1PR5A

Escherichia coli purine nucleoside phosphorylase complexed with 7-deazaadenosine and phosphate/sulfate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
237
structure length
231
Chain Sequence
ATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHITAAERQTTFNDMIKIALESVLLGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity of Escherichia coli purine nucleoside phosphorylase.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 74
structure length 231
sequence length 237
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pr5A00
4OGKA 4MCHA 1T0UA 4R31A 4RJ2A 1B8OA 1Y1RA 3KVVA 3FWPA 1OVGA 1OUMA 1ULBA 4NSNA 1NC1A 1T8RA 4TTAA 5K1ZA 4YMLA 2QDKA 5B7GA 1ODJA 3OZCA 4QAQA 2A0XA 3NM4A 3FAZA 3P0FA 1JE0A 4L5YA 3DF9A 3EUEA 3FUCA 1LV8A 3FOWA 1WTAA 1PKEA 3DJFA 3P0EA 3E9RA 2A8YA 4F1WA 1RSZA 4BN0A 1Z5OA 4MCIA 1TD1A 4WKBA 1NC3A 1PR1A 5JPCA 1A69A 4I2VA 4TXHA 1A9OA 1M73E 2QSUA 3OOEA 5KB3A 4QEZA 1U1FA 3E9ZA 3UAVA 1PK7A 3UAWA 4DABA 4GMHA 4YNBA 5F76A 3OPVA 4OY3A 2ON6A 1LX7A 3ONVA 2OC4A 1VMKA 5FAKA 3ENZA 3KHSA 1C3XA 3KVRA 1A9QA 1TGYA 3U40A 1PW7A 5F7XA 5DK6A 1V4NA 1K9SA 4L5CA 3OOHA 1T8WA 3MMSA 4F3CA 1K3FA 3E0QA 5F7OA 1B8NA 2HRDA 1Z33A 4X24A 3F8WA 4GKAA 1RR6A 3PHCA 4IP0A 4WKPA 3TL6A 4JOSA 1PBNA 3C74A 2OECA 2A0YA 5C80A 3OZEA 4TS9A 5CYFA 1TCUA 4QARA 4YJKA 5CCDA 4L6IA 1NW4A 2IQ5A 3OZBA 4DANA 1Y1TA 5B7PA 1TGVA 4P54A 3KU4A 1A9TA 4L0MA 4H1TA 3FNQA 4M7WA 1RT9A 3NM5A 5F7ZA 4M1EA 1Y1QA 1SJ9A 1PR4A 1Q1GA 2AC7A 2BSXA 2XRFA 1YBFA 5CXSA 4OJTA 3UAXA 1TCVA 1ZOSA 2QTGA 4DARA 1RXYA 1U1CA 2I4TA 4JP5A 2Q7OE 1PWYE 1ODIA 4NY1A 2B94A 1OTXA 3PNSA 3BGSA 4G41A 3LBAA 4EB8A 1YQQA 4MARA 4DA8A 3KVYA 4YO8A 1CB0A 4TXJA 1ULAA 5CYGA 1JPVA 1RFGE 1PR2A 5F73A 4R2XA 4D8XA 1RYZA 4TXLA 3OF3A 4LDNA 4LNAA 3PNPA 2QPLA 4R2WA 1JE1A 4TXNA 3NM6B 3QPBA 4TS3A 2AI2A 1RXSA 1SQ6A 3O4VA 3LGSA 4FFSA 1Z38A 1JDSA 4D8YA 4K6OA 2H8GA 5F77A 1RCTE 4TYMA 2QTTA 3MB8A 4DA6A 3K8QA 2A0WA 2OC9A 1Y1SA 4QASA 4TTIA 3LA8A 4D98A 4JWTA 1T8YA 2GUWA 4DA7A 1FXUA 3UAYA 1V2HE 1V41E 4EARA 4U2KA 4QFBA 1N3IA 3K8OE 3KUKA 4LKRA 1ZL2A 3EEIA 3BJEA 3D1VA 1V45E 1Z5NA 1PR5A 2ISCA 4M3NA 1JP7A 1JDTA 4L5AA 5EUBA 2RJ3A 3DP9A 2PGAA 5EPUA 1I80A 1Y6RA 5CCEA 1SD2A 4TTJA 4D8VA 4PR3A 1U1EA 3INYA 4GLFA 4OGLA 3GGSA 1PR6A 1V48A 3PHBE 1Z39A 4F3KA 1U1GA 3IOMA 3SCZA 4DAOA 2HWUA 3IEXA 3OCCA 1ECPA 3OZDA 1OV6A 4GLJA 4WKCA 1V3QE 1Z34A 2AI1A 5B7QA 4G8JA 1QE5A 4WKNA 3GB9A 4D9HA 5B7NA 1JDZA 1A9SA 5IU6A 1VFNA 4DA0A 4F2PA 1RXUA 1PF7E 3EUFA 3EMVA 1XE3A 1CG6A 1JDUA 3T94A 4BMZA 5F7JA 2HN9A 4OEHA 1T8SA 3BL6A 5I3CA 1Y6QA 4BMYA 1JDVA 4LNHA 1PR0A 1VHJA 1OTYA 1ODLA 3O6VA 2AI3A 1YR3A 3FB1A 3DPSA 2P4SA 4E1VA 3NBQA 5CXQA 1VHWA 4ECEA 1JYSA 3DDOA 4DAEA 4BMXA 1Z36A 3UT6A 1ODKA 1SD1A 2I8AA 1U1DA 1G2OA 4UC0A 1RXCA 3ODGA 4TXMA 4NS1A 1A9PA 3BSFA 4LZWA 4G89A 3UAZA 1YQUA 4KN5A 4OF4A 1Z37A 1Z35A 4WKOA 4F2WA 1K27A 1LVUA 1YRYE 2HSWA 5F78A 1OU4A 1PK9A 2OXFA 5EFOA 4QATA 1A9RA 5ETJA 5IFKA 1Z5PA 4PNPA
chains in the Genus database with same CATH superfamily
4Q9KA 2EYQA 4CM8A 4Q4CA 2XNCA 4I1VA 1GFSA 3KU1A 3OE4A 2LDXA 3L7KA 5ICFA 3ZTTA 4PLTA 1BC5A 4BWGA 2XUKA 3BQNB 3UVEA 3WI7A 3B8HA 3FOBA 4XWKA 1KXZA 2GBIA 5D3MB 3LT1A 2NU8A 4D0NA 4WBNB 2AW3A 5BUSA 1S5PA 2QF7A 2ZR7A 4HSGA 4YUZA 3WX0A 2OBYA 5AVRA 3IEMA 3SQXA 1Y3FE 1G8FA 3CSUA 3SHFA 4AJIA 4JOQA 3E3LA 1GUFA 1NQTA 2NN3C 1N5MA 1CZNA 1R00A 1JQKA 1VI6A 3PHGA 3MGCA 3A1TA 4OAOA 3OZCA 4OKSA 3TEFA 1W5FA 3W1WA 3KCNA 1L3IA 3M4ZA 3AF2A 1ZR4A 5A0FA 1I2CA 4N41A 1N25A 3L01A 3OTOB 1TAUA 2HOQA 1YDFA 4AT1A 4K7JA 4C20A 3QG5A 4IWYA 1UBUS 4FFWA 4TQAA 2FEOA 1XVIA 1A5TA 4C4PA 3YASA 1AB6A 4XFDA 5EQTA 4DGQA 2GD2A 3E2MA 1YO6A 2BKAA 4ZQHA 4BY9E 3SZGA 4ZCRA 2XCRB 1XJ0A 1MORA 4HHEA 1PKEA 1SD5A 3P0EA 1E2HA 3PZBA 1SC6A 1G8KA 2F3UA 3DOIA 5F35A 4RY8A 3CN9A 7MDHA 4XYLA 3EPHA 3ASVA 1ZMTA 1H1LB 3G59A 2CL5A 4HQ0A 3GGDA 1CS0B 3HM2A 2BISA 5JASA 5A04A 3PRJA 4RPCA 1UBKS 4WKBA 1JZSA 2BDTA 2FPKA 2R96A 2VP0A 5AM0A 2XSZD 4BV3A 1J22A 3GD7A 1KDRA 4F6RB 1SU4A 4E0BA 3SDZA 3WB0A 2VLBA 4PPGA 1QGAA 2XDYA 4RZUA 1MXHA 5FIUA 5ITVA 1PJTA 2CDCA 2VJPA 1UDWA 2W58A 1GKLA 4INOA 4XEUA 3QVTA 4IXNA 3I9OA 4LRYA 2PA3A 4UE3S 4INPA 1N9ZA 1XDWA 2X7JA 3BOSA 1IRXA 2AD1A 1KNXA 2DHRA 3TS1A 4E2ZA 4E31A 2B7CA 3MMPA 1TA4A 2HLPA 5DBEX 4AJOA 4B75A 5JAOA 1KY2A 5T3YA 1IQPA 3UF0A 3R5HA 4XSGA 4TWJA 3N6VA 4YJFA 1IG0A 3AB8A 4ROTA 3JQPA 4CTKA 3GMTA 3ZY6A 3KHSA 4A1FA 4ZK6A 2R8XA 2CLMB 2WA2A 3ZDQA 4L0CA 4CDGA 5CFNA 4DQXA 3RIXA 3RGWS 3FG9A 1DT3A 1YMUA 3RIEA 4PQYA 2VDNB 3TJZA 3FOAA 1P2TA 1FLNA 3SIWA 2H9AA 1CU1A 2XRYA 3Q5GA 3GT0A 4FGJA 4KB5A 4CIWA 1S3SA 4RW0A 3PC3A 5TT1A 1Y9ZA 3RVBA 1GVNB 2CHVA 3T3PB 4ZMBA 5DWQA 4IFEA 2MYUA 3TMKA 2C96A 3CW8X 3I73A 1AXRA 3V8QA 3WGYA 3TLAA 5GADl 3I2KA 4IOLA 2W98A 1UC4B 1O9BA 4KGZA 4RD2A 1YS9A 2VT6A 4M9CA 4IXTA 2YHSA 4R1OA 2EIXA 5TPWA 3PDIA 4S05A 1ZUIA 2DFKB 4O4HB 4J4TA 5A4AA 5AVWA 4ZRMA 2OAEA 2QRVA 1P74A 2D13A 2R6FA 2FZ4A 4LX8A 4W1QA 4BQFA 1JS1X 2HF8A 3IVCA 3FLMA 2WHQA 4UNRA 3O8NA 4HUTA 5FTLA 2YXPX 4J2TA 2HY7A 4DC9A 3WWEA 5LQAA 1T6YA 4Q4AB 5CITA 1VIMA 2F9LA 3HO8A 3OX2A 1ZNQO 1UIMA 3EFOB 3KJZA 3QNMA 3UW1A 4BVGA 5ICMA 5K8JB 5C53B 4KR7A 1DAHA 3DEAA 3F6YA 1QJ4A 1ZD2P 4FXPA 3GLVA 5EE0A 3ZDXB 1NNLA 1OAOA 3UV3A 1BS9A 2Z30A 3ADBA 1W2HA 4TL8A 2VH5R 1A27A 3GJTA 3TCKA 3HB9A 1WE2A 4DYHA 3T7JA 4YROA 3OG9A 3WGTA 1KKLA 3N70A 4RD6A 3A0RB 3RAGA 1DAFA 4DSUA 1RIIA 3GZNA 3D4NA 4BCDA 4Q4AA 3VSAA 4BP3A 1RZRD 1B42A 3MB5A 3NTOA 1BXZA 2B4YA 4FOSA 4TX1A 2F62A 5TEWA 1EFCA 2WMYA 4ESEA 4I5FA 1TJNA 2QTMA 4RL4A 3TLEA 1TJPB 1EX1A 3KR0A 2O0MA 4G8DA 2YJ5A 1Z26A 4BVBA 3ICEA 3R6WA 3AU8A 2P6RA 2J4FA 1U2SA 4XQGA 3CUUA 3H97A 3K1JA 3LP8A 1BSVA 3O7MA 1EEHA 1AUPA 3CUWA 4N7BA 4DDVA 2CZCA 3GHYA 1XKQA 4FNOA 1KAHA 4ZT2A 4I4IA 2WIJA 3UK2A 3FPGA 4EO7A 5L6MB 3IUYA 4C29A 4JI8B 1X15A 1EM6A 1SM4A 3HCEA 3C6XA 1KO5A 3UAGA 2FZCA 2VAPA 5FOUA 2MYNA 3WL7A 3VISA 3HHEA 3EZ7A 1RXIA 4HGRA 4JX9A 4MKHA 3UMRA 4E33A 1H3FA 3RIHA 3WLQA 4EM6A 1D2RA 4F96A 3CTPA 2E4YA 2BFCB 1UADA 2A0KA 2V96A 3FFBA 1T5BA 4O3MA 2X8JB 4W5QA 4NY1A 5C32A 3W5BA 4BKPA 1RWVA 1G9XA 3NONA 1JG4A 1YQXA 4G0WA 1WXXA 4HQRA 4MLZA 1SQ5A 3MUEA 1IVNA 3GNLA 5EWJA 1GLGA 3OM9A 2W6ZA 1SWWA 3RBXA 4HWRA 1A98A 1NY6A 3HJGA 4L02A 3F5SA 4DKJA 3ADKA 3GJSA 3GA7A 1JX6A 3DYIA 5HMLA 2VPWA 4UUAA 3FVQA 2P9ZA 1BD3A 2OQVA 4C2UA 5L9AA 1QF6A 4OI1A 1P7PA 4R2XA 1CUFA 1M5UA 5F73A 3OM1A 3W8RA 1J06A 3HP7A 4QRDA 1K2VN 3ZW9A 3TWOA 3ZWQA 2IEAA 1N6PA 3HGQA 3UEOA 3HBLA 5JZ9A 2DT5A 2ZUFA 3QU5A 3WMFA 3PRKE 3RS5A 3O21A 5SZKB 3K20A 2O2SA 3ABQB 1GV1A 2XZOA 2C5FA 3VVMA 2B4KA 4GGPA 3DV9A 1UM8A 3WNCA 3WRWA 2VA9A 3GL9A 3L0BA 3W2HA 3C45A 2HX1A 5KWIA 3GIDA 4XI9A 5G0TA 4FIZA 5AH0A 5GMOA 1M5RA 4K6OA 4MDFA 1ULZA 1KEEA 1CJUC 3PDCA 4BVLA 1NU6A 3AC0A 4CKWB 2JVIA 2P6UA 3RU7A 4XCXA 3V4VB 4JK3A 1HXHA 1TDJA 2L19A 2QM0A 1MEOA 1WNFA 5CA0F 2Y93A 2NTYC 1F5SA 1X7ZA 4GWGA 5EZQA 5KSYA 5A2QA 1KEWA 1P7ZA 1ZNXA 2OC9A 2G70A 1L4LA 2P5UA 3M1AA 3ZV3A 1P1CA 1KY4A 1LRJA 3K16A 3ZIDA 3DDZX 1VJGA 4UEOA 1PT7A 3V32A 1Z28A 4DMMA 1SU7A 5I8PA 1OYYA 4ZAYA 2WQ7A 4HXYA 4XB1A 2QP9X 3AIOA 3MMXA 1AKEA 3L8DA 4RJLA 4K0KB 5AI5A 4H9GA 3TTWA 3D5EA 5TGTA 4R2HA 4S1NA 1L3CA 2IYRA 3I5AA 1NZDA 3T7AA 3X3HA 3LPMA 1U7PA 2AMVA 1IPEA 1ARZA 1GP2A 4OVKA 3NDBB 3RV4A 3RT7A 2GCOA 1SVSA 4PRLA 3VZRA 5K3SA 5M2QA 2E9SA 3IHTA 3OIUA 3B6ZA 3RJ9A 4OXIA 4U9UA 3GMIA 3RRMA 4JYAB 4HLUC 3BQ9A 1BDHA 4RPJA 1YVUA 2Q49A 1EX9A 4E94A 2QMQA 3HY6A 2P40A 1G16A 3OIGA 4L75A 1FFDA 1TYCA 5CR9A 4IUYA 4TTPA 2D1SA 1NLFA 2W2TA 1EDEA 3AVWA 3WZLA 1BGWA 5REQA 1N2CE 2IBSA 2FR1A 2FLWA 2I54A 3HCOA 1QMGA 1XG5A 3L7AA 2CXNA 3ITNA 3FM9A 4QQFA 4JKIA 3TD9A 2GBLC 3Q0EA 1KPHA 2WYOA 2PSFA 2AOWA 2I6UA 3LA6A 4DLKA 4U7FA 3F71A 3NEPX 4WESA 4D3FA 4B2PA 1B0ZA 4HVCA 4JLMA 4U7WA 4B47A 3CCBA 5EXTA 3Q5EA 4ID3A 2M6SA 4Z4IA 2JAPA 3JYPA 1IHOA 1UMKA 3DWGA 3H19A 3S8YA 4ZO7A 1XZGA 3EE6A 4WIAA 3THXA 4BVAA 2AZMA 4GU5A 1NJGA 1W1IA 1E4EB 1OZAA 2GZ2A 3GWZA 5CCEA 4P3XA 3QMMA 4H0FA 1KIMA 3PPYA 4FYHA 3ZWXA 3GJZA 2DHQA 1JHDA 3H9BA 2FLVA 2VCHA 2WFAA 1W4LA 2KSQA 4DRXA 3HN2A 4UW9A 2H52A 4PZLA 3QHPA 2C7GA 4F4DA 5AHRA 3MGAA 2BR5A 5T5QA 1C14A 1TEXA 3H5AA 3T7TA 4P2BA 4KE9A 1DBIA 1G8GA 1JYEA 1YZQA 2Z8YM 1ZX1A 2ORYA 3JQQA 3WIDA 4F3KA 2G9RA 2JJQA 3K6RA 4P4NA 3WLSA 3IP3A 1YS2X 3IKLA 4AS1A 5JNUA 3WL5A 3D8NA 3MRSA 2Q5QA 1GKYA 1OGIA 4BMNA 4V1CA 4FYXA 3AI7A 4I8XA 5BQXA 4FJ1A 2ONCA 1I2AA 2X4GA 3IEUA 4G84A 4LOHA 3VOSA 5I9IA 2VSYA 5AWFC 4CMEC 2XVAA 3KQMA 3GOQA 2ZJYA 3KZCA 1YKFA 2PT5A 5CDFE 4Q1AA 3CWCA 2O5EA 1GLVA 1IHYA 4P4UA 4UNQA 3UATA 4Y2GA 4PQRA 4NOLA 5K0LA 3ZHUA 2WDPA 4YFYA 2D7JA 1M34E 1K7FB 3ENKA 3PWZA 4G0QA 5B57C 4LGVA 3I83A 4J4BA 1NYQA 2YWFA 2R6DA 4PFQA 1THMA 2PQMA 1TU4A 2BOVA 3ACCA 4FZ5A 4UBIA 3HEBA 2YY6A 4MPRA 3HJUA 5CFMA 3I58A 2WWHA 4J3NA 4UUPA 2YQ5A 1DKNA 5LSAA 3GLIB 1NX6A 3OEYA 4R8KA 4WK6A 3IB6A 4WFKA 3DZIA 4UHKA 1FUUA 2ZJOA 3M81A 3T94A 1ORVA 3I9FA 4DMCA 5COBA 1KKMA 3PDUA 4UEKA 3O03A 1C9NA 1LK0A 4UVHA 3HB5X 5HXAA 1E6WA 2HC9A 2I2XB 5ILQA 4KITB 3OLYA 4C6RA 4DRZA 1PZXA 1R8SA 1CCWA 1T6BY 2C1EA 5JZMA 5AJWA 3OM8A 4BXOA 4AI6A 3HU5A 4CFSA 4ZKEA 3P9SA 4LZJA 3UFXB 1J9GA 3ZD9A 4YY3B 1RHJA 4I9GA 4KACA 1QZTA 2YJ6A 4GKKB 5JO9A 1W49A 2PIDA 3A1UA 1V8OA 3N7AA 2VNIA 2CWWA 3FR7A 3QVLA 3W6NA 3HXLA 3VR2A 3IOCA 3PGKA 4CTNA 2C83A 4H7EA 3T4EA 3PL1A 5EHNA 3RYTC 1P4SA 4XJTA 3EOAI 3DVAB 4TWRA 1G3UA 5JSYA 4PPQA 3KJHA 2XA9A 3NHAA 2C99A 4WY8A 3ZI7A 1T1EA 3F9CA 2ZJ3A 2ZQ5A 3F5MA 3W7AA 4D3ZA 4D25A 2ZSFA 3MMNA 2CFOA 4PW0A 3CNOA 5J2TA 3DBLA 3SHQA 4F2GA 4RPIA 1OILA 5HKOA 3DDOA 4RVSA 4TMVA 1QO0D 2GAAA 1M1UA 1P5RA 2ZTUA 4BMXA 1GTMA 3LGXA 2VQFB 4Q1FA 1KTVA 3UT6A 1VKZA 3G79A 1FFBA 1WW3A 1EVIA 2BBSA 2GFIA 2ZE6A 3P9QA 3F7OA 2GN1A 1EHCA 2HD4A 2C8VA 1Q1ZA 2G9UA 3EK2A 1DEXA 5IKMA 4CQNA 1JIKA 3GLIA 2J4CA 1UEXC 1ZY2A 3DB2A 3H87A 1S3IA 3EIOA 3K0EA 2VBCA 3H18A 4NQZA 2PVSA 2UUOA 2O2IA 3NKVA 4IBOA 3UAZA 3HJRA 2PNFA 1ETHA 1QOPB 1ZNWA 3JTMA 4UHFA 1CQXA 3DZGA 3DTYA 5F52A 3TINA 3ZWCA 1UZAA 1DXOA 2YNMC 4NYIR 3FF1A 1BMTA 2UZAA 2YWCA 1E1RA 4J6EA 4KJZA 2IYEA 3R7WA 1SUIA 5DTEA 4MV4A 1N78A 2R4UA 5LU9A 1X9HA 1C7ZA 3JZMA 1HT0A 4TYWA 2C78A 2RG1A 3GGGA 5IABA 1VYVA 4WXEA 5JC1A 1ENPA 1ONSA 2Y1FA 2QTNA 2UVQA 3QVXA 1QQ7A 1GSHA 1F3OA 3A6HA 1C1DA 2WKRA 3QK7A 4WGGA 4D4JA 2ZRAA 2RGBA 2IPLA 5SZJA 3PWTA 4D43A 3P27A 4QYXA 2ZIEA 3GI1A 2QJRA 4WAUA 1CQIB 1V43A 2FA9A 1HT2E 3WJ7A 3DFKA 4CQJA 4KO3S 4LGYA 2Q8QA 1OVGA 3NTQA 5FV7A 3STVA 3VR0A 2DXIA 2X58A 3QFFA 4IJUA 4F8JA 3T3MB 3HE3A 4CF7A 1EBUA 1U6JA 2C2BA 4R2IA 1FFGA 3SDSA 3BJZA 1YZFA 5IDQA 4EZEA 1NVWQ 3R74A 5IYZA 2OAGA 4H7DA 4FB4A 1NG9A 4DV2B 5B1HA 4D92A 1E1YA 3KFXA 5K6RA 4K6MA 2PJRA 5A9SA 3IPCA 2FAXA 4AZSA 4RD4A 2LVBA 4NNOA 3TH5A 3JYOA 1S2LA 2NU8B 2YYSA 3COPA 4WBNA 4E46A 2YJTD 2WINI 2C88A 3DF9A 3Q9SA 1BU8A 3K6KA 2CHUA 4N8SA 1CRLA 1JPUA 1P0PA 3P1JA 4WNAA 3T12A 1XFDA 1CFJA 3B6KA 4UNPA 1HT1E 5MFPA 3W3AD 1WTAA 3DJFA 3C6YA 1IZYA 1D8AA 3AY7A 1UXHA 2WFLB 1VPTA 2H4HA 3I9KA 1KOJA 3N75A 4J0EA 2PJDA 4XTRA 4Y2UA 4MS1A 3EXIA 1FFHA 1VI2A 2I2AA 3GMSA 4Y2TA 3T3GA 4CV3A 3N8DA 3ISVA 4HVAA 2MYTA 4LRUA 4A0HA 4CWAA 5FEUA 1A82A 1EUYA 3VVCA 1LBEA 2J7PD 3BXPA 1QVZA 3VKFA 1I2DA 3U0BA 2IK8A 4PTYA 2BFWA 5IHPA 1VBFA 1G6Q1 3EOZA 4LE2A 4Y1RB 2BFBA 4O4HF 1R6BX 4YRNA 2GN4A 2H2FA 3DFZA 3IMCA 2QK4A 3I5XA 3X0DA 3RLFA 1XEFA 2IOQA 1RACA 3DLTA 4X8OA 4FFMA 3C5VA 3G1WA 1PVVA 1TJ3A 2CNLA 3GVIA 3QYPA 1QG4A 4R1UA 4WOJA 4EK9A 3VO2A 5LZ7A 3ZVMA 3D8TA 2IYLD 2X8WA 2ILTA 3BGIA 4TMWA 1SBIA 1XQ6A 5BN4B 5K4GA 5C7LO 4PF1A 1CULC 5L3QA 4MDYA 2O2YA 4GI3A 4MULA 3NBYC 3W2IA 2C7VA 3GUHA 4M22A 4OY3A 1ABFA 5KJ1A 3U9TA 2JDIA 2OC4A 3L49A 5E3JA 4BIMA 2FU5C 4JHLA 3HKBA 3VTAA 1N0UA 3QELA 1C0IA 2GDJA 3ETLA 1CC1S 1BCRB 1L5NA 2HF7A 4AN4A 2CXTA 3QP9A 2CXXA 3MWEB 1U3CA 4FD3A 4ZZIA 2PJUA 2BFEA 1C0LA 1GQYA 1W4ZA 2OBBA 3U40A 2B36A 1VPEA 4CLXA 4HAXA 4FMCB 1SKYB 1TC1A 1VBMA 1QORA 5F1YA 1ZVJA 2OBNA 3MQ2A 2Q6VA 4O08A 3TIFA 3GUUA 3LSYA 3S55A 5KNLA 4RHEA 3GAMA 5J23A 1B6GA 4N7MA 3DDNA 2Q7XA 3G1TA 1A76A 1B8NA 1OFGA 2PL1A 2QRHA 5EIAA 1DAEA 4B2IA 1Q14A 5KNCH 2J59A 4QOIA 1AS3A 1Z33A 4JXZA 1SG9A 2XSZA 2GHRA 1F4LA 1BXGA 4RTOA 3DMTA 5EJ6A 1IQRA 5LZ5A 4YRBA 5JQGB 2DKNA 3U4HA 4WKPA 1JIQA 2VK1A 4EL5A 1FYVA 4BRSA 2F59A 4Z2YA 4AMYA 3QVVA 3A36A 4RPKA 2PLNA 1Z7BA 5HP4A 3FB4A 4C9BA 1YL6A 1H4QA 1PZMA 1YACA 2YL2A 3DXYA 4I50B 5JHHB 2A0YA 2L18A 4KZPA 4HRXA 5I7SA 3UQYS 4V0MA 4BZZA 5JAPA 1EHYA 4TS9A 2JCXA 3RKSA 1XROA 4J0KA 1MX1A 5HK8A 4Y3UA 4WUVA 5LN1A 4RE6A 4XJXA 1FFSA 2D1RA 4JVNA 2VHJA 5BMVB 5IMSA 5CIWA 3RVLA 2VI5A 1WL8A 2R60A 3JQ6A 3M5WA 2DBYA 1U0SY 2AEFA 4GPZA 3QWAA 3I45A 4LJAA 4DZZA 5EKXA 3QHAA 1KAMA 1NVMB 2G9ZA 3AZOA 3LC7O 3MT0A 1F2UB 4U2GA 3ZN2A 4HQNA 2IYQA 2IQ5A 3WSTA 5BV1A 1UPAA 5A7HA 3I1YA 3CN7A 4MGZR 3TQQA 1NULA 4F04A 1P4AA 2V7QD 2OGWA 1C3VA 2AOUB 4YR9A 3FE2A 5DP2A 3ZCPA 4JNCA 4Z0HO 1OLXA 1ZK1A 3FKJA 1UWKA 1JVSA 3CO0S 3CBQA 3GDFA 3SX4A 3CF0A 1UJ5A 3JVUA 3TLJA 4BV2A 1UOPA 1G18A 2ZK7A 2BH2A 1MOZA 2FY8A 3QI2A 3KS9A 4IH1A 4MV3A 1ECGA 1RC1A 1N33B 3E8SA 4LQCA 5EHIA 3HGMA 4FNGA 4Z4FA 3HDJA 3WIVA 1KZ4A 3F7NA 4YRSA 3HKDA 3UA3A 2HGSA 3S99A 4BO3A 2AOTA 1GUAA 4A0SA 3EIUA 2XRFA 1GZUA 1QWOA 3Q3CA 2ODEA 3L5OA 3MWYW 4QUHA 3WLRA 1NP7A 4UZFA 4LCEA 5DLDA 3R9IA 3WKEA 3ZLBA 4FN4A 5C1OA 5CEFA 1VJCA 2ZIXB 4LZNA 4OX9Y 3PD7A 1XLUA 4DREA 4O8CA 3NXKA 3LT0A 2VH1A 5CVEA 1E69A 4DC1A 1TIPA 4BS9A 3P2YA 4AU1A 4B85A 3W6ZA 3K9WA 4HFJA 1SVIA 4WESB 3M7IA 3IAM6 5GM1A 3A3PA 2IHTA 5ABPA 4MUIA 4EHHA 5E2BA 3PG5A 3U19A 4HQ6A 2ZXUA 2E87A 1RHKA 3QVGA 3O4IA 2OV2A 3PNSA 4MI3A 3GLFE 3JAKB 4N0QA 2VT3A 2O0JA 3NRBA 1ZD1A 2FWMX 3L6RA 2R5FA 3U16A 4HNVA 1JG7A 2QRGA 3ZHCA 3PGA1 5ALIA 4LTNA 3CUVA 4US1R 3BZBA 2VJCA 1LK5A 1ZD3A 4FFLA 4FR2A 3C6MA 4US2R 4JJ8A 2QRUA 3KBBA 3NYWA 2OBFA 4OP2A 4QYMA 1QGOA 2HA0A 3VZPA 3T9FA 5KKNB 2CVZA 3OQIA 1YA6A 3JRXA 1T1RA 4B2YA 3AL0C 4D8XA 1U3WA 2UZIR 3IIIA 3LZCA 2J46A 2R1TA 3OVMA 3ZDRA 3B78A 5TLSA 3QQPA 2UZ3A 5CH5A 1PJZA 1QKJA 1EAMA 2IYOA 3H9EO 3JTEA 2VBIA 3P8ZA 1RTKA 2XQGA 3PFGA 4YN3A 1QIIA 2B0JA 1RXSA 4G09A 4Y6LA 3PXGA 3H5LA 4DY6A 3P94A 3VR6D 1GAXA 5KAPA 1O0BA 4DIMA 4A8TA 5H3LA 4EBBA 3ORQA 2Z2ZA 2CSXA 2A35A 1P6QA 2JHCA 3GPCA 5AW0A 5JQGF 1NR5A 3BTUA 3G89A 1H5QA 3OQIB 3EW7A 1EP2B 5DZSA 2C7QA 4HD8A 2GZSA 3EPRA 4PCUA 5HBGA 2JK0A 3NBXX 4TS1A 1MC8A 7REQB 3AP3A 5K8VA 2QTTA 1REQB 2HFJA 4FFPA 4K6KA 1JAIA 2C3UA 2NAFA 3BXGA 4M0CA 4WOPA 4M1TA 4RBNA 1XTRA 2EGGA 1FDUA 4PLGA 1C3OB 4QEDA 1OZHA 3Q7RA 1M6VA 3FD8A 1JILA 3FBTA 2D5AA 4PRZA 5EQFA 3S2UA 3W05A 3WL4A 4CM9A 2WLTA 4C2TA 3GJ3A 5HUHA 1AKRA 1I30A 1D6SA 3ABSB 4G8CA 1K68A 2WWXA 4LRSB 2VP4A 4B1FA 1R66A 1NNSA 4D41A 1RM0A 2GUWA 4YONB 4EYEA 2NO0A 2O3TA 3AHGA 3CCCA 5GZ3A 3ECSA 1A8QA 3CYFA 5D5HA 1QHXA 4PV7A 1R4ZA 2FRDA 3PKJA 3X1XA 3WYFA 4F6CA 1C8BA 4KPGA 5EMKA 4BFYA 1YRBA 3H2JA 3RVSA 4H27A 4URXR 1QIJA 3TIGA 4BMDA 4MPDA 3PGMA 1NUUA 1TPYA 2F8LA 2JL1A 2PMWB 2ZIXA 3FPAA 3W2GA 1V41E 5A3SA 3SIPA 1YUNA 2W37A 5ERXA 1KR5A 1MAVA 1QXSA 4V1CB 1CUIA 1KS9A 1KSJA 3M3DA 2Z9DA 4P3PA 3IQIX 4DPLA 4UQOA 5CH3A 3UMJA 3KCQA 2BTOA 3SEAA 1AT1A 1XTKA 3W90A 1P73A 1XZJA 4FVTA 2WLSA 1KJIA 3M89A 4J76A 5FFMA 3ET4A 3I30X 3WYBA 1JXOA 3LYLA 4BMCA 5DXAA 1IBSA 4KW7A 1NLUA 3D59A 5GIOE 3FPCA 4KKVA 3C41J 5IAEA 3TW0A 1O6BA 2WICA 1Y9JA 4RVGA 5EP1A 3L93A 2PD4A 4KSCA 2VNSA 1MA3A 4GMKA 3N2ZB 3VJLA 3IAS1 3WBBA 1NG1A 2ZAGA 1Z83A 1N2GA 3KOOA 4JT4A 4QBTA 3T5CA 4I6GA 5E4TA 4BMOB 3AK4A 1W36C 4OQXA 3I8XA 4G0XA 1T2UA 2C54A 3JPWA 1TYZA 1Y5LA 1XPOA 2J3QA 4LVOA 3D7LA 3IEVA 4AO8A 2PVCA 1T6XA 2XOKD 3IDZA 4D6PA 6AT1A 1YZVA 3UJCA 2NUTB 3V46A 3ETDA 5K4HA 3LVRE 3EW9A 4C78A 3UICA 1BDMA 1REQA 1ZINA 2J67A 3HPRA 4N39A 3T1QA 1GN8A 2F64A 3WLJA 4DV6B 1U31A 3LI2A 4I1RA 2ADFA 2AUNA 1M2KA 1P4HA 1O87A 2LDBA 3AEKA 1BKDR 3BE6A 4LNUB 4M1SA 3D31A 5EKSA 2PUWA 2Q3MA 1XYGA 5GV8A 1QDLB 3D54D 2XV1A 3VPXA 1RC8A 1D7OA 1PR6A 1V48A 1Z39A 3GNQA 1DMSA 3U9SA 4TL9A 1HGXA 5FLYA 4D4MA 1GL3A 3BFKA 2NTNA 5JYCA 3EVBA 1R5NA 2JKVA 1F1JA 2ZVQX 4IYJA 3ENVA 1IXYA 3D0QA 3OE7D 1YQEA 1Z4IA 1ZVQA 3WYCA 4PGMA 4EX6A 1TZKA 3ZOKA 4CT0A 4N48A 3FNEA 2ZP1A 2RHBA 1RQNA 4K6GA 4QBHA 3LXRA 3NAQA 1HZZA 4N65A 1SY7A 4DRYA 4I9HA 1TPZA 1Y1KE 3DDWA 5LP1A 1VJTA 3ZV6A 3JWIA 4BCCA 2XKKA 2HZBA 4AUEA 1QUEA 4CKBA 5ES4B 1S2DA 2XE8A 4C89A 2I91A 1QH8A 3KOXA 4M1ZA 4D9HA 4MA0A 5B7NA 5DYGA 5KNCD 2C5GA 1T29A 4V3BA 3E15A 3BC1A 3OJ0A 4DLNA 3QKSB 3IODA 1T0PA 2KYRA 1MX5A 3PBKA 2XECA 3ZC3A 4ZQFA 4DA0A 1JDNA 2Q2VA 1NDQA 2EFDB 3GRAA 3GXBA 3L4EA 2RHTA 3KAJA 1OXBB 3T9BA 4MV0A 4RPGA 1VHDA 2N0SA 4JD5A 4J7XA 1MJFA 5E9AA 5EHXA 4FK8A 1WJGA 4ADSG 4Z49A 5CT8A 4DS3A 3BIWA 1Z82A 2IX9A 5KJEA 821PA 2O48X 1JIUA 2AJTA 5F51A 2YYYA 3QFRA 4MS3A 4C5CA 1Y5RA 4URZR 4GBMA 3B3FA 4B6GA 5IF9A 3HJNA 5B36A 4FCVA 4G25A 3NHRA 1I7LA 1T2VA 4N3CA 1ZJWA 1WDLA 5KYUA 1L7VC 1YNSA 1YAHA 1Y4ZA 2QRVB 4X3CA 3R4CA 5FPHA 1T2AA 1RM3A 2YFKA 1BHJA 3O1IC 3BB4A 5F64A 4YDRA 2AQIA 1E0DA 2BKXA 3GQVA 3DC2A 5JCOA 5BWMA 2JFBA 4ZOLB 5JH7A 3LUJA 1IJBA 3BMNA 1SXJB 2SKEA 3AERA 4TUYA 5I8ZA 3T15A 1UJ6A 5CYPA 3W8NA 2ZU0C 4BFWA 2JF0A 1PYDA 3WK5A 1IMJA 4GI1A 1OTYA 1MJGA 1YCGA 2ZU6A 4RK5A 4U7TB 2A58A 1O8BA 4GYKA 2BUBA 1T26A 2ZT7A 3R5FA 4GXNA 3ZLJA 3T9AA 1L4HA 4MQEB 2OHFA 2G72A 5DHUA 4XWGA 4GHWA 4BO9A 2FR8A 1QFSA 2AIRA 2CFSA 2CNWA 1CUJA 1WD5A 2OGSA 2WHPA 3QVUA 4IX9A 2AKYA 4NPHA 5D84A 1TFRA 1J2UA 3GJ5A 4UMEA 3I72A 3IBYA 3NC1C 3ZBUA 3QPAA 2UYOA 3P5SA 1AQNA 4I9NA 5F9HA 5JC8A 3PUIA 4PGAA 3L7CA 4RH1A 2CHEA 3TEMA 2EBFX 2XIJA 3RT1A 4I14A 4K9QA 1XUOA 2DHCA 3LFTA 5KTSA 1XVUA 1ZH2A 3RFTA 3WWCA 3JW8A 3V80A 2IEBA 1YU6A 2WC1A 4AO6A 1A9PA 2XYPA 3C3MA 3N1UA 5A6SA 2WIKA 2FFRA 1QB8A 1CR0A 2UZ0A 1P2BA 4KGXA 3QTBA 2CNKA 4CEJB 3EAQA 5AVOA 3AB3A 2I4NA 2OZLA 4XIFA 2QVCA 4G26A 1OC4A 1S96A 2BF7A 2LD4A 3K6SA 1YC2A 1PK9A 2FI1A 4YV7A 4KN6A 3H6GA 1ZN2A 3BHNA 3AI1A 5EFOA 3U3XA 1EWQA 3KT0A 4IZIA 2PUJA 3HCCA 4M1YA 3FYUC 3A9CA 4M1QA 3ZHXA 2J6IA 3UJ7A 2JLBA 3WLNA 4BZWA 4EMBA 1FYFA 1Z0ZA 2CY0A 4PAQA 3MTDA 3FDZB 3ZZ0A 4FLEA 3E48A 3A4VA 3CWZA 4PPFA 2IX3A 2WJ3A 3LKZA 3KVVA 4PG8A 4ZEMA 1XA0A 3FWPA 2ZTHA 1QYRA 3A04A 3I12A 3K6JA 5B6IA 3R0VA 1PKXA 4ZTUB 3RH0A 3JASB 1HMPA 3TAHA 4J0DA 4IIEA 4WOKA 3RS8A 4IHJB 5CD9A 3ZY2A 5J3JA 4IJKA 1GSAA 2JK1A 2B82A 2NUPA 3BTSA 3ESQA 4XASA 4CFZA 3CEMA 2QDKA 1Y8RA 4DCUA 4U0KA 4E13A 4GDFA 1I1OA 1D4AA 1W2WB 2JHAA 1NRXA 2IGBA 3D3KA 5IT4A 4MRMA 3EVCA 1WCIB 2WPDA 5BN4A 1NYRA 2BHNA 4A2WA 2HIGA 3L1UA 3UPTA 2R6JA 5KWJA 2H57A 2E48A 1OLSB 4IV0A 5KUTA 1HNZB 1K5GA 3EG9B 5SYAA 9ABPA 1JI0A 3DEYX 5JANA 3ONNA 1U7XA 4YP6A 1XWWA 3TQCA 2PBRA 5FL7D 1UKYA 3FXAA 1E60A 1JG3A 5JSHA 3NCTA 2Y05A 3VGJA 5EQJB 1YZTA 1MEJA 1T8TA 3DFMA 3C3JA 1KBZA 1II9A 4Y98A 3RJMA 3SS9X 1YL5A 2YV2A 1IG3A 1J07A 2R751 2VDJA 2VVTA 2WMOB 3BMQA 3CLSD 2J6BA 2H59A 2PUTA 4E7OA 2AUTA 3PLNA 2P8SA 3F4LA 4E2FA 2OD7A 2OGUA 3PI6A 1DX9A 2HRZA 3A4IA 3K73O 4X20A 3WK9A 3C7DB 3FWHA 5CIQA 1WPRA 4XVRA 3QW2A 2ETVA 1U6IA 3EHEA 4RFSA 1C80A 4TXHA 4EGFA 1ZISA 3K32A 4H2DA 4LHSA 2JKYA 4YCBA 5FKJA 1RJ9A 4RZQA 3ZQ4A 2ZSBA 3ZWYA 4B7UA 4LRQA 3GPLA 4GUAA 2Q3JA 4BNDA 1CQWA 2WJWA 3WLEA 4D45A 1PK7A 5JNLA 1N8NA 5EJEA 2O8EA 4LMAA 5DM60 3DDSA 4NJEB 1Z18A 3VH3A 1G1MA 2RGYA 2WE8A 5IUJC 1X0XA 4EVQA 3RQIA 5IF3A 5LQMA 1Z0SA 5L51A 3ZEIA 4C2BA 1TYBE 1T4CA 3GPIA 1KKUA 2IEIA 4AJKA 3R0JA 1K6EA 4G2NA 4PHHA 2H2IA 4QU9A 4EHAA 1BX0A 3DT9A 5CGQB 1KEPA 1A96A 2IIBA 3RIGA 3WA6A 4CKEB 1F7UA 5BMVF 4L1KA 1XZDA 4XOUA 5DYTA 4DQLA 4HH0A 4OO3A 3PEVA 3MJ4A 4ZMSA 3P2JA 3FSJX 4AVYA 3ZK9A 4MWZA 1GKIA 3K4HA 3LU1A 4O1HA 5LLTA 2PUVA 1NWCA 1OOEA 1TK9A 3GUYA 3O94A 1QTQA 4CKXA 4RSHA 1DGQA 1AE1A 4I8IA 4CEHA 4FXOA 4F71A 1ZW1A 3P9KA 3SC2B 4WXYB 3MUNA 3G0HA 2GCIA 1CHDA 4LYYA 2BSAA 4L5CA 4DIBA 3U3DA 1ZOPA 2FP4B 1L7PA 3M2TA 3OUUA 3VU9B 5J40A 5A9RA 1M2EA 1U65A 1MUUA 3PC6A 4QX6A 1UOEA 1E79A 2DUJA 2GA8A 3I8OA 3KJFA 4Y6OA 4B6QA 4EKYA 4R16A 1QX3A 3A4NA 2DC1A 1M2FA 1JMVA 2KB0A 4X24A 3SAJA 4DQKA 3INNA 1JHQA 1ZUNA 3FMPB 2YUTA 1FL9A 3BG5A 2JFOA 3DEKA 4HQFA 3LCVB 1ANKA 4Q0MA 5D6NA 4YUXA 1BW9A 1I9CA 3EGVA 4K6CA 4G6ZA 3IKTA 2J0UB 3JRWA 4NZMA 4TLLB 4WGFA 2XADA 5E1BA 5IBCA 4CQMD 3H2IA 5JYBA 2BM8A 1V8FA 4MAAA 4M7OA 2PH7A 3VU9A 3WBFA 3CRW1 1Z5GA 1BHQ1 3VDNB 4EGJA 5JSZB 1Y1PA 3VNSA 4OJKA 3L8HA 4QOGA 3PYMA 1GEGA 2WM8A 3KEOA 3KNZA 3R7WB 5H3HA 1TVKA 4MUYA 2AN4A 2ZSEA 3QWHA 3T3EA 3CGWA 5AR1A 1Z45A 1A8HA 4GEGA 4OU4A 4XUDA 4EVRA 2JDID 4MV7A 2C4UA 3WGMA 1FNSA 1GG9A 1K88A 1KJJA 3DVQX 4MB2A 2GRUA 4OB6A 4UD2A 5EGNA 1KI6A 1Y8QB 2MMGA 4E2XA 3TZHA 2BZ1A 2P7IA 1H8ED 4RHYA 4W7SA 4DBLE 1LDMA 2OXEA 4NFHA 4P86A 2NVOA 4LF4B 3D3EA 2H07A 3OT1B 1CUWA 1SXQA 3OJLA 4UM9D 4LFBB 5JCZA 3I92A 4CLRB 1SCBA 2HSEA 3DTVA 1SZCA 2H1FA 2WJPA 2ZSKA 1EGVB 3T52A 4ALKA 2YRXA 1Q7EA 1Q17A 2Z4SA 5FADA 2RGDA 4KXFB 3T7SA 1I24A 1W5SA 5CBPB 3RSHA 4DR1B 1A9TA 3D1JA 1OI3A 2F00A 3RRNA 3NRCA 3UG6A 2ZB7A 1UUFA 4BNDB 2V7BA 3NR2A 1N7JA 1U2GC 2P6PA 2PO5A 4QPNA 5J2TB 1WB5A 2VAVA 3WNVA 2HWKA 3IBFA 3MPOA 4YDQA 1AQLA 3VPSA 1MPTA 3DOFA 4GFDA 4C5BA 3B13B 2O8FA 1PR3A 1W44A 1X7YB 3C85A 5AVKA 3E1KA 3BWDD 1G5RA 1LFDB 4CMEA 5BXQC 3ZD6A 1XFAA 4IZ6A 4ZALA 5GONB 1I6MA 5L45A 2QXTA 4WY5A 1FF9A 4K9MA 1U5AA 2Z83A 1ZOSA 1JQBA 1DL5A 1GQFA 1FXWF 3BK7A 2YVQA 1JQ3A 1I0LA 4JGGA 3VOAA 4ENWA 1D1PA 1NXOA 3JX9A 4MMYB 4RYLA 3LUDA 1U1CA 3E9NA 3FW1A 3QF7A 4AO7A 4BGEA 5A05A 3W34A 4QUJA 1Z5UA 1M0WA 1YS6A 2QNIA 4HB4A 4MH0R 2AT1A 3BL8A 3Q12A 3R7AA 5KX5F 3OZXA 4JIGA 4KO1S 2B9EA 4Y7CA 1YJBA 4IXMA 5KOJA 4IGEA 4KIGA 3AUTA 1W88B 4OP1A 4PC2A 1KFBB 4PBTA 4PHGA 1OJ7A 3HUFA 2IU6A 1XEWY 4LYHA 3L0DA 2EHDA 3O26A 4MIYA 3HCAA 5FYDA 1RXVA 4JYBA 3KZOA 4GF5A 1R0LA 3G8BA 4JJEA 4RQAA 3HDTA 4AN1A 4AJEA 2QROA 3GP3A 5L4SA 1W46A 4KWIA 2DQKA 2PZEA 2DSTA 4OL0A 1R2QA 4YAIA 5LBUA 1E20A 5B64A 1ELOA 2HKIA 3GFGA 3LMKA 3RSFA 4KR3A 1JPVA 2B8EA 5FNVA 4EQ6A 1ODFA 4Q9DA 2V7EA 4PLYA 2FW6A 4YRRA 2VP5A 2HL6A 2IHYA 4UQLA 4RKFA 2UVPB 4DJDC 2ZRCA 3FUWA 3S5JA 1QQ6A 3CZRA 5AM3A 4KHZA 2G76A 2WTXA 5LBIA 3TW8B 1OH5A 1ESEA 3R44A 5BT8A 3QE9Y 4CMIA 2YFHA 3HWRA 5LCXA 3D2LA 4UNSA 1TYEB 1UAYA 4AUNA 3B1KA 4GZMA 3SKXA 1N9GA 2A1UA 2CGEA 3AYXB 3G2JA 4NKRA 5BW6B 2WY2D 2ZPTX 1C8KA 3CZCA 1EUDB 4Y2YA 4EG8A 4EY6A 2FF7A 3VAYA 721PA 2P3QA 1HQKA 3O84A 2EFHB 1FXWA 3DDUA 2O2CA 1R9NA 1IIBA 3ICWA 4MW7A 2DJIA 1SCUB 2I22A 3FTPA 2XAUA 3R3WA 4GIBA 1GTVA 4HH3C 4TMFA 5FWDA 5CAEB 1A9YA 4DA6A 1NYLA 5F23A 1UC8A 3IVXA 3Q7QA 3W9SA 1WMBA 2QYOA 1UJCA 2ZUDA 1BKSB 3KTAA 5C51B 4BE7B 4QQRA 1SXJC 1ULUA 3ZH9B 1Z7WA 4REMA 4BV9A 4DVJA 3G2KA 1Y1SA 4BWVA 2V6FA 1Z68A 1E3MA 4YI5A 1D1SA 2PSDA 4WE3A 1RD4A 2CMKA 2AN9A 2BGTA 3AVQA 3ZDFA 1CE8B 3PPIA 2W00A 5HOEA 1G3IA 5D6OA 2Q5CA 4YRJA 4KPUA 2ANCA 3G8YA 5EXXA 4ZCLA 1HDRA 3OETA 3TR6A 2IXFA 1I4LD 2BGMA 4J94A 1ONBA 3U7JA 4YAOA 5I01A 1B8UA 1G8PA 1T3TA 3IPYA 3AUYA 2B0CA 3FIUA 4G9BA 5FNVF 5LIPA 4U2KA 1KEKA 4S1VA 2Q3FA 1CJTC 1RHUA 3OIVA 3V4SA 2IWHA 1XEWX 4K6HA 1TKCA 3KJIA 3ICQB 1NFFA 5LFAA 1FTQA 1QYDA 2UXCB 3FYUB 2Y77A 3CFYA 2CE7A 1LNZA 2GCPA 4KU4A 4OQLA 2C5EA 3WDSA 1D4ZA 1W47A 1OX5A 2VF8A 4PX3A 1IBKB 4WOCA 2R7AA 2Y71A 4RTRA 5CDGA 3LTEA 3V4RA 1QTIA 1XTQA 2H2WA 4G5FA 1IUNA 2EFYA 2JGFA 4XB6B 5TXGA 2B8TA 4J16A 5ELMA 1W85B 1EDBA 4COOA 3W9YA 1NW6A 1BXRA 2HCFA 2P69A 1EFKA 1QP0A 1JHOA 3KKNA 3KPUA 5TJHA 4R6WA 3RVJA 4KQXA 4F91B 4RTSA 1E0JA 1E2IA 2PMCA 3V34A 1W19A 1OSNA 2PVPA 5A4DA 4KO4S 4DSAA 1H4VB 2GPNA 2ZE8A 4OK6A 2RJ3A 1JKIA 2WJJA 4DPKA 1GPKA 1Y7PA 1V26A 1STOA 2EQBA 2Q1UA 2RGWA 3DP9A 3J7TA 1QM5A 5CJJA 1XF1A 3E9YA 3R9KA 4CJXA 1C41A 4WOBA 4OPMA 2HRCA 4WXMA 3QKSA 1PO7A 1QGDA 5LVAA 2PUBA 2J6CA 1LBSA 1KC3A 1W2GA 3INYA 4WJKB 3I04A 5J2UF 3TE6A 1XKLA 5CLLA 1XRQA 1TAHA 1XCJA 2PLAA 2ZVPX 4RCZA 4HAZA 4WCFB 4QU0A 4OMCA 3UFXA 4OREX 4EY4A 2WV9A 3HS3A 1K6JA 1E32A 1NFQA 1YV9A 2YDYA 1D03A 3PF8A 4KN8A 1AB5A 5DLPA 2PYIA 2WVJA 4GEKA 1GPMA 1QMPA 2XMPA 1M8GA 1ZW6A 3MTBA 4IV5A 4MO9A 3G3EA 2AG6A 2PANA 1CDDA 4RFVA 4A03A 1UDRA 1I32A 3T7CA 3UMCA 3K71B 2HPZA 1TQHA 2R7LA 5KYTA 1WMFA 2BRUC 3FYDA 5B2ZA 3VUEA 3X44A 1HF3A 1DQRA 1Q11A 1Z8DA 1ULSA 3CF4G 4KUGA 1N4DA 2VDRB 4GBGA 2O07A 1IN8A 1JL3A 2AKEA 1WZUA 4C4XA 1ONNA 1Z34A 2VK8A 2HHHB 1Y3BE 3C0KA 3T6KA 1HDEA 3O4JA 1L7OA 3MJDA 4CPDA 4PINA 1OJLA 5GTDA 2DH6A 4Y0VA 5KTNA 1VXRA 1IBRA 3CNLA 2PGJA 3GB9A 1X8KA 4AWBA 4ENVA 5SZHB 4GMGA 2C20A 5H4GA 1V3VA 4G86A 3VPBA 3EEBA 1HR0B 2GM5A 5BV2P 1X3LA 5CFZA 2YJ3A 1XRRA 3D5QA 2QX6A 1J0EA 4CM3A 1T5HX 2ZWIA 1E7QA 1NJ6A 2V45A 3NHFA 1HH4A 2WIDA 1R18A 4G63A 4PGHA 3QE4A 3VJMA 4CIXA 4DWVA 3D3WB 3U4GA 2LIPA 4MW2A 2ZSJA 3QV1A 5ALVA 4K3VA 5ENDA 5JD5A 1PNTA 1RYHA 2WAAA 4JI0B 1YE3A 1M2OB 2NXEA 3WGNA 3KKKA 3EXG1 5LC1A 2W70A 3PXBA 1XWFA 3U4AA 5IX8A 5J2UA 3VBCA 5HE9A 2PT7A 1QHIA 3KDSE 2A59A 3B7GA 3FUXA 4R1MA 4P36A 4WERA 5BWCA 1NKSA 2BFAA 1L4MA 1KSFX 2Q6IA 4NE7A 4MV5A 4TKLA 2Y0EA 3R5SA 4JBYA 4P92A 4BJ5A 3F73A 5D51S 3CRRA 2JRCA 1VQ1A 4NX2A 4BHTA 3A6GA 4Z8YA 2HF2A 3MWFA 1CP2A 3BXHA 3IAM1 1QK5A 3CNNA 4ZCPA 3V97A 3VTKA 1PZGA 2R2AA 1HRDA 3URMA 4PX2A 2IE8A 3ANYB 5CDFA 4CUJA 5CFLA 3JWEA 4LJ8A 2XUFA 2ILVA 2I6QA 2VDLB 4LDPA 4GP6A 4BEWA 4X1IB 5TQ2B 3IALA 3NGLA 4F12A 3K94A 5DW0A 4E1VA 2AMFA 1E2QA 3FPFA 5EINA 4BUZA 5AJZA 4E5SA 3KD3A 4N5HX 1PS9A 4TYYA 3SOPA 1ZR2A 1KFJB 1MVLA 4D0RA 3UH1A 3LWNA 5IBRA 4LIPD 1XA4A 4PC1A 4YRCA 1U8XX 1KMNA 1TTQB 1AJEA 3TM4A 5AUOB 4HLCA 1PVDA 1N5OX 1L9XA 3BKWA 3DE4X 2F8MA 4IL5A 4QD3A 5FPPA 3R3HA 4ZD6A 1K2WA 4XARA 2B34A 4R9VA 1MABA 3PVZA 2J85A 2OQRA 3LY7A 3WQQA 9LDTA 3ITEA 1UBSB 3CLKA 2YASA 4KQHA 3HU3A 2QGZA 4HX5A 4RK7A 1GGJA 3EC7A 3QEBZ 1G1AA 3BMCA 4DDTA 3LJKA 1Y6ZA 1NQWA 4JB2A 1T4BA 3C8DA 3ZIAD 4CW7A 2ZS7A 2QL7A 4M99A 4HFMA 4BUJA 3NNDA 1HKHA 1E5VA 1QQTA 4FYIA 4GSKA 3VO8A 3G02A 1TUBB 3D81A 4BX0A 5KNBA 1YRYE 1RKXA 3NQ41 2B4QA 1T8PA 4Q6WA 1I8TA 2WTBA 4D9GA 5AD1A 4LE1A 1N36B 1B16A 5H82A 3TYXA 2COKA 3UHJA 1GZ5A 3QX7A 1Y3CE 3CNQS 4WW0A 4ZCIA 2X4LA 3L06A 3ERCA 4LSZA 4KXVA 1AGYA 2A9VA 4OLHA 2BHLA 1A9RA 1HE1C 1IB6A 1V6AA 3MS2A 1DRKA 4KFSA 2REBA 3NIFB 4U3JA 1U02A 2JI6A 2UV8A 4ISCA 1JLRA 4TL6A 1T0UA 1YDMA 3ABIA 4GPEA 3OMXA 3WOHA 3I01M 1NRIA 2I29A 3RTAA 4OA8A 4YO7A 1I3KA 3B36A 3K15A 1XBTA 5G1NA 3MD0A 2QY9A 4MIKA 2JAUA 3ETJA 5KWEA 1US8B 1T8RA 2GF9A 4LW8A 4C7JA 1YWGO 1ECBA 2A7XA 5HTKA 2QN8A 2Q3CA 3C8MA 4PLWA 1FSGA 2GR9A 4NU5A 5C3MA 2HBYA 1VG1A 4BQIA 4QQNA 3R8XA 2JFUA 2NX2A 3ZWOA 2BUAA 3FCXA 1E9VA 3L1HA 2YYAA 2LXNA 3BRWA 1FK8A 2GKOA 1WXHA 4J0FA 5C8XA 3R41A 3UC9A 3RADC 1P60A 1GYPA 2HMTA 3VC1A 2HFKA 1FFYA 3G2QA 3IP8A 1RRVA 1U8EA 1DKMA 1R27A 2P7HA 4HQLA 4TLMB 4WI1A 5DLEA 2NADA 5T57A 3RSOA 2ZRFA 4I08A 1KXJA 1WY7A 2CBXA 2RDMA 1CZUA 3K9CA 4ZAFA 3S2GA 1XNGA 1JEDA 2ZRMA 4L9WA 1Z6AA 1DX4A 3SYTA 4JB0A 5JAIA 3GFRA 4FGLA 4JBLA 1T9AA 1QFZA 1U7WA 4IIXA 4LXGA 2R87A 4B6RA 1LV8A 1DC7A 5TPZA 1LLCA 2IYZA 2PKQP 2MSWA 2VNKA 3P2OA 1TZ2A 2CJWA 3UKDA 1LQUA 5FX2A 1DQPA 1DG3A 3FOZA 1O9GA 3UZUA 4EJSA 4EG7A 5BORA 4BN0A 1ID8A 4DCPA 2Q5OA 5BN3A 3RUEA 4RXUA 4MCIA 3ZJUA 4G1CA 5CBKA 4GH5A 4MGEA 1GTG1 3DMDA 1A5BB 4IDGA 1RU3A 1L5LA 3WDKA 3CT6A 4M0DA 1GFIA 2CJYA 1T4GA 4EFLA 1DJPA 2ZQYA 1M66A 4WNCA 1FP6A 2RGNC 2JLQA 2IHUA 3P9PA 5EWJB 2X2OA 3VZQA 4RA6A 3W4IA 1ZMRA 3AVYA 1PE0A 1CK4A 1W52X 2O5RA 2J5BA 1C0KA 3K96A 2V7GA 1Q6ZA 4U9IS 1KK2A 4DKXA 2HT6A 1KU0A 5DSZA 2C2XA 1EZ1A 2CEAA 4S0ZA 4P9NA 1G8YA 4C7VA 5LZ2A 2D54A 1UWVA 2ASEA 2WR8A 1JXMA 3IQHX 2WWWA 1YB2A 1GEEA 2P4UA 1KMHA 1VL2A 3C14C 3LV8A 3MLBA 5T4HA 3ZCRA 2H3HA 4OBEA 4Y9DA 1B6SA 3DZDA 1RLUA 1EVLA 1X42A 2XWQA 2NVBA 3I2YX 3FKQA 3QE2A 4L8WB 4LQ4A 5EXSA 5IBQA 4IHJA 2OBMA 1OH8A 2AFRA 3DVLA 1D5CA 2VAMA 3PD0A 5P21A 1ZHOA 3TOSA 5T4FA 3TG2A 2HJVA 4WDRA 3TDKA 4NV0A 4FONA 1ZRHA 4O59O 5F9MA 4R05A 4DFDA 3G68A 3FZQA 2A9FA 1JEEA 3OM0A 4Q9NA 3T4UA 3ZE7A 5I9LA 3OOHA 2EKDA 1T4CB 2OV4A 3TZ6A 4EI7A 2PGNA 2NSLA 3LY8A 3OIDA 3LPLA 1G8HA 3QFTA 3K1AA 3COVA 4H3SA 3ZS9A 2RH5A 1F2DA 3VR4D 4BTVA 4QUBA 3ZUGA 3ZGYA 2CT8A 3K6SB 3DULA 3EZ6A 3I53A 2FWRA 3F8WA 7ADHA 1U2DA 1XCGB 2HBRA 5HBRA 4GR9A 5TF4A 4ARZB 3C3KA 5A3RA 3UWKA 1V7PC 4XQ9A 3KV3O 1L8QA 2BZSA 3EISA 4I4NA 1PHRA 3TTVA 5JBIA 4AG5A 4IIHA 1WG8A 3CF4A 1IK4A 2O2JA 3DE2X 5FBKA 1Y3DE 1QGED 1KEZA 3A9TA 3IMGA 1GA4A 3P71T 1GCOA 1R0BA 2NXNA 4IKOA 4ZC1A 2BVNA 4PFSA 5KI6A 3D0RA 4U1RA 1S8NA 3ROMA 2QLTA 4V1CI 3DBHA 1A7KA 3OPNA 4RJJA 3IIJA 3A9VA 2W2VA 1QPBA 5IDWA 1QCDA 1VSUA 3AR4A 3DMHA 2H9YA 4JZKA 1FP1D 1C2TA 1YA4A 4BN5A 3DKRA 8ATCA 4N4AA 2Y99A 4H0CA 4DUGD 2DPMA 2SCUB 4HZGA 2Y4NA 1YF3A 5KJ6A 4RPLA 3KQWA 5YASA 2DKFA 2ZS9A 2ICAA 1OW3B 2XB4A 2O8EB 2PEYA 4G65A 3ND8A 5BPHA 4A9AA 5B4VA 4QLOA 4AAYA 1ORTA 5TEVA 1E9FA 4AULA 4ZARA 5J4HA 4BVHA 2JNWA 3VHLB 2QVXX 4AC9A 4LVNA 4DEYA 2XY4A 5JZVA 1NXXA 4LHWA 2JARA 4MP8A 3R8FA 2AN1A 5JWOA 3MWLA 2V59A 5HM6A 2YNMA 3CZAA 1C5KA 1DQZA 2GJ4A 3U37A 2WJZB 3QJYA 3GV0A 4EIWA 5JXJA 3DQZA 4RZHA 2DY1A 2HDWA 2JB9A 3JQCA 2O54A 2AG1A 3ELDA 1JDJA 2VJQA 3IR6A 1NBMD 1NVBA 3TXXA 4M7WA 4FGZA 3VXKA 3OQ6A 2PKWA 2PQ6A 2R66A 1X7WB 4G4GA 1AC5A 2E4VA 1L7MA 5ADWA 1T3HA 4QA9A 1EXMA 1PW5A 4QICA 2HDHA 4K40A 4KYTA 1FTGA 1H2FA 2B8WA 2QU8A 5ESXA 2QZZA 1T0BA 3KSDO 4F5DA 2ODNA 5A02A 4MUBA 2V3WA 1QF7A 3TNJA 2P9EA 1JEQB 1OLUA 1ZXBA 1G5QA 2ZRBA 4KFUA 3UAXA 2PY6A 3ZU2A 1H8HA 1NN0A 3IEIA 2HPVA 4W6ZA 1CZHA 1DEKA 2FPOA 2ATCA 1YZ3A 3KWLA 4N9QA 1LCIA 2WU0A 4DARA 4C7OB 4TYPA 3P9RA 3RJTA 3VBEA 5THKA 4YP7A 5JY6A 5DTMA 5C3UA 2RE8A 2AQ8A 3JATA 3F6EX 1OB2A 1S3FA 2Q8PA 1TRKA 1JLLB 1ZZEA 4FMDB 4RY2A 3WHKA 4MVJG 3VX4A 5AJHA 1EWVA 1NVAA 2ZSIA 3DVSX 4LYJA 2DMRA 3JZAA 3QWIA 3KVOA 1Z8HA 1BEZA 4Y9UA 1ML4A 4ZOLF 4OQZA 3V7NA 2CLCX 5HSGA 2QLLA 3DNFA 1O95D 1Z08A 5DNVA 4FDMA 2VDMB 1ICIA 2RGNA 2REQB 1ECJA 1NW9B 1H6DA 2A9JA 2P8JA 4NMWA 5ALLA 3UWSA 5DOZA 1GUDA 2ZYRA 3BXZA 3GGOA 3UENA 5DRTA 4IIJB 2QMEA 4TXJA 1ZZGA 3CLRC 4MQ6A 4QBKA 4LFCB 3WA7A 2K7FA 1I5OA 3JVDA 2YC2C 1NF9A 3DZFA 3Q41A 4R2MA 1YFLA 4H16A 3KZMA 3PSHA 1GQOA 1GFWA 2JD0A 1A2BA 1CEXA 1SZJG 2B35A 2LBPA 2WHPB 3DNPA 3C4QA 1M2GA 2BFPA 2EIHA 3AP2A 4HK4A 4ED9A 5IASA 1LNSA 4JLAA 4ML3A 4EF5A 1GV0A 2X15A 2W6CX 4Z7QB 3FNGA 4YLEA 1J0DA 1JE1A 1FYEA 2FSFA 3MD9A 5JZBA 4JP1A 3QPBA 4ZOCA 3PT5A 3AFHA 1VPVA 2VP6A 4HF7A 4J6FA 2J3EA 1UZMA 4QO8A 2TSYB 4U0JA 2IELA 3BK1A 3OJFA 2A5GA 3OSZA 3PUKA 4IIJA 3SC4A 3VC3A 2ZRGA 5MGNA 5DNEA 3IOEA 1AF4A 1YB7A 2IF0A 2IZOA 1I3NA 3LBYA 3ZK7A 3W06A 1UOOA 5HR5A 5A7GA 4O3FA 4EHKA 4QGGA 5HF8A 2QORA 1MAHA 3NAZA 5F77A 2HW8A 3INGA 1GL9B 4QQ8A 1F9EA 1LF5A 4FQ8A 4ND8A 4OX9B 4YPVA 1I7SB 1VCNA 2VQDA 5GJVC 1HLDA 1VXOA 3ED1A 1XTPA 5CDTA 3LLVA 1T3LA 3K8YA 3BRSA 2V9PA 2Q4OA 3OHPA 3HO1A 2WZCA 3DMYA 4HDSB 2ZATA 5E9QA 3WY9A 4QASA 3CKLA 1QRDA 3NJ8A 3TQIA 2XRMA 2A5DA 2C9YA 4IFTA 3ZXUB 1P1IA 1ZONA 5HILA 3N3BC 4D98A 4YCCA 1V7QA 1X1BA 1HSZA 1YUBA 3BT7A 4V2UA 5IVPA 2SKCA 1SUWA 2XWPA 3ICOA 4L07A 1W5AA 4BX3A 4PPYA 4R9NA 3C98A 4W4TA 3RVDA 2ETXA 3ROKA 4Q82A 4H3KB 2QTCA 2FK8A 1MGPA 4HBZA 1JKMA 2PPLA 3B1XA 3EH2A 1N5IA 4IJVA 4PZEA 5DHTA 2H2GA 5FXMA 1TKRA 2VSNA 1EHIA 1V2HE 1AM4D 3KP1A 4G4IA 2W6MA 3QNUA 4X7BA 1ZGCA 1D0IA 1YHNA 3RUDA 3WO1A 1GPAA 2C1XA 2GLUA 4JL6A 2BGNA 4JEUA 1MAUA 4B31A 6ABPA 1RWOA 1H2BA 3MCZA 3PFIA 4WWHA 3NIBA 4YCJA 2FOIA 1NMEA 1LTKA 1A8PA 1Y8ZA 4E32A 1D2MA 2GN0A 4JS0A 5I7AA 5K6TA 4M9ZA 3DHYA 1JWAB 5E6UA 5FLXA 4OQMA 5DM70 2I7XA 3JQ9C 4N40A 4F8EA 1N2XA 3FBGA 2X9QA 3GHHA 1ZC4A 1F0PA 1AUXA 1OFUA 1WXEA 4NF2A 1A50B 4DNOA 3BE5A 2X1HA 4XKJA 1UBMS 5FTNA 3S2IA 4WN9B 3EFBA 3L6UA 4ZT6A 3SVZA 3RS7A 1AS0A 1NUSA 4JQOA 5FH9A 3G0OA 1A97A 3N58A 3G8AA 1WCYA 5KSWB 1NHWA 2OPHA 3DE3X 2RK3A 5IAOA 1FFXB 3B1VA 4ZOEA 2P6OA 3AY0A 3AF4A 4HI0E 5E6RA 5HE8A 4CRWB 3RS3A 4LF8B 1HDGO 3OU6A 1QYIA 3NRJA 4G37A 4KV7A 2HIHA 1BIFA 1Q6YA 2G06A 3QYAA 5KTMA 2OHJA 1CYDA 1HG0A 2J3IA 2R6ZA 3OZSA 4AY5A 1U1EA 4D3YA 3N07A 2RI6A 3NYIA 3SJ7A 3SKVA 2X8AA 2ZR8A 4RQBA 3HZOA 3FPKA 2ZR9A 4X1KB 4EGCB 4RF4A 3H3JA 4EH1A 3SVLA 1EVQA 4B3BA 1PJAA 3LWZA 3TX2A 3A26A 3HXQA 1RP7A 1E2EA 3OICA 2ECOA 1LUAA 3DEFA 3SKYA 3WB9A 1IC6A 4IDQA 3MC1A 1VE3A 1NZFA 4WUTA 2HJWA 2ZIZA 1AKUA 3NOXA 3MGKA 1LJ8A 1V5GA 2A88A 1PUXA 3MYYA 2QVLA 3OZDA 3AF6A 1NONA 3V4OA 4J75A 1I6LA 1RP1A 1J5EB 2TMGA 1TC2A 4P7JA 4MWEA 5LQCA 2ZSDA 1ZUWA 3HBNA 4GLJA 5EZYB 1TF2A 1JSCA 1UBEA 1IEXA 2JGEA 2QN2A 2H1SA 2NZ2A 3ZNOA 4ZN6A 4LJLA 1QE5A 4JYPA 1OMOA 3LQ2A 3HJCA 4W1PA 2DUMA 3AH8A 1YFZA 2KBFA 3LK6A 4LZAA 1VE5A 2QE7D 1SQGA 2IEDA 2D5BA 1OZ0A 5U1PA 2JW5A 2IDJA 1XXHE 3BJRA 4DNQA 2AJDA 1XZLA 4MQFA 4UNIA 5JVDB 3HWX1 2AFIB 1M0SA 2P2DA 2QP4A 2UYCA 2BI4A 3BYZA 4BLPA 1D3AA 3BCHA 3VYRB 4ZI7F 5JR3A 2PXXA 3P2MA 3BIOA 4C7XA 4IDEA 3CR7A 3U1BA 1CF4A 2PQ0A 5K4AA 3JV7A 5ALOA 3RTGA 4MB6A 3U60B 4LGCA 2PXHA 4C6TB 1KZ6A 2FUCA 3D6JA 4HDMA 3KDPA 4EUHA 4OKIA 2FG7C 5F7JA 5B30A 1TTTA 3O4HA 1M74A 3DVAA 5B58T 4P4TA 1C3OA 2EJVA 1NT2A 3KOWA 1TJYA 2HLDA 4JZYA 5AI9A 1LB1B 1UOQA 2WOJA 3H1PA 2H5JA 1L5KA 3R9WA 3CINA 4WK2B 3VV3A 3ZGZA 4BMYA 3S1SA 3FVVA 3F6BX 2JJ8A 3IDQA 3S4YA 1ENYA 3K0BA 2CDAA 1YR6A 4I2NA 3U26A 3ZXSA 4PG6A 4ZGWA 1BDBA 3GEEA 3ZYCA 4C2AA 3NTRA 5EJFA 5ALSA 1TMKA 5JD6A 1D6NA 1SHLA 4YRTA 3THSA 2VHQA 4ZO9A 2E18A 4FC6A 4S1OA 4X44A 1K0FA 1KI9A 2WHRA 2M2IA 3M49A 1CUCA 4G56A 4IWXA 1SK9A 2AI3A 2WF8A 1IY2A 4B3CA 4MUAA 1U0LA 2YRWA 5A5VA 1JGTA 1SBZA 2XE6A 1L4KA 5LWQA 2EKZA 4FB5A 2I9KA 4BGVA 5HYVA 1AMNA 3QBVA 3B3GA 2B5VA 3R5TA 4B3MB 3GN2A 3G0GA 3M6FA 3QXCA 4LZZA 4LXTA 4X63A 3RFCA 1VCIA 1X80B 3AWDA 3GA5A 2XUPA 1DIRA 4ER3A 1OXVA 1XMIA 4PYMA 4F21A 1ZJYA 1XLWA 2CXOA 3OPYB 4NMLA 1P4JA 3D4IA 2HCRA 4TMXA 1PUIA 5K3AA 2VDOB 3UA4A 3OFSA 1G2OA 2OYSA 4IMIB 2PYDA 4KDEA 3UFBA 4F45A 3M4NA 2CHFA 2AMJA 3P2EA 3UJDA 4B34A 1X1RA 2AV6A 2BGIA 1YZKA 2BMDA 2FRXA 2MWMA 3DGEC 4M9QA 4NS1A 2HSJA 5CT5A 4ZQBA 2H1RA 4EI8A 5CB8A 3WGUA 2YFYA 3WLHA 2AB0A 3CB4A 2G4LA 4HRVA 2BRUA 1OHHD 4HNAA 1JIXA 1NN3A 1WUKS 4U4AA 1T0HB 3BGVA 1DTEA 4FDVA 5KX5B 5DNUA 2IP4A 2FCRA 4C22A 5LM3A 5FA6A 1E94E 3B5JA 5C8YA 2QIPA 3ANXA 5LXTF 5BRNA 1GA6A 2Q6KA 1FDWA 4HXGA 1R6XA 2NSJA 3TNFA 2V7TA 1JH8A 4G5XA 3GFFA 4TSRA 4B8WA 1W0JA 4XTCS 3FTCA 1UJBA 4WLVA 1AOXA 3Q7IA 4HEJA 4AY4A 1Y1RA 4E15A 1RYFA 3FTEA 2GZHA 4EW6A 2N9UA 2QM8A 3ME5A 2QN1A 1T2CA 1TQDA 1PQ4A 2VF2A 3F97A 3IUPA 1K8YB 2OCYC 5AVYA 4BFSA 2F1HA 2J9GA 1NC1A 2O3SA 2YXBA 1BCRA 3W8FA 4E6EA 1PV2A 3EULA 5K1ZA 1ISMA 4B44A 1DKLA 2O3RA 3HDQA 3K05A 2V65A 4II7A 4GZ5A 2HUNA 4ERNA 3MTJA 4F85A 5BOSB 2MSKA 2ZBEA 3H1BA 4LE0A 1DQYA 4QSMA 5C5EA 1OFUX 3KT8A 3F5QA 2DPGA 4LSWA 3PEWA 2Y6VA 3KQYA 1YR9A 2XYHA 3MA0A 1Z0UA 4S1TA 1COWA 1VMAA 4H7IA 4ALNA 3P9IA 3G0DA 4PBRA 5ER6A 1JEOA 2OFXA 2QI9C 4R5HA 3SQWA 1IEWA 4FHGA 1KZYC 4R2JA 5CM9C 4LN1A 5A03A 4XGRA 4NATA 4HEHA 5IJWA 4JENA 2O8FB 3G49A 4J4HA 4DE5A 2DCUA 3EUEA 1HE5A 1SAYA 3AIMA 4X91A 3LW8A 4G5RA 4DLXA 5D5PA 4V0ME 2YWJA 4JODA 2EEZA 4B7AA 5FTJA 1L8OA 3WRXA 4A2QA 1U2TA 3W6UA 3ID6C 5BRAA 3E9RA 1J2RA 1GTRA 3UXEA 3HU2A 4KUHA 4AURA 3HNPA 4FINA 2RHRA 1Z5VA 3GCZA 3DYVA 2JAHA 4TQGA 4WK4B 3EIEA 2I87A 5CNKA 4PM4A 1OXKB 1HFWA 4JEIA 3O4GA 5LZ8A 3QBDA 2QTLA 3A58B 5C7YA 2QW1A 1ZJ5A 3OD1A 1TFUA 3GLTA 5LDGA 1PR1A 1TZJA 2Y1CA 2RH9B 4S35A 5ALRA 1AQYA 1U5CA 1P9OA 2QX8A 3CLSC 4ZI7A 1EFLA 3UPDA 1EJ0A 1ZVMA 3LUPA 4NPCA 3T06B 3VSEA 4MIOA 3V7FA 3BL5A 3PUHA 4RMHA 4NCJA 5CNIA 2OV6A 2O3JA 3WSWA 4ER0A 5AUPB 1P7WA 3I32A 4ID9A 5F3RA 5DX0A 5FWYB 3V1UA 4EWLA 4MQFB 4HNUA 2AC2A 2XKJE 4DUZB 4AS2A 2FUKA 2B99A 3V2IA 1FU4A 4AFNA 4B6OA 1Q15A 4YJHA 3ZU5A 4AX8A 4CNBA 2F4NA 4XPIA 4PXYA 4LS3A 2ON6A 5KYNA 1E5TA 4JUDX 1YNOA 4AJ9A 4ZODA 5HEKA 4FOLA 2G0TA 3VTFA 1MO3A 3H5OA 3BULA 2OVBA 2RFLA 5FAXA 4NYMR 3DWIA 1XCLA 3CPHA 3MELA 1VSQA 1SXHA 1HDIA 4WECA 5EMLA 4ZO4A 4BEVA 1TM7E 2V0CA 1G5FA 2XZPA 2J30A 1EFUA 4WEOA 1PNRA 1U94A 4B7ZA 4OFZA 3DBRA 2Q9BA 5TNXA 3WIEA 3PUWA 1ZH0A 2H63A 1GGEA 3TSOA 3ZQ6A 3QMWA 3W79A 3QH4A 4DMFA 1Y6GA 4BNWA 3FFWA 1TL7C 3D02A 1N8SA 2D62A 3I6MA 3MMSA 3BWBA 3D43A 1GNSA 1QCCA 3L8YA 3WLMA 4C07A 1DJMA 3GFVA 1IN4A 1U7UA 3C4VA 1VMIA 2P3SA 4NU0A 1G64A 2BHRA 4X1OA 1IBLB 1JBKA 2GRJA 2HGZA 3HVIA 5KTYA 3DMNA 4EG6A 3ZR4B 1JI3A 1J00A 1VJ1A 5KWVA 4AY6A 3PCTA 1Y4DE 3H83A 5BY2A 4CLOA 4X20B 2GZ3A 2I66A 1JFTA 2QUIA 3SX0A 1HTWA 2Y4OA 1QKIA 3G6WA 4K28A 4M0PA 4UU8A 5EE3A 3VSDA 5KNDD 3IBGA 1UKZA 3BB1A 4TOIA 4MKFA 1E8NA 4YASA 4EMTA 5TMDA 3KLPX 5EJ7A 3EDMA 3GEMA 4F92B 1H9AA 3N0TA 4ZJZA 3LX6A 3RRJA 2HQBA 3ZPXA 2IYUA 1DKQA 4GNKA 3I4LA 4MPJA 1OD6A 1IEVA 1NJFA 2PYZA 4FBMA 5I4BA 1P2UA 2ADOA 3HEAA 3SNKA 4FMDF 3BZUA 4IDFA 1Z75A 3TTXA 4F4CA 3H3XA 5E9JA 4HNSA 4YCSA 3T7RA 4KVGA 1I7PA 1E6LA 4O4IB 4WZZA 1YS1X 3UK1A 4P8RA 1WCIA 2YDXA 2XJ9A 5KC8A 4AIIA 4EF4A 3GGCA 2GTHA 4Y0AA 5KHAA 1A88A 2G25A 3HBAA 3OAAD 1WSAA 1JTVA 5EHZA 5FWNA 1RXWA 2W2LD 3CE9A 4DSTA 1BN6A 1SCIA 2VWHA 4H35A 1H0HA 1WOYA 2ZB4A 1VJ5A 3KU4A 5AM1A 5KKCA 4IIJF 2O1WA 3ROEA 3PLRA 1Z73A 5ALMA 3PICA 4L0MA 3RK0A 3VR4A 3V8BA 3WYAA 3ZQKA 3DZCA 4IJMA 2ZJ7A 4YP9A 3WMEA 1BW9B 3K9FC 3TXAA 4TPKA 1YXMA 2IYSA 1JYFA 1G98A 2C42A 3ILHA 4JL5A 4Z3DA 3OBBA 4EQZA 4Q3NA 5TS3A 1HLPA 1RLOA 1SOVA 2KBEA 3RUCA 1PR4A 5CA0A 4YAUA 2YVUA 4GPD1 2VZLA 1Z6XA 3ASUA 3LPDA 2REXB 2Z09A 4JQCA 2C9CA 5DM4A 1ZCFA 1ORRA 5LZ4A 4EAAA 2YWRA 5JS6A 1WOMA 1KHHA 1UC9A 1XZAA 1F0YA 2H1LA 3HUDA 3CBGA 1V39A 4IZHA 5EIFA 5LP6C 5CFOA 1PR9A 4RAQA 3LO5A 4G1MB 3S2YA 4YPOA 4YJ2B 1SA0B 2JJ1D 3BWVA 3DOHA 3WV4A 2Q7OE 5B3AA 2CBZA 3LBNA 4AWXA 1I2MA 1DB3A 3A9RA 3THWA 2IYTA 3PVSA 5ESWA 4YHBA 5G02A 1VPWA 1XR3A 1ODIA 1YMQA 2PHZA 2YHUA 3HVJA 3PLAE 3CWQA 2QW0X 1PQYA 4FHEA 4EJ6A 2B94A 3V8NA 4ONEA 5K05A 3I9NA 2BZGA 2FSSA 5T6MA 2H08A 1UPTA 2E82A 4CKEA 4RA9A 1MQ9A 4RDXA 1ZCAA 4J7UA 4LC1A 1LLQA 4C3OB 2IH2A 5JT1A 1LWOA 2PTHA 3EFOA 1E8DA 1LPOA 1KZGB 3A4YA 3UGKA 5JARA 1QU3A 1I2BA 3WMWA 1ZMBA 1BA3A 4AQ7A 3RDPA 3B3JA 4MS4B 2OBXA 1FW8A 3HDVA 4OQYA 5EIWA 1S0UA 3EEYA 3GJ6A 3UMVA 2GBFA 1PR2A 3LIPA 1RYZA 1VL1A 2NZWA 1QYXA 2F1KA 3G2IA 5FPTA 2DU8A 2PZMA 4QXPA 2HMYB 2P1RA 2AE2A 4B46A 4DV1B 3MN1A 4XSHA 3O9MA 4FOTA 1E7SA 2BR4A 1DI0A 2R8OA 3TECE 4JEHA 1WHSB 4DOMA 1DJOA 3X1YA 3AIIA 4TS3A 5C1IA 1PYGA 4PS1A 1AHHA 2XD4A 2P79A 1EFRD 1ODSA 3BFXA 4AN0A 2JFNA 2O7RA 4BLSA 1VYTA 5BNWA 4HNRA 3C3CA 1JDSA 4H17A 5F2EA 4BNVA 4YLYA 2UXBB 1AKVA 4QDTA 2PRSA 3WLAA 4YX9A 2IOYA 1UAAA 2ZYUX 4MLPA 1DDGA 4KPYA 3H05A 5EQDA 1ZCJA 2C07A 4EHJA 1OX6A 2FJPA 4LSGA 4ZYYA 3SJCA 1I3LA 4PZ9A 1MP0A 3F96A 4TZ0A 1W88A 4WJLA 4LMRA 1EQ2A 3DMGA 2QSJA 3RK1A 1TQ6A 2GEFA 1SIWA 2O57A 1XO1A 4JMLA 1V95A 1Y34E 1BVYF 1U11A 2R7KA 3RABA 2G07A 1L5FA 1HE3A 5IM4A 3S1LA 4EI2A 5LKRA 4MQMA 1LFAA 2H92A 2O0LA 3OEWA 2FZ5A 1JJ7A 5GM2A 1PQUA 4Q05A 5LA6A 4A6DA 1UT8A 4IGFA 4WVLA 1D2EA 5M7EA 1X2EA 4NBWA 3T3DA 3W3ZB 3A2MA 2H0QA 4DA7A 5HFNA 4XUCA 1L6RA 5IDXA 1WZNA 4PX5A 2VR1A 3SR3A 1FRFS 1E0AA 1WMAA 3NBUA 5AESA 4JJKA 1LC3A 5AKKA 3VPAA 1LBHA 1UPFA 4ZGBA 2AN3A 5GV7A 2J5RA 3JYLA 5I9MA 2XUHA 3MUFA 4RTLA 1C9YA 1P0QA 4GE0A 4LTDA 3R3VA 4NDZA 4UNNA 4W8OA 4Z0PA 3DTVD 1N2JA 3AR8A 1B6RA 1CLUA 1DZIA 4GLOA 1WCWA 3AINA 4LY6A 5ALFA 2VTBB 5DSTA 4DR4B 5K0NA 2GCNA 3KUKA 3SN6A 4JYMA 1O0CA 2E7ZA 3OMLA 5BP7A 1ZL2A 3BRQA 4JJFA 3LLCA 4HADA 3H9CA 4N47A 3VO1A 5B6PA 1DLJA 1V2GA 5JPIA 4EUNA 3DWFA 5IZ4A 2A84A 1FOEB 2VRWA 3V7WA 4ZDJA 2XGOA 2ZBPA 5BSEA 4I3GA 5FWAA 3TTTA 2EQ5A 2N46A 5AKXA 4UZEA 1DDIA 1S7GA 2BHSA 3ZE2B 2GFQA 2Q07A 1RAGA 2EZ4A 4CODB 2POCA 2UUPA 3X1KA 4X62B 1WIWA 3MILA 4OMFG 4DR5B 16PKA 5FO0A 1EPUA 4KC0A 1HO3A 5DO9A 1RYNA 1GG8A 3NT2A 4K6FA 2HU2A 2CVQA 3RTCA 3EBLA 3FFTA 1D2CA 2QJWA 3GAFA 2NV2B 2IW3A 1TJ5A 2VHXA 4A27A 4F6LA 5FB3A 2C58A 3F47A 5C4MA 1J56A 3MTQA 3U81A 4JA2A 3GAAA 1SC4A 1LLDA 2Y0PA 2APJA 3WMXA 3C7TA 3MINB 4LJKA 4P4LA 4CXMA 4RTPA 5BYAA 1BH2A 1VGQA 3ABZA 4HXEB 2QRLA 2ORIA 4YCDA 1TKBA 3UHAA 1C2YA 4UTRA 5BPFA 2D06A 2JCYA 3JALA 4WASA 3WQRA 2D8AA 1MXFA 2VEDA 2YINC 3AUFA 4M36A 3WJAA 3D6VA 2OR3A 1YRQA 3A9SA 4LHZA 1X86B 2IPNA 2PIAA 2CLKB 3W6OA 3P0HA 2HMWA 3T5MA 4GWKA 1T5SA 3HLKA 5AOVA 2GPYA 3TLCA 4PIVA 2O1XA 1EUZA 1UINA 2D5IA 1IAVA 1Q3KA 4PRKA 2QX7A 2HAEA 4FLMA 3IEXA 4I4TB 4BYGA 1IUOA 1CDEA 2QMUA 3EXHA 2EYUA 3OHMA 2IGTA 4H3HB 3L7DA 4N49A 4TUYF 3NWOA 5DI3B 2Z9BA 4LMBA 3ZQUA 3COJA 5DLQC 1N7IA 3RS2A 4UTXA 1Q1EA 2Z95A 1PWZA 1GFZA 1RAEA 3E9DA 1NBOA 2NZYA 3P26A 1PTJA 2C97A 4RV5A 1RWKA 1YK0A 5DM2A 2ZETA 4TTRA 2G8NA 2ORVA 4J16C 1JPNA 1FPQA 4MJLA 4XUGB 2ODBA 2NWQA 2YWBA 4ARUA 4ZAVA 2ZSHA 1IL0A 3BJMA 1FBNA 3AFMA 1EZZA 4EVIA 5JBNA 3DV0A 1VI5A 4MWOA 4GQIA 1U0NA 3V7YA 3VDXA 4R9SA 4NZZA 1UANA 3JCZA 2HV8A 3RBZA 5IT0A 1WPXA 2FRVA 4ODIA 5JSFA 1CVLA 1CXZA 1YULA 3ZTYA 2H5LA 2CVPA 3IE1A 4HH4A 4ZDKA 4OUDB 4WPGA 1OT3A 3G5AA 4P31A 4E11A 2CV0A 3JAMA 2AQKA 4DV3B 3B48A 1RNLA 4X94A 1EM8B 4X8LA 5BV0A 3QYJA 1GNQA 3LYAA 5JISA 3EA0A 13PKA 3OPQA 3NHUA 4NNJA 3ZDCA 1LI5A 1YKSA 1ZYUA 2WUVA 3ASYA 1C4KA 2BKEA 4ZEVA 2E4ZA 3GQBA 2CL7X 1HA3A 1UMCA 3B5IA 2ODQA 1JF8A 4LDZA 1K7SN 3IDFA 3IMFA 1GXSB 1LTQA 4MX8A 1AQ6A 2R5WA 3JQFC 4A23A 5EWLA 3EPKA 3DZKA 1OAAA 3QYFA 3PJRA 2NPFA 2P2SA 3KKMA 4JT2A 5FOSA 3WB2A 4CQLA 1HUQA 4OI0A 4RNDB 3ET5A 4RO0A 2ZJZA 1WBJB 4LNHA 1I94B 4BLVA 3ETCA 5BW8A 5K8IA 1WPQA 2DKOA 4R3NA 1GLNA 1U9IA 3HVKA 1JRLA 3NWEA 5JFOA 1PSWA 2G7MC 4R54A 3O6VA 4AG3A 4DSNA 2G4CA 5DM1A 3AI2A 2CD7A 1U0TA 3V8PA 2R1UA 5IJ0B 5K8UA 3UTCA 2KWIA 3AEKB 1UQTA 3LBIA 4ASUA 2XCQA 2JBWA 1MFZA 3OFVA 4HDCA 5CXQA 4M0EA 3PQ8A 3J