUNA 2GJAA 4GF5A 3DEZA 3D0RA 3ENQA 1W5EA 1O97D 2EL7A 4BJ6A 4HKTA 1VSUA 4OQDA 3RADC 4IX1A 4UUMA 2GESA 4Q24A 5JPCA 3R2JA 2OHIA 2O1EA 2JH8A 1SOWA 1A82A 3HWRA 4Z1MA 4CKWA 4BNDB 3GLVA 2VXBA 5CLFA 5LMZA 3DV0A 2Q5QA 1EBBA 1ZRSA 1NF8A 2VK8A 5HDBB 1YB6A 4C0AC 5D3ZA 2L69A 2VZ0A 1W8DA 3ZDEA 4LF6B 1AXEA 3P0FA 1SBHA 3HP4A 3IBTA 3UUGA 1QK3A 1SHUX 4QQRA 2Q6LA 3SPXA 1T1IA 1SXIA 1C50A 1XZCA 3PQ4A 4EH1A 3M5PA 4KGDA 1DO2A 5CG1A 3G0HA 3QLTA 1TNDA 2D2VA 3MWDB 2CHFA 3UOGA 4L02A 4RY2A 4XVUA 2I03A 4ZXPA 3R77A 2I7TA 4ZJYA 3Q9LA 3VX4A 4DR3B 4QECA 5LSAA 4B31A 2D5AA 3EGXA 3VO1A 3MSCA 4J0HA 2N9UA 4C03A 4CXMA 1MP0A 4E4TA 3N8DA 4G9EA 1R9MA 2OCDA 5FUBA 4CT4B 3QKWA 1HRKA 5HIKA 1G38A 5FHQA 4Y1RA 2GM3A 2QTNA 2ZQZA 1NI4B 1WG8A 1JEAA 4QYWA 3VR2D 3W6NA 1IOLA 4P81A 4CMAA 4EJMA 1E66A 3JYNA 5C5DA 3W5BA 1DGQA 3MAAC 4RKYA 3P8ZA 2QBYB 2QKYA 5FV7A 3HYNA 5D6NA 1N5DA 3PL5A 2VTBA 4B3RB 4ED9A 5LP6F 1RAFA 2VAMA 3KK0A 1KZ4A 1NUTA 1C4WA 1X2BA 5EE3A 3ETHA 1RHRA 2JAXA 2WYIA 4B7UA 5I3ZA 2X86A 4PZ0A 1DADA 2QYSA 8ABPA 4PPQA 3VI3B 2VNJA 4XA8A 2JVJA 1WM1A 2X15A 3BE8A 2X8JA 3C5WP 3E5NA 3FN4A 3SBDA 2P11A 2COKA 3LUAA 5GIPE 1QANA 3L7DA 3CVUA 2GD1O 1GCOA 1H2WA 1I01A 1KK1A 4YRMA 1E2EA 4M1ZA 2AFHE 4LMRA 1XG5A 1JP7A 4B35A 1A1VA 3ZV4A 3A7EA 1F38A 4AUMA 3PF8A 1H1DA 2CBXA 4ND8A 1K27A 2CL6X 5CAEB 4P84A 4O8JA 3DULA 4ASUD 5ALNA 5AQ1A 1EFRA 2YXDA 3GEDA 3QQ5A 1PBNA 3BKWA 3BMQB 5KKAA 4X93A 1H2HA 1E7RA 1S1MA 3NWOA 2OZEA 4P54A 4NZOA 5IC5A 1IHOA 3NLLA 2HPZA 3PJGA 4C6SA 4EHLA 1UFKA 4IOLA 2XUKA 1I6KA 4R16A 5BNTA 3QSYA 4X20A 1AUOA 1QO7A 1U0FA 1Y7HA 4GNKA 2WTUA 1QLHA 4O4HF 2E4AA 1TIBA 2K5UA 4P7FA 1JT9A 1M0SA 1GILA 3WOVA 5GP1A 4JS0A 4L5YA 1NI5A 2N46A 1E9SA 2ZJZA 3OESA 2IYOA 2NYUA 4CN9A 5K0TA 1QHHB 2OY0A 3OZBA 1KI3A 3U16A 3H1TA 2OV4A 5IJZA 3ZEIA 1E20A 3QE3A 4X92A 3W3AD 4B47A 2O8CA 2Q45A 3KTOA 4WOKA 1JB1A 3C45A 3T7SA 4D25A 4W5NA 5JR3A 1N36B 2OORC 2PRZA 4ND7A 2VP6A 5K8VA 5BORA 3ZD8A 4LWZA 2IVFA 1SCDA 2UZAA 3Q7SA 1ISJA 1K5GA 2HMVA 4TTSA 1J97A 4NKRA 5CLJA 1XKXA 1OI2A 4JC5A 1ZMOA 4QTTB 5F98A 1FUYB 4JC4A 5TMPA 3ZWNA 4FZ5A 3FUCA 4DSUA 3QMWA 2QTLA 2ONZA 2KPOA 3DV2A 5BW8A 3F46A 2O5VA 5IJWA 5KJ1A 2AQKA 2QN3A 4IHAA 3K8QA 1SKYE 2Y9MB 3K9WA 1UZUA 4HH1A 1BE0A 2F43A 3AI2A 3AOGA 1B1AA 1P6QA 5AM1A 2VLIA 2BKUA 1VKJA 2H1HA 2WFZA 1TM4E 2ZYRA 3C5CA 3LCMA 3GWGA 4MYUA 1IYZA 4UOEA 5CVTA 3SVTA 3B85A 1GSAA 4FE4A 5CDGA 1CY8A 3H2SA 4LI0A 2CXQA 3NBQA 4MP3A 5E2AA 2GQ0A 5TT1A 1QYXA 3T7IA 2UKDA 4HNRA 5B1YA 2QT9A 5C1BA 1T36B 1TUBA 1XO1A 1EFVB 3QFFA 4GYWA 4M9XA 4NYIQ 4OFBA 5C80A 4IYJA 1SBCA 1OT5A 2VTDA 3R3YA 1XCOA 2J3MA 1OW3B 3GFOA 5BW6B 5AIAA 4N76A 1PJTA 2YY5A 5EKXA 3ZZTA 3ZIUA 5ALWA 3ZK9A 4EVQA 4OGGA 3AI3A 3KDSE 1YOVB 1XP5A 1NA5A 4M21A 4XDHA 4FFSA 3I6BA 3P2EA 5EJEA 4J07A 1X13A 2HU7A 1MQ8B 2WJGA 2ZPTX 5DLPA 3N0XA 4YI3A 1XDZA 3C7CB 3M83A 5GMOA 1H66A 5ESRA 1N5IA 1SAYA 4J03A 1I4DD 2HHLA 1C30B 4CUZA 3L77A 1AHHA 1VM6A 1OGIA 4TVOA 3V4LA 4HJRA 2DVMA 3LQ2A 1DX4A 1U1FA 4J4BA 4CFZA 3ELBA 3JQ8B 2Q2VA 1XTRA 2I34A 3GHYA 2CD7A 2Q8PA 1EIZA 5JVDA 2Z3VA 4EW3A 1E2BA 2UYGA 1DUSA 4EQ6B 3G6KA 3B1YA 4ICIA 4AYXA 3O3NB 5DXJA 3WBJA 2VJCA 4R3NA 3ZBQA 1BROA 1GGKA 4V24A 5F73A 3AM4A 5HMLA 2EHJA 2QX9A 5LB2A 1PIWA 3I5AA 3GEMA 3U4AA 3I61A 4KQIA 4IO1A 1KBQA 4G0QA 3RVRA 2OSBA 4NOMA 1HYHA 2I9KA 2EKZA 3IV6A 3V34A 1EEXB 4BAGA 4NBTA 3VV2A 3DZBA 3BM5A 1MDBA 3LY5A 3V7UA 4ZDIA 4NU5A 3E22A 1H1LA 3THXA 1TYDE 4CMEA 1JS1X 5FUYA 2EEZA 2LVBA 3GZ4A 3GJRA 2PZFA 4JB0A 2O1WA 4G5RA 4K3VA 4NMLA 3RQIA 5A3QA 3HSKA 3C7KA 4QYTA 2A9VA 3M6FA 5F2NA 3A58B 4OLJA 2NACA 2PO5A 3D4OA 3O8RA 3MT8A 1CUSA 2XCIA 3JPYA 1CHNA 2Y93A 1ZC4A 2YJ6A 1E99A 3C3BA 3HYTA 2FW8A 4M86A 4ZODA 3THSA 4HV4A 4LF8B 4CU2A 1P0PA 2BFBA 4IRUB 2WWXA 3SHVA 2WP8J 2CXUA 4GZMA 2C2GA 4HUQA 3REFA 4AM8A 5HUHA 4TYWA 4DEYA 2AKAB 5BN4A 4LE0A 3L8DA 3D6MA 1U3GA 1QYVA 2AQIA 2AZDA 4BYMA 3RYFB 3K2IA 3R7WA 6REQA 4Y2QA 4XRGA 1KXJA 2QAGC 2X4DA 2YINC 3LZDA 4Q9HA 1SQGA 1HZZC 3CLUD 5K8JB 4JLKA 2HMYB 5E2IA 4YNBA 3RVKA 3D7RA 4NI5A 5AHOA 1FFDA 3BS4A 1EA7A 4XWKA 4JB8A 5DTMA 1GA4A 1SURA 4DV1B 3QYAA 4H4EA 2XUFA 4QOGA 3UKOA 1AKWA 2LNDA 1DRWA 3LK7A 4BB6A 3DOOA 1DAIA 2ZAGA 3IALA 3ZWWA 1BKYA 3FTDA 4IDPA 5EEHA 3SC4A 3CG4A 4EP1A 1D1TA 1G9SA 4GLBA 4KV9A 3F6PA 4XWTA 1YUBA 3AHFA 4OK3A 4UMEA 1QIHA 3O3MB 4RESA 4CNQA 2H7YA 4F04A 1JUDA 2JIOA 4U7HA 4WASA 1KGDA 3NIFB 4C4RA 3FBTA 4KITB 3A4YA 4DSTA 3FNFA 1EESA 1QHFA 2IUTA 1UYJA 1E1CB 4HX2A 4FUQA 4X8HA 5DPMA 3LQKA 4AK1A 3MF4A 1V9CA 1QMHA 1SCBA 2XCUA 4JOSA 4EJFA 2EC5A 1AE1A 3Q5EA 5ULLA 1PR9A 3DE0X 1HL3A 3GP3A 1OXUA 3ZDXB 5BUSA 3EPBB 1DC7A 3FMFA 4C7KA 1M2JA 1LW6E 2GZ3A 1AKNA 1XALA 4PYIA 4BNMA 2G5PA 1WUHS 2VPIA 4ETWA 3VR6D 4HBZA 1KTIA 4XFKA 1R5JA 1MXHA 2VHXA 5SYAA 2A6PA 5EJ2A 5IHPA 2BN4A 1EJ2A 3LQ4A 2R65A 4YCSA 2WV7A 5B1DA 1GFIA 3WIBA 4OLHA 1OBFO 2JAPA 2W6PA 1OAKA 2Y6UA 3RU3A 5FX2A 3I05A 1GDTA 1ZI6A 3ILHA 3A3OA 3IULA 1EE1A 1G20A 2D62A 1SXQA 4MVJH 2D7CA 3E9MA 2JGDB 2SCUB 1TZKA 3EC1A 4H60A 4JFAA 5DB4A 4ENWA 1Z68A 2ZXFA 3HDJA 5DH9A 3K2BA 3CN9A 2PL1A 3F1KA 4HLUC 4QE3A 3U7HB 1E5DA 2JRLA 3OD1A 2ZYWX 3S68A 5JMWA 3SS7X 3T7CA 3ROMA 3IT1A 2IOFK 1FYVA 3T7EA 4UEJA 4ALJA 3UC9A 1SUEA 1VDMA 2QV0A 1YZUA 3D2CA 5AI8A 3WL6A 4B9EA 4D3SA 1OB5A 2WJPA 2PBRA 4IDGA 2BFFB 4RQTA 4B9AA 4KO3S 1X7WA 5ICCA 4RZUA 2DCMA 1YOBA 4XJXA 3W4JA 5A4IS 2FUG6 3EG5A 4LTDA 1QQAA 2JZOA 2J7PD 2OFXA 2R7AA 2W2TA 3AB8A 3SKVA 5KNCD 1WPQA 1YQQA 1QHXA 1Y48E 1CZRA 1I1HA 1V9SA 3QBTA 1I5RA 4E4RA 4P3NA 1QDLB 1M33A 3TOSA 1KOGA 3UK2A 1RC1A 4YJ3B 1RJ9B 3F7OA 3ZNNA 4F2PA 2DLDA 1EZ1A 3C8ZA 1E2FA 1UEJA 3EBPA 4TWRA 1EP3B 3E0XA 1GKLA 3PNYA 1OWPA 5GQSA 5U4QA 3ORQA 4XUGB 2JLWA 1BVUA 3LWZA 2MTBA 4FYJA 2PD3A 2QG4A 3K2EA 5M7EA 1NAHA 2GPNA 3HN2A 3ZVNA 1U3CA 4QUEA 1F2TB 3GN1A 3ZV5A 3I64A 4OJMX 4L57A 3R7FA 1QFZA 1U9IA 3L6UA 4C6TA 4ZIRA 1TTQB 1ZK1A 3ONNA 2ZRJA 4LF9B 4XYGA 3GVXA 2W6QA 1L7PA 3MLAA 4MVJD 5IX8A 3BQNB 2ZBEA 5CH5A 1KFBB 3E70C 5DEOA 1Y1KE 3TMAA 1KXZA 3NMUF 5JROA 2X8BA 1AGNA 1BE1A 4TGLA 5I9NA 1OBOA 1HFWA 4ESOA 3L05A 4DWJA 5JH7F 1NM5C 3OURA 2AVDA 3LP8A 2C5HA 1GYRA 2CXSA 2G9ZA 2X3YA 3AY7A 4NPHA 2A9JA 4I2NA 3BOSA 4JQCA 1F1BA 1HTTA 4NHEA 2WTXA 3KT0A 1DQPA 2XNHA 3AERB 2RHBA 2DP4E 2WFLA 3EC7A 5I7OA 5JQGF 4DV4B 4R2LA 2W00A 4UFPA 1QZXA 4IDFA 5HMMA 1KP9A 3LIIA 3KWLA 4XXHA 4FN5A 1Z6QA 2OBMA 1C3OB 1N3BA 2NO6A 1BDBA 3DP7A 4OV6B 5HF6A 2NV2B 3SC6A 1ZN7A 4RAQA 2BJVA 2P9CA 2VDMB 1RBMA 1P3JA 4W5TA 4BNVA 3V4RA 5F4ZA 3MXTA 2CCGA 2VJAA 1XCMA 2X14A 3P9ZA 4OJYA 4A6PA 4OQLA 1UBOS 1L7QA 4JC8A 3RE1A 2CDRA 2R97A 2QP3A 4WLNA 1DBVO 1E9EA 3R75A 1E3MA 2Q9BA 5F77A 1UC4B 3WLJA 4DDHA 5C8YB 2VXCA 3R4VA 1OWMA 3H1EA 4JJ6A 4NDAA 1H69A 2HO5A 3O92A 1EVIA 2FFQA 3H4IA 3PA8A 4XCQA 1VJ1A 2HNKA 3CHYA 4HXGA 4MINA 1JEYB 2HPVA 4HGNA 1OTHA 2E89A 3H5AA 1OH6A 3LHIA 4NK5A 4IFIA 3RSQA 1ISSA 3LYAA 3KHTA 3SFTA 1H6DA 1T5SA 3LUKA 1E8DA 3SFZA 4M8IA 2ZUUA 1ZONA 3ED1A 1DRVA 1BS2A 4IF4A 1C9DB 3DKKA 3A27A 3HGMA 3Q3VA 3ZHZA 2FETA 4F91B 4BQPA 1LPPA 1M67A 1ZA1A 2B69A 2JAOA 3AKEA 5EPOA 1Z7BA 5DW0A 3ZJUA 2W0MA 2Y05A 3NASA 4IINA 4JBGA 3RVLA 4D41A 1NKTA 3PUYA 5JH7A 4OUDA 4XZ3A 3GLUA 3DCNA 1KYYA 1TT7A 4UHBA 5AKXA 1O77A 1WXFA 2BP7B 3EUFA 4R1NA 1CZUA 1PKXA 1F8XA 4M1MA 2OFFA 1IXKA 1WCXA 3SSOA 4E3ZA 4AS2A 4G6ZA 3TL2A 4H31A 2VDQB 1CJCA 1KR5A 1RLTA 3QH4A 3VDMA 2W0SA 3GNSA 1OZGA 4UXIA 5T5QA 2W43A 4NJEB 3L7YA 2TMGA 3N70A 2WINI 4YAJA 3U3OA 1RHUA 2CYBA 3RC2A 4TS4A 5ICGA 3Q3CA 1TTHA 3QVSA 1P18A 3EQ6A 2FSIA 3HDYA 1LPMA 3IEUA 4LYAA 5CDFA 4QTYA 4K40A 1WUJS 3T1TA 1DEAA 1I7QB 2QZJA 4A2PA 1THMA 3DE7X 1LS6A 2GGSA 3GGPA 4ZYTA 3AP3A 3PQVA 1Z17A 1KZGB 2B3DA 3D54D 3ZY6A 2E87A 5DNAA 3KGDA 2V7QD 2AFIA 3EMKA 3LWDA 3L7MA 3OT4A 5JJKA 3ESDA 4GBGA 3HSSA 3I9FA 4L4RA 3V4OA 1JWLA 4C87A 2E6KA 3K8OE 4E5VA 1C30A 5L51A 5LZ5A 2R44A 1L5HA 3HXQA 1TF7A 3U9TA 4LJRA 1RAIA 3IAAA 1CUYA 1HNNA 3QVMA 5A5EA 2GPJA 3SNKA 4AJ9A 3F3KA 4O4LA 2QJWA 4MGKR 3K0BA 4BCBA 4BX3A 2KJQA 4RX1A 4BFTA 1JAXA 1PDWA 4MW4A 4UBMA 4UUPA 3FPEA 3K1ZA 3OZ7A 3L0BA 4NBNA 5G3ZA 1LPAB 2WUWE 1VBKA 1NXSA 2ZSIA 2DZDA 4FMBB 1SXGA 5AVUA 4Z4GA 5KTPA 4HDMB 1ML4A 2I33A 1AUPA 2RGYA 4RELA 2IPXA 1SQ5A 1DS6A 3R23A 2QRVB 4IDEA 4I2VA 1QM5A 4JB2A 5F9FA 3OHPA 3SMVA 1SXHA 3VZCA 2DCUA 3GROA 1FLAA 1SUWA 2QIPA 3LBHA 4Q4HA 5LN1A 3F5QA 1VLVA 4QREA 4J9UE 2J5BA 4P4LA 3ZXYA 1ZCJA 1JTVA 1JDSA 4EB3A 1PL8A 2IYQA 1EFPA 2FPIB 3ZHYA 4B6PA 4M83A 4QPPA 2WKRA 2RH5A 2XWBF 3LIPA 3O8QB 3RT7A 4C6RA 1GDDA 3H8VA 4UKDA 4W5OA 4FFNA 4G4SP 4N8SA 1TYZA 2AMYA 2GTHA 4WJKB 3ZV6A 3LO8A 4BQFA 5BQFA 4PPYA 5KX5B 1N78A 1RDFA 1RXYA 3NO4A 1XMPA 4NV0A 4XPIA 4HEJA 4DMFA 3K71B 1PT9A 2ZBGA 4BBAA 4AROA 1QG0A 1Z0SA 3EXEA 4G36A 5GZ3A 4Q1BA 4MVYA 3DD1A 4EY8A 4QPZA 4OHKA 1JAZA 3I76A 3K0EA 4QEDA 2EQ5A 1XAJA 1ZXBA 3QG1A 1LZKA 1VG8A 1M5TA 3PB3A 1EUQA 1WCIA 1GP2A 1CB7A 3PD1A 4A82A 4EY7A 2QL5A 3SOPA 2YY7A 1KDRA 3HLYA 1ABFA 3EVDA 3NCHA 2IUSA 1NKVA 1XD2A 4ZI2A 3K6SA 4X20B 1FEZA 1MRSA 4BZPA 2HADA 5J4VA 3P2IA 5MN4A 1ZBQA 5E8JA 5C7LO 2DYKA 4ALLA 3OSUA 2C9CA 3M2PA 1QRTA 3CF0A 2ZB4A 4EABA 2DFKB 5H3HA 1IH8A 4JYPA 4PO1A 2QVBA 3COZA 1PGPA 2Q2OA 3OC0A 4V0ME 1U2QA 1B8VA 4C04A 1WSBA 2A9FA 4E2XA 3R9IA 2WFAA 1ICIA 4V02A 4ZJUA 3DZCA 1MOQA 1YDHA 5DWQA 2O6HA 1JSRA 3WKCA 1WR8A 4XQ9A 2FR1A 4K9KA 3T1HB 4CM8A 3SQLA 1GZVA 2M6KA 5CDHA 4HDRA 2GEJA 2XB4A 1FUKA 3CU5A 4KI0A 2CT8A 2NU8B 2P30A 3Q8KA 3N2YA 5JBNA 1GR0A 3PD0A 1MEEA 4ZC1A 1XRNA 4TZTA 4IKOA 1U7DA 5I4BA 4AY5A 1NRJB 2GJ4A 4KJXA 2OCLA 3RS2A 1CTQA 1YS6A 1I4OA 2AE1A 4YRIA 1XN1A 3DTVA 2AS0A 2V7QA 4E15A 2JCBA 2NSDA 3MMXA 3DOJA 3QI7A 3TLYA 3QBJA 1QTNA 3AU8A 3CGWA 2O52A 3H65A 1L7DA 2OVBA 4K2AA 3AM3A 4R68A 3AVPA 1D9XA 3WWZA 5CCDA 2QMUA 5LP6A 1OXXK 4QDXA 5K3EA 4Q00A 1TU3A 2C61A 1LBIA 3SHTA 1E3SA 2CJYA 1JIVA 3HN6A 1QK4A 5T6BA 1TI7A 2OHFA 2FP4A 4NYMR 3RAPR 2JEYA 4FYYA 3QPBA 4A6XA 2IHZA 3HUEA 2OV8A 3DMTA 4FYVA 1N7JA 2DECA 3NOOA 4YV2A 3WKAA 1Z4NA 2OWDA 3E84A 4CEHA 3GLSA 1CQZA 2NQTA 4OBWA 5DI9A 4P2BA 3TNLA 5CW1A 3VM6A 3EBOA 1O4WA 4OUKX 2NQ8A 3WIVA 1YZYA 1YFZA 1OLOA 2HC9A 1BGVA 1P4RA 3O4GA 4FMDB 3SY8A 1YV9A 2YWFA 2EARA 3NAGA 2BBSA 2ZS9A 1S02A 4C7XA 9GPBA 1MO4A 2CLFB 4V0KA 1H9AA 1UODA 4WXYB 4AMUA 2FPPB 2G25A 2XNJA 4RFLA 2XB6A 2PUWA 4YWJA 2R48A 2VWQA 2WSMA 2W2XA 3N8GA 3ZHBA 4BVEA 2C42A 1CNMA 1NKSA 3W2EA 2ZB8A 4ZI3A 4L6IA 3P2KA 1H6BA 1J99A 4YUAA 4KR7A 3P20A 2PBFA 1WMAA 1DTEA 2C3UA 2ZITA 3GEIA 3ZGYA 4AUEA 1WV1A 4XFJA 1V43A 3VNAA 1U7HA 1KE2A 1M66A 3IX7A 3VR5D 5FNVF 3UOAB 3DNFA 4M7WA 4XD7D 4F46A 4DUZB 2R62A 1W8IA 3LPCA 4D4GA 3GARA 4KNWA 1VE5A 1NZJA 4Z6KA 3KV3O 5FDFA 2ZJOA 2DQKA 1ZW1A 3EA5A 3CVWA 1GCAA 3PC6A 1Z56C 2GEVA 2HL6A 1OTYA 1ZN8A 4TXJA 5FUWA 3SC2A 2M98A 2EX0A 1RWXA 2D8MA 3ILXA 5AKEA 4MS1A 5BW4A 1D4AA 1JXQA 1IUOA 2OMEA 5T41A 1J5PA 1Y4AE 2E49A 1U4NA 3FLAA 3IAHA 4BMSA 2WF8A 5EIAA 1JECA 3X1XA 3I32A 4M0KA 1TD1A 1OF1A 3OPXA 4KGZA 5DE3A 5TQ2A 4B3DA 2I4LA 3MJEA 2YIMA 5EJFA 2EL9A 1FVHA 3IKVA 4KQEA 5FBWB 3LGXA 5ES4B 1KI8A 3KJEA 3GFVA 2ZDGA 3MGKA 2K6GA 5ARDA 5KJFA 4DLAA 3D0KA 3AV3A 3DJFA 3PVCA 2UUAB 3CRVA 3EGCA 2CUKA 1RIIA 4ACBA 4C4YA 1Q74A 2O14A 4CU5A 3NOXA 5JIBA 1CUEA 2GRAA 4QG3A 4EZEA 3CRRA 3FUWA 3H2YA 4L75A 5AM3A 3C3EA 4V0SA 3CE9A 3TW3A 1SELA 5BMVA 2P2DA 1W93A 1NYRA 3COWA 4EHKA 3FY4A 3JCZA 1ZJYA 4WBNF 4RDXA 2PUDA 2WAMA 4ML3A 4M7RA 1AB6A 2BCGY 1YRBA 1TYCA 1UBCA 2V7EA 3HZHA 3JR7A 4G97A 5HCIA 3NBKA 4GR9A 1MENA 3VR0A 2NSHA 4QRDA 3DTYA 4D8YA 1I9GA 1RJWA 1U1EA 3KLOA 3VKWA 1MCZA 3WMFA 3CLHA 5A4KA 5BV8A 2QNBA 4HNHA 4S1PA 4K6HA 3M9LA 4RH3A 1OOEA 1KWKA 3NONA 1TKRA 1N7HA 4L5BA 4IGKA 4LEIA 1IB0A 3GAAA 2QTCA 5K7SA 1D4FA 1I6LA 1U04A 3K5WA 3C6KA 1U0TA 4PHHA 1WMSA 3G82C 4BB9A 5C8XA 1OUMA 4P4UA 1F17A 1Y6GA 4E31A 1V3QE 2XMRA 4ITUA 2GCOA 5EPUA 5C51B 1KJWA 3DC2A 3MOSA 1Z75A 5EXDA 4K9MA 1GZ3A 1CY7A 5BNFA 3LW8A 3VHLB 2JLSA 5A62A 3ND7A 2QROA 3EASA 4KKVA 4TSFA 4DS3A 1HOTA 3N7TA 5KX5F 3EIQA 1KRXA 4HF7A 5DYWA 2WF7A 1X2EA 4BC0A 5H0IA 2LDXA 3G2MA 1QQ5A 2PK3A 4OU5A 5DXFA 5EJ7A 3HC7A 2OBFA 3LX4A 1PDVA 3LFUA 4A91A 4LYEA 4P82A 1JKJA 1COZA 3SR0A 1Z4OA 2M2IA 3HCAA 1BMDA 3AKZA 1DXQA 2JJ8A 4IXMA 2VUSA 4I5FA 3FDFA 3A3PA 4FKZA 1UQTA 3PICA 4Q4CA 3V48A 4AL4A 5ALVA 5CAEA 3OT1B 3F6YA 3VFDA 3WK6A 3K8YA 3ZD6A 1PX0A 5B6JA 5EL0A 4AO7A 4D43A 1ID1A 1NBMD 3QVXA 3HG7A 5KSPA 3H2JA 3W1EA 5A4FS 1FDUA 1V71A 4TTQA 3KVYA 4UVGA 4WDRA 2Z4SA 4RF3A 1Q0ZA 3TOCA 1P0QA 5IMSA 4QO7A 3RB8A 1Q7CA 4BBJA 3GH3A 4JT8A 4US1R 3WDMA 5FR1A 1DNPA 1CUHA 1NR1A 4RA6A 2QXYA 5EC8A 4B6JA 5HK9A 1HE3A 1FP4A 2Z43A 1F06A 1B00A 3GZNB 3IR7A 2JCXA 4U4AA 5HKKD 2V0NA 3D8RA 3TXAA 3PDUA 4J6FA 3ZNQA 3F9RA 5CDTA 5JNWA 3HVHA 5FLKA 2E1RA 3ETCA 2EJCA 1ZD1A 4Q3CA 4OX9Y 1UJ5A 1YQWA 2EWWA 2OAEA 3FMIA 4X6YA 3VYSB 3ZLJA 2O8FB 4UJ3A 4I3GA 2EBHX 4HWTA 5BRJA 2R1VA 3DWIA 1YA8A 1QFYA 1UXKA 2P2SA 2Z4RA 3ND6A 3W2GA 3DONA 4B3XA 4YRSA 4WZZA 2VDPB 4C4TA 1O96B 2V4ZA 1K66A 3VSCA 1Q0PA 4BVGA 2VJKA 1LSOA 1LNSA 3N59A 4ND1A 4RK1A 5GAJA 2O5CA 1CHDA 1UDWA 1WPGA 4KH1A 2GKGA 4FB4A 3HEAA 2OXIA 1P81A 3TTUA 3ZHXA 3QLVA 4YRFA 1X80B 3FB1A 3P4XA 3L6CA 3KPJA 2FPWA 4FSHA 1KHHA 2D13A 4HFRA 4Y9TA 4UHFA 5HQTA 5IANA 2DWCA 1UQUA 3HY6A 2F59A 3CNLA 3U4GA 3T7KA 4K9PA 1YQUA 2JGIA 4FT4A 1Z2PX 4KN8A 2F1JA 1Q1AA 2ROQA 3ETLA 4PHTA 4TOIA 3KQHA 5M5BA 1M7GA 4UHEA 2B98A 3ET4A 1KGSA 4Q39A 1PJSA 2C84A 2QENA 2AQ8A 4RGVA 2VDWA 3T4XA 3A6PC 2C95A 5IK2A 3FKSA 4DR4B 4L85A 3BKXA 3CEHA 4ZPJA 5AJYA 4US0R 4Y9SA 1TADA 3WNVA 4IIYA 3GUYA 3N9IA 1T43A 4H08A 3VRHA 1W5TA 4PSVA 4R1LA 1HDIA 4M8NE 2XUGA 3T0GA 5ICEA 2BUBA 2PS9A 3OZTA 3IEIA 2ZWAA 3DFIA 5I9TA 2WAAA 1H2BA 1A7JA 4HDCA 5EIOA 4KJZA 3OFSA 4H59A 5DX0A 4ALNA 1Y4ZA 1MAVA 2OENG 2IF0A 4JJFA 2IYRA 3U26A 2FF5A 4B40A 5AXDA 4CMKA 2TSYB 2WJVA 4YONB 1AQNA 3ETJA 1D2GA 4D9FA 1NURA 4RD1A 5LQDA 3F3YA 2C82A 5FXMA 1APBA 2CHGA 1JWBB 4S0XA 3PNBA 1GG5A 2GVZC 2RMKA 2XF8A 3NWEA 2R84A 4MITA 1G66A 4P4TA 5AUPB 3GK3A 1SRQA 2J85A 4HNUA 5FBVB 1SUSA 5TX7A 2QSJA 4UBOA 1R6TA 3K0CA 3IMEA 2QVCA 4XVCA 2ETXA 1DC3A 4XDZA 4BKMA 4DLVA 4DQDA 3BXXA 3UAVA 1DIBA 1NMZA 4DC9A 5DCWA 2ZJ2A 3P0HA 3PSHA 4Z0TA 5HFJA 2B4YA 1XMQB 4I9GA 1D6JA 3QTTA 5BMOA 1UC9A 3R0JA 2GVNA 4HDKB 4XLLA 5G3YA 2ID9A 2REOA 2FPNA 3WB9A 1PJAA 3VU1A 3LL7A 3MFQA 1XF1A 3N3BC 1DKLA 3AVVA 1IXZA 4FMDF 5LDDC 1EWQA 2IF2A 1GEGA 4YP7A 2V54A 4FX2A 4QA9A 2C07A 5LQKA 4X45A 2CC2A 4Q47A 2B83A 1YXMA 3BUSA 3CLRC 4MV4A 1GZ5A 3DWFA 2IUUA 1TK9A 2FVXA 1WVGA 5AWFC 3ZHSA 5C52B 4FGLA 1ODIA 2OLJA 1NX9A 4A2QA 1DT5A 1GKIA 4HQOA 3KKNA 4UQOA 4ZV9A 5BYKA 1PT8A 1BEZA 4UTXA 4B3HA 5C8VA 4TWIA 1CIJA 2QSYA 3QU2A 4P36A 4CG2A 3VTZA 3BFPA 5DWVA 1E6EA 3KQLA 2DSTA 3QIVA 1JBQA 5JYBA 5HWSA 3BK2A 2INGX 2W8ZA 3ENZA 3RFFA 1JG3A 4M9QA 1GZSA 4YXFA 5EJ5A 3JR3A 5IT9A 2PKYX 3WFZA 3L7AA 3MCTA 1U0GA 1XLWA 5EFOA 3HB9A 5ERYA 3U7GA 1KVRA 4PQGA 3ADOA 5BR1A 2C92A 1TGYA 3L8EA 3F6CA 1E59A 2RI6A 1FYFA 5E6UB 3PDIA 4NOKA 2FN7A 3G23A 1ZJZA 3B52X 1TA9A 4NCAA 4MYDA 3CEAA 4B84A 1IN1A 3EGDB 1XQVA 1UKEA 2YWRA 4KL8S 5G40A 5FKJA 4TV8F 2Q29A 1X1TA 1F14A 3DNPA 2JKVA 3I04M 4QBGB 5HYVA 5EE9A 4KR6A 4PSAA 4XM1A 4CCWA 5IPFA 1O94D 1GG9A 1U4OA 2FKNA 3AOEA 3EQ9A 5F3DA 3S1LA 2ZUTA 3RDPA 4B3FX 3CNQS 1PQ4A 3KFXA 3DMDA 3UM9A 4DDVA 4KPEC 4C08A 3DXZA 4RPHA 1BVRA 4X41A 2NVBA 5IJ9A 4K3UA 3RABA 2Y1EA 4DLYA 2G5TA 3E1GA 1CY4A 3WLKX 4EGFA 4GFDA 3GA0A 5B64A 1H4SA 3WC4A 2BP7A 3HU1A 1LS1A 1E2IA 3WLRA 1A8UA 1R4NB 2GCNA 3KSZO 3CVOA 4RK0A 5BYBA 4B2PA 5B2EA 3WGTA 5JCZA 1DWOA 2JLCA 2AVNA 2HV9A 2PFGA 5CB4A 5BWMA 5JDIA 4F12A 1DWPA 1TL7C 2PJDA 1P3Y1 4DA0A 3LJKA 1ESZA 3L4JA 1CJBA 1D4OA 2XD4A 2ZUVA 3KZ1E 1WXHA 3NWBA 5JQWA 3LXUX 5JAHA 4ZYLA 3RF7A 3UANA 5ABPA 3NVDA 3H0WB 1YMQA 4YRZA 1GQQA 2PJUA 4KXVA 4ZWNA 5C0OE 1ZL0A 1SCUB 4YCJA 5CVCA 2J48A 4U2DA 3BH7A 2NXEA 3KQSA 4X62B 2OPBA 4DMKA 1GEEA 2KWIA 3QOWA 1L5KA 2CNWD 3PXEA 5AJWA 4H1TA 2R79A 5HIMA 5LLSA 4F4JA 2NUPB 1JFFA 4OGLA 3KOMA 4PIVA 1E0JA 3OFKA 2OILA 1MC4A 1Z0AA 3KP1A 1ZMRA 4XQCA 4WV3A 3SD7A 3MEQA 2AOUA 3LC0A 4CTNA 3I9MA 2V6JA 3TW0A 4EZBA 2XD9A 4ALKA 3T4PA 3L43A 3ZK7A 2IGTA 3RHTA 3ZVKA 2ISQA 3C1OA 4QHSA 1CP3A 2I1VB 3BMCB 2FW1A 2J08A 1YZVA 4LJLA 3ZZ1A 4L0MA 2F62A 3KEFA 4INOA 4WX2B 1NXQA 2FZGA 3JQBC 1JR3D 2FWIA 3FZNA 1TCUA 3LA8A 3X1WA 1TJPB 3HKDB 3FE2A 3LKZA 1AKRA 2NSLA 5AVZA 3CVXA 1ISPA 2FFBA 2H07A 2YC4C 1JDBC 4CV0A 3PTAA 4DJJA 3T99A 1R3DA 2R1TB 2BR4A 4FKBA 3ZDYB 1XLVA 2CXRA 3FRHA 5J9FA 2P6OA 2YCLA 5DCLA 3GRUA 3L0OA 2HBRA 3MK31 3COVA 4W6QA 4DUGD 1JU9A 1EDZA 2Q3BA 2J6BA 1G3QA 2QU7A 3MJVA 4M4SA 5IAEA 3CNBA 4YCMA 3MOGA 3NFYA 5EIEA 3IIMA 4MIOA 1VI6A 4J4TA 3NIBA 3QEAZ 1FP4B 3Q4GA 4GPTA 1TVEA 5FPTA 1F2TA 1LX7A 4D3DA 3EIOA 2CZCA 3K09A 1AO0A 1UBHS 4RPJA 4TQAA 4OM7A 7AT1A 2VSOA 2IEYA 1V3VA 1U0HC 5F2KA 2ZRAA 3LK6A 4PYMA 4TLMB 2II6A 3F8SA 4KRGA 1T1EA 3GLGE 1P29A 2A0XA 3LCCA 3B2QA 3DT6A 1VLZA 2ZQ5A 3GRFA 2ZT6A 2RH4A 3KELA 1A9TA 1T6ZA 1VYHA 4I1SA 1C5KA 1QP8A 1UDCA 4GRIA 5E4JA 4OAPA 3JQRA 3NV9A 2ZR8A 1T8SA 3VSEA 1OB2A 5AKLA 4UHCA 3I3OA 3EWNA 1Y34E 3ESQA 1T8TA 1HQKA 5A02A 2WM9B 1T2UA 2P9FA 2XB9A 3TDNA 2O05A 2F4VB 5LYJA 3CJTA 3GPIA 5KEIA 4LV6A 4PBTA 2O5EA 3KFVA 3IUBA 3KZOA 4UFNA 2FPOA 4OU4A 5IKPA 1ZU5A 2FMHA 3AETB 2Y1XA 4JUIA 4MK4A 4PGGA 4ZOBA 1OA1A 2F3TA 3WMGA 4CKYA 5JXHA 4NCHA 2VWGA 3ZCVA 3ZCSA 1UIRA 2R8YA 3EXG2 1B6RA 3KT8A 4C0HA 1JAYA 2W6ZA 4OKNA 3S44A 1GV1A 1XROA 1VIAA 3R5SA 2OA0A 4C5AA 3CF2A 5DASA 1RBYA 1ZS9A 4DCNA 4I19A 5ISMA 4BU0A 4D44A 1YFJA 1HKUA 2FSSA 3TGWA 4QRHA 3DZ7B 1TMKA 3AR4A 1ZZEA 4ZCMA 1P2FA 3MWJA 3MWEB 3SI7A 4P0PB 4DG5A 4IKPA 1M8PA 1Z8DA 4OA5A 3GBSA 4DZZA 3UV7A 3LCVB 3VOBA 2YVKA 3ECAA 4YMGA 4IDAA 1HMPA 2H4FA 1ZRHA 3PFFA 4L8FA 4D6YA 3DJYA 2YV1A 1V7ZA 4M3NA 5DJ5A 1QOPB 1QC5A 3DLBA 2QM8A 4MKXA 2Q0SA 1POXA 4OXRA 5FTWA 2XNKA 4JZYA 2H18A 3OQNA 3FVRA 4CTKA 2WTEA 1U0RA 4P9NA 3U4IA 3WSTA 4BQOA 5AVQA 2FFAA 1M5RA 5KCZA 1JHYA 2GB4A 5CUQA 2BZSA 1EGMB 3EGVA 1J0EA 2XVAA 2ZZKA 1ZKMA 2QN1A 4DHEA 4JWKA 1DEHA 3BRWD 3AUKA 3MTAA 1M2WA 3KKKA 4J0FA 3SHWA 3QFHA 1PG5A 2Z5LA 1R0XA 4QUBA 4RPLA 4YK7A 4BRUA 1VSQA 5FWNA 3UN1A 3VKHA 3DHYA 4GGOA 3KL2A 3EVCA 1O95D 3UVEA 4KVGA 3C74A 4K9QA 5DM60 5E4TA 4WOJA 1PKEA 2YXPX 4G09A 4M76B 3TNJA 1U9JA 3LQFA 2VJBA 1SQ0A 5CCEA 4WNYA 2ST1A 2QPLA 8AT1A 2A0UA 2NZ2A 3GD5A 3JWEA 4QJBA 2YHUA 1KJJA 4IILA 1YS9A 4JVSB 4MW2A 3W6UA 4Q3DA 1GQYA 4B46A 4E5YA 2DOKA 4RVHA 4CIVA 4EBFA 4W6ZA 5AT1A 1QF7A 2V03A 1U3UA 1ISHA 3PR2B 1HDGO 4G01B 4YRDA 1SVSA