1PR5A

Escherichia coli purine nucleoside phosphorylase complexed with 7-deazaadenosine and phosphate/sulfate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
237
structure length
231
Chain Sequence
b'ATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHITAAERQTTFNDMIKIALESVLLGDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Structural basis for substrate specificity of Escherichia coli purine nucleoside phosphorylase.
pubmed doi rcsb
molecule tags Transferase
total genus 74
structure length 231
sequence length 237
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pr5A00
1JPVA 1TD1A 4M7WA 4QARA 1RCTE 1K3FA 1T0UA 4L5CA 1RSZA 4BMXA 4DARA 4LDNA 3OZDA 4I2VA 4YMLA 2Q7OE 5F78A 4R2WA 1JDSA 4MCIA 1A9TA 4TXMA 5B7QA 3UAZA 4F1WA 1PW7A 3FUCA 4L5AA 5CXQA 4BMYA 1K27A 1ODJA 5CYFA 5EFOA 1OU4A 4DABA 1Y6RA 1NC3A 4D8XA 3ODGA 4WKOA 4F3CA 1PR6A 4OGLA 5B7GA 3PHCA 4OGKA 4EARA 2QSUA 1A9OA 3T94A 4E1VA 4DA0A 4JOSA 4GLJA 1FXUA 3NM4A 4TS9A 4TTIA 1JP7A 3DF9A 1T8YA 3SCZA 1U1EA 3E0QA 5C80A 4OEHA 4F2WA 3FB1A 1PKEA 3OZCA 1JDZA 4MCHA 1V2HE 3QPBA 4BN0A 2PGAA 4IP0A 1V4NA 3D1VA 3E9RA 1Z34A 2HWUA 3E9ZA 4NY1A 1M73E 1NC1A 4FFSA 1SD1A 4GKAA 3LBAA 1PR0A 1VHJA 3OOHA 3UAXA 3ENZA 3IEXA 4TXNA 3OCCA 1ULBA 1YBFA 1SJ9A 2B94A 2QDKA 1CB0A 5CXSA 1CG6A 3NM5A 3OZBA 1ODKA 4M1EA 1Z38A 3BL6A 3P0FA 3PHBE 4EB8A 1C3XA 4LZWA 2P4SA 3U40A 3P0EA 5EUBA 4TXHA 1VFNA 2GUWA 2I8AA 3K8OE 4M3NA 2OC4A 1Y1SA 1SD2A 2HSWA 1JDTA 1JDVA 4L6IA 1PR5A 3DPSA 3FAZA 4X24A 3OZEA 1U1CA 3EMVA 5FAKA 1V45E 2AI1A 4QASA 3PNPA 4D8VA 4OY3A 1RXCA 3UAWA 1A69A 1TGVA 3O6VA 3FNQA 1Y1TA 4DAOA 2AC7A 4WKCA 5K1ZA 4H1TA 2XRFA 1PF7E 4YO8A 5DK6A 2AI3A 3C74A 4D98A 5I3CA 3NM6B 3UAVA 1VHWA 2IQ5A 3TL6A 1WTAA 1V41E 3MB8A 3UAYA 1I80A 5B7PA 3IOMA 1JDUA 2QPLA 3DP9A 5CCEA 3O4VA 5IFKA 4YNBA 4F2PA 3BSFA 4QAQA 5CYGA 1YQQA 2OC9A 1PR2A 4U2KA 4DA8A 1U1GA 1K9SA 3PNSA 1OV6A 4WKBA 1RXYA 2HRDA 2RJ3A 1A9QA 3EUEA 4P54A 1A9PA 1RXUA 1TGYA 1Y6QA 4JP5A 1A9SA 4DANA 1ZL2A 4WKPA 2A0YA 4G8JA 3DJFA 1PWYE 1ODLA 3INYA 1RXSA 5F73A 1QE5A 1U1DA 1Z33A 3OOEA 5B7NA 1LX7A 4TTAA 4DAEA 1YR3A 3NBQA 4R31A 1T8SA 3DDOA 3K8QA 4QFBA 4G89A 4JWTA 4GMHA 2A8YA 3GB9A 4QATA 4NS1A 5JPCA 5F7XA 3MMSA 4G41A 3KVRA 1Z37A 1RFGE 2I4TA 3EEIA 3OF3A 2OECA 4GLFA 2ON6A 3FWPA 4TTJA 1V3QE 1G2OA 1Z5PA 4K6OA 2QTGA 4LNAA 1T8WA 1XE3A 4L5YA 1Z39A 1A9RA 3KU4A 5KB3A 4BMZA 1LV8A 1N3IA 4UC0A 1RYZA 5ETJA 4DA7A 4TXLA 4RJ2A 1LVUA 4NSNA 5F7OA 1Y1RA 1Z35A 1NW4A 5F77A 2H8GA 1ECPA 5IU6A 1VMKA 3GGSA 1Q1GA 4OF4A 5EPUA 3ONVA 4TYMA 4D9HA 1PK9A 4YJKA 4L0MA 2HN9A 1Z5OA 2ISCA 3F8WA 3FOWA 4QEZA 1PBNA 5F7ZA 2AI2A 4LKRA 3KVYA 1Y1QA 1ZOSA 1JE0A 1U1FA 3BGSA 1B8NA 1YQUA 4ECEA 1TCUA 4KN5A 1V48A 2BSXA 4MARA 4F3KA 4PNPA 5F7JA 1JYSA 2QTTA 4DA6A 1Z36A 2A0XA 4LNHA 1SQ6A 4WKNA 4OJTA 4TS3A 3OPVA 2OXFA 2A0WA 1OVGA 4TXJA 5F76A 4PR3A 1PK7A 1T8RA 1ULAA 1PR1A 3KHSA 1TCVA 3KVVA 4R2XA 1OTYA 1RT9A 1B8OA 1OUMA 1PR4A 1JE1A 1YRYE 3UT6A 1OTXA 5CCDA 3KUKA 3EUFA 1Z5NA 3LGSA 3BJEA 4D8YA 3LA8A 1RR6A 1ODIA
chains in the Genus database with same CATH superfamily
1DWQA 4EUKA 3VISA 1YT5A 1JQKA 3IDAA 1R5NA 4IRMA 4M8NE 2HQSA 1JU4A 2A94A 1Y3HA 1YC2A 3GGDA 1X1TA 2LD4A 4MR9B 5DIZA 3OPNA 5HHTA 2Z1MA 3H17A 3U49A 1UXHA 4KLZA 1X7YA 2V7QA 1GY8A 1FMTA 1OC2A 3MTEA 2WAMA 1KO8A 2ZB4A 3E23A 3LK7A 2QJRA 3PDWA 3LQ4A 3R3WA 4L9WA 4MH0R 3GPCA 3KKNA 1O9HA 1XVLA 1G5FA 3OZVA 3P4YA 4R2WA 1UR5A 4UHJA 5EPEA 3EAFA 3HDQA 4TMVA 3QPAA 4K9OA 5B7QA 5KQLA 5LYJF 2ZP1A 3F5MA 4EW3A 2WSSD 1ZNYA 3RDPA 4E4RA 4MR7A 5C32A 4I4TA 2WICA 3ZIUA 2X0JA 3V33A 1AIPA 5LMZA 4M1QA 1M34E 5IK2D 2ORIA 4GECA 4JI5B 2BEUB 3AEQA 3CZPA 3KHUA 1EUQA 1PUIA 2ADFA 2CYAA 4RENA 1IYZA 3RSHA 5IM5A 5JS1A 3WLFA 1C8LA 4HYQA 1Z7GA 3AUFA 2N3ZA 3F9IA 4EJFA 1E4VA 3P32A 5JSFA 3COJA 3AUJB 4B76A 3K96A 3FPBA 4RHFA 4D8XA 3CGWA 1SQFA 1NR5A 1WPRA 2NUTA 1Z0ZA 1XMQB 3VR3D 2IOFA 3T61A 8ADHA 3C97A 4GDMA 1TYZA 1K8QA 2XNCA 1E94E 4GICA 1TZBA 5AOVA 2JBAA 1SHTX 2WKQA 4J1QA 4JR1A 2MMCA 4IHJA 3OSZA 1JPNA 1HFJA 2VYNA 4F4JA 1M2NA 5K8CA 5GMOA 3LUBA 4TWRA 3N9IA 4QIHA 3RUHA 3HS3A 2IYWA 1II8B 3HB5X 4ZAXA 2FPKA 2M9MA 3VZBA 4GLJA 5EIWA 5K3AA 3B85A 1I7NA 2B2NA 2OWEA 1U7XA 4UXJA 4YLGA 2VWPA 2J9YB 3JVDA 4Y1RB 3BTSA 4OQZA 4ARZB 5TLSA 1SKQA 1F8GA 1PT8A 1RQPA 4OD0A 5EQJB 2ATIA 1XN1A 1QP8A 1T9AA 4CLOB 3BL8A 3JRXA 3VU9A 3FRJA 1H2FA 3GO4A 3TLGB 1P62B 4LHYA 1M2HA 2ZJ3A 3A1UA 1OLXB 4DL9A 3ENVA 1J9ZA 1VL2A 2XX3A 3D6HA 4GS5A 3UBMA 1P1KA 4M86A 3LW7A 3IHWA 4MMXB 4UVHA 5J4YA 1L3CA 2PMFA 5IJWA 4IP0A 3VR0A 2XJ9A 1QHSA 3GUHA 4P4SB 2HTEA 5DSZA 5A2QA 2VJKA 4DG5A 2PKEA 1LXCA 4OHRA 2BJWA 2R7LA 2EAUA 3QVSA 1P0MA 2FOIA 4J4HA 5KO2A 3KPWA 3K1ZA 4PCVA 1EBFA 2FSPA 2X5KO 5COBA 1R5BA 1FA9A 4OYLA 3MJDA 3NYRA 4MRPA 1GKLA 3W8RA 1RCFA 3P5SA 4GKAA 4CR6A 5KVAA 2ZDQA 4X1KA 4AO8A 2R5FA 1SUCA 2V55B 1Q1AA 1AQ6A 3OWOA 4RPCA 1TEZA 1X13A 2WM8A 2ID4A 3NNSA 1BW9B 1JU9A 4II2A 4L4XA 2HBQA 2XOXA 5AHWA 4M1KA 1YBFA 1K0FA 4JC4A 1UFOA 1U28A 2IE0A 3QWHA 4MYTA 4JEIA 4L8GA 4QT0A 2B94A 1A7KA 2HLHA 3MXTA 1C41A 5DNWA 3V80A 1CZRA 4TYNA 4RV4A 2HOQA 2PFSA 5FOTA 5FFNA 4PZEA 2HH9A 2OMEA 3MMNA 4EQ6B 4QTTB 3EDCA 5FV7A 2OZKA 3EFHA 5D8DA 4E4TA 3HA5A 3X44A 3A6FA 1CUBA 1YZVA 1Z38A 1NDUA 2F3TA 1J7JA 2JAOA 3BXFA 5DN6D 1IAVA 3MJTA 1F8FA 4IIJF 3LUKA 2HY7A 5FTWA 4G4GA 1QLHA 3U40A 4B3TB 3NJRA 2ZBVA 3NR2A 4TTTS 2P8JA 3NHZA 5EIBD 5KYWB 4V0OA 4FFLA 5KAMA 5GM2A 2P4UA 2XPCA 4OFXA 1ZI6A 1J06A 2X7JA 3VTFA 3L7IA 2XEDA 4G1CA 1EGAA 4F60A 1JMYA 2WK1A 2Y76A 1Q22A 3RSCA 1Y89A 3OTQA 2IOQA 1GRNA 3E82A 2G17A 2X3YA 1YR1A 4A2CA 1DI0A 1W88A 3ULKA 3K70C 1WOMA 3OZEA 3TKLA 4ZDJA 1GNTA 1W46A 2XTJA 2R8OA 1B6TA 2Q2WA 2FN8A 5AK6A 1U1CA 3CHYA 5DH9A 3QY9A 1ZVMA 1YNOA 1T3HA 2C9CA 1LBTA 5EWJA 1SVWA 3UY4A 4OGGA 5ITZA 4GYWA 1ENOA 2GEUA 1ZRHA 3F2VA 2O8BB 4B46A 4KTTE 1J7KA 5ARCA 2RAVA 2H00A 4JZYA 1AKTA 4ZPXA 3T4EA 3HRHA 5HCUA 3WNZA 4CMCA 2BMVA 1V47A 4HXEB 2FP3A 3QOYA 4WCFC 3BEDA 4CMEA 3NJ8A 3E8XA 4XGIA 4DCPA 5SZIA 4BS9A 4X41A 1JKJB 2RC6A 2Q5FA 1WX1A 4C0JA 3VHXA 2Q0SA 5T57A 1RPAA 2XGOA 3EB9A 3DVAB 1KIMA 4BIMA 2C8VA 1Q7CA 4R69A 1QS0A 5KMGA 3A6KA 1T2NA 1ND6A 4XQGA 3FCYA 1AV7A 2OCYC 4H1TA 1VIMA 5TRTA 1UT6A 3UJ6A 1ADJA 1HMPA 1HTWA 5HKOA 4C3ZA 3SYTA 5B3AA 4KLRA 5A04A 5JBIA 3CUTA 2FK8A 4E03A 3R7NA 3OZWA 2QMUA 3PD7A 1H9CA 3PXGA 3A4IA 2CMFA 2OWDA 2DFNA 3HB9A 3ZGNA 4B5KA 3F98A 3ADBA 4A0FA 4EPTA 2ZBGA 3NLLA 1UPXA 2BGGA 2GJAA 4XUDA 3V7UA 3QXGA 4PF1A 3RRJA 5JW6A 2R44A 2IPNA 1YRBA 1WXFA 1J2UA 1G8SA 2H9IA 2E2WA 2QKYA 3NDRA 2O6LA 1M66A 4PCAA 3PEYA 1JZQA 3C1TA 3H9UA 3UAVA 4DHWA 4IDAA 1IM2A 3AESA 2GEFA 1P0QA 2VC2B 3D7SA 5IPFA 1Z8DA 5H1YA 2QVLA 5CXXA 2Y8EA 2YXDA 1D04A 4F5YA 5LOVA 4IXDA 2YUTA 3TSYA 4BNHA 4MW1A 1L8QA 4HUQB 5BY2A 4PZPA 1PJZA 2ZETA 1O58A 2VRBA 2IS4A 1LBSA 2WHYA 2YHIA 3E48A 4G84A 5ES3A 1NVEA 5CA0B 4JGGA 4H9GA 3T0IA 1PD1A 1TVEA 3NRBA 1F7UA 4EQZA 1TL7C 2J7PA 4LCBA 4B3BA 1XXHE 4KEAA 1C7QA 2O2ZA 1PEDA 3TR5A 1YZ3A 1Z28A 1ZKDA 3ZLBA 1NVVQ 2G7ZA 1G59A 2QZZA 4G0VA 1NW7A 3PUWA 3UUEA 1TYAE 3U26A 1QOPB 2H1SA 2UUPA 2QLTA 5CCEA 2BVNA 4YMSA 2ORVA 4IH9A 4PVDA 2A59A 2Y6UA 2VSYA 2A35A 2ZBEA 3E7FA 4UFOA 4YRJA 1D4AA 4CFYA 1E6KA 3EOBI 4YROA 4ZU1X 4J7XA 5B55A 1PLJA 3DV9A 3FOBA 5ENZA 4EKNB 2G9NA 4YPOA 3H2BA 3ZU2A 4AQ7A 4F84A 2WHEA 4BFLA 5JJLA 4AJLA 3FNEA 4LDRA 1U81A 4OAQA 1PD0A 2JLYA 1CY7A 3HO8A 3DHNA 4CKEA 4F5DA 3IP9A 1M1NA 1KAMA 1Y8QB 3SKYA 2CUKA 2HF9A 3EUEA 4MGHA 1I1OA 1RD4A 1ORWA 2SHKA 3DVRX 5CX4A 2GMWA 5IT0A 3EEBA 3DAGA 2PJDA 3L02A 3O3NB 3PIRA 2CEAA 3R6WA 1QNFA 4YHBA 3R8CA 3HB4X 2WHXA 3K20A 4REQB 4AJOA 5CB4A 2BMAA 4JR0A 4OXRA 3A9SA 1V4VA 3MWGA 3KT0A 5CDGA 1EQUA 2H3EA 3ECCA 3F8SA 2A0YA 2IV3A 3G0HA 2IDKA 3H1BA 1BKDR 2I7CA 4JB8A 5ITZB 1UIRA 4TUYB 5DLQC 1KI8A 4HUJA 1AS0A 1RXSA 2GA8A 3MJSA 5L3RA 5T4FA 4FFVA 4BJ5A 1UKZA 1VJ1A 2F8LA 1GT91 5DHFA 3FVVA 3L41A 1K63A 1TJ4A 2AFVA 2FZEA 2VPIA 4EENA 2ZPTX 3U4CA 5EIAA 3WL8A 1GRQA 4Z4FA 3QENA 2IX9A 5FV4A 5EUMA 4TN1A 1OSNA 3OEHD 1OXVA 5GJBA 3GJ0A 1L5ZA 1P39A 4ZD6A 5JCJD 3WKDA 2KBFA 4I14A 4BGEA 4DR3B 4FOOA 1ZHFA 3K9GA 3IEIA 4WA8A 1BZYA 4PBRA 5EXTA 1O97D 2XCSB 1BG6A 1UF9A 1E1CA 1R5JA 3LDHA 1BD3A 3DBHB 3MRXA 2OQVA 3CO5A 2BONA 3FG9A 2FR8C 3SX4A 1UPAA 2EATA 4ND8A 4RTMA 5J4KA 2M6LA 4GLOA 2BL4A 5FBZA 1I4EB 3N2KA 4I2NA 1JYEA 1EDBA 5FORA 2IYVA 5ICEA 2IZ0A 2I4MA 2B1RA 1D4OA 5AHXA 5AVJA 3PC3A 3R5TA 4H3SA 3N87A 2I22A 2BYTA 2ON6A 3DO6A 3VTAA 4F6RA 3EXIB 3W6OA 4GWKA 5F1YA 4JOBA 3RREA 1H1TA 3ACCA 4N41A 3GP8A 4GZ5A 1IG3A 1G2OA 1F2UB 3C3PA 3A1SA 2F17A 2Y99A 1I2MA 3STTA 2ZJ1A 1DRKA 3CRQA 2OK7A 3KEQA 3ZC3A 5FFMA 2PWAA 3UV6A 2QGNA 3A1DA 4REMA 1XSEA 2YHIB 2I33A 3UJDA 1CUZA 1HDOA 1XQYA 4EB0A 1T6YA 2AYXA 3TVTA 4WNAA 5KNDD 2BGKA 2UZ1B 2X1VA 3H9EO 1Z13A 3OIDA 1T1RA 5T3UA 1L2TA 3R44A 2ZJZA 2NYUA 4NJEB 4BN5A 3HXQA 3OZGA 3QEOA 3SAJA 1VJDA 1KA9H 2UZ0A 1N2CA 3DC2A 4ZO7A 3N6VA 3CTMA 4P38A 2C4WA 4BV8A 1XMJA 3A1NA 3DM9B 4C9BA 2WIJA 3OLQA 2A1UB 3DDUA 4BQFA 3W5DA 5HBGA 2YKGA 3TSOA 1EQAA 1YOVB 3JYNA 3OJFA 2I7TA 5ADHA 2ZRMA 3JATA 3WGHA 2E7ZA 2CLKB 3V00A 4LZNA 4DNQA 4BUZA 2X5JO 5HQ3A 4L0CA 5BWNA 2CV1A 1C1XA 1G16A 1Z0DA 2OG2A 4G5FA 1RU3A 4FMPA 1UBFA 2FNAA 1R6UA 2L18A 3T9EA 1SNYA 4FNGA 4OLHA 4Y6OA 2GRJA 5EPUA 1FEZA 2PZFA 4FFOA 1ML4A 3WLLA 3JD0A 1ZVJA 3AHDA 2C5BA 3A3NA 3I52A 1DJLA 4XJSA 3N1UA 3V42A 4CKEB 1NBHA 4GMKA 1M1YB 4B7CA 2C7BA 3DEZA 1EINA 2FPSA 4LRXA 1SCIA 1NGSA 2F9MA 5DULA 3RBXA 2XQGA 3BE8A 1GQ2A 1OY1A 1Z5OA 4DM3A 5B64A 4A0SA 4MVJI 3F1KA 3STXA 1C29B 3O4HA 4YQZA 4FEEA 3RTGA 5C81A 5KPDA 4XDGA 1EZ1A 3JPYA 5I4BA 1AN0A 3GFVA 3ZDFA 3A2LA 2WWVD 1ZM2A 1PQPA 1BCSA 2O3JA 3IERA 3ROFA 5CU7A 1NATA 4TPKA 3AZQA 3CMMA 3TJRA 3T9CA 4C6TA 1EG2A 2J3QA 3SJAA 1BU5A 1WR8A 4ENVA 4BNVA 3Q87B 3TQFA 1KYYA 3M49A 1RBYA 3E5NA 1X6VA 3IAXA 2Q9BA 1PJCA 4G4SP 1UDWA 1ZS9A 4O2RA 4RESA 3UUWA 5IVHA 2FLVA 1Q0ZA 1SCNE 3DMRA 3LY5A 4ZI7B 1E3TA 2BFFB 1KI2A 4EDFA 4KN5A 4UU8A 1DJQA 1X86B 2BSXA 4QXQA 5CLQA 5DV9A 3B6IA 3TZHA 3WVNA 4BKPA 2V1XA 5K09A 2IBTA 2ALJA 2Z8YM 2QVXX 4IICA 3TZCA 1JYSA 1F0KA 2A0XA 1ZD9A 4C14A 4LNHA 4OX9B 2IOFK 4FHZA 1G4AE 2FPGB 3EA0A 4RDHA 4G0PA 4MVJP 2NVOA 4TTPA 4C78A 1FFCA 3OPVA 2F4NA 4AAYA 3DEJA 1J2JA 2WIGA 2A0WA 2JCSA 1VBMA 2JD0A 2LPMA 1X70A 2VSFA 3BG5A 2AW3A 1M8FA 4MQFB 1OVGA 5TMDA 4DQDA 2LZ0A 4BVHA 1JT9A 1SKAA 2VHXA 4JCCA 1YR2A 2FWRA 4I08A 1KAEA 2YY5A 4LPSA 4HWRA 2C5EA 3AL0C 1NW6A 5AVOA 1X38A 2LKCA 3N2KB 3JD4A 5DYGA 1YA4A 3IVXA 3WO1A 1VMIA 2W48A 4E5UA 2I1QA 3I2GA 3R5HA 1V8OA 4YLEA 2VSNA 1DP4A 2OQ2A 1DCFA 1K7EB 3MRSA 3N39C 4R83A 4BNMA 3OESA 4PQRA 2IPLA 4QHYA 4C0LA 5JS6A 4DIOA 1WCWA 4F6RB 1KRXA 1J0EA 1EGQA 2WFZA 4ZCPA 2HT1A 2I4NA 2JHAA 3SFVA 1OZ0A 1Y3FE 1JDNA 4URXR 2JAWA 2WOOA 1T0BA 3CCCA 3A4YA 3DHVA 4MW7A 4OG2A 4AZWA 4EKYA 1N9ZA 1ZEMA 3M5WA 2PS3A 3MWYW 4I9GA 1I6MA 3FA2A 1NW3A 4PX2A 4S1TA 4BVLA 2FF7A 2ZSFA 4DCOA 2FG5A 1XU4A 3I34X 4YJ2B 2JFZA 1B0ZA 1CBUA 4WNAB 4ZTBA 2KI5A 5BN5A 3IMEA 2DM6A 3U7HB 4MYSA 4NL4H 3TE7A 3CXUA 5K3EA 1TKAA 2NADA 1MZVA 2ORED 2QG6A 2IS2A 1NRXA 1YZHA 1TIKA 4BFWA 1G19A 4UZEA 3H1PA 4IIBA 4H16A 1GR1A 4PC3A 4RE6A 1XA3A 2HMAA 2KYRA 1VC2A 4X7MA 3UEOA 1J70A 1KDTA 1O94C 4YRLA 2R84A 2PBFA 5CTAA 1I5OA 4I8XA 2OZLA 3IDQA 4MJLA 3WAKA 2J6HA 1VDZA 1P7ZA 2PQ0A 4LFCB 3RK1A 4F7WA 4GRDA 1R0BA 4EO7A 4LMPA 5G4LA 2C31A 3RKSA 4W5TA 3UUFA 3AEXA 3ZGOA 1A9TA 4DCUA 1SXQA 1MDBA 3GBSA 1L1EA 2EEPA 4ZQHA 3G0IA 2EKBA 1J2RA 1ZH2A 1PW7A 1MHTA 1JHOA 2BF4A 4Q7EA 1PJRA 1X39A 3AFHA 3DDZX 1SRQA 3IVRA 1ZVQA 4OH1A 2WVAA 3D7LA 2VDJA 5CXQA 4E2ZA 2D62A 2F1JA 1Z5ZA 3I9NA 1D03A 1IB0A 2GAAA 2ZYTX 1PJ3A 1GV1A 4G07A 2GQ0A 2NP6A 1HKHA 4RJJA 2W2MA 2X9GA 4LY3A 4XOIA 1YB4A 1IXZA 1X8LA 4HNSA 4G4IA 1BYIA 4G1VA 2SNIE 4G5QA 4CQLB 1OIVA 2BCGY 2WB2A 4WJKB 4W5QA 4D96A 1CDOA 3INRA 1WKBA 1UQRA 2V4UA 3EG9A 4TZTA 5DBIA 5JAQA 4GVXA 2N46A 3DDHA 1J20A 2HHJA 5KNLA 1SOWA 4MCJA 5IX8A 5TGDA 3GAMA 3K9CA 3CZMA 3PHCA 4I4TF 4ANFA 4ZCRA 5KJEA 1VJ0A 3HKDA 4OUDA 1YRHA 3VNAA 4AKHA 4FN5A 3N0TA 3AU8A 4A82A 3TW8A 1AM4D 3GY0A 1NA5A 5KQMA 1FCJA 3AP2A 3IELA 4DVGA 4N6NA 2XUZA 1TAQA 2FR0A 1YJXA 1DTEA 4JXKA 4QFCA 1JMKC 1UKVY 3ESAA 1C9DB 3OQJA 2X6TA 4UTNA 4UEQA 4YI3A 1JP7A 2X0FA 3TNDA 3OQOA 1LTQA 2H3HA 3OKCA 2VXCA 3ZBQA 3Q1KA 1HF3A 2RGEA 1OAOA 3AJDA 1L9KA 1RYDA 2NW6A 1P1CA 1RFLA 1Y4SA 1UBMS 1U1EA 2DWOA 2LP4Y 2WPNA 3RF7A 4CV3A 4DGSA 1UWCA 3BWXA 3E0QA 3SC3A 4NQRA 4H31A 3H7AA 1F51E 2JVIA 1KVSA 3HYSA 3GF4A 4A8HA 5A1TA 2ZU6A 2ECFA 4L6AA 2R60A 4JI8B 3HNOA 4NCJA 4TV8B 4E12A 1X3SA 1ID1A 1YU9A 1V2HE 1VIAA 4LK3A 5IF3A 3J80A 5DYYA 1MC8A 5IT9A 1SIOA 2R4TA 1JQ3A 1Q2UA 1NBIA 1TCBA 1VSVA 2AQKA 2FFJA 2ZRLA 4KNWA 5FOVA 3UV3A 2WJHA 3CLVA 1SQ5A 3F6EX 1WUKS 3W5JA 3S3TA 3LC0A 3CW9A 2WJGA 4RHTA 1Z7EA 4NY1A 3LOPA 4LRYA 1VL6A 2HLNA 3KLPX 5THXA 2V1UA 3B51X 4MPDA 5JNUA 1KHHA 4CKWB 3O31A 4YS6A 1KKLA 2IF0A 3KDPA 3EEOA 3HJAA 4REOA 1SUBA 2WMOB 2WIAA 1J8YF 2D1YA 2CHVA 3IEXA 3FW1A 3W9UA 4MW5A 1QF9A 5J1SB 3REQA 1L7QA 4ZOCA 3SBXA 4JI1B 3TS1A 3FCEA 1FUKA 1R6AA 1THTA 3LPDA 1S7CA 1OFIA 2X8JA 1G9TA 2BFWA 4W8GA 4LJLA 2X42A 3ZWWA 3P9IA 2QE7D 4OJMX 1W4BA 2GNAA 3RS0A 4UM9D 3L8ZA 2R6AA 2Z4TA 3KZNA 3WFJA 3RV4A 2CVZA 1FBTA 4AVYA 2OZLB 2ZIWB 4UTZA 1E9VA 5CA0F 1QDEA 2P2CA 3CE6A 1Q57A 2OBMA 1RVDA 2CXNA 3I8SA 1Z5VA 4HK4A 5EUBA 3TRJA 3VO1A 1DG3A 2A33A 2ID7A 1QIGA 1JDJA 3AXTA 3WRVA 4X8HA 2XNJA 1QYWA 2XSZA 1P75A 3HKCB 3KM0A 1DHRA 3QIAA 1KWGA 3OCUA 2PZKA 3IPAA 4GC5A 3EF1A 1SURA 3K6RA 5FBKA 5JQGB 3URMA 1P1RA 4OK5A 4EVIA 3AY0A 5I51A 1RRKA 3MN1A 3NOVA 3DJYA 4ZJZA 2QNIA 5JJIA 1R0ZA 1UAGA 3EZNA 1CIPA 3UGTA 4BFYA 1RXVA 1X8KA 3OUUA 2WJJA 3EDRA 2D5IA 2MTBA 3KQSA 2ANCA 2ZSKA 3BRSA 2B1GA 3RJTA 5JWOA 2A4MA 3OQNA 1T1EA 5I9SA 4BNNA 4MIOA 5CT8A 3KQHA 4YJ3A 2ZQ5A 3I9V6 3EG9B 3I72A 1WAMA 5AIBA 4R2IA 5ALNA 1I4TD 1XT6A 3DAHA 4I66A 1XZIA 3VPXA 1Z15A 2CLFB 1QCZA 4FZRA 1HT0A 1A69A 4O4IA 2VJQA 4C7VA 4D3SA 1RWXA 3D43A 3DL4A 1RLMA 3PJDA 4QECA 3RYIA 1YFKA 4KXMA 3L5KA 3QLJA 1NQTA 4UU7A 1UJ2A 2HXSA 2UYYA 3F8TA 3GL9A 3TW8B 1NJ5A 1OT5A 4LHXA 5CNMA 2Q29A 3W2GA 4X1YB 3BXEA 3HGMA 5ILGA 3SIRA 4WKCA 3WNBA 3BERA 4N0DA 1EB8A 4RVSA 2EX4A 4ZPJA 1NW9B 2Z83A 4I7EA 3INGA 4AURA 3U7GA 2I78A 2YBDA 2QORA 3SS7X 1P17A 3HJUA 2CEKA 4FLFA 5FWYA 2BUBA 4TUYF 2RAFA 3BSWA 3HYTA 4RK6A 5DI3B 3WL6A 3KEOA 5EJ6A 4QQKA 1K0UA 2P2YA 4HNAA 4ZAZA 1DTWA 2DZDA 4MKGA 4RPIA 3KKPA 4LJ6A 2EG9A 3G2IA 1MDFA 5KTTA 2Q5JA 1XVVA 2O1SA 3RC2A 4KAJA 3RH0A 1JF8A 5JNWA 4ZVTA 4BLWA 5JDIC 1Q17A 2JJ8A 1NXQA 4EA6A 4RQAA 1UODA 4ZQFA 3OZXA 3OM1A 4ZVLA 1QTNA 4D80A 4RD0A 1K8XB 2VHJA 3MELA 4JL8A 2AFIA 2ZR0A 4QPPA 4I50A 4TLDA 4DE5A 3H3FA 5AHRA 5JLJA 1ZLXA 1DO0A 1I7SB 3U60B 1TRKA 2Z6VA 1R9NA 3DBLA 3QF4A 4DLYA 1AO3A 4Q15A 2ODEA 3A3PA 4D4GA 5K9ZA 1KI6B 3MB8A 1G2IA 2CFOA 4B2LA 5BUZA 1N1MA 4KYTA 4RTSA 4ZAGA 4M76B 1NN1A 1QKKA 1QZUA 3THOA 3W8EA 4V3BA 1A72A 1VTKA 1SCDA 2P0AA 1LLFA 2FSIA 3OU6A 4RZQA 4ND1A 1SEVA 1O5TA 4PXAA 1GXSB 1SN7A 4FFRA 2CE2X 3BBPA 5ALPA 5FTNA 1AZTA 1LH0A 1X7ZB 3B1VA 3FCSB 3FNHA 4FGJA 1PR3A 2CLCX 2CNWA 3K6KA 5A4JA 4EPXA 1XPUA 1BHJA 1RBQA 3UAOA 4BGUA 2WIFA 1K6JA 1QFJA 3DHWC 2X8JB 5E9AA 1OWMA 2Q7XA 3U62A 2ZYVX 1E96A 4RSHA 3ZLTA 5DLPA 1OXSC 5IFKA 1U2ZA 5TQ2B 4R84A 3GDFA 3CR8A 4Q24A 3OJ0A 4OB6A 3DFIA 1JG3A 5AVZA 2WWWA 4XDYA 3QFFA 1PE0A 4E6EA 4QTZA 3V1NA 3X1ZA 1PYDA 1U5BB 1NVDA 1RRVA 4BVGA 2YOHA 3TAHA 3ACDA 4XX0B 3O82A 4AJ2A 3JSXA 2RHRA 2E4UA 2PUTA 4KZKA 4LDQA 4PPQA 5JR3A 1TGYA 4Y0VA 1X0VA 3TJMA 1PNTA 1XZNA 4R1UA 4RNCA 2CF5A 1TU4A 4EFLA 5EIBC 3GT0A 3CISA 1BQEA 1I6LA 1RHJA 1BEEA 2AX4A 3VAZA 4YX9A 2C3UA 1JHAA 2J33A 3F6YA 5LYYA 4HDMA 3WGYA 1KXZA 1XZDA 3TKAA 5KOHA 2IBSA 2P6RA 3N8KA 1REQA 1JLHA 2QENA 4OGWA 3A9TA 4HN2A 2AK3A 4TLMB 3DAYA 1GAQA 1CQXA 3HN2A 4PPGA 2ZT8A 4R3NA 4QBKA 3RS2A 1HK7A 3ETHA 5KYYA 5LWHA 3PYXA 4O4IB 3FHJA 4NFSA 3QUTA 2QN7A 2CN1A 4CM5A 4HFJA 4L73A 2OZPA 3ZNQA 1EFKA 1PHRA 4TROA 3VH3A 1WVMA 3L18A 5BOSB 5IUNC 3NU1A 3CB4A 4WXYB 3FBWA 3NTQA 4JI3B 3EXHA 1XN4A 4YGYA 3RFCA 3E1SA 5CB4F 1L7VC 3HK2A 2X5XA 1WXEA 2FXVA 5ELXA 4V03A 1AKWA 3AJAA 5JADA 1EFTA 2ICAA 3ILXA 3TLKA 1EK1A 3G82C 4BO3A 2RI0A 4OI0A 1I1HA 4KYUA 1KOJA 4N8EA 4JU9A 5A4MS 3FFWA 2XWSA 3C7DB 1VSTA 2A58A 3F7NA 3DLIA 4HNAB 2XJ4A 2X14A 4ZI7F 2GTHA 3IYLW 1NONA 3TN7A 2KWIA 4Y1FA 3RU7A 4X44A 3BE5A 4P2GA 3KIPA 4C04A 2MR5A 5E3HA 2ZRHA 1N2BA 1SZPA 1ZSVA 1UZUA 4KH0A 1ISJA 4MLCA 4XQCA 4JT2A 3D7MA 3H4MA 3FCAA 3HCPA 4B34A 1KJ8A 4NICA 3FDJA 3DOJA 2W4IA 3CB2A 3MUEA 1E3SA 3K09A 5BUCA 1TAUA 1E4EA 1AVTA 3EDQA 3JQQA 1QQ5A 3FTNA 2DUNA 3HA2A 1GSOA 5U4XA 5BURA 4HP8A 2XUJA 1Q3KA 1VYUA 2C3YA 1B73A 2VZ0A 4LHEA 3EZXA 4RHXA 1NFQA 2I4IA 5KVCA 2HA4A 5E6RA 5E3IA 2HDHA 1RYZA 1FS4A 1XYYA 2BFEA 2OHGA 2PFGA 3AG5A 5SYAA 1IXSB 2HHLA 3LCRA 3VR6H 1KEUA 4DIDA 1HLPA 1ZHHA 2WKWA 4JVSB 3O8LA 4NMHA 3ASVA 3ZZ0A 1ULSA 2GHQA 4EJSC 2O8FA 1IPFA 3BJRA 1NVVR 3EUWA 2AXQA 1LVUA 1AG9A 4EY6A 3GAFA 2D13A 3SKXA 1Z35A 2VDUE 1OF1A 1W0CA 1YRAA 4WOKA 2X58A 1Z47A 1M0EA 3DLTA 2Q4EA 2D8MA 3AW9A 1NW4A 4N5DA 3IV6A 4MYCA 1LW6E 4B32A 4IBOA 4YJ2F 3CRZA 4DMMA 1Z6XA 5BVHA 4NEGA 1Y8RB 3A1VA 1KYWA 1YDWA 2HO5A 3GW8A 4DC9A 1VCIA 3SZ3A 1T43A 4DMUB 2O8DA 4ER6A 2WWHA 1T4GA 4GUDA 3OKPA 4FK8A 2F00A 1NLFA 1ZSNA 2JI9A 1PLKA 4HMOA 3JQGB 5IT5A 5GQSA 3BH6A 2JGIA 3I30X 3ZS8A 4JC0A 1C14A 3S0JA 3TX2A 5CITA 4N82A 1CFJA 4Q47A 4X6UA 4ZT2A 3LFHA 3LUAA 1XJ5A 4BVEA 4LRSB 4EKGA 2PIDA 1RM5A 1T8PA 3BICA 3GJ4A 4UMFA 5D5QA 4Z2YA 2VBFA 3MRVA 3FOWA 4NZZA 1RCUA 1GAJA 3AV3A 4H4DA 1PFUA 1T4DA 2J9FB 1QH8A 4RUKA 2CXUA 1SC6A 4ZYYA 2FUKA 4B8WA 1A96A 3F71A 5TMBA 4PFQA 4B84A 2J0VA 2RK4A 3VPHA 2ZJOA 3JRNA 4Y9DA 2HFKA 5EKDA 4V0ME 4ECEA 4RIIA 5LN1A 3WFZA 1XHFA 1FJ2A 1XEAA 2XZLA 2P5SA 1RZVA 2W6PA 2YWBA 1G9SA 1V5IA 3D59A 4EGCB 1ID8A 2RGCA 1J2YA 3VYWA 1BFUA 4Q4DA 3TTYA 4B3IA 1WXIA 1OFUX 3RWOA 5F7JA 1NLUA 5KX5A 2IK8A 1XOIA 3FMOB 4EPYA 1N92A 4JI7B 2H1FA 4D8TA 2GO1A 4D0RA 3D7NA 2YS7A 2QX9A 1IZ9A 2G9UA 1NVUQ 2YN0A 3OC6A 3KU1A 2HIMA 2CBGA 2QAGC 2XCOA 3BK2A 2QAIA 1TZJA 3LPLA 2YIVX 5ALZA 5F51A 2CXSA 2F62A 1NM5C 3IP5A 5BYAA 2A7XA 3CUUA 2PU7A 3H19A 2FJUA 4KYIB 1QV6A 4RFSA 2QXUA 4HXGA 1Y5RA 4HLQB 2WF8A 3QU7A 1O97C 4QYMA 2QL9A 3K2QA 4Q3LA 4DRYA 3G5TA 2GCIA 5J9FA 3GV0A 4B6PA 2RHCA 1G2QA 4FLEA 2XIQA 3AUAA 4IYJA 3GOQA 4K87A 4C0HA 2QN1A 4KRXA 3B5JA 3TTWA 5K20A 4UAUA 4QPDA 3KQKA 1EHYA 2R66A 1ZUNA 1QGUA 2QPAA 5CCDA 1EGHA 4EYKA 1ZC4A 3PNOA 1FFWA 4PONA 3ON5A 2OAEA 3NHFA 3QQ5A 2ONYA 2IPAB 5A3QA 5JV5A 4ETNA 4HUTA 4MV6A 1UBHS 4NRDA 5EMMA 2RCNA 1A04A 3M0EA 4C2BA 1PZGA 4F38A 4FB4A 4HNUA 2Q6LA 4OIMA 4IGKA 5T7BA 1OI2A 1AA6A 5G40A 2WT4A 3E58A 3GRVA 4AL4A 5GVSA 1AUQA 5K0TA 1EE1A 1OI3A 1U0EA 2I03A 2EJCA 3PE3A 4MA0A 4M0CA 1ADFA 1KXJA 4MVJA 4RYDA 5AXCA 4ALIA 3ZN2A 3M89A 2PEYA 3UJNA 3FHLA 2JLXA 2PMEA 1IATA 1DBWA 1LPNA 2XCTB 5BOSA 3OT4A 3LCVB 3CLRC 2VN8A 4QOJA 4E15A 1E2KA 5HFJA 3WDSA 2AK2A 3CSDA 2WLTA 1THMA 3V2HA 3PNKA 3ZXXA 4LJ9A 5LDHA 4KI7A 2QSJA 3PA8A 2ZXFA 2DERA 2P79A 2DSTA 1GG2A 3DXYA 2NNLD 1GQRA 3DFMA 4B44A 1CVLA 3OLVA 1JW9B 5DFAA 5C53B 2HNBA 3TNYA 3TTVA 2I5PO 3JVVA 3BB1A 1JPUA 1CR0A 1J24A 1JZSA 3D2LA 4NAVA 4XUCA 1KAHA 1G21E 2FE1A 2IUTA 3DOOA 3RF6A 1STOA 4QLOA 2QN9A 3D3KA 4UBNA 4MQLA 5DO9A 3O75A 1TJ3A 4BQSA 3PEEA 1GZ6A 2WJ3A 4J49A 5EWMA 4DR1B 3JQAA 3PX3A 4OHOA 2Q6IA 1HEYA 1GZVA 3GA7A 1E0JA 2PCLA 2G83A 2CBXA 4O4LA 3MERA 1CERA 4LGCA 3ZK9A 1X87A 3E9YA 4MRRA 1HYGA 4OQDA 1MX3A 1M67A 1X1QA 2GXQA 5JQGF 3U6KA 3DVQX 4X1OA 5GV7A 2HIHA 3VYTB 3ZZ1A 1XEWY 3I9FA 5FQOA 5A7GA 1B6SA 3WQRA 1A9OA 2G0TA 1CUCA 1TM3E 4U9HS 3P4XA 2NGRA 4ZVMA 3ZOKA 5CEFA 1UM9B 4ZCLA 5M3BA 3U3XA 5EJGA 3DTTA 3AEZA 3NB0A 1E5DA 1LPBB 3WIVA 3CF0A 1KK3A 2RCYA 5LD2C 3ABOB 4Z7OB 3JALA 4UBKA 3P7MA 4ND6A 1I6KA 4FJ0A 3AI1A 5T3YA 2DSNA 4M8IA 3M6FA 4FYYA 1IZ7A 1G0NA 3QJGA 5DHUA 3UT5A 3V4FA 5AW0A 4LISA 1KU6A 3KELA 4I9FA 3TQOA 2VUUA 1UKCA 3VDMA 5KINB 2WF9A 3O9MA 1JB1A 4UHEA 1P61B 1PNVA 1ZG3A 3QE3A 5FADA 4ICIA 3VRHA 1U5CA 2V6GA 3DUFB 4GE3A 4RVGA 4BN0A 1ZK1A 3R3ZA 1J8QA 1GG5A 2YZ2A 2ZJYA 4F21A 4LE0A 3A4LA 3NJ4A 1VKJA 2VAMA 1MT0A 3HBLA 1FFXA 4YB8A 5FX2A 2ZZKA 2G9VA 1IY0A 2BIFA 3VOAA 3VR4D 2GSDA 3E9ZA 1U1IA 1XTSA 1IHXA 2A5LA 1A95A 3BAZA 2HI0A 4NOMA 4TV9A 3LU1A 1KETA 4A10A 5AVXA 2BLNA 1EXVA 1VSBA 2JVJA 3Q5DA 2ZJ7A 2V7EA 4JBGA 2CLHB 3E7DA 2FTKE 3DEFA 4J0DA 3I6YA 5EWLA 1VHJA 5CT6A 2WYIA 1M54A 2BJVA 1M5UA 3TSZA 1G5RA 1EESA 1TMGE 2BTOA 4US0R 1X15A 1S8NA 2GJSA 1Q14A 4FDTA 3EIQA 2J08A 3DYBA 3NANA 4H1VA 4ITRC 1SPBS 1E63A 1E7SA 2VATA 2ZTMA 1NLMA 3CRNA 3V8NA 4P81A 3KKZA 2F3SA 4ZGBA 3SHFA 2Y3IA 2JA2A 2GFIA 4GP7A 4O3FA 3CVOA 5I9LA 5IZCA 1YMQA 2QV7A 1SU4A 4B85A 3JRWA 4FYPA 2VP9A 5GV8A 3SYKA 2R86A 4HQOA 2E4YA 2IY7A 4F72A 3BF7A 4F3TA 4MV4A 3OX1A 4TSKA 1SA0A 2B8EA 5AMXA 1PKXA 5IWCA 4B3FX 2W70A 2B5WA 1O3YA 3PC7A 3Q9UA 2V54A 4A8JB 3DNMA 1N5IA 4KO2S 3GJ5A 4HWKA 4J0EA 4CMJA 4ZDIA 4LZAA 5ALSA 3P96A 4DLNA 4PQGA 1K7CA 3U1TA 2WJAA 3CUSA 1ADGA 4C7JA 4I1OA 1Z4IA 2XMRA 5EHNA 2ZAIA 1PVOA 2JRCA 3AHGA 3DPSA 1K2WA 3FAZA 2W6ID 1SVKA 5DBGA 1GUYA 1RQLA 1I3OA 3PEVA 4TT3A 4ZYUA 5MDHA 2P0YA 3HLTA 2PUHA 3KL2A 2NVUB 3AOEC 1P74A 1DBVO 2YC2C 2JLWA 3EPPA 1C1DA 3EVDA 5FAKA 4MMYB 3P71T 2AI1A 3JQAB 3K0EA 4G1EB 2QIPA 4GNRA 3R2JA 5EWMB 1O03A 3WSTA 5G1OA 3FUUA 3LX8A 2R3SA 4PLVA 4QGGA 1FQKA 2B6HA 2JGDB 4JGIA 4TVBA 4GPEA 5F2OA 2Z56A 1J1UA 4LGMA 1KPGA 2JFPA 1KQGA 3HVUA 3AVOA 1OX5A 4BVJA 1OI4A 4BFCA 1DEXA 2QRUA 4R8VA 4LY0A 1FZQA 2RH5A 4B4DA 4R6WA 1DC5A 1NIJA 3MFQA 3OX4A 3IQWA 1SOAA 1A2KC 3EZFA 4JBLA 4PG8A 2H5IA 3DOFA 1M9NA 2YCLA 3GD5A 3ROXA 2EJUA 4BE7B 3JZAA 1QOQB 4N01A 4Q39A 1KO5A 2W8ZA 1Z2CA 1QGOA 4ZVNA 4YQFA 1EGVB 1K7YA 1YL6A 2R6GA 4DIBA 1VXOA 2HGZA 4YJ3F 1L4UA 1V8FA 3QU2A 4L7QA 3JY6A 2R87A 4FPXA 4KXNA 6ADHA 1IY8A 3V4RA 1SXJA 3BK7A 1M10A 4RV5A 2ZBFA 3D4BA 3DKIA 4KQ9A 1TFUA 3ETGA 4CF7A 4W5NA 4O4IF 2B8WA 2Z5LA 2ZUUA 1C8BA 4GRAA 3MTQA 3FGNA 3JAWA 4GXTA 4KGXA 1QO0D 5KWSA 4L8LA 1XZCA 3RYFB 3ZJYA 4ZARA 1WBBA 1ISHA 2C59A 1GRCA 4PSDA 1WSBA 2D0PB 2WZBA 1CJKC 3K9LA 2J5QA 3H9JA 1P2SA 4DLLA 1PZHA 3KYBA 3ZYCA 3IURA 5JALA 5ULLA 1JEYA 3ORFA 1N6PA 2K6GA 3K9WA 3FJOA 1TQHA 1F6WA 2G7MC 3LD9A 4J6FA 4NNOA 4V3CA 1P2DA 2WE8A 3D8UA 4WADA 2H54A 4PS0A 4EKEA 2WUEA 2FH5B 1IHDA 1I5RA 1BMFA 1FVHA 3H18A 1B2RA 2PUAA 1EE2A 1CVIA 1U7HA 4FKZA 1R37A 3ZHCA 1OBOA 3I2HA 4X66B 1D07A 5IAEA 4AJIA 2Q6TA 4J0IA 4UAGA 1ILEA 3MJRA 1MVLA 3H86A 5TQVA 4B4OA 1NJ2A 4K9LA 3DLCA 2E3JA 3WSWA 2VHVA 2ZKIA 4MGKR 1IDOA 2BM1A 1SU6A 3BMCA 3SN6A 4J3NA 1OPRA 1GAEO 3KZXA 3CMCO 3DVSX 1QE0A 4RH1A 1KSHA 2QW0X 3W2EA 1DAKA 2C5AA 1T3GA 3W4KA 3MCZA 3AINA 1RI2A 4OQLA 2GM5A 2WFMA 1U2QA 1L7DA 5B6PA 2PZLA 3NNDA 4XM2A 1E58A 3W2IA 1UBLS 4I50F 5E1DA 1FX0B 2PGXA 4EEKA 5BSEA 2ASEA 3I1YA 4MGYR 2QRGA 2XMDA 5T67A 3ESRA 4JUFA 3P0IA 1L5YA 3WKEA 2AQHA 1EP9A 4U2KA 2C3OA 2RE8A 5KDOA 1SO8A 3SMQA 1Y5NA 4I3GA 3QA9A 2O20A 2V3VA 2YVAA 3EPLA 3KKMA 4DJFC 1HFKA 1WSWA 2C7VA 4V0SA 1QVWA 2NV2B 3C6KA 5FNZA 1X14A 1VJCA 1XO1A 3FBTA 2E49A 4FM9A 1I13A 3B3AA 1N33B 2VHZA 5T8KC 5G0SA 3Q2OA 4B3DA 1T5IA 3GN1A 4HATA 3GDWA 5TB5A 3RE1A 4DMKA 2PJZA 3ONNA 2NXEA 3R9KA 4RD2A 4MS4A 5CK5A 2GN0A 3LUPA 1YVDA 4DN6A 1K06A 1CEQA 1RVV1 5CJJA 2YJ3A 4KVFA 4LYYA 3UCFA 4ZOEA 1C1DB 4YRRA 5T64A 2EFYA 3CXRA 4IDCA 4JLPA 1QSGA 2GM4A 1UJNA 2RGYA 4GPD1 2WJ4A 4ILKA 4JUIA 4LFBB 2VJAA 2O1EA 1GNSA 3T5TA 5DRYA 3T7RA 4D9FA 2AJLI 4AQDA 4BP9A 2JFOA 1EVIA 1U1DA 5F73A 1XKTA 2P1ZA 3GEIA 4C76A 2Q07A 5JSZA 1BWQA 4DCJA 4RA9A 4HDKA 4EUEA 1YR3A 3PEWA 2AMLA 3EQ8A 4B4UA 1DAEA 1EFVA 1WABA 2P40A 3RBAA 3WRXC 3PGKA 1JJVA 4JLWA 1XRNA 3W34A 4WH0A 1JAYA 1LSJA 1T2VA 2JF0A 2E1RA 3ELDA 4RHEA 2IYXA 2J85A 3RS8A 4YONB 1UOOA 1OIWA 1LDBA 2NZ2A 2ZR7A 1UWLA 2ZROA 3IXLA 3K5HA 4L8VA 4LY6A 4QZVA 5ICGA 2AMYA 1PAUA 2XGMA 1DWUA 2XMGA 4OMCA 2ZVDA 1Z4QA 1DADA 3WHIA 5CCBA 4Y3UA 2YV1A 3CG4A 4B7ZA 1SXJB 4PC7A 4UDNA 4JMLA 1MORA 2A0FA 3MAJA 5DNUA 3PVSA 3JAWB 4NMWA 1JFLA 3UJ7A 1MW8X 1VPVA 4FXOA 5J5VA 1NVXQ 2PBRA 3FFTA 3OVMA 5DISB 2WC1A 5MFPA 4JX9A 1NKVA 4TTSA 1USUA 3ZVKA 3B7PA 2V7UA 3EVAA 4Z3OA 1ODSA 1WL8A 1JQLB 3VJMA 5H68A 3SICE 4HDNA 4Y6QA 3UKOA 1Z5PA 4YGXB 2C2BA 4Y2HA 3GNQA 4BNZA 3C7CB 1SZJG 4KQFA 1GPWB 1KPHA 2JZOA 1ZBQA 2ZIXB 1C3EA 3DTVB 2HIAA 1DRJA 3IVAA 1WRBA 4BATA 4DLSA 2P2SA 3WLOA 4LI3X 2WZDA 4PSAA 3B1JA 5DNVA 1OU0A 3GJ6A 2HK8A 1FK8A 4GQIA 3SPXA 5F23A 2XMZA 3KU4A 4RANA 1WF6A 2PL3A 3UK2A 3QU5A 1IUKA 3GLVA 4GZ3A 4NK4A 3BMCB 1XCMA 2JI8A 4OPMA 5ILQA 4EY4A 2BCJQ 2RHJA 2BMDA 3L7MA 2I7XA 3NONA 3R5KA 3TRFA 2DQZA 3E2MA 2V74B 3EDMA 4D99A 4B8YA 3RLFA 3N0XA 4QPCA 3HDTA 2V7WA 2JGLA 3HO6A 2CJXA 3RS9A 1IY2A 1RNLA 3IFSA 2NXNA 4TSFA 4N3NA 4MUIA 3O4GA 1JQEA 3PBKA 5PGMA 3M4XA 1MJNA 3LSTA 2HX1A 3SC2A 3BIJA 3GPBA 3RSLA 4BAGA 5M2QA 1FDWA 2JCBA 2SCUA 3OT1B 3WB0A 2H51A 3RBZA 2ZSBA 3UJPA 5G1PA 3VMMA 5D3QA 1QF7A 3D0RA 1RQXA 4DG9A 1JHQA 2DQ4A 5GONA 1A2QA 5EA2A 1DU4A 4KOEC 1R6XA 3PGJA 3NZEA 3T99A 3W5AA 3ONVA 1QK3A 5FPSA 2CLDX 1NAIA 2V9PA 4HRYA 4A2QA 1ABFA 1S89A 4N5NA 5LQCA 3CVYA 3H2KA 2G25A 4R5MA 3E9DA 5FUYA 1A2OA 4BZPA 4DMRA 1GDHA 1GN9A 4A36A 3OIUA 5BQ5A 3ER9A 4QGHA 2OO5C 1QYRA 2O8EA 2PDAA 3T9FA 1DMSA 1M6YA 3F8WA 1NMQA 3P2KA 1UM8A 1W4AA 4PSCA 5KTRA 3UN1A 4YJHA 4OK3A 1SOMA 2J7PD 4CEHB 2FDRA 1PBNA 2QR3A 4Y6LA 2OEPA 1YRLA 2IODA 5DJ5A 1YDGA 1COWD 2FGKA 1T9GR 2WPDD 5L4NA 4D6YA 5HRAA 3RTAA 1E6LA 4F1JA 1Z0KA 4QODA 2NO0A 2WNSA 5CPBA 4DLBA 4ZKDA 1UFRA 2VT6A 2B37A 1V95A 1L5MA 3T5CA 5KKCA 5CGZA 1WKVA 3N6RA 2JI4A 3FVQA 4NEQA 1N4AA 3W1WA 4F0JA 4MDEA 2OZEA 2G5GX 4RA9B 1NU6A 1QC5B 1AY0A 2VQEB 1HE1C 1G4HA 3LOUA 1MJHA 1O5OA 3DXFA 1AK2A 1JFVA 2W6QA 2FMFA 1Z36A 1QU3A 2O9JA 1WE2A 3R5XA 1ZW6A 4NV1A 3EGDB 2BGMA 4NABA 5ISMA 2GUGA 2IH2A 1Z16A 4FE3A 1Z4KA 2E55A 3AG6A 3H5WA 5G02A 3F47A 3GAAA 4YCBA 5CVVA 4RSGA 5DNYB 4IUBS 1C4KA 5F5NA 3A6JA 3H5AA 4S05A 1PEKE 2CMKA 2DFDA 4WV3A 2VYFA 2L2QA 3L07A 3VKWA 3OICA 5BQXA 3G1TA 4BXOA 4O1IA 4XWKA 2VOEA 4R68A 4KIJA 2XWJI 2XF2A 3N3BC 4FX5A 1L5RA 1V35A 3JQFA 1Z0SA 1GVHA 1XZEA 1WF3A 3BIFA 3ONDA 4RKFA 5J3JA 2YDXA 2ZSDA 4HDNB 4QGBA 3AKCA 1OUMA 2O06A 4UBOA 4P4NA 4A0HA 3JVEA 1JG4A 2V58A 2WM9B 2JRLA 2WJWA 1Z12A 3BJMA 2EJWA 2AXPA 5LLTA 1Z6TA 2QTWB 3IKVA 4C4XA 2IY8A 1WCIA 4AMZA 4AP5A 1Z56C 3KUKA 4PV7A 3RU3A 3WLQA 1RYHA 4AZTA 1E8MA 3ORSA 2GEDA 3Q7SA 2AN9A 1IXRC 4NOJA 5IEJA 1ZI9A 1BU8A 1EP1B 4UARA 3LA8A 1YS2X 4DLAA 3CPJB 4LV8B 4UPEA 5IHPA 1HLFA 4OL9A 4F06A 2ZE8A 4URUR 3R7LA 4M7WA 2I6GA 1BCRA 4ZT4A 4EG4A 2QSYA 4S2EA 2YRXA 5ALVA 3GEDA 2Z58A 3ZWCA 1ANKA 4A92A 1T91A 3JQBA 4ZQEA 1QRSA 2I34A 1PJQA 4L5CA 2OMKA 3B1WA 4IJMA 3F7MA 2C4NA 1OTHA 5BV8A 4C29A 4RCVA 3C87A 1P80A 3FTCA 4R8LA 1H2ZA 3A31A 3BGDA 1KEKA 4IILA 4US1R 3EYAA 3O74A 4BBPA 5WRFA 3VZPA 2XRZA 1R0SA 3MF4A 1E6WA 1JEQB 2QOEA 2E4XA 3G23A 5BV0A 9ABPA 4LJAA 4YV7A 3BGOS 2Q7OE 1FNCA 1OZAA 5BPHA 2NT3A 4Y0AA 4TXMA 2BHTA 4F91B 2OG1A 5GONB 1E0DA 1YJ5A 4K8OA 1MMFB 1TZ2A 1FNNA 1NF8A 1MFPA 2D5AA 3ZX4A 2BZSA 1J8MF 2NZVG 3R7DA 4OXIA 3VZDA 1PGPA 4PC6A 1EB9A 1Z5UA 4HH0A 4L5AA 1JAIA 1NF3A 5C4IA 1XTJA 1P60A 3ND6A 3TOVA 5TS2A 3LUHA 1R15A 3BCHA 4IIGA 4MVJF 1C9EA 3GQBB 1N2HA 1ZIYA 3BMQB 5EMJA 1OH5A 3T7EA 3HADA 3HEAA 3WL7A 5HZHA 2O8EB 1X77A 3PKZA 1ODJA 4EUSA 1EFAA 2PVPA 1UKEA 4IUDS 4MQEA 4YJHB 1YZTA 1Z06A 3TOXA 3O8RA 2H4FA 5BP7A 2VSQA 5TXGA 1OU4A 4UQLA 2CYCA 4YC7A 3PB3A 3PQ4A 4PINA 4IXNA 5EYPA 1M5RA 2VA9A 4J7UA 2E9SA 1P2UA 4Q7MB 4QYXA 1YMVA 4IEFB 5KTMA 1C1HA 3AGQA 3UFXB 4J0FA 3H0KA 1RIFA 3PNQA 4K6MA 4M1MA 1DEAA 2CYBA 1H22A 1PVVA 4HSGA 4BCCA 3PJEA 3U4IA 1ZQ1A 4BNDB 1PDVA 4LXQA 4QHSA 3UMYA 2RGBA 1DKMA 2Z2ZA 4NZMA 1T3SA 4TGLA 3BSYA 3PUYA 2PUVA 4KWEA 5H3HA 3U7QA 4H7PA 1RQ2A 1WCXA 4PRKA 2BP7B 4XM1A 1LNQA 2QZPA 2O3SA 3DF9A 1T8YA 2DFKB 2E85A 3ABZA 4YP7A 4I6GA 3SXJA 3TEJA 4EJMA 3DOIA 3MPOA 4O4LF 3SYNA 4ZAFA 2CUNA 4DWVA 5H4GA 2EF1A 2DRIA 3FZEA 1EGMB 2W11A 5C80A 1U5AA 1E2EA 2FFAA 4K6CA 3FB1A 4HYEA 5GZ6A 4KBFA 3WA6A 1TMYA 3ZV6A 1Z73A 2M6RA 2VJOA 3M6VA 4BO6A 1FP4B 1NWCA 3QEBZ 1I9GA 1ZUWA 4MW9A 3OQVA 4PYQA 1CUYA 1R18A 4PIVA 3Q8XB 5I6DA 5HRCA 3G1WA 2VRCD 1E9AA 2BZ0A 1SHZA 2YJTD 5BV1A 2ONKA 3ASZA 4HRXA 1D6NA 1R3DA 3TBKA 3U16A 2JK0A 1EDZA 1RQNA 4MKFA 5AI6A 1XP8A 3Q3HA 4P82A 1ENZA 1K5PA 1JTVA 1KS2A 2P9TA 1IQ0A 1WCIB 3MD9A 2D7CA 3UOWA 3ZW8A 3U19A 2I71A 2AW5A 1MR3F 1VB5A 4BNIA 3R3SA 3KXIA 1GUFA 2CKMA 1IBKB 4EK9A 1RHUA 5FFFA 3SHWA 1PZXA 5J5CA 3TKYA 3OCCA 2XXAA 1E69A 2W43A 3ILVA 4JYBA 4RGQA 3NO4A 3HV0A 5A3VA 3OEYA 4NV3A 4AJ9A 5HWSA 4GE0A 1SB8A 3GJQA 2QDKA 4HPJB 4M9SA 4RXTA 3UMSA 1F8YA 3CZ9A 1E89A 3EJ6A 2I76A 3AU9A 3DO8A 3EIFA 1KE1A 4IUCS 1C3LA 3PD1A 2NZUG 4WNCA 1TPZA 4Q9LA 2HCTA 1YZUA 5TF4A 4RADA 4RIFA 5H9WA 1MN6A 3P0FA 4QQ8A 2QRLA 1P33A 2QTRA 4UAVA 5EGNA 5FJJA 4F4DA 4MS3B 4KR7A 4BRUA 1H0KA 2H7YA 4QELA 4L27A 3NWPA 2WHPA 2B2XA 3OIFA 4CG3A 3P0EA 4LDPA 1OX4A 5FYDA 3NH9A 1TW2A 4JVOA 3UVEA 1MX9A 1IL0A 1CDEA 3E1GA 2HYDA 2ZJAA 3F6CA 3R09A 4MV3A 4B8ZA 1DCMA 1LPMA 4P4LA 5ED0A 3OY7A 2HSWA 3IAUA 5FEMA 1I10A 4YAOA 3LIPA 4OHXA 5LZ7A 3PA6A 3K8YA 1X74A 3DA8A 2J46A 2EP7A 1ODTC 3SSNA 3LQRA 4Q4LA 5JTTA 3EEQA 3HFSA 3Q7IA 5C1PA 1GTL1 3SNKA 4DWWA 3IVGA 4BDSA 2FV8A 3V1MA 2HBYA 3FRIA 1O4VA 3GNSA 3HN7A 2JIRA 3KQMA 2D1TA 1LX6A 3P9CA 3TSAA 3QX8A 4RY0A 4WUTA 5A02A 1KFKB 5EYPB 1NI4B 1WPGA 3X43A 4BKUA 5DX1A 3E3AA 1CRZA 5E6UB 3FOZA 2IHNA 5K2MA 2CE7A 2HSDA 3SDSA 3SNHA 2WOJA 2Z3WA 5IC6A 3E84A 1UADA 4CM7A 2Z2KA 2FUG1 4UBLA 4CM3A 5G41A 2IUEA 1SEPA 2C9DA 3A6LA 2JJ1A 3AEYA 3EBLA 1TK9A 1N5LA 3U5TA 4Q3BA 1Y7LA 3DD5A 5FUBA 4LE2A 1W44A 2C2MA 3RWMB 4HDRA 3B48A 1XZMA 3LCUA 3LC1O 5AQ1A 4MYRA 2NSLA 5UKDA 1Z0IA 1FTNA 3Q9LA 4L3WA 4MYHA 4W6QA 4DOMA 4KQ1A 4MUFA 3CW2A 4NPCA 5D00A 4P3KA 1X80A 2Q8NA 4EY5A 4MW6A 3HE3A 1ZDMA 2LWIA 1O6GA 3A6EA 4YALA 3R75A 3OC0A 4J0QA 4PHCA 1KKMA 4PXYA 2J0QA 3CJRA 1ISIA 4YO8A 1X1SA 1EBBA 1U90A 3AF4A 1BRMA 1Q7TA 2IEBA 4WCFA 5DM2A 4LXYA 5B53A 3AJ9A 2XMBA 4MAAA 2AVDA 4WY8A 2BH2A 1U8EA 3DCIA 3ZWVA 1RTKA 3OKAA 3NTLA 1H8EA 1VG1A 1PW5A 1BJRE 1Y3IA 1CUDA 1DFIA 2Q28A 3H11B 3ILYA 1NN0A 4JJIA 2XBUA 1J25A 3T5MA 3WLPA 4ALNA 1PU2A 2AKAB 1SIUA 2INGX 2IQ5A 4LDJA 3MS4A 4UD2A 5CCXA 4C22A 3GA5A 3MOIA 4K0KB 3AUTA 3BXPA 2GAIA 2J0UB 4JROA 1TYEB 3RUAA 2IWRA 2RI6A 1WW8A 2CZCA 5D2CA 4AJNA 4ESOA 1KKUA 3THRA 4F4IA 5LPNA 4HFRA 2WR8A 2RAPA 2LBPA 2EKDA 2XNKA 4R1TA 2PANA 1Z3CA 2OHOA 5SY9A 4E11A 2UYQA 4OSOA 1I80A 2J07A 1AE1A 3KT8A 2BKLA 2XT9A 4IF6A 2WEKA 1ACMA 1F3OA 5B1EA 1HEIA 2HT6A 4ARCA 3AJRA 4HPXB 3WB9A 4D7AA 1AH2A 1W7AA 4G1UC 5LP6C 4B7XA 3IP8A 3WLNA 4YRSA 1KEWA 5DCWA 1JSXA 4FKMA 1JR6A 2A3NA 2YN2A 2F48A 5EJEA 1DUIA 1A9ZA 4QAQA 3PQFA 2O5VA 1VLZA 2HPAA 3NDPA 4IDPA 1EMDA 2XMPA 4P7JA 1U0SY 2NVWA 4L78A 1E2LA 2KSQA 3DS8A 3HR7A 4N0EA 4AICA 3EZYA 3OIWA 1GEGA 4HB0A 1FVOA 1DOHA 5AI8A 3ICQB 2WMNB 2GPAA 4EHHA 3HL4A 4KTVE 4YUAA 2WIKA 4QLBA 5KS2A 5I7FA 1GTSA 1O7JA 1U2EA 1XVTA 1NX9A 4YEDA 3GDHA 2R48A 4WECA 2YICA 2JFUA 3QNUA 4RIGA 2CVFA 2W6OA 2HEGA 2GCGA 2WVJA 3QBEA 4IDEA 3DNFA 2Q6OA 4CV1A 5F1OA 5KQGA 1ZJ4A 3QE2A 5BYBA 1ECFA 2WAXA 3K30A 4YN3A 3TOZA 2JIOA 2OP0A 1PJ4A 1T2DA 1KYIA 1IWOA 2P77A 2VXYA 3OTWA 3QKIA 3WLTA 5LXTA 1V7CA 3PT5A 4PRLA 3LDGA 3T7SA 1G5HA 3ELYA 4O2AA 2XF8A 3ZIAA 4DREA 2J5KA 3PFIA 2P6OA 2QLLA 3NMUF 3QSGA 2O1XA 1X7HA 2HF2A 4GBED 2PJUA 3FCUB 3GJ3A 2B6NA 4HF7A 2V7PA 4UD6A 3I23A 5GZ1A 2HPVA 1WXGA 2IC5A 3QEMA 4U6QA 3M6WA 3PD0A 5DYTA 5B7NA 1IMJA 3U7RA 4DWJA 1EK2A 1N75A 1ODFA 1XZBA 3WJ2A 5BYKA 3K70B 4P33A 2FFBA 1WCYA 3O4IA 5GOZA 5IDYA 3I1JA 3LGAA 2PH7A 5IBQA 3QVXA 1MC5A 2ODWA 4BBAA 1FP1D 3M9LA 2Z6QA 2AOXA 4Q4JA 3FOEC 4CR7A 3OPYB 4NZNA 3LBHA 1GYPA 2QN3A 1RM0A 4Q93A 2WABA 4YAKA 5LC1A 1U4SA 4RKRA 4E2XA 3L84A 4KLAA 1C9JA 3N8DA 2R8ZA 1X80B 3T3IA 4HZGA 3K2BA 2X9NA 1PV2A 5JY1A 1U2RA 2YASA 3FROA 3GMDA 2OFWA 5FUQA 4XRRA 3LVRE 3FTFA 2Z5GA 3JQ7A 1RFGE 1Y0BA 3UFBA 4HQNA 4WCFB 2XTAA 4EG8A 3LPMA 4RIEA 5EHIA 1Q50A 2ZANA 4YT2A 1XMOB 2NUPA 2QYOA 1YZQA 3E03A 3MTIA 3UZUA 2OECA 1AUVA 3MWEA 4O29A 2X4LA 5I48A 2BGWA 1QG0A 2E4WA 4E14A 1NQ5A 5KSZA 4WXPA 3PDJA 2E5LB 2BGUA 3S2GA 4BKMA 2APJA 1C5KA 1MENA 4RFVA 1CR2A 5EE5B 1T9GS 3RFVA 3F5DA 2F3QA 3KOMA 2FR8A 1L5OA 3PE6A 3PWTA 4L0QA 2WWFA 2ZT7A 4JJZA 4QDUA 5K7SA 3QIVA 1OASA 4O8CA 1YIOA 3LDFA 2CLLB 3N3AC 2YWEA 4HEA6 1ZM9A 2WILA 3K9QO 4LHSA 3OQPA 1FNSA 4INAA 5ESXA 4ZVUA 5KVQA 3SS8A 3WKCA 3G2OA 1NUQA 3M6AA 3QKRA 5IHXA 1QWOA 4AN0A 2WV7A 4RJ2A 3W7VA 2GCPA 4XLZA 4EG5A 2KM1A 1F4LA 2I3BA 3H9GA 4OHFA 4RZ3A 2YZ7A 3R4CA 4AMVA 5C5EA 3M82A 4DDTA 2UV8A 4YQEA 1R4ZA 5L40A 2ZLBA 3KV3O 3CWQA 3JSAA 5F77A 2Z2XA 1RYMA 5EHZA 5KSOA 2K5UA 3HJRA 4WCDA 4NX2A 5CJPA 4I9NA 3UA4A 1CF4A 3QNMA 2GOYA 3HJFA 3H5OA 5KNDH 1U31A 3GUUA 3F3MA 1B4DA 5DLDA 5F52A 1CCWA 3VR5D 4EB6A 1TEXA 2WUWE 2I4RA 3RAEC 1OZHA 1RLIA 3SSAA 1OH7A 1HT1E 2MHCA 4Q9NA 4L0MA 4WE3A 3O1LA 3FWKA 3LFUA 4AMUA 4X95A 4YR9A 3D2AA 5J43A 4RQTA 1YR7A 3OF5A 3ETNA 2G1KA 2P3LA 2JW5A 4Q16A 2AZ4A 3NTOA 1IEWA 1A8SA 1SQSA 3SHVA 1WA5A 2CNWD 2GYVA 4Y8VA 5CFZA 5GONF 4FP9A 1CWUA 4HY3A 1Z2AA 3M1AA 3M3DA 5C8DA 1X3LA 3C45A 1Z7BA 2QP4A 4LF7B 5DYWA 3JS5A 1QTQA 3M4JA 2COKA 1K2VN 1B8NA 2GJ9A 3DNPA 2WHQA 1Y1PA 4NH0A 5C8YB 4XDZA 2RBEA 4FOLA 5CHEA 1HC7A 1FLNA 1K08A 1XLUA 4DDVA 4NXNB 1NTOA 2ATXA 2RI1A 1DZIA 1XTPA 1WMDA 5C9ZA 5LQAA 3I4LA 1M2OB 3IA2A 4MVJM 3NIGB 1WB9A 4KXYA 1L5QA 5IM4F 4Q4JB 4QXPA 1T1GA 2QK4A 3P2YA 1S3SA 5LBTA 3EVTA 4PLGA 2H2FA 4HS4A 3STVA 5AKHA 4DEXA 3L6RA 4Q21A 5CMLA 4ROTA 1JIVA 1YHNA 2ZJFA 1PVDA 1D1PA 1MQSA 3U3OA 4EAQA 3W8DA 4POOA 2WY2D 2ZWMA 3DMNA 1T6ZA 2NTJA 2AQIA 3I39X 3IJEB 4IR7A 4TXJA 4UUBA 3RRYA 4BV9A 2QU7A 3KP1A 5HCIA 1P4JA 3ZKWB 4CEIA 5HKAA 3IDFA 2AG1A 3ZH9B 1L4NA 4CKBA 4JY7A 3VXKA 4K1XA 4J43A 4IGAA 2ACVA 5IBPA 1WHTA 3VO2A 4CF6A 3PTZA 4WNYA 1DARA 2E1PA 4NFHA 4P22A 1UBCA 3IOYA 2WWGA 3QU4A 4FFDA 4J0JA 2QM7A 1PSZA 2H4YA 1D2MA 4L0DA 2AF3C 3OE7A 3O5AA 4MUMA 5FHQA 2AG6A 5JE8A 1FYEA 3V2UA 3VC2A 3ZE9A 3E7WA 4W9MC 2AR7A 4PGHA 2ZUSA 2NV0A 2BZGA 1GTVA 1UDRA 2XQKA 3VVBA 4E2FA 2Q3FA 4TWIA 4RX1A 4RH0A 2EX1A 3IO5A 3UT6A 3HUUA 1XMSA 1N32B 1YMUA 3NRJA 3I61A 5BMVB 4GOMD 5FRDA 3DEKA 5DK4A 5NLLA 4KVGA 4D8YA 2CNDA 4FKBA 1N2JA 2CLOB 3H3JA 4B0PA 2RB5A 3C5WP 3MFYA 1ZOPA 2BFMA 4JJ4A 4DRXB 1PFKA 2LCIA 4RAQA 4E32A 2C92A 4FW9A 2D2VA 3WGIA 1CX9B 2VTVA 3G7UA 2GJKA 3L05A 2AF4C 2C2WA 3OM0A 1F1JA 3T1QA 3WTBA 2QYSA 3QKRB 4TVKA 1FDIA 5JVDA 5B5SA 1YS6A 2YFHA 2EHDA 2NTYC 3ZHSA 4ZQGA 3KDSE 2GD1O 5AVQA 1J5XA 3VC1A 3B38A 1Y4UA 1S3GA 1J0AA 3O0DA 3X1MA 2W2XA 2XTZA 4LDNA 2VUTA 3MNFA 2QNRA 3FWNA 2PCJA 3MJEA 3PUJA 4R9SA 4ER5A 5A2GA 4K81B 2F1OA 2VPZA 3HEMA 1Q74A 3TB4A 1GM5A 1P45A 1XYGA 3NWEA 1PWXA 3RD5A 2VRNA 3A26A 3IKJA 1P9OA 4M1ZA 3GLIB 5A0TA 4JXZA 2ZWIA 3DC7A 4BMPB 3ZU3A 2IYTA 3IBGA 3OEEA 3W05A 1KORA 1EFRD 5JMTA 2GN6A 4ME6A 3TLCA 4MYUA 2GPSA 4CQMD 2E4ZA 3DFKA 3H8VA 3M6LA 3S2EA 1V5EA 3RVNA 3T54A 1FUYB 5C0OE 3L8FA 3QI2A 4MR8B 1OB2A 4ZVOA 4M9CA 1BGXT 4DIEA 4DUPA 1GL3A 1O94A 1YD7A 3CVWA 1DWOA 2XDYA 7REQB 1DIHA 5C34B 5EFOA 3IUYA 1TUBB 4XJVA 2NZJA 2X9LA 1XQWA 3FGZA 3NKLA 1H4SA 2W90A 1L7RA 3QM1A 2I2WA 3N2GB 1JXOA 2OR3A 2BLLA 4NYJQ 5DX0A 5BVGA 1H3EA 3DAPA 3LCCA 1NKSA 5LP1A 3M81A 2VJMB 1GTG1 3OZ7A 1AHIA 1UCFA 2CXPA 4ALMA 2PRZA 5B4TA 3K0AA 4PR0A 4U0JA 5JUWA 3HY3A 1XZJA 3TVDA 1RQ7A 2Z4RA 4A6PA 4FBMA 2VDLB 4L8YA 1FRZA 3AZPA 1IOVA 4TTQA 4YRAA 4CKZA 3RFXA 1PSWA 4B47A 3GGGA 1TTHA 1VHLA 1E2MA 2FN9A 2QS9A 4RPGA 3ESXA 2VWHA 4DNPA 2DPMA 3KC2A 3HCAA 2BTQA 4EUNA 5KTKA 1PBTA 3K2EA 4DA0A 5CT5A 3GQVA 1ZY2A 1TDJA 2C5LA 4M0LA 4PX3A 4UM7A 1UBEA 1MO6A 1SOVA 4N7JA 3UB2A 1G17A 2G70A 3B7GA 3H4VA 1G7RA 1CETA 3WQHA 5AJUA 1EWQA 1NBAA 1XEXA 5B3LA 1JDBC 3GFSA 2W4QA 4GW3A 1JHDA 4K2AA 5FA5A 2PYDA 1BYUA 5DHSA 3O3CA 2O2XA 2VF2A 3SQXA 2SKCA 1C7RA 4A6XA 5JOQA 5ICCA 2VS1A 3T41A 3OFSA 1HYQA 3I01A 2OYCA 3UOGA 1WNTA 2R1UA 4AMYA 2J8ZA 4I1RA 1JDZA 1NVAA 2QVBA 2X2FA 1E99A 5C1DA 1NIPA 2CY0A 1SCAA 2A30A 1GNPA 2G9ZA 3BFKA 4O4HA 4P83A 1PNOA 4ZT3A 4DCNA 5JXHA 1V4NA 3WK6A 1R1DA 4JVLA 4NMLA 4W8OA 3TL2A 4AJ4A 1CUUA 2OAP1 3B3GA 2XVYA 2ZUFA 2KQUA 4M53A 4NCIA 4WXEA 4Z7QB 2G04A 3TFOA 3RVQA 3BRWA 2HU5A 3QVLA 4OLAA 5J40A 3QKSB 3PQ2A 2Z5VA 3KOYA 3TG2A 1OYVA 4YP6A 1PR0A 1F2VA 3CLTC 1TF2A 2AXNA 2ACWA 5HP4A 3BFJA 5HVNA 3IJ5A 1JXAA 3COWA 4E33A 3IBYA 3NWJA 3GPLA 4YAEA 2YJNA 2WNIA 1HY3A 4EO9A 2HUPA 2AFIE 2X6RA 3HXOA 4KAAA 1EBUA 4RF4A 4DYHA 3WLIA 3F0TA 1Q1NA 1FYVA 3ITDA 2QXTA 2OSVA 4I46A 3WYGA 2VNIA 2BJHA 1DSSG 2YFYA 3NT4A 2GBLC 3GEHA 3QUCA 4YREA 3SYMA 3OY2A 4C88A 2GK4A 3BIXA 4FDMA 4HJXA 2H4ZA 2YS6A 1D7OA 2XH8A 1YQ9A 2QP9X 1M7BA 2OSBA 4QDOA 4WFIA 1YKSA 2DHDA 2VDQB 1T4CA 3EISA 4FYVA 2IS6A 1B8VA 4HX5A 3B89A 5IYZA 3W5BA 3HCWA 4PX9A 2DWQA 2ZTVA 1Q5PA 5LFAA 2ZUDA 3ICEA 1PP4A 4QOFA 1S9DA 2ATCA 2XBMA 4RPHA 2ONZA 1MD9A 1XTTA 4YRTA 2FCRA 2GGSA 4WOPA 4ZTUB 1F14A 1T5TA 4JKIA 1FW6A 1V7PC 4MROA 3M6MD 1S02A 1IY1A 3EFOB 5IBCA 5E1OA 1XKXA 3V97A 3PFFA 4BJ6A 5M04A 2H31A 1CRLA 2PT7A 4OAPA 4RA6B 2OP1A 4JBNA 3MOGA 3JAMA 4JUCA 3WO0A 4R54A 2FZ5A 4LYAA 1I0LA 2P3OA 4D74A 3K9BA 2H7VA 4HR7A 1YBHA 2GX6A 3EULA 2FRXA 4BZWA 3CLSD 3K0AB 5DGIA 2G1PA 2ZBUA 2GPBA 4CCWA 3FNQA 3IXQA 3PNYA 4FT2A 4HEJA 4UXIA 4NAUA 3ROMA 4D6PA 2MMGA 3ND7A 1JFSA 4LBWA 1H85A 4RPLA 4KLNA 3RC9A 2ZJ4A 4EJ6A 1NYLA 2ZTUA 1XC7A 2PRYA 3PRYA 2WKSA 2NG1A 2D5CA 3N86A 2WSSA 1ULHA 1SR8A 3OECA 1PJBA 1VE7A 5K1ZA 1J0CA 3LZDA 2X4IA 3LL7A 3M5CA 1NZDA 3JU3A 3AI3A 3LECA 3LQFA 4QOGA 3VPFA 3BDAA 1JR3E 4WZBA 2VUIB 3KOZA 2ET6A 1XEXB 2TMGA 4PU0A 3OIYA 4NCNA 4EJ0A 3GLFA 2UU9B 4OA8A 1ECLA 5F9FA 3RJMA 1MRNA 5FUVA 3NP9A 3D3WA 3NCTA 1JTEA 1T9CA 1W0JA 2QT9A 4GYJA 2WINI 3JQ9C 5AJWA 3TI7A 2X4DA 3CPHA 4YCSA 2GPYA 2YFKA 5HS6A 3MTBA 5CA1A 2OHVA 3KOXA 1JI0A 3VR3A 1D6SA 3COSA 1NNI1 4O8ZA 1GNLA 4EF4A 6NULA 4PZAA 2QXYA 1UZLA 5EP3A 3QEAZ 1CRPA 4YH1A 1TD9A 4Q34A 4B83A 3FZNA 4C2UA 3W6UA 3DLBA 2BAGA 5DNEA 3B53X 3HV2A 3T3MB 2FMKA 4DQLA 1S8AA 1XZFA 5CEJA 4JWKA 5K0FA 5A6SA 4M1TA 1U04A 5I7OA 1CEYA 4RJTA 3CZ5A 1NE2A 2E21A 4LWQA 4PQFA 2E87A 3P9ZA 1FJGB 2V3WA 3GUCA 1GSAA 4H0CA 3ZHYA 4M0UA 1C4XA 1D2GA 3JYPA 3QBTA 5JDIA 3N2YA 4RZXA 5JFTA 1EVYA 2HCFA 2O2JA 3U13A 4KSYA 4CRWB 2G4LA 5BV7A 5DM4A 1LY1A 3RODA 3EVGA 1SXIA 1KHTA 3AI2A 5HDQA 1B16A 3UUGA 1K92A 4QXMA 4GEKA 3E18A 2QMOA 2QD5A 1TAHA 2MIIA 4HDSB 4EY3A 5CLGA 4RF2A 1S2NA 2R1TB 3CBQA 1OOEA 2WSBA 3OZAA 2R7NA 2QEQA 5HZMA 3CJTA 1EUDA 3C6QA 3CUYA 1ZK2A 5IYZB 1KMMA 1P72A 2FEOA 1UJCA 3K9NA 3PNSA 1LJUA 2YWCA 3P9QA 1IONA 1OA0A 3VAAA 2EKQA 3WNQA 4DIKA 1FFAA 3N53A 4QBFA 5AOBA 1NQWA 2HRDA 2YWRA 3VOSA 2IIPA 5FBVB 4KO1S 1KP9A 2OE2A 4CKCA 3C3XA 3LK6A 4IVQA 3QI7A 3AQIA 4GXQA 2BUAA 1F38A 2FGJA 4GX0A 2QTAA 1ZM3A 3CNEA 4M6WA 5C1OA 1TM5E 3BJZA 3IH5A 4XD2A 1V3TA 3EA5A 4X1IB 5AYVA 4B35A 1ZL2A 4P3OA 1AXGA 4KAFA 5IAGA 5EZYB 1ZU5A 5C5CA 4ARBA 2NU9A 1IC6A 2BPOA 4C4RA 4LC0A 4WUVA 1VMEA 2IZOA 5K3SA 1N6HA 3HC7A 1V6AA 3INYA 1ORDA 3R9IA 5DN6A 1B93A 1MT3A 1PDWA 2IPXA 2VNAA 4NKRA 3HDJA 3DBRA 1H4VB 1Z17A 2OT3B 2PS0A 1R16A 1U2DC 2C2GA 2Z9DA 3IEKA 4J03A 4MIEA 1Y98A 3DDOA 3JWGA 2PD3A 2GHIA 2C7RA 4JWTA 5HF8A 4C5BA 4EYQA 2W6JD 4KIWA 4J3JA 3GJYA 2R8PA 1T5HX 2J7KA 3BDIA 3ZE8A 3BM5A 5LXTF 3P4UA 4OB7A 3V9AA 4OV6B 5ICFA 1GA1A 1N5OX 2R2AA 5A9TA 4F8EA 1DPFA 1YULA 2CFSA 3V7NA 4NBNA 4LG1A 1MHPA 2Q3BA 3FI9A 3UQZA 4BNKA 3G0DA 5F3RA 3I9JA 3ZQUA 2FPPA 2LDBA 4N6GA 4QDTA 4RL4A 4J76A 4BO8A 1XDWA 3C43A 5E7IA 1IHPA 3AGPA 2VF8A 2WMYA 4ZV7A 2JHPA 3U4QB 3ZTWA 3D3WB 2C7GA 4XQ0A 3WBJA 1T5DX 2FUNB 4C5CA 3SEQA 5KYNA 1G41A 2D7JA 2ODTX 3VU0A 1V8ZA 3HYCA 4PZCA 3UWDA 3FWPA 1UT8A 3CLHA 3KQQA 3GLRA 3GRKA 2IYZA 5ALUA 3C14C 1W5TA 3A4TA 5JXWA 5KYTA 2PWBA 5ALJA 1SKBA 3EUAA 3OQIB 2SBTA 1RHRA 2H08A 1NU8A 3AO0B 4IVPA 4M4SA 4RTPA 2VBCA 1OKKD 1UC5B 3D8RA 3DONA 2P5UA 4AUEA 4MQ4A 1P4AA 2MSEB 4P0TA 4RBNA 2R8XA 1FDSA 2REXB 1SELA 1YCGA 4PO1A 4C4AA 4EI9A 1YHZA 1Z39A 2ZYWX 3K2IA 4NYIQ 4QVGA 5KB3A 4U9IS 3RFFA 4E30A 2PGIA 4CCYB 4QU8A 2IVFA 5ETJA 3G0BA 1BROA 4ADSG 4G25A 5FR2A 2WYWA 2WTMA 1UDXA 3TD6A 2Y2VA 4OXYA 5B6JA 3VI3B 1ORIA 1UL1X 2RHWA 2YXLA 3ZWNA 4TYQA 4QTXA 1CU1A 3EWNA 3IP7A 4Y2PA 4EMBA 3HB1A 4MS1A 3SHTA 3ZG6A 2NSJA 1UPUA 3OJLA 3SF0A 5BWBA 2HTFA 5KCZA 1F2TA 4B2PA 2ZWPA 3RG8A 3LYHA 5BT8A 3V7FA 4JX8A 4L8WB 4NP6A 3LW8A 3HU1A 4ZCSA 1ECPA 3WBFA 4AWBA 4QYIA 3DOCA 2W93A 2V96A 4R5HA 5AVKA 3S1AB 3ZE6A 4ZZIA 5IDWA 5D51S 3AUXA 4D0NA 1I7LA 2PAFA 3NVKI 1YI0A 1TM1E 4MVJE 4YAJA 1I6WA 5KCMA 4EJSA 3ZLUA 1BMFD 4JOQA 2WM2A 3LFTA 4RDXA 5DOVA 4CKCB 1QH0A 2A67A 5LQNA 2YWHA 2I91A 2D00A 1CJTC 2I67A 3FZGA 3EYWA 4C21A 5KOJA 4PLYA 1XTKA 3RANA 4F1KA 3EX7C 4NDNE 2XA1A 3P19A 4B6OA 3DMDA 2QMQA 4LX0A 4HXFB 2CXOA 2V4ZA 3A14A 2H85A 3FGPA 3QVOA 4WFQA 2OZVA 1DT5A 3G2NA 4IMIB 1DDIA 4NENB 4C4SA 5AKGA 2AI2A 4DPMA 4WQMA 5LQMA 3ZCPA 1IMOA 2REQA 2RH8A 3C39A 4W7SA 3HR4A 1M6NA 1QIJA 2J3MA 1SBQA 3EQ2A 2X86A 2AG8A 1DQYA 2ZIFA 1D1SA 3DTNA 4OFBA 4ZA2A 3V4OA 3SOPA 3W2TA 3WRYC 3NHPA 1TK2A 3IV7A 1F8UA 3KYDB 5A5FA 1TTPB 2Z30A 5AKJA 4XVCA 3TX6A 3C5VA 4IL5A 3T1VA 1U6JA 1NI5A 4ZOAA 1KJZA 4L07A 5YASA 4TQ9A 4CGZA 2Z08A 4JDPA 2DPYA 4JT8A 4YAWA 5DTRA 3X2EA 3FPEA 5LCXA 4UEOA 4DQ0A 5BUSA 4PS1A 2JFGA 1ZJ6A 2KE5A 2HO4A 4PRZA 4F92B 1CVRA 2FHPA 4K6GA 5I8ZA 3L4SO 4OJTA 4DJDC 1ISFA 3OUTA 2HMWA 1LDGA 2O8CA 3GLHB 1MAAA 4Q4AA 5AI4A 4LXHA 4MGIR 4PE5B 3GMSA 1E3EA 1H05A 1KMHB 2SICE 4X90A 3TNFA 1O1YA 4BNYA 2W2OA 3TXXA 5CDUA 3X3HA 5L53A 4NCHA 3PXEA 5AVUA 4LMRA 4OBWA 3E27A 1THZA 2BRUA 2WUDA 1QGYA 4CQJA 4FU0A 3JARB 1MQAA