1PR6A

Escherichia coli purine nucleoside phosphorylase complexed with 9-beta-d-xylofuranosyladenine and phosphate/sulfate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
237
structure length
234
Chain Sequence
ATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRQTTAAERQTTFNDMIKIALESVLLGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity of Escherichia coli purine nucleoside phosphorylase.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 81
structure length 234
sequence length 237
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pr6A00
4UC0A 4M3NA 1K9SA 4D9HA 2ISCA 1A9OA 3DPSA 4TXLA 1PK9A 4OF4A 2H8GA 4MARA 1T8YA 4IP0A 1JE0A 4JOSA 3BJEA 3NBQA 2GUWA 3PHCA 1U1FA 1ZOSA 4TXMA 1JDZA 1WTAA 1VHWA 4L5YA 4I2VA 5F7ZA 3OZCA 4DANA 2HRDA 5EFOA 3DP9A 2IQ5A 3OF3A 2OC4A 1ODJA 1LV8A 1RFGE 2B94A 4WKBA 1JDVA 3KU4A 4YNBA 5B7PA 5K1ZA 3TL6A 3QPBA 2I8AA 3BGSA 4WKOA 1JP7A 1JDUA 4WKPA 4TTIA 1Z38A 4G8JA 4LNHA 5F77A 1PR1A 3UAXA 4DA7A 3BSFA 1RXUA 1VHJA 1OVGA 2XRFA 1V48A 4F3KA 4TTAA 4TS9A 1SQ6A 4YMLA 1Y6RA 5JPCA 1JE1A 1PW7A 3KUKA 1TCVA 2OECA 1V41E 3SCZA 1A9PA 2A0YA 1I80A 3KVYA 5ETJA 1Z5NA 5CYFA 1ECPA 1Z34A 4TXJA 1JYSA 5I3CA 4OGKA 4E1VA 3K8OE 4L5AA 4RJ2A 3O4VA 4L5CA 1Z33A 2QTTA 3FWPA 1JDSA 1TGYA 4MCHA 1V4NA 5F7JA 1ZL2A 3U40A 5CXQA 4DA0A 3LGSA 3OOEA 4U2KA 1YR3A 1NW4A 1RR6A 1XE3A 1Y1TA 4DABA 3P0FA 1A9TA 2QPLA 3EEIA 4F3CA 5IFKA 4TTJA 3E9RA 4OJTA 4K6OA 4BN0A 4D98A 2I4TA 3ONVA 1A9SA 3OCCA 1T8RA 1Q1GA 4BMXA 1Y1QA 4F2PA 2OC9A 1FXUA 4DAOA 3E9ZA 4DAEA 1PR5A 1U1CA 1YRYE 4EARA 4JWTA 4NY1A 1K3FA 4WKNA 5F73A 3E0QA 4OY3A 1PR0A 1OTXA 4G41A 3C74A 3UAYA 1LX7A 4EB8A 4TXHA 3OZDA 2AC7A 1OU4A 1V2HE 5B7QA 4NSNA 1QE5A 1VFNA 1OTYA 3IEXA 3NM6B 5CXSA 1Z5PA 2P4SA 1Y1RA 3ODGA 1RSZA 4LDNA 3K8QA 3GGSA 5EUBA 2ON6A 1RCTE 3OZBA 4M7WA 4LZWA 1N3IA 4DA8A 3NM4A 1VMKA 1OV6A 4G89A 5DK6A 3OOHA 3FOWA 3DDOA 2OXFA 1T8WA 3DF9A 4DARA 5F76A 3PHBE 3EUFA 4F1WA 3EMVA 1CB0A 3KHSA 1ODIA 2QDKA 3LBAA 1Z37A 1Z36A 1Y6QA 4MCIA 2HWUA 5B7GA 5F7OA 1V45E 1ULAA 4YJKA 1NC1A 3NM5A 1YBFA 2AI1A 3LA8A 1C3XA 1CG6A 1SJ9A 2BSXA 5B7NA 1YQQA 3FAZA 2A0WA 1RT9A 3OZEA 1A9QA 4TS3A 4R31A 4QEZA 4TYMA 3UAZA 2A0XA 1YQUA 1M73E 1PF7E 1A69A 3FUCA 5C80A 1Z39A 4GKAA 4PNPA 1G2OA 4F2WA 3O6VA 1B8NA 3UAWA 4LKRA 1U1GA 4ECEA 5CCDA 4L0MA 1ULBA 2HSWA 2HN9A 5FAKA 5CCEA 1ODLA 1JPVA 1Y1SA 1V3QE 5EPUA 1Z5OA 4WKCA 4X24A 1RXCA 1PBNA 3FB1A 4QATA 1A9RA 1PKEA 1PR2A 3KVRA 3PNPA 2QTGA 3KVVA 1B8OA 1SD1A 3D1VA 4QASA 3UT6A 4FFSA 1JDTA 4R2XA 1U1DA 2A8YA 3DJFA 2Q7OE 3ENZA 5CYGA 2AI3A 1T8SA 3BL6A 1PWYE 3F8WA 3INYA 5F7XA 1U1EA 4DA6A 3UAVA 3P0EA 4GLFA 4H1TA 1OUMA 1LVUA 3IOMA 1TD1A 2AI2A 4GLJA 4JP5A 4M1EA 4D8YA 1PK7A 4P54A 1SD2A 2QSUA 3EUEA 1NC3A 4D8XA 1PR4A 4L6IA 4BMZA 5KB3A 1RXSA 1TCUA 3FNQA 4LNAA 5F78A 3T94A 4PR3A 1RXYA 3OPVA 4R2WA 4NS1A 3MB8A 4QARA 2PGAA 4OEHA 4TXNA 3GB9A 1ODKA 5IU6A 1RYZA 4GMHA 4D8VA 3MMSA 1K27A 1Z35A 1TGVA 4QFBA 1PR6A 4BMYA 4QAQA 2RJ3A 4OGLA 1T0UA 4KN5A 3PNSA 4YO8A
chains in the Genus database with same CATH superfamily
5DFAA 3WGGA 3UV3A 4MUJA 3ZCUA 3OE7A 3TQHA 3MFQA 1RWMA 2F9LA 1W0KD 5FF9A 1H4SA 5CW2A 3MS2A 4D9HA 1Z6XA 2QIOA 1VXRA 2IYUA 4FWIB 5HTKA 4AZSA 5C7OO 1KQ3A 4WESA 3DPSA 3ZVNA 2O8FA 4HDSB 4QZVA 1OPXA 4YCBA 4QBFA 5FBLB 1IQRA 3CU5A 4CT5A 1D4FA 4C3OB 2FHSA 4PHTA 3LQ4A 3RREA 5DHSA 2OHOA 2DHDA 1VJ5A 3BSYA 4P4SB 2CNBA 3G9QA 1H4QA 1T9BA 4NH4A 3C3PA 1Q95A 3NBXX 4JYMA 4TSRA 3GHHA 1QMPA 4FW8A 1PU2A 2QRGA 5HS6A 2DULA 4ON9A 1AA6A 4HSEA 4MK4A 4N0QA 4EMSA 4FGZA 3WDKA 1S1MA 1ZC4A 4EVQA 1NLFA 3BEDA 4FYMA 4MINA 1Z2NX 1QFXA 1JNYA 2X0KA 1QRAA 3FETA 1HA3A 5D1HA 4LYJA 5L3VA 1G20E 2FPUA 4Z5XA 2WYUA 2XUDA 3C3KA 4RSHA 1L1RA 1VJCA 1W29A 4FS3A 5EFOA 2NQ2C 4CKBB 4WCFB 4ZVTA 3BL5A 3CRNA 4CMGA 2PZBA 3F6SA 2SBTA 4G25A 221PA 3WSTA 1B41A 4ENVA 4LRTB 1AF7A 1DIGA 3H6HA 3JATB 1JIIA 1FRFS 2CZQA 4PO9A 5LQSA 4DJFC 1GWNA 5IBCA 3CKYA 1JFFA 1YRBA 2AZTA 1AZSC 2XJ4A 4OXIA 4JDUA 2P2DA 5JMPA 2FSUA 2R7MA 3CSDA 3PLRA 2X8WA 1WMSA 1Z4PX 2Q9UA 3A11A 4LRYA 3TZCA 1YB2A 2G83A 4RADA 1UANA 4AW9A 2PFSA 4LOKA 3T7KA 3ZGXA 3JPYA 2FLVA 1Q14A 1GPWB 1NT2A 3HVUA 3RBZA 1FFXA 2DKFA 1A8IA 3C5HA 1T25A 3HBJA 1E1RA 2CJFA 4HAYA 3VVLA 5CA1B 2H1CA 5CFQA 3VNRA 4CKCA 4G8JA 4E07A 4M98A 2IXTA 3WRVA 3UMVA 6REQB 1YZHA 3TZBA 5EL0A 2ZQ5A 1U9IC 1PJLA 3G79A 4BLUA 1MNAA 3IUQA 2XQVA 3LTNC 4ZAFA 5LLTA 2NVOA 3OY7A 3RVNA 3UAXA 4RK0A 3ML1A 1HRKA 4UEKA 3R7WB 5AJXA 1SXGA 1CP3A 1ZONA 3GH1A 4J0DA 4JHXA 3QEAZ 1OVGA 4MW0A 1VI2A 5AW5A 3EW7A 4RTMA 3FLAA 2ZM5A 2Q4DA 3NHUA 3A1TA 3UCXA 4F3KA 3P2KA 2E21A 3AVTA 1SQ6A 2P5SA 5BR1A 4NJMB 5L3QA 4R3WA 1JG1A 4P80A 4KPEC 2BRUC 1XTIA 5TY0A 5BN3B 3EGOA 1ZA1A 3IELA 1GLGA 1PV2A 1GG9A 1NAIA 2Y68A 3H99A 4M60A 3V1NA 1H0KA 1W4CA 2GM9A 2WD8A 1G9TA 3AR6A 3DTNA 5EHNA 3RUHA 3RU3A 4ATNA 1V9LA 4OQFA 2ZETA 2ZRQA 4HWPA 4L4ZA 2O7NA 3ND5A 3KB1A 5IVHA 3BB4A 1A9PA 3H75A 2NZ2A 1EU1A 2EV9A 1EFUA 2IEYA 1TYBE 1U0HC 4V02A 5FLKA 4DDTA 3UKOA 4KLAA 4ZOLB 1IN5A 4M76B 5EWLA 3WV4A 3BIXA 2F1HA 4A4DA 3FYDA 4WFKA 4DMCA 3SYKA 3GROA 3O92A 2XMRA 5K05A 3ETHA 1XZAA 3C87A 4I99A 5F4ZA 4N47A 1JHAA 4C4YA 1KKMA 4YFYA 2GEUA 3SJCA 3K8ZA 5ALWA 3TOXA 2EKPA 3D3WB 3WBKA 1NP7A 1X8JA 2A0FA 3T7RA 1H9CA 1I0IA 2JBHA 5AKYA 4YBZA 4MEAA 1C7ZA 3S8YA 3W04A 3AW9A 2PT5A 3B3GA 3U4DA 4ZV4A 4CCAA 3I0ZA 3UJ8A 1IM8A 3RTBA 2JCXA 2I7TA 3KR2A 5EXDA 2JRLA 3VR6D 3EE6A 4X71A 3T7SA 1IJKA 1J7KA 4CE6A 3N0WA 4DQXA 3SBEA 4EA7A 3MXTA 4ESOA 4L4XA 1F14A 5TGDA 4ZDKA 5LNK1 1NYQA 2QG6A 4ZQHA 4B7ZA 3NTOA 4LX8A 3QEKA 4MW7A 3TLAA 1MBZA 4Q7QA 1JT2A 1XHLA 4UU7A 4WSOA 3BIOA 3H5TA 1PTJC 1N2GA 1P8AA 4LV8B 2Y76A 4W82A 1DSSG 1RE0A 5IW8A 3OP1A 1KO8A 5JR3A 4Z8YA 3Q8KA 1EBBA 3QYFA 1EEXB 3HGTA 4ARVA 3D1LA 4BNKA 1RJWA 1XBTA 1FP2A 4CMJA 3ET4A 1NW4A 3O75A 2BJVA 2W00A 4LIPD 4QDTA 5E3JA 5KTTA 1DJLA 1DC3A 3UICA 3WLIA 1Y1TA 1RYMA 4DUGA 5CRIA 1A0OA 1S3SA 4O33A 5CDYA 3BD6A 1C8BA 2ORYA 4TLBA 4ND8A 3WDSA 2ZE5A 3ZQJA 4XFDA 1QAQA 1P5ZB 1QH1B 4KCGA 4NU0A 4CKEA 5KQPA 2R7AA 4MV4A 3EC1A 4JA2A 1HLPA 2Q5LA 1II0A 1PV4A 3AP1A 1XGKA 5TPZA 1CHNA 2TRSB 2X1HA 4EG3A 8OHMA 1COWA 1YIDA 2IT1A 3LIPA 4D9NA 1J2YA 1X70A 4DLSA 5FWYA 4QECA 2UZ1B 2Q9AA 1NYRA 2RAUA 5FTKA 2IX9A 3HH8A 1OBCA 2DCMA 4LTMA 3KQPA 2A9PA 3ECCA 4OOEA 1TQ8A 1W6UA 1XJWA 1SMKA 2I65A 2P7IA 3GZ4A 1A8SA 1H85A 5DWDA 4WDQA 1O0SA 2XA9A 3CZ5A 4R8KA 4L08A 4RQUA 2JIDA 5MHTA 3DE0X 3S8EA 1ZJ5A 1GZ3A 1MC5A 3ZLTA 1U1IA 3Q3CA 4IPTA 5EKSA 4JBNA 4DUGD 1XLWA 1U04A 1GCUA 1DBSA 2PH7A 4MYHA 4OVKA 1GT6A 3VU3A 3PFNA 1NSTA 1GPYA 1W9HA 1WMFA 1N75A 4ZD6A 2H9IA 1D5WA 4A91A 4AG3A 4WXRA 3ABRB 4G5HA 5HRAA 1DQNA 3PX3A 4I8IA 4LQ4A 5HM8A 1JIJA 1NMXA 3D8UA 4F9EA 2LNDA 5EE0A 5HUQA 3O8RA 8ABPA 1HYHA 4AZ3A 4OI0A 1VFNA 3C41J 1FDRA 3KFXA 4L15A 4NXNB 2C9OA 1I10A 4GYKA 2FSPA 5JDIC 1OZ0A 2G0TA 4INOA 5G0UA 3L18A 4P81A 4HQKA 3T7JA 1SQSA 5A5VA 4FS8A 3NRJA 3BQ9A 3ICCA 2O5VA 4IZOA 1ZGAA 2I4MA 3RIMA 1F0NA 2BBTA 1RU3A 4GL4A 4AQYB 1ZLXA 2CUZA 2ZCVA 5KYXA 1MXFA 1KKLA 1KAHA 4FD3A 4WLOA 3KP1A 1T5IA 5LYJA 3BK7A 4FT4A 2BELA 2D2XA 3IAM6 4FYJA 1GKUB 1R4MA 3QF4A 3U44B 1D8AA 3DDHA 1PL6A 2G4VA 1S8OA 2DBYA 4WEOA 4DMFA 4XWWA 4ZTBA 1A2OA 3HGQA 1TA9A 4Z3DA 4DPKA 4DXDA 4D3SA 5HCUA 2Y9MB 4QYTA 5I4BA 4M4SA 3OFND 1LF0A 5JJ5A 2H07A 2Z6AA 1F0KA 1OV6A 5JASA 3RGWS 4N82A 1F7VA 2H7CA 4DADA 1VIDA 3GJZA 3VR3D 1ZUNA 4KFRA 2CXQA 3IP6A 4NOJA 2QL5A 2Q3EA 4IOMA 1P5JA 5GV7A 3ER8A 1C2TA 1XAIA 3ADKA 4M6WA 1F2UA 4PFKA 1BDHA 1YI8A 4PSDA 4LQLA 3VGPA 4OATA 5BNFA 1N0UA 2FPIB 4HAWA 4L5IA 1QIFA 1O96B 1E3QA 2R8XA 5CX1A 3TGPA 5K3OA 1CNFA 1WPXA 4MA4A 2HSGA 5HBGA 3JX9A 1J07A 1E2UA 4AKHA 3LX5A 1G4AE 1V25A 1WUIS 3OCXA 1WR8A 2XA1A 3EWNA 2OCBA 4URWR 1GFWA 3WQRA 3EDYA 5KQSA 1JHUA 3CUUA 5FI0B 4A23A 1P3Y1 2YRWA 4X00A 2GEBA 1JKJB 2IZZA 3EXG1 2YY5A 5MGBA 3UHOA 1TT5A 1C7QA 2ONKA 2P9FA 4UBNA 3V00A 2A9VA 4NJOA 2VQEB 2J08A 3FCYA 4PZ0A 3I2FA 4MGZR 4MLPA 4AJ9A 1UKCA 3CBGA 1TB4A 5I48A 2CDBA 1KFKB 1VI6A 2NNWB 1GNRA 1X7WA 2ZRNA 1M72A 5J47A 3RVMA 5HKLA 1T9GR 5TQ0A 3OZTA 1CZNA 1NGSA 3FOAA 4GW3A 2XWJI 3LT0A 1UJMA 2QRNA 3PCXA 3E5MA 4OHWA 4B6SA 3PP8A 1PGPA 2E48A 2YTZA 2C7GA 2FRVA 1E5QA 3AF2A 4W8GA 3M4YA 3RC2A 4CMIB 2J9YB 4HB4A 4F91B 4DUYB 3NAQA 4W1RA 5D85A 3OC6A 4GP7A 4F1JA 1L1QA 5REQB 4W1PA 1WAMA 2Y1CA 3FUCA 5AUPB 3C85A 1YBHA 3LCUA 4Q4JB 2K5UA 5HIKA 3SYTA 4MW5A 1BU8A 2P67A 1KETA 1SVOA 1NYLA 1UK8A 4NEHB 3ZHCA 2QZJA 3BDIA 1TPYA 4HFNA 1A95A 4Y1RA 5KJ6A 5HMLA 1VHQA 4NARA 1XP8A 3HCWA 2W6PA 1ISRA 1QOQB 1PEDA 3SAJA 4QD3A 3FZQA 4PWZA 1B43A 1HOTA 4P83A 3DYBA 3B51X 1ML3A 1A4UA 1QQ6A 4U7GA 3ZD9A 1V9SA 4YAUA 2Z1DA 4F92B 1A5ZA 1QTNA 5AVTA 1SZDA 1EP1B 4L8GA 1L7OA 7REQB 4A0HA 4IG4A 1T8UA 1K3UB 2HN9A 1VFPA 2VJMA 1ODLA 1QQ7A 4E6EA 1UAAA 2E5LB 1VA5A 4DZTA 2NTJA 4EGFA 1JFSA 1Z12A 1N8SA 4EY3A 1PJRA 1I32A 1RC0A 3G7NA 3ILVA 4X24A 3ZNQA 2A5FA 2OMEA 2NO1A 4BEWA 5J1SB 4JX8A 5C1BA 3EC7A 1HR0B 4GVPA 5KCMA 1HE4A 1U9YA 3F2VA 4FFBA 3OHSX 3PNPA 2RB4A 2HRQA 2GAFA 4YCMA 2QTFA 1XT6A 1GXSB 1K0UA 2HBZA 4B6EA 3H16A 4DXAA 5HQ3A 2P3LA 3LZDA 3BH6A 3IQWA 1DS6A 2HU2A 3L7LA 1JKIA 2QJRA 3VHXA 2J5XA 3RWOA 2FPSA 3QKUA 3E23A 2G5GX 4MQEB 3VO8A 4CG3A 3ZLVA 4B3BA 1DOZA 3RSGA 1MV8A 2ISQA 1X3SA 2BCEA 3D8SA 3ANYB 1DX9A 1BRMA 5H0IA 2BFBA 3HJHA 3FGOA 1UH5A 2GBPA 2BFDA 2C5EA 2MSCB 3COVA 4HFMA 1PUJA 3N1UA 5EYPB 4E5SA 1B8UA 2ZRHA 5A1JA 4KV7A 5F7XA 1C5KA 1NBEA 1QQ5A 3OE4A 3IEUA 3IHWA 5H3HA 1EM8B 1QHHB 3RJTA 2DQSA 3T9CA 1QNLA 3HP4A 1RWKA 8GPBA 3GDOA 2EJCA 2EZ9A 2P2ZA 4B43A 3RU9A 4UHCA 5BO5A 2V1UA 1AKTA 3L7BA 3WGYA 1M2OB 3RUPA 5IJZA 2JATA 4H4DA 1Z73A 1T35A 4XM2A 1QO0D 4P3OA 1HDOA 2A9KA 5JXHA 4F6RB 3L77A 4RXTA 4N5LA 4YCLA 1JHOA 1T5DX 1PZMA 2YS7A 1Z4JA 3KDSE 5JATA 5BPFA 3VTKA 3ZTWA 4BC1A 1HF3A 1F0PA 1D2NA 5C1OA 1QYDA 5IKEA 3GW8A 5EJ9A 2PZGA 2PTHA 2Q3LA 1QZXA 4KYVA 2PYZA 4E09A 1MB4A 4DZZA 4AZ0B 1TIKA 1JQBA 4HUJA 1VKHA 1NONA 2GHRA 4J4TA 3FPKA 1ACJA 1P0FA 4PC7A 1YS4A 3I04A 3SHWA 3W5HA 1SK8A 3AESB 5IAKA 1Z75A 1D4OA 2B99A 1F8GA 2XNDA 3W3AA 1GNPA 2B82A 1XZIA 2C61A 3DUFB 3I39X 2OQRA 5G3YA 1M6WA 2B37A 3TSZA 1RXYA 1M2WA 3LX8A 4PC3A 3OTQA 4MQLA 1A5TA 1FFEA 4X7PA 2VZ0A 1MX9A 4HX2A 2MSEB 2P4UA 4MIEA 3E9QA 2XE6A 2JC3A 2QPOA 3EPKA 3M6FA 1UP7A 5B1DA 1P9NA 2OL4A 1DX4A 2BZGA 5CFNA 2AW3A 4GMHA 5KIAA 1MEJA 4UD2A 3LIIA 2WWVD 4YMHA 4BKRA 5AHXA 2WSSA 3LD9A 4DIEA 1MFPA 4HH0A 4KVFA 3X1KA 1V47A 5C4MA 4ECAA 1BH2A 3EY4A 4DLAA 3TOSA 3BRCA 3U0BA 2W2QA 4EW2A 3FR7A 5FH9A 2RHGB 3IAXA 4DILA 1GPMA 3QPDA 4OOFA 2JGMA 2QV7A 3WLKX 4EKIA 4DGSA 1YFZA 2E82A 3N7TA 3F6YA 2BW0A 3WLNA 5KWJA 1ZRSA 1JJIA 3FFAA 3TTUA 5HIAA 2CLIB 2VRNA 2Q5HA 4XQ9A 3CPHA 5FX2A 3ORHA 2FMKA 1WTCA 1W88B 2B4AA 3UMSA 5KMGB 2O8CB 4ETNA 4LE1A 4XZ3A 1GTSA 4NNOA 2Q4OA 1IHPA 2AN5A 3UW1A 4RIGA 3N53A 4EPTA 3O94A 3WLHA 1AIPA 5K3FB 1F2VA 3RS2A 1BX1A 1ZXBA 3L4BA 5DBEX 4EOGA 1CY2A 3U9SA 4RFSB 1U0LA 5J5CA 1IATA 2ZS9A 5TNXA 4AKTA 3X0DA 3LBNA 1RPJA 4M0KA 1Z26A 4RV9A 2QBYB 4FMDF 3LUCA 4K6GA 3N76A 4WINA 5LZ5A 3RYFB 2ZSFA 4QEKA 1WMDA 3RC8A 4K7JA 4MV1A 2BEVB 4HLQB 1F6BA 3C45A 4R68A 4OJMX 1EJBA 4B5KA 4L7VA 1X8XA 1XWIA 4F4DA 4X6LA 2E87A 2JGRA 2EKZA 2FZWA 4LRWA 4ARBA 4CM8A 1VPLA 1P0QA 2YHAA 3CE6A 5ALOA 1RQRA 1V6SA 5F1OA 4GT1A 4AY5A 2X0JA 3RTEA 1CWUA 1D4ZA 1PNOA 5D6OA 2BFNA 2J8ZA 2ZUSA 2H5IA 3KYCA 4GRIA 1O6GA 4GMKA 2NYRA 3VVBA 2FPGA 3NV7A 3ZVLA 1NHWA 2X5KO 3I0NA 4M37A 4P82A 3UK6A 4A03A 4CMEA 4BP3A 1EA7A 5D5QA 5AHRA 5HZGA 5KJEA 1KIFA 2DETA 1UBJS 2AOUB 5MN6A 2O5RA 5HNKA 3EGWA 4AJIA 2W6NA 5BN5B 5DBOA 3H11B 3LOQA 3MTEA 3ZHBA 3PUWA 4DS3A 1K92A 3WS7A 3DEKA 2QYHA 3SFTA 3C24A 2JAHA 5HF5A 2JI9A 3VPCA 5T6MA 3WLPA 2JAQA 3PVZA 4CL2A 4YRJA 4OYHA 1W93A 4YDQA 3CNQS 3TVTA 4IDGA 3QX8A 4F4FA 1R0LA 1R4AA 1WDMA 4WY5A 4F97A 1YB1A 3HXQA 1TUIA 2O59A 1GN8A 4RJTA 4NG5A 4DA7A 1WX1A 5C4IA 2BMAA 1E1YA 3MSXA 4EW3A 1KZ1A 1KO7A 3K1AB 1U7TA 3MJFA 3K9LA 3L7JA 5FAXA 2JI6A 1WLSA 1WKBA 3AHIA 3HG7A 2XRFA 1ZI8A 3UWPA 4DV1B 1XL0A 1NYTA 2G06A 4C4SA 2G9NA 1ZKDA 3KTAB 3VJRA 1E9BA 1NQWA 4E2FA 3UYKA 2E3JA 4KXMA 3P9QA 5EEHA 1P2BA 2BMDA 4RPLA 3WYNA 5DRYA 3HR7A 1FTSA 1QANA 2JBAA 4WGFA 4PSUA 4ZO8A 4BN4A 4GGMX 4XA8A 1LFDB 1H66A 3QVOA 5LU8A 2B8JA 2HRRA 2H0QA 1DIRA 2H06A 2PGXA 4WFIA 4MIKA 1R12A 4LZLA 4MJXA 4R8SA 3WGTA 1G6HA 2J31A 4KMRA 1OX4B 1BWPA 3X44A 4D02A 2HD4A 3DE6X 1D4AA 1IEWA 3HKEB 3M9LA 1QG4A 3QFRA 2QTNA 4D5EA 4ZHQF 3LKVA 3IBYA 1I7NA 1EE2A 2OCIA 2WFLB 2XITA 4PE5B 2F1JA 3GELA 2IA5A 1REQB 3L6BA 3ZXXA 4E2ZA 5JCXA 4ZMRA 1Z8FA 2RK4A 3E53A 4F86A 3D8BA 1P1BA 2UYOA 4XARA 1LBHA 1WB4A 3MOIA 2W6CX 4HAXA 1YCDA 4PGAA 4NYJR 4B82A 1JMVA 4Q03A 3R5KA 2X5JO 1KAQA 3GEIA 1Y9DA 1ZU4A 2WD7B 4CNQA 3WGHA 2HREA 5C52B 1NBWB 4OAOA 3U44A 1GL9B 4J0JA 2O0HA 3DE7X 1HRDA 1HLFA 2V6MA 3HPQA 2HB6A 4PONA 5YASA 3UG7A 3TRJA 4D92A 3VDRA 1JKMA 3S55A 1I7SB 2OGZA 2X7JA 2WJ4A 1VZ2A 3FVWA 3PFIA 2ASVA 3Q9NA 5HF6A 1YQGA 2C2GA 3JZMA 4KH0A 2RONA 1G21E 1PT5A 1YAHA 2NSHA 5FWYB 1RM5A 3GHYA 1O2DA 1VGVA 1WEKA 5CLQA 4GBJA 4A26A 1E2KA 3DLPX 4NHEA 4L0QA 4US2R 2C83A 4MKZA 4C89A 1NSFA 4TTQA 2D7DA 1ZXLA 2BGTA 4FCCA 4GZ6A 5L9AA 2J41A 2NZWA 4CPDA 4MVJG 4YV1A 1JTFA 4IW3B 4BQNA 4JCCA 4TGLA 1DIOB 3RS5A 4QO8A 3VV2A 4I14A 5IXSA 1TUEA 1MD9A 3I9V6 4MO2A 5HILA 4KO1S 1HETA 5BSTA 1I01A 3WA6A 1W52X 4BQPA 1V71A 5FFMA 1WPRA 3T4UA 1AHPA 1RKQA 1ATIA 1C9MA 5A0FA 2GYYA 3V48A 3ZDXB 4EB3A 5JC8A 1NM5A 2VJQA 4PX9A 1RRKA 2IYRA 4R8LA 1MW8X 2AQ8A 1PYOA 3HP1A 3W2TA 4NZZA 2DF8A 1F8YA 4N9QA 1NN3A 3HN2A 4DCGA 5B64A 3WAJA 3W9SA 3AMVA 1JEAA 3Q7QA 4YTEA 1CUUA 5CFMA 2UYQA 5ALDA 2QLLA 2VHCA 2QF7A 3FDIA 3PIDA 4XIJA 5B6IA 4CKCB 5L40A 2XYPA 3WGZA 1CF4A 3MTIA 4D98A 2I4TA 1NRJB 4KXXA 5FI1B 4PCUA 1QFJA 1U2EA 2XUOA 5ICSA 3WL8A 2WZCA 1VJDA 5BN5A 1G8JA 3REFA 4BMXA 2J4DA 2HSDA 4Y9UA 4EF5A 4CMHA 4D8UA 3GEHA 1R5BA 1KRXA 1BAPA 4DUPA 4ZTZB 4BIMA 2IZ0A 1YL7A 2CFIA 1I0ZA 2NU7B 2IU3A 1VLMA 2Z3VA 3AIOA 3CUEF 2OCGA 3FDFA 1YJAA 3GJQA 4HVTA 4II3A 3SNHA 1SVNA 2AXNA 2QZSA 4FGKA 1WXEA 4LXHA 1SRQA 2JD0A 3BRQA 4Y1FA 3RFVA 2OQIA 1P7ZA 5K6TA 1O94D 3BKXA 1EVLA 1VMIA 2PE5A 1P74A 3AU9A 4EEXA 3E1KA 4G0MA 2O7VA 1D3AA 1SCQA 2ZP1A 3GUUA 4JKIA 3RIXA 1RXWA 4MGIR 1NTOA 3M6VA 4YHHB 3YASA 4CVNA 4X1YA 4N0DA 4DCNA 3CY6A 1GM5A 1T1RA 4HMQA 2YMQA 4M0DA 3OJWA 4KXWA 5K51A 3E61A 3GLGE 1RZUA 4FB5A 3U3XA 1L9KA 2XQKA 2PBRA 1IPFA 4X7MA 4EI8A 1X7XA 3DB2A 3NH9A 2Z09A 3M82A 5GZ3A 1XDUA 4MP6A 5B7QA 2YH2A 5CD1A 1N9GA 1F8FA 4WKGA 4M9UA 3U9TA 3ZDZB 2ZAMA 2EFDB 2MR6A 1VJGA 1F12A 4TSFA 1DC8A 5HCIA 4CF5A 2WYVA 4JJKA 1DE0A 2PX2A 3UFXB 4C1NA 1KEPA 3ROZA 3OQPA 2XWSA 4IEEA 5LD2C 1O0CA 1GV0A 2HLDA 4IY1A 1QHNA 3PYMA 3W5JA 3K8QA 4MS3B 4L28A 1XPJA 3DYVA 1RHKA 1I7PA 2PLWA 2VJKA 1AUVA 4LMRA 3A3YA 1UAGA 1M54A 2Z5FA 3ROKA 3GZTB 3AVUA 3D3NA 3ZIAD 4RF2A 2YHIA 2V4UA 1EFPA 1H1LA 4RTOA 1M8FA 2AMFA 4ZOLF 1IM2A 2LKCA 4UBOA 4PN7A 3N2EA 1YRHA 4J2HA 3VX4A 4AMBA 1QSGA 2Q4BA 3F7TA 1Q77A 4FCVA 5AXDA 1JUDA 4QL3A 3WKBA 9LDBA 4Q48A 1Z6QA 4RVFA 5E95A 2IS6A 5CM9C 1G8AA 4Q9DA 2DTEA 3MOSA 5TPWA 1E6LA 2ZRIA 1Q21A 5AOCA 4C76A 4IDDA 4JXXA 1XCJA 3HCOA 4KZPA 3ZC3A 1OAKA 4QXRA 2C82A 1KI2A 1L7NA 2VWHA 1NMSA 2OXFA 3O5AA 3RFFA 4ZICA 1PGJA 3RRFA 3V9AA 1B73A 2PYDA 3NDPA 3QG5A 4PYMA 5F21A 3RASA 4PZDA 2VZ8A 5K8IA 3EVEA 5EMNA 1PJAA 3EXEB 1EM8A 3TPZA 3UOWA 4C7OB 5BSGA 4PC1A 2DPHA 3UZUA 5CM2Z 1OI4A 1AQIA 2ZBEA 3Q3VA 3SMVA 1FYEA 2VJYA 3JU3A 3KJEA 3PXUA 2VZLA 4RIEA 3U62A 4AECA 5CFZA 2Q3CA 2GKOA 2BMVA 4L75A 1L6RA 4J6FA 2FRXA 3PBKA 3KT6A 4OXKA 1MVOA 4CTNA 2C8LA 1GPNA 4MCIA 5D5PA 3QE9Y 3IKTA 2AJBA 3IIJA 2XH8A 3JYHA 1MKYA 2V7UA 4ZN6A 2IFTA 2OD2A 1TUGA 4I55A 3OPYI 3GEEA 1JEEA 3GR6A 5CP8A 3THYA 2P0YA 4I50B 3A06A 3GEPA 2FQWA 4OGWA 1YFJA 2Q99A 4DMRA 1BHO1 1L3IA 4AULA 4G5SA 3EF1A 3RLFA 4QU8A 1XRSB 2ZXFA 4L07A 3G2QA 2XGMA 2PJUA 4NBWA 5FPPA 4W7SA 4AFNA 1KR5A 2IP4A 2GX6A 5FFFA 1OWPA 1M34B 1NW6A 4JL8A 1Z8NA 4MWCA 3IMEA 1N8TA 1IH8A 3VC7A 3EPLA 1QGOA 5AMXA 5JSFA 2G76A 2Y1LA 1QVVA 5CBPA 4MUAA 4Y9TA 1ONSA 5FIUA 4CDRA 2ZJ3A 1DFGA 1GY8A 4H3VA 4LV6A 1N6LA 4L50A 1HNZB 3A31A 3NI2A 1YDWA 5K0SA 3ROPA 4BBPA 3B1VA 4EG6A 2OGTA 1T5SA 1LK7A 3OICA 1SM4A 3DVQX 4FQ5A 1DCKA 1ZWKA 3CJTA 2EOAA 3NONA 4YP0A 3OCJA 4AG6A 1EUYA 1E3JA 3AHEA 4RFVA 1OFTA 4JBLA 4B8ZA 1ENZA 4ZCMA 4KWHA 4UAUA 2ECQA 4PG7A 3FCXA 4P3KA 3FVVA 2CD7A 4V1CI 2F7SA 4K9LA 4NP6A 3V8NA 1BOFA 1CE8B 2PRSA 3C3MA 3MZ0A 1UBHS 3R8CA 2UUAB 2H4XA 2EBFX 3EEFA 3D3QA 5B30A 5ABPA 3S2IA 3RQIA 3MC1A 1B0ZA 1L5WA 3CZ9A 3LDUA 3MJDA 3SS8A 5LLDA 1EJ0A 5EE3A 4QUEA 2XNCA 3CVUA 4NICA 1XKTA 4Q9AA 3WI7A 3KC2A 3O03A 4IQFA 4PG5A 4RABA 4AICA 4E70A 3IUPA 1S8AA 3L7IA 4R81A 4I9HA 1Y9ZA 2KJQA 3B7PA 3CCFA 4ESEA 1TKAA 1Z47A 3KVRA 3IAM1 1Q7GA 2VTEA 4YJ3F 2EHDA 1E2DA 3EC2A 1WZ2A 5BQ5A 1HNXB 4WNIA 1WBBA 3TNYA 2CFOA 2UV8A 4MNTA 1A4IA 3A14A 1CUDA 4U02A 3SC3A 4ABTA 3RWBA 3W5AA 1NRWA 2P9ZA 4NESA 1G9SA 4JWKA 3UJCA 4KSYA 1YHYA 1GGHA 2V7BA 1RBMA 3CCBA 3NJRA 3PJEA 1XZFA 2ZAOA 3AERA 2XGGA 1JHRA 3GEBA 3QTLA 3EA0A 5E2IA 5BV1A 4ADSG 2PLNA 2CCKA 2IBMA 4I1RA 2FPPA 4IDQA 2M9MA 1N3LA 2OAEA 3PHGA 4QUJA 1VKJA 1T8SA 4E32A 1SQFA 5B2EA 3CLTC 3SQDA 2QP4A 3SR0A 1NF8A 2PX5A 1QKJA 3RRYA 4JC0A 2A84A 4YRBA 3T6KA 1JZQA 2B34A 4GBED 1WB9A 1LJ8A 2OCKA 3G23A 3TJRA 2IEGA 1YUMA 1UMKA 2QUKA 3HKCA 3N8GA 1CIJA 3W5SA 2ZE7A 2FX5A 4HAVA 1UAYA 2XDQB 7ABPA 2AI2A 3ZVMA 4JP5A 1VCIA 1XP5A 2NQTA 1ZO8A 2AOUA 2XIJA 3D43A 4I4NA 4FE4A 4D8YA 4DQKA 4YR7A 1ADFA 1YR8A 4KIFA 5CB6A 5AT1A 4AYXA 3VR1A 1HQYE 1VPWA 3IEVA 3EEYA 2VHXA 1Q0LA 2HC9A 1HC7A 1U8CB 1TLFA 2BUCA 3H18A 3IESA 4OSOA 4XH9B 3TRFA 3KJHA 1QPZA 4YQZA 4JKOA 1GVNB 5JSYA 1QWSA 4CLRA 1A4RA 4Q4DA 4R9UC 5LWQA 3DD5A 3WLAA 4DT1B 2XGOA 1KK0A 2RJNA 1TC1A 3S2GA 1U2GC 2JAWA 3LL7A 3FPBA 4W9NC 2WF9A 2WIGA 5FPYA 4D8XA 2YJ3A 2FXVA 3R4CA 1E0JA 3CTMA 4MJ3A 1BJTA 3D02A 3EA4A 3QUAA 4MRVA 3N59A 4HEJA 1SXJA 4QFCA 2ORWA 4P0TA 1P80A 4RIFA 2QRMA 5AXBA 1LRKA 1HYGA 1AC5A 1R8XA 4IZ6A 2XB4A 4ILEA 4IDFA 3IT2A 1WMBA 3PQ7A 1CJKC 3PNBA 1SU4A 2XDQA 2QD3A 4OKNA 1CY8A 1VG1A 1KO5A 3WWCA 3MCUA 4N5NA 2ZR9A 5AK4A 2RI1A 4LGMA 5F2EA 1KZGB 2QLNA 1VM6A 2PKWA 2FU5C 3HA7A 4R7TA 5AW9A 4F5ZA 3GN1A 5K8JB 1FNSA 1QCZA 4IHJA 5JNLA 1X3LA 1E6CA 2OV8A 2X6RA 5IEBA 3ZV7A 1O03A 1OYYA 5T7BA 2PKYX 1QK5A 2AV6A 2WG0A 1B1AA 2AZDA 2JFFA 2PWBA 1A8UA 3QKSB 1VJ1A 4UTVA 4G81A 4IYJA 2FFQA 2RJ3A 4U2DA 1BMDA 4O2AB 4BFUA 1FVFA 4TL9A 3EIEA 3U1TA 2G0AA 4TLLB 2HADA 1H23A 2WUVA 3NR2A 1VKNA 4BXOB 2JZNA 1K9SA 2V6GA 3EVCA 3C3JA 4CQMB 2JLZA 1BW9B 1SKMA 3DBOB 1SCJA 2Y77A 3S29A 3WOHA 4D9IA 1CY0A 1PDVA 4EJ6A 1SC9A 2CT8A 1E61A 4JMPA 1AX9A 2R8PA 4QYXA 4YDSA 1KDTA 2FZ4A 2QN1A 3DCIA 2D0IA 3R76A 4EBFA 1NF9A 3CH5A 1E3WA 5EERA 3EW9A 2NVUA 4EKDA 1W35A 4ITUA 3UHJA 1K7SN 3STWA 5AW6A 2XJ9A 1XTPA 3OFVA 5A9RA 4UCQA 3V46A 3K16A 2GJKA 2QNBA 2YY7A 1ANKA 4YASA 3T38A 3ZDQA 2BUBA 2XOXA 2NX2A 3HN6A 3P45A 5FRDA 5LMNB 4V3BA 3BXEA 5DTJA 4ZU6X 3MHTA 1F8UA 4J43A 5LIRA 2VTDA 5CH8A 1AO3A 2RHTA 1B14A 4Y6GB 4YFVA 3TRDA 1HT3A 3X1ZA 1WSAA 2MHCA 3C8HA 3EVZA 1EWTA 1NP6A 4HDMB 4GYWA 2JJ2A 2QQ5A 2VLBA 4V39A 1ZM3A 4TKMA 2EZUA 5EQJB 3ZR4B 2IKSA 4QBHA 4TL6A 3HCCA 4BUJA 1L5MA 3FYUB 1HG1A 3IQDB 3VRHA 9ATCA 2GUGA 4V0RA 2ZUUA 2CNNA 3HBAA 2FSVC 4Z9FA 3PDUA 2VT2A 5C5DA 1N5KA 5KREA 1ULUA 2VN8A 1JI0A 2W71A 3DZDA 1JDVA 3DH0A 3DF7A 3LT2A 3NGMA 3PNOA 4GRAA 1GARA 4KO8A 1JV2B 1V1MA 4HQ0A 4Q7JB 4YJ2F 4ZIRB 2CC2A 2GAIA 4HADA 1CDEA 3O0DA 3QPBA 5INTA 3BHJA 4KPYA 2KYRA 4Z9YA 1LBTA 3QPWA 3EG9A 4HMPA 3ESZA 3OO1A 4MYCA 3T41A 1IFXA 1OI2A 1UDRA 1GCAA 2JF0A 3NAGA 3D7NA 2Q0XA 4WKPA 4MVJI 4TTVA 1FTNA 2AEJA 3KLPX 4REMA 3OU7A 1YA8A 4MKHA 4JI1B 2BGIA 2EFEB 1SA0B 3OZVA 4TWIA 1Y3CE 1OQAA 3G0CA 4YQFA 1Q6ZA 5JO0A 5AD1A 1NPTO 3OLQA 4C05A 3WKEA 4P6VF 3CN9A 5DO9A 2AT1A 2D8MA 3JRNA 4FDMA 5H81A 1UJBA 4ZI5A 3VKUA 1OU0A 4L8YA 4MLZA 1O6CA 3PJDA 5E7IA 2DECA 2GMWA 1I2BA 2WAMA 3CS3A 2JAPA 2W2LA 1EFTA 2XMGA 2A58A 1Z0JA 3FNHA 1VBKA 2BJHA 4PLYA 4CUJA 1A1SA 1CUGA 2HTEA 2V8OA 3THXA 2DY0A 2QR3A 2PSDA 4U00A 1CERA 3RRMA 1JE1A 1YA4A 2B6HA 3C8ZA 3PYLA 3QI2A 3R5FA 4XIFA 4B6JA 3VC2A 3HA2A 1A04A 3ADBA 2ZCUA 4DCSA 3NXKA 2DT5A 4UXJA 3K35A 3WMRA 3ZXSA 2ZJ0A 3BXFA 4EYSA 2CXOA 2A0YA 3DL7A 4FGLA 1WCIA 4KODA 3I1FA 4JLOA 4EDHA 3F5QA 3GUHA 3T1YB 1X74A 1GL3A 1TM5E 2Q8PA 1QZTA 3GGGA 3WIUA 1R10A 1DUVG 1R9MA 3VMFA 3VSBA 3RDPA 1NDQA 3QTTA 2IEZA 2PU5A 1UXGA 5JT1A 4P08A 1Z34A 2B2XA 2IUTA 4E13A 1S2NA 1TA0A 1WW3A 3C1AA 3HDJA 4M1TA 5HMMA 1G5HA 4FZ5A 5E8RA 4BU0A 2AC4A 5AVRA 1A2BA 1M8GA 1E63A 3F74A 3HU5A 2L69A 4EJSC 2J32A 2WOOA 1Q44A 3IDQA 3H9UA 3IQXA 3K9WA 3GAFA 3SN6A 5KOYA 5CIQA 5KJCA 2ZG6A 2PY6A 4AJLA 1WB6A 1ZCFA 3EY9A 3M4XA 5FL7D 3JWHA 1XTUA 3BERA 3R3UA 3HB4X 4K03A 1Y7PA 4DLLA 5CLFA 2FCRA 1K8QA 2WUWE 1BDJA 2H5LA 1A8PA 2QTTA 3THOA 1T0BA 4HQRA 4CTMA 1SUCA 4M99A 3FWPA 4K6FA 1DQYA 1U3DA 2VEOA 3GJ0A 1XXHE 4G9GA 3ETLA 4MCHA 4O4IA 1OZHA 4R2MA 1I6MA 4RD3A 5F7JA 3W06A 1JR3E 2I6GA 2H92A 5I7WA 2A1UB 5EHZA 5EEGA 2VDWA 3OOEA 4DWWA 2QE7D 2QQ0A 1SVMA 2YZ7A 4FNAA 1OV4A 3PT5A 4QGBA 5CCXA 5AM1A 3ZY2A 5A4KA 2D5BA 2V96A 2MSWA 3A4TA 3QQ5A 1TU3A 2C84A 4KSBA 3R7BA 3RAPR 2V7VA 3CH4B 3ZWDA 1GPJA 2H59A 3R5TA 3KHUA 4TROA 3O8BA 4K9DA 1RRMA 3NTVA 1M1UA 4GR9A 2ZJ1A 4NONA 4OG2A 4CT0A 3QXSA 5LA6A 1E1DA 3QK7A 2EC5A 5ERGB 1E9SA 2JZOA 1CR6A 1P73A 4UW9A 4X9XA 3ESQA 1OWMA 3AEYA 1UFOA 4UXHA 3LLUA 1CJCA 4YMSA 4TYPA 1EFVA 1PGNA 3PNVA 1CULC 1OFUA 1VMAA 2R86A 4NQZA 4PIMA 1P1FA 5KNBA 1E2IA 5F51A 1NUTA 1JRLA 3PFWO 2R62A 4PCAA 3QFTA 2FUCA 2Z83A 4G1UC 4PV7A 4WX2B 1DT3A 2JI8A 3SBOA 3ZI7A 1DNPA 1JTVA 2BY4A 1NXTA 1C9NA 2FOXA 2POQX 2Y93A 1DZ3A 3BMNA 3JW8A 4N3CA 2R5NA 5DX1A 2AFHB 2J4FA 5C8YB 2P69A 1KDOA 3EH1A 3NT2A 5AI8A 4AJKA 2BGUA 2YS6A 4ZA2A 2DH5A 1BG6A 4U6SA 4JY7A 1WVIA 3U7GA 1IY2A 2QTVB 4PO8A 4OMUA 1RWBA 3NDBB 3ADPA 4IDCA 4KFCA 1K2WA 5BVGA 4NIMA 1XOIA 1RQNA 4E5PA 3DBHB 5JARA 3HEBA 2Q6TA 4S0ZA 1K08A 2P6UA 2HWXA 1MTZA 4EARA 5JG7A 1TTQB 3ZU5A 4XGRA 5F5XA 1L5HB 3ST7A 1POXA 4ALMA 1GAJA 1QHFA 2PZLA 3OE5A 5GVRA 4BWFB 4DMMA 1L3BA 5LWHA 2F8LA 3CUYA 2IXFA 1BVYF 1Z5GA 4Q7LA 1CLEA 5EKDA 1THGA 2RCYA 2RJOA 3BMQA 4KXFB 3VHQA 4N48A 4EKYA 4JIGA 4LDZA 4ZU1X 4RS4A 5CX4A 2QSZA 3LRPA 2BZ0A 1GNLA 5L3ZA 1C30B 2WFLA 4URYR 1JHQA 1KFCB 1QR6A 4HCJA 4DNXA 1ODCA 2I62A 4EI9A 2XCIA 3GZNB 2P11A 1OTYA 5LUAA 4BLOA 5ITSA 2PV7A 1U5BA 4L9AA 2XODA 3ENQA 1MFZA 2HNBA 1MQAA 3I30X 3IPCA 2VCHA 3JVUA 4QX6A 4ZYTA 3ODGA 3J80A 5KNDA 4DCOA 1XMSA 2PNFA 4WOPA 1E7MA 1QH8B 3MJTA 1UBRS 1KH2A 5GGYA 3Q8WA 2RHJA 3STYA 2IGBA 3HPRA 1E7SA 1E2HA 2QI9F 4EPYA 4CGZA 3GXOA 2QUIA 1RPZA 2W6MA 3AFHA 4Y2XA 1P2UA 4UNPA 1XTQA 4DR2B 3GD7A 3PDCA 4L78A 3UJ6A 2VIIA 4FHFA 1U7OA 1HE2A 1U2DC 1NVTA 2C9BA 3BEOA 3G1TA 3L0CA 1WUKS 2D6FA 5JPDA 2G0NA 1C80A 1GA4A 4XIYA 2X5NA 3HBMA 3M6IA 5JFOA 4EG4A 2DFKB 5JPIA 2JLSA 5ALJA 4R3UC 3ZEAA 1KWKA 4L3VA 2HA2A 3NIFB 3QEJA 2F00A 4BC0A 4ND6A 5LOVF 5AR1A 5JCZA 3BWYA 3HUFA 4XX0A 2IWRA 1ZP6A 4INJA 3VYRB 2X76A 2ZTUA 4I4TF 4CF7A 5C35A 3OOHA 2AD5A 1W2GA 4AMYA 4GE3A 3WP1B 2GXAA 5CDFA 3DYIA 4OHPA 3OOYA 4BASA 5J4LA 2X4LA 4Y2GA 1KI4A 4FFLA 4NZOA 4UAJA 4W9NA 4LFAB 3K9NA 4WBNB 1T29A 1I3KA 3EUFA 3PWZA 4D82A 3QEOA 5KC8A 2RDMA 5BWLA 3WLMA 3QF7A 3PD7A 3ZUPA 1XN1A 5KQMA 3NWEA 4YPFA 1Q22A 2FJ0A 2HSJA 3N3AC 4GR4A 4CLOB 3KZNA 5EHQA 2BKVA 4MS1B 5FTLA 3P26A 1Z36A 3ZE0B 4BGUA 1BS9A 2D1RA 2XKJE 3EXHC 4QO7A 4MWSA 4XWAA 2F1OA 2Y71A 4TWAA 3ZDBA 1DAEA 1DUIA 1MRZA 3R3HA 3ER9A 1SVIA 4KFSA 2WPDD 5FNVA 3UWDA 3AM4A 4RD1A 3ZU3A 2CV0A 3MRVA 4HAIA 4W1QA 1DQPA 3AI3A 1H3NA 2WJ3A 3IBCA 5JVDF 1JJ7A 1V0JA 4OI1A 2PGJA 1BXGB 4X90A 3ZE1B 3DBRA 1EDBA 2J6CA 1G41A 1YQQA 3ECAA 5M34A 1MO3A 4RTKA 5F9HA 5C7LO 1DZIA 7YASA 4IFIA 5GJBA 4ARZB 3C6KA 5AKXA 4MKGA 3A9CA 4P7JA 2ZWMA 3PSAA 4ND4A 4RXMA 4RBNA 1VKRA 3KWLA 3D0RA 5DHFA 5IJ0B 1MEOA 3PRYA 4BNIA 4YJFB 4Y6SA 2YHBA 3I32A 4RO0A 3HA5A 1C0KA 2VAVA 2FW8A 4RDXA 2I4OA 3HDQA 5TT1A 4AWBA 1ZNQO 4QQKA 2DPMA 3STTA 4BZXA 2FKNA 5AVZA 1PF7E 3VA7A 5JQGF 3TSWA 3ETJA 4XTCS 1NP3A 4PNPA 2JJ1D 3C39A 3NHPA 4TRJA 1U0BB 4QQRA 4V0ME 1C7EA 2XOEA 3ASYA 4IUYA 3D5TA 1WY7A 3S40A 4C5AA 2DT8A 2XZLA 4ZXPA 4HK4A 4RPCA 2ZB4A 4M8LA 2A7QA 2QA5A 4IGIA 1M6VB 3NBKA 5DHTA 3I8OA 2WTNA 2PEYA 3BWMA 2QX8A 5AW7A 5GZ6A 1ZAKA 3TM4A 2WVGA 4ECEA 1Y63A 5FB3A 1VMDA 4QVKA 4Z4EA 2P35A 3HCBA 3L8MA 1QHYA 2I4LA 3QEBZ 1Y8QB 5KEIA 2DR0A 3BRSA 3LCVB 4IKPA 1ESMA 5FAKA 1JB9A 1AN0A 5BQ3A 2FZ5A 1C1HA 13PKA 2C97A 1A9ZA 1JEQB 1IAQA 1V3QE 5TV2A 2ZB8A 1SNYA 5C81A 1WVGA 1NVVR 1RBYA 4MRSA 4TV8F 4ZKEA 3VU9A 3DL4A 1IVSA 2C2WA 2HA4A 2GCIA 5TLSA 3LXUX 4MX8A 4D8TA 2VDOB 2XWQA 1A9RA 1T8PA 2X7XA 3QXCA 1FP1D 3HO6A 3W7AA 5BMVB 1NMQA 1JVSA 2R6HA 3L82B 2NV2B 2R8OA 4YRCA 1MRNA 4Q1FA 4HAOA 3L7YA 4KBYA 3PGXA 3BFPA 4O2RA 2ZLBA 2W6IA 2NN3C 3BFXA 2AWNA 1W7AA 3ZLBA 2J59A 1QTQA 3WB0A 3HEAA 4HXFB 3U4MA 2EARA 1VRCA 4WZBE 3DZCA 4BO1A 1DPGA 1WOMA 3K9CA 4CV2A 5DHAA 1VHTA 4OJKA 4B09A 3COPA 5ICCA 1Y3HA 1SWVA 4F2DA 3JQBC 1FU7A 2RH5A 2VDMB 1J20A 1FUEA 5IC4A 3PGJA 2VK8A 1KI6A 4DV3B 3KFLA 1GAQA 2ZI3A 1J0AA 2JGFA 4OQDA 4FYHA 4EP1A 2OORC 1QO7A 2X1VA 3GBSA 5TS3A 4RESA 2FLKA 1SCKA 2DVMA 2VAMA 4P3YA 5HW0A 4GLFA 1ZHFA 2VBGA 3ABSB 1TYZA 4JJ6A 5CA1A 2DXIA 2VT7A 3E7PA 3G5AA 2FEPA 3ZS9A 1T4BA 4JB8A 4JI7B 3U1VA 1W36B 5EGNA 2FP3A 3CPJB 3H7AA 1F3OA 2AR0A 3L02A 1N6RA 4PZEA 3V33A 4ENWA 4IM7A 1U80A 4R2HA 3DNPA 1U3GA 3KQKA 3A25A 3AJ8A 3ILXA 4Q15A 3EZ2A 4Q93A 3SHTA 1MDFA 3CRW1 1NLUA 1IBKB 1EMDA 2ET6A 2VG8A 4PYOA 4Y7DA 1E7QA 3ZZMA 3ICOA 3EK2A 3WWYA 5CG2A 1YC2A 2WZDA 1PT7A 3AQIA 5LQJA 1BS1A 2PQ2A 3EULA 3K53A 5KYUB 1QU2A 521PA 4YLEA 1RP7A 4ZZ2A 1COZA 1XIVA 3HVIA 3ZJYA 5ISMA 4LNAA 5DTRA 4FYPA 1IL0A 4RZSA 3D6VA 1AM4D 1V96A 1XVVA 3OLXA 2FPOA 5MDHA 4JYAB 5ALQA 4P5EA 3FPLA 1VYTA 3QJGA 1XYVA 4FUQA 3Q4GA 4NS1A 4O3FA 4NG4A 3M1LA 4REQB 2P1ZA 3W5VA 4NXMB 4C29A 1VE6A 3L79A 4QARA 3TOCA 3BWVA 3KAKA 4Q4HA 4XRGA 2N0SA 1WJGA 3K9QO 2YZ2A 1ZH0A 2HHAA 3AGPA 3QVGB 5IABA 3GCDA 4II7A 4BMDA 3TDKA 3B1YA 4EHHA 1IOWA 3HEMA 4ZOEA 3Q3GE 4ID3A 4PG6A 4UKDA 4DV6B 2E2WA 4QOGA 3QU2A 5BWBA 1FRZA 3CEPB 1RYFA 3WFJA 1N9ZA 5CDHA 4L2IA 3M7IA 2WM3A 3VR6A 1LW6E 4OREX 4RHFA 1DKOA 5AK5A 3D54D 2PLRA 5SZIA 4JEMA 1R50A 1R5OA 4WLEA 3QV1A 3GNQA 5TARA 1EEHA 4QJ4A 3N8HA 1D6SA 3DXYA 1ARZA 1CZLA 2FPRA 4JITA 5B55A 1NR7A 1G5PA 3SLGA 3I5MA 3NIGB 4RHUA 4DMUB 4HEHA 3CV3A 4E4YA 2ZIXA 3Q7PA 3ND6A 4UOZA 3I09A 2DBZA 3FF1A 1N6IA 4IJUA 4RY9A 1A9OA 2EWWA 4O02B 2OHHA 3P4UA 5T6BA 3LQFA 3WK9A 5HQ3B 1OXKB 2ZTLA 2V65A 5EZQA 2LZ0A 3ORSA 5KOHB 1V3UA 3T0GA 1OTHA 1L4EA 1B93A 1K8YB 4MARA 1Z17A 4CXMA 3PEVA 5LOVB 4MHSA 1U2RA 5HFAA 2GUWA 4YLYA 4CN9A 1DAIA 2FE4A 2UVQA 1T3SA 3MRSA 1MX3A 3ZTTA 1C4XA 5IKOA 3PR2B 2XB2A 3RYIA 3IQIX 5EWMA 1LPPA 2FR8C 1Q7RA 2MWMA 2HA7A 4BLRA 1PJ3A 2HAEA 1BJKA 5G41A 1ORHA 1XZBA 4M0PA 3HDGA 4ZDJA 1Q7BA 1RZ3A 1F06A 3OOWA 4MPJA 2GRJA 2F43A 1YTUA 2N42A 3GT3A 5KWVA 3LOPA 5K3CA 1TVKB 2JS7A 2JJ1A 2NUPA 3OF3A 4MI9A 4RF5A 3EH2A 1D9ZA 2NVWA 3W5BA 1MZPA 2BE7A 1E5LA 3N2KB 2R11A 4UU0A 2G09A 1RFGE 2I5PO 4QOFA 2O0KA 5FEMA 2R5WA 3MWJA 4B4KA 1E94E 1UBUS 3KOXA 1Z6TA 1HTTA 4TM8A 2HPAA 3P9YA 4TV8A 1GTL1 3DDZX 4W5QA 2GPYA 4KX3A 1A2KC 3E27A 2FEXA 2FW1A 3ADOA 3IPAA 5AKLA 5K1ZA 5C7IO 1P1RA 3W8NA 1KC3A 4QWWA 1JP7A 4JJIA 5DN6D 5DW3A 2ZRLA 2DG2A 2PKXA 3LUJA 3P2OA 4ZAZA 5FBVB 2H5EA 2RH4A 3G0OA 4MVJE 4RHTA 2OAGA 4WIAA 4ALLA 1SC4A 3DDSA 1HQKA 4LF9B 5F77A 2NGRA 2VRBA 4HQLA 4CIWA 2I33A 2ZK7A 3MSCA 4JLKA 1KOJA 3TDMA 4M9RA 3GF4A 4IDEA 5TF4A 1RYYA 4RVGA 2IHBA 4IHQA 1PR1A 1UKZA 4I4TA 4K8RB 1SBQA 2IHYA 2Y0EA 2XTJA 4FBGA 3W8EA 3FZGA 5BRJA 3LQKA 5JCJD 5AK0A 3DE1X 3MK31 2PUCA 3DOEA 2OOKA 2FFHA 4G5GA 4TVBA 1G5QA 5ECYA 3KQSA 2X0FA 3SJAA 3DHEA 5DM0A 1M7GA 1XMVA 2CNWD 2SCUB 2BZSA 5KSPA 1RRCA 2H9AA 1TU0A 2E18A 3LHDA 3R5JA 4JUDX 4RQAA 4TPKA 3U61B 1K75A 3AR3A 1GG2A 3L46A 2HDWA 1PW7A 5LBIA 2Q1XA 2O1XA 1LJUA 2ODNA 4M0EA 4QE3A 4MAAA 1RAIA 3O2NA 2H1OA 1Y4DE 4R6WA 2G1PA 2FWMX 2JFUA 3IT3A 3MWDA 3SCZA 4AXBA 3EUAA 4FEYA 1YS6A 2D1SA 1N9GB 1R66A 4LYDA 4QBTA 1RABA 3QNWA 4DCCA 5BY2A 1JLLA 5IF3A 2XR1A 4X20B 5ETJA 5TMEA 1IBMB 3H5VA 4GLLA 4J3JA 1HNNA 3HYLA 5L4LA 4Y6QA 3DO8A 2CK3D 3OAAA 3OIUA 2YWDA 4WH0A 121PA 4QM7A 3OH8A 5IRCD 1Y1PA 4EHBA 4L6CA 1GFZA 2GJSA 3T1NA 3OFNA 2HA3A 2AYXA 3B2QA 1VSUA 4WGGA 4B4OA 4WHMA 3GRFA 3OKFA 4TKVA 2NADA 2PVCA 3TL2A 1KIAA 4IMJB 4NENB 1UC9A 4MCJA 5AVWA 4FYIA 1AUXA 5A3VA 3VH3A 4F7DA 3H2BA 1EGQA 1XQ1A 3KSAC 4IXTA 4ZPXA 4W8HA 2JASA 1LQUA 1EWVA 2EFGA 2FI1A 3CKMA 2WDPA 3LHSA 3MYYA 4X1KA 5A4AA 3T5AA 3E3MA 5FUVA 1WCIB 2YVUA 1CQIB 3WQQA 3AM1A 2YN2A 1FNNA 1C3OB 1DTSA 1W0KA 2GNAA 4A0RA 2L82A 2R7NA 3DOOA 2X4DA 3AEZA 1BXKA 1S4QA 4Y98A 2I87A 3CQ9A 4C0LA 2P9EA 3GRAA 2PMBA 3GLIA 1AH2A 1E1LA 2C4KA 4LZOA 1JGTA 2CVHA 1UUFA 3F8SA 1PT9A 2AMJA 3N87A 1GR0A 1YK1A 3CUWA 2NXEA 2HHLA 3HL0A 2IDKA 1HYQA 3PU6A 4J3FA 4MUIA 1SKUA 1YDHA 1U2TA 2O2ZA 1OHHD 4RSGA 2RBEA 1Z83A 4MV6A 4E5NA 3I4CA 1N2SA 2IVFA 3OSZA 3A6FA 3WL6A 4QT0A 2ZUFA 1SO8A 4G9EA 2CF6A 4W5RA 4MWZA 1JSRA 3A3NA 3D1JA 1T2DA 2FDCA 4BLPA 1SA0A 2QRVB 1E79D 1RJGA 1AUQA 2YUIA 3PG5A 5DYTA 4GI5A 2DBRA 3IR5A 3B5JA 2FXIA 4FR2A 3AQ4A 3NYRA 1JPUA 4NE7A 2XUGA 4YROA 1ZJWA 1J99A 4XQCA 1PDWA 2A94A 2IF0A 3C1TA 5EVJA 1A9SA 2FGKA 5FOTA 3WLQA 1GPDG 3OUUA 2VF8A 3WR5A 5CVTA 2GHTA 4XDYA 4BMVA 3EOZA 4MSUA 4O4IB 1W88A 2OFPA 4WXEA 2YW2A 3CJQA 2H52A 4LQCA 4TRRA 1FDIA 4IIDA 5LXTF 3T9BA 3U7QA 3UOGA 3ADCA 2YFYA 5FTNA 3NDRA 5HM6A 2JFQA 3L43A 1EK1A 2IXEA 2Y2UA 5AJVB 4UNQA 3SSOA 2ZIXB 1AMOA 4Q3BA 1U1CA 2HLHA 3F78A 5CJ2A 3OZIA 3F67A 1PHRA 4WRRA 3T8YA 2PWZA 1R15A 4WLNA 5LC1A 5BN4B 3WHKA 1Y8ZA 3RNOA 2PUBA 5F3DA 2KLHA 4DRZA 5IJXA 2Y05A 4ZT7A 4WZAE 3NIWA 1OIVA 3NBZC 5CEEA 1KS2A 2NYVA 4OI2A 2OHIA 4ZT2A 3FLBA 1IOZA 2OP0A 2FUNB 2R48A 3BXHA 1YZYA 2BH2A 3MTGA 3FNBA 1Y3DE 3AF5A 2X6QA 4J1TA 1C4KA 1KJYA 4XWGA 2FW6A 3M2PA 4XDHA 4ZREA 4YPVA 2AQHA 1FDWA 3Q0TA 2IZ5A 1GCIA 4F45A 5KNCH 1XJCA 3DGEC 3FCUB 2PLAA 1CUCA 2H5JA 4H2DA 3H2KA 5D87A 4FDAA 4G65A 3TAXA 3VR6H 3MTAA 4YT8A 3AG5A 2DWCA 3DMTA 4P32A 4DR1B 1GCOA 3O8LA 4Y67A 5DEOA 1ZD2P 2A1TR 4KQ1A 4X8HA 5FD8A 4ENTA 4AQDA 1DAHA 1P5RA 2BVNA 5LZ2A 3QPVA 3DOIA 2XMZA 4H0CA 1MZVA 2XCOA 2LIPA 5DYWA 3MF4A 3PZRA 2WJGA 1M6YA 3E5RA 3EJ6A 2WLSA 2E0IA 2FYTA 1K5PA 1KK2A 3GWGA 4FBLA 4FP9A 4YMWA 1Q20A 4UJ3A 1N3BA 3GLTA 3HLKA 3ORYA 3I6ZA 6CHYA 3ZCPA 2YBDA 2UXDB 1GYPA 3W34A 3K0CA 1OY1A 3OY2A 3HZOA 4MEJA 2VOJA 1X1BA 2PJZA 4NKRA 3P5SA 1PTJA 5DEIA 3NC4A 1RKVA 4EJFA 1ORVA 2B9EA 4IKEA 4O2AF 4R8RA 1UBFA 1Y0BA 2J09A 3P9IA 1U7HA 5FBRB 2HCJB 1L6IA 1SZJG 1S8NA 4G0QA 2NO6A 2CBXA 2PK3A 2JVIA 2I2BA 4G85A 3SSAA 3L06A 3OESA 4BJ6A 1VECA 1LTKA 2ENWA 3PPXA 1GQ2A 2FQYA 3HMKA 4QDKA 5FADA 4TWZA 2QI9C 1E2LA 2HQSA 3CIFA 2SHKA 4IV5A 3PFHA 4P86A 4B2YA 3RYCA 1YUNA 1ZSYA 1JVNA 3DNMA 3H1PA 2Q0SA 3RSZA 2JVJA 1FX1A 5A04A 4X8OA 4MVJP 5ADWA 1D2CA 3EDRA 3ENWA 1AZTA 1IJFA 1OE0A 3AGQA 3S44A 4K5QA 3MNFA 5EPEA 3K7EA 3PEFA 2JH8A 1R9JA 4ES6A 1OYVA 2ZDQA 4ROSA 1J8YF 1ZHOA 2VHYA 4WXPA 1W85A 3MMNA 5BW6B 1S3GA 6PFKA 2GSDA 1ID8A 5IDVA 1FB5A 2QW0X 4KGDA 3S6JA 2RC5A 1NT4A 3SC2A 3QRWA 3T5TA 2AXQA 2WHPB 4AVYA 4F0JA 1ZK3A 1WKCA 2VYVA 2YVLA 3AL3A 4BWVA 4XD7A 4B76A 1ZMRA 4CETA 5DM70 1ZOPA 1JR4A 1ML4A 4MV8A 3UG6A 5JSQA 1QBKC 4G37A 4TYMA 2PQ6A 3GBPA 4GBGA 1Y5LA 5EHXA 5IAJA 5CGQB 2WTMA 1G55A 2O19A 1XD2A 2X23A 1RPTA 3DLCA 4CDNA 1FFYA 9MHTA 3B1WA 3BB1A 1AE1A 1VL8A 5IZCC 5DJ5A 3TW6A 1A69A 3IMFA 3VR0A 1MIOB 2WEKA 3MCVA 4YEDA 1JFVA 3LUBA 4D43A 2VDNB 4QRHA 4POAA 1VL5A 1VBMA 2HJWA 1Y3BE 1SUIA 3GU3A 5E6RA 1S5PA 3HY3A 5BSVA 2H1HA 5E9QA 3ZHQA 1UZLA 1TJ4A 1TAHA 3TLBA 5TQJA 2D59A 4NDAA 4U1RA 4YXWD 3FOZA 2C5HA 2I4RA 2O3RA 5JDIA 2REQA 5IUNC 1HDRA 3WRYC 3E4CA 1MENA 1G42A 2JD1A 5ENZA 3T9DA 2CJXA 3D81A 3HSKA 4YAWA 1ETUA 2WZQA 3DHYA 3KKMA 4CCYA 2ZIUB 4GQAA 2G5PA 2PMWB 3JTEA 1QV9A 4QOHA 1QZUA 4KQFA 4E1BA 3IA7A 5K3FA 3LUHA 4N3GA 3QU7A 4Q6BA 1U9CA 1ZUNB 3UA3A 4LMBA 5KNLA 3O83A 2JEYA 1OR8A 2Q3DA 1BFUA 5JAZA 2IV3A 4XX0B 1BXZA 1OBHA 3TW8B 1V5WA 4PQYA 1QZZA 5E4FA 4QPZA 4PZ9A 4CL3A 5F12A 5FTJA 1NWHA 1QG6A 2OSVA 2IPNA 4C4TA 1VRVA 1TW3A 4AS2A 3EPRA 1WXXA 2CJWA 2B2CA 4BO5A 2BDEA 4KKVA 2B5OA 3MTQA 3OLVA 4CKBA 1RYHA 3TVYA 1G3UA 3GQBB 3MCTA 2G08A 5FCDA 2DQ4A 3WJ7A 1H5NA 3WYAA 4YUZA 4LK2A 2H08A 5CBKA 2DEUA 4RTLA 4OQNA 5TC4A 2AI3A 1T2EA 2PKRA 2WAXA 2ZRDA 3O7WA 5AYVA 5HE9A 3S2FA 1SC3A 2JD2A 2DLNA 2Z9BA 3T3GA 1YIOA 2IPOA 3W05A 1ZIOA 5ALTA 2ZROA 1BMFD 1RHMA 1TT7A 3P0EA 3FGPA 3TS1A 4NFSA 4EHLA 1H0SA 4KZKA 4ZEMA 4C7MA 1FPMA 2CLKB 3KSZO 5I7EA 2RSLA 4MTLA 2VP4A 3MWEB 3SXJA 3M70A 5LP6B 3V2IA 4AT1A 4OQLA 5DWVA 1M0SA 1Y48E 5KQRA 5HHTA 3I3SR 3L1UA 3U48A 4E22A 4G0ZA 3U7IA 1UDWA 1QR2A 1QQTA 2G36A 4OPMA 3OT5A 2J33A 4NYIQ 5ALGA 5KKCA 3ENNA 4BRUA 2PJRA 3ZGOA 3KEMA 3E7FA 2PXHA 4JP2A 3R6WA 1OAAA 3HE3A 2I29A 4M0LA 4B81A 2C7VA 1C8LA 3V4ZA 1EFPB 1H1LB 3LY7A 3N86A 2XVXA 1KBQA 1SB8A 5TR9A 3T15A 4DDMA 4MVXA 3QEMB 1PVDA 1M1YB 3BFJA 2CSUA 5KB3A 1JHXA 3ZHSA 3FPJA 1BH6A 1OKKA 3FNQA 2V0NA 4I50F 1B3BA 3ZU4A 5LFAA 3E1GA 1I1QB 3NHAA 2NXWA 3EISA 1EVIA 1ZN2A 2OK8A 3MIZA 2B21A 4UM9D 1SHJA 4F6RA 3PLNA 5CBPB 4DR7B 1MF7A 4R8MA 3K0CC 2Q5OA 1G8MA 1WSWA 3ED5A 4YB8A 1ZICA 3ZWYA 2LR0A 2D62A 4CLHA 3WK6A 3WB1A 3GA7A 3W2HA 1BE8A 1XF1A 3NC0C 3HUUA 3OTHA 4KO2S 1UEXC 4OEHA 5C51B 4ZOBA 2X8JB 1GA6A 1N2IA 4GKVA 2A5JA 1Z45A 4TMFA 2C9YA 5TJ9A 2PBZA 3IEPA 1FYDA 3MMSA 4O63O 1J7JA 2WJVA 4JBHA 3HFSA 4EGQA 4RGQA 1NUHA 2OGSA 3MCAA 3GLIE 1G98A 5H4HA 1HQCA 1TJ3A 2QLTA 1H5QA 2C0QA 1I1HA 1JDBB 1O0BA 3O8DA 2IYEA 1RI4A 2AR9A 1JI3A 1QH0A 2YXEA 4XOUA 3ILSA 1X2EA 1XXHB 3P9XA 4FYXA 4QYWA 1E62A 3WIVA 3QBVA 2DOKA 4YO8A 4FGUA 4ALKA 4G5RA 5JD3A 5LZ9A 1DKLA 1JWBB 2CLMB 16PKA 5CCBA 4LXQA 2JJ2D 4M3NA 2IZ7A 2XUKA 2ZVDA 4F8YA 4HX9A 1L5QA 1O57A 3K0FB 3A1EA 1QLHA 3GP5A 4S04A 4PU0A 3IVGA 3I5AA 4EMUA 1NA5A 4OIMA 4Z4QA 3W1WA 2VHEA 4EG5A 3QPCA 4HS4A 3QIAA 1UQUA 2PUFA 4Z2AA 1YKFA 3LT1A 1NQ5A 4Y2UA 3C6XA 1JR2A 2YJNA 1AKYA 2J3MA 5CU7A 3EDQA 3WGVA 2WUEA 4UOEA 3TR5A 1WCXA 2C3OA 2EW8A 2UUPA 4ZAVA 4E51A 4OQ4A 5ALIA 5IZ4A 2OCXA 5DB4A 4JBIA 1LJLA 3NBQA 4URUR 3L6UA 1K6EA 3DFKA 3W78A 4HEQA 3ZX5A 5IN5A 1MA0A 1ZOSA 2X3FA 4TXMA 4EELA 1W59A 4KO3S 1E2BA 1WTAA 4C22A 5F52A 1XDBA 1BTOA 2IVZA 4EATA 4HFJA 1NBMD 2OSBA 1I5EA 2HQ1A 1Y3AA 2I1WA 3ZY6A 2EKBA 4Q34A 5TX7A 2LD4A 2NV6A 3HLTA 1DBVO 3ZGNA 4DQLA 2FPLA 4ZOCA 3A27A 5EP3A 4X97A 1ODJA 1VI5A 2HDOA 2XQIA 4PINA 4NDNE 3KKKA 2E1RA 5ILOA 1R4ZA 3FZNA 2GNOA 2Z2JA 1K6XA 1L7EA 1LRJA 1D2MA 1N1GA 2A9OA 3BIFA 1E3IA 2VBFA 3HACA 3UK2A 4U3JA 2PH5A 1A9XA 1R64A 2IV7A 4FGJA 3PUZA 2JLQA 3S70A 1U4OA 2EYQA 3B6IA 4TLAA 1T26A 2PLFA 5HFJA 5C8ZA 4RTSA 1DJMA 1JDUA 1UBEA 2CLLB 3WO0A 3CNLA 4G5FA 3I6YA 1SVLA 2OZEA 1XA0A 4GMGA 4TTIA 1BIFA 1P4SA 4G56A 4X95A 2HRCA 3M5PA 5JCPA 3COWA 7AT1A 1E3SA 3JD0A 2BAGA 2HJSA 1TAGA 1XTZA 2UZ0A 3VU1A 4Q16A 1W1UA 2Q49A 3C0KA 1Z4MA 2Q6IA 2IYNA 1CY1A 3IS3A 3IBTA 4LF8B 1ZUIA 2EXXA 4IQ4A 3HM2A 4Q39A 3PJFA 2XVYA 3A3OA 5DTEA 4DCTA 4IRXA 2J07A 2VDJA 1L7QA 2CEAA 5HXAA 5DIZA 1Y9AA 1S1CA 1PL0A 4BGIA 3E8XA 1TJ5A 3KXKA 3QWBA 3K9FC 4U2GA 2F67A 2HZBA 3VSEA 4J16C 1H9BA 5CMLA 4KQGA 3DP7A 1L4LA 3ROGA 2I76A 2XTMA 4P31A 4UCWA 2VPXA 3TZQA 3VOSA 1TKBA 1YHZA 1JBEA 3LMKA 3M89A 3QMWA 3CLTD 3ZJ5A 3LWBA 2RIRA 3ZBUA 4WNAA 4YAFA 3MINA 3ZOZA 5DPMA 3KUKA 3L8DA 4AUEA 4Z54A 1T0HB 1GEEA 3Q5DA 4B35A 4BO4A 4A15A 2QZ4A 1ECCA 1ZBQA 2DM6A 2ZYSA 4RACA 4UARA 3H1BA 5HRCA 2J6IA 1PZHA 2OO5C 2P6MA 1RE1A 3KVNA 1I6KA 3AJDA 4PC2A 4YJFA 2GAJA 3CX3A 5C34B 1ZVQA 3CUSA 5NULA 3D0QA 4O4HB 2IUUA 5FV7A 2HTFA 2IXAA 2MDTA 2CY0A 1ORRA 4PTLA 1J39A 1XVIA 5BW4A 2TSYB 5T5QA 1ND5A 3KL2A 2YXDA 2H48A 3RFTA 5FORA 5LA6B 3FRJA 2EW1A 4TXJA 1F7UA 1TVMA 2Y6UA 3GRKA 4IKOA 2YCLA 1LFAA 1SHKA 2QTCA 3QENA 2QTHA 4D3YA 1ZNXA 2BEVA 5CITA 1W30A 4CDMA 4E1VA 2P2YA 3IMKA 3NAZA 4YV7A 4ACAA 5CA0B 4IDNA 3IQHX 2V3WA 3SDBA 1MPXA 4HD8A 1ODFA 3CNNA 3OZUA 3VFDA 4ZQIA 1SC6A 4M0FA 1N5LA 1VRWA 3G2IA 4EX6A 1Q0SA 4BV9A 4EMBA 5FEUA 1OC4A 1RZRD 4FHCA 2FSSA 4AX8A 5CFRA 4QUBA 3TTVA 3G2PA 2BFPA 3A26A 4OSPA 4TYWA 3KAPA 2J9XB 3FBTA 5J58A 1LKZA 2Q1SA 3LM8A 3W2EA 2C99A 1HGXA 5E1OA 3ABQB 2FJPA 3ZGVA 2RARA 1GPLA 2F3SA 4JR1A 4TT3A 3SR3A 3PPVA 1C50A 1MABB 4O5AA 4NBKA 4J4HA 5T3YA 1N7HA 1DBRA 2W2OA 1V5IA 3UAOA 3UGJA 3IAFA 2P6NA 5JXJA 1SXIA 4XGQA 3RV4A 3O8OB 4UXIA 3QVXA 4B7XA 4KBGA 3QUQA 1TM3E 3AONB 3R6TA 4JEIA 5I5EA 4G0VA 4NPCA 3PQ4A 2FV8A 3HCRA 2WF5A 3THYB 3CRZA 3NRBA 4DABA 2O1EA 2WAAA 1OFGA 1UBTS 4UUBA 2VA9A 4QUHA 2XMDA 4JDPA 3FMIA 1L8QA 1L5VA 3GLRA 1BEEA 4QGGA 2D1QA 1W6RA 1A8HA 3PNKA 4ACBA 1OLUA 4UEQA 3WYEA 2E5FA 3CZCA 3KJGA 1N2JA 1V9CA 4HRXA 3OETA 3RM3A 3WICA 3SGLA 5JCOA 4DLUA 1BU5A 2C31A 3N8KA 4ZTUB 1KMQA 4B2IA 1L8OA 1X77A 3VPSA 3UCFA 3ICEA 2VPYA 2QMQA 4NPHA 1AN9A 2ZVJA 3CKLA 3PR1A 4V0NA 1BHSA 3CNEA 2GD0A 3KQLA 4F2PA 4TLMB 2WDZA 4AN4A 4GVLA 2QROA 4D42A 4IJKA 2HF7A 5H8WA 3SC6A 4HPWA 3GJTA 5L45A 2GPBA 3LXXA 1EWRA 3NEJA 3ZZTA 2YWFA 4D9CA 5TB5A 1U6KA 3RYHA 2R47A 4QYMA 4ZRMA 4ABYA 3CT6A 5FHQA 4OFZA 1GUDA 3L93A 2VF2A 2F2TA 2O0JA 1DDIA 1V8FA 3AF3A 3NJ8A 2DE0X 1Z4KA 2WKSA 4G1BA 2RKBA 1CUIA 2JRCA 3A0RB 3EFEA 2ECPA 2F3TA 4O2BA 5GY7A 4MVWA 5JS2A 2NMVA 1RMTA 3DAFA 1VIMA 1TMGE 2AFIE 3L92A 1JQ5A 3A2KA 4F5WA 1N77A 3I9JA 2PQ0A 2CV1A 4LZNA 1J0XO 4PPGA 3VO9A 1ADJA 1GQYA 4PG8A 2EX1A 2Z2KA 3BIJA 5FLXA 3IBSA 3JQEA 4PS0A 3SX0A 1CJBA 4YAIA 2F6RA 4KE9A 3LVQE 5IPFA 4EYEA 2C2ZA 3GP8A 1USWA 4HHEA 4OX9B 1M33A 3B20A 3V8MA 2OQ2A 3IIMA 2C29D 3HDVA 1QAOA 2BTQA 1VG0B 8ADHA 4LXGA 1HYEA 4O1IA 1DARA 3DMDA 5F64A 1AS3A 3KT8A 3KXDA 2OORA 1ZMOA 2XAUA 3LNCA 4RF3A 3S8MA 5HKAA 3KKEA 3GLHA 1BNCA 4LXIA 3V7WA 5EUBA 4BVGA 4BKOA 2R6DA 1J0BA 4MUNA 2YVKA 3GFRA 3HHEA 1MOZA 4R5MA 3HDTA 3EDCA 3GPBA 2Q5EA 4D46A 4LSMA 2PCJA 1ETHA 2ZJ2A 2QYOA 2BHNA 4CL0A 5BSMA 3CM0A 5FWXB 1IHOA 4KB5A 4AIIA 5CB4F 3PQEA 2QRUA 5AKZA 5TGTA 2CUNA 4ZAYA 2VAXA 4Q3CA 1G8FA 1MB3A 3R7NA 3HJFA 5GOZA 2F59A 4YT4A 1T6XA 1JJFA 2O8NA 4JLNA 4U2EA 3KG2A 4BNFA 4G2TA 2YNMA 4CUZA 3QKIA 4Y2JA 5JS8A 2Q1TA 3U7JA 1IY9A 1N6PA 3T4XA 2AZ4A 1QK4A 2J9FA 3FOWA 4TYNA 4QLAA 4KXUA 1UCFA 4G0OA 3A36A 2RI6A 2VNKA 2VUUA 3A9UA 5F76A 2P9BA 3CT4A 1DO2A 1PNTA 3GO4A 1FDVA 1KI8A 1YONA 4NMMA 3ZKWB 5LP1A 1ZEJA 2ZSAA 4JT8A 3TLZA 2AKEA 1GOTA 4MZXA 1L4NA 1Z8HA 2DWOA 3M8KA 4PHFA 1Z2AA 1GNQA 4PFSA 5DLYA 1RCFA 1HZZA 2R1TA 1RAGA 4CM5A 2NW6A 4DR3B 2CL7X 1LLQA 1TYAE 1DXOA 4LGCA 5ICFA 3ZZUA 1EFVB 1KYWA 5B7GA 1BOOA 1V45E 3LP6A 4BNUA 3W1EA 3THWA 4JP8A 3B38A 3FUVA 2G9QA 1YBFA 2E1PA 3NM5A 4IJVA 1O6BA 3LA8A 3D4BA 5AUOB 2GHIA 2Q4RA 2XE8A 1CG6A 1SJ9A 1O95A 2H2FA 3KTOA 4IO1A 4UHFA 4XSHA 4MI6A 4IOJA 4R1OA 2QV0A 4UUPA 1YOVB 1YT5A 1LDEA 1YZKA 1GSIA 2GF9A 3EVGA 2B1JA 1JA9A 1TK2A 1T1EA 1NFFA 3VYUB 1FU4A 2X0NA 3O9VA 3SZLA 3ZDYB 4MAFA 2CE2X 5FFNA 1UFRA 3TLGB 2IHTA 1IQPA 4KVGA 2VDKB 4G63A 4R84A 5I7AA 3H11A 2A5LA 1TQDA 4LDPA 1BE0A 4MUMA 1KERA 1OGJA 8AT1A 4KFUA 5CEJA 3K20A 4IAOA 1DIAA 4UEWA 2VTBA 4Y2SA 3FUXA 2Y92A 3PDIA 1YFKA 5D8DA 1JHMA 2GEVA 3FM9A 2VSYA 2V7QA 1ZGGA 5F98A 4HDKA 3AM5A 4MV7A 4G0UA 1A98A 2C0CA 5DOZA 5ALVA 1I94B 1NR1A 3I23A 4MA0A 2QN7A 4AF7A 1PWXA 2R4TA 2VPPA 4BP9A 1KJ8A 3S1SA 4PHCA 3WX0A 3C16C 4MO9A 1JS1X 4GXTA 3L04A 1J1UA 1R8QA 2GWHA 3O8CA 3O38A 1KXZA 3UMBA 3JQAB 2X9LA 4S1WA 2O5EA 3OZFA 2OBNA 1ADGA 2L0XA 10MHA 3DVAA 3PICA 1ZD4A 3N6RA 2H2AA 1QFZA 5HZHA 5CA0F 2VR1A 2CMFA 5KQGA 1TK9A 2FN4A 2D5LA 1YZGA 1V26A 4Y2TA 3NT5A 3TD2A 3GLVA 1E3WB 1KYYA 4FLEA 1OXBB 5TMDA 2GR9A 1U2SA 5DMHA 1X7YA 1PE0A 2HU5A 3L5OA 1W76A 4WWHA 3U26A 1XNHA 3VI3B 2O8DB 1T0PA 5EESA 2W2MA 1IPEA 3SNKA 1R16A 2W0MA 3O2QB 4QXMA 3ELYA 1R9NA 4H77A 3WGNA 1L7VC 4J0FA 2A4MA 2QU8A 1JEDA 1KPIA 7REQA 1WE2A 3IRUA 3N8IA 1BWSA 4HF7A 1AXGA 1B1CA 1GTRA 4J9UE 4ALIA 4QASA 4NQRA 4L76A 3ZXUB 1I7DA 2Z3ZA 5FWXA 5DV9A 1F8XA 1Y6JA 2YFHA 2R5FA 2GBLC 2L42A 2VSXA 3K3PA 2Q0HA 2V8BA 2UUOA 5D5HA 2OFFA 4RZQA 2FPXA 2QJFA 2YXNA 4TV9B 1TCAA 3DEHA 1Z0UA 2ORIA 1T4CA 1U1DA 2QVXX 3BWCA 3CSUA 3K96A 3SVTA 2MYPA 3ENZA 2XCUA 4RWZA 2VH1A 1UOPA 3TJMA 3TYXA 2H1VA 2WU1A 4UM9B 1I2MA 6GPBA 4QVGA 4Q1CA 4O59O 4KL8S 3OM1A 3OPXA 4JOCA 3ESYA 1JXAA 1E79A 4LI3X 2X9GA 2Z1MA 3DAOA 4YUXA 3GAAA 5CVUA 4HDCA 2CD9A 4HY3A 3LNTA 3QA9A 1A88A 1R27A 1L5RA 1E2GA 5ECGC 3F3YA 4MKFA 4JJGA 1JMYA 4B5LA 1XRMA 1U90A 3EVAA 4WXHA 1B4DA 3B9QA 1P7WA 5AKHA 4D99A 5J2TA 2M1ZA 3HJTA 3TSYA 3TWOA 2AJLI 1SBYA 1XEFA 4TT8A 4DQDA 4BPBA 1PK7A 4AG5A 3B13B 4B3IA 2BFDB 4O29A 1U3FA 2X9NA 3M81A 3HN7A 1T4CB 4P54A 4XB2A 5EMLA 3OX3A 4ZGBA 3VNSA 3WMFA 3TZ6A 5K20A 1UFQA 1E0DA 1IBRA 2AIRA 1P9LA 1ZIYA 3IQEA 4L16A 4QTUB 1FMJA 5GJVC 5BOSB 3CRVA 4B48A 5KNCD 5JWRA 3LX6A 3ENKA 2IYLD 1U4SA 4LY0A 2IP2A 4ZDWA 3HY4A 3RLIA 4F72A 1YB7A 3L84A 1S2GA 3UJ9A 5B3LA 3PHHA 3B53X 4NMHA 4UE3S 1S96A 4XLLA 5LMUB 4AI6A 2C5AA 2RGEA 1MIOA 3HY6A 3SDZA 1P1JA 1K97A 1ESZA 2QM8A 3RC1A 1DKUA 1UXHA 3TOZA 2C96A 4N01A 4QWMA 4DHEA 4R2WA 1LLFA 1ST2A 2BP7B 1DHRA 2YNMC 3ANLA 1JKFA 1UBOS 1WZIA 1T43A 3G2MA 3M0EA 1IE3A 1G6Q1 3HFJA 4A27A 2C2YA 4TXNA 4BJHB 2PVPA 3L1JA 1OMOA 1RAEA 1COWD 1KY5A 2G1UA 3QVSA 4HPXB 3VOBA 5AHOA 3K6SB 3AR7A 4R1MA 4KQ6A 1Y6ZA 3G2NA 3H5LA 4K87A 1Q12A 1NN5A 1SEPA 2H1WA 1UM9B 2OG1A 4G86A 4TTRA 2VPZA 1A5AB 1GTZA 1Z35A 2IEIA 3LBYA 4Q4CA 4IDBA 3ZZ0A 3REQA 1PR6A 3L41A 3PPYA 2OT3B 4B4WA 4Y30A 1K0FA 1T2CA 2ZOSA 5KNCA 1WMEA 4MR8B 1P19A 2H2DA 3QSYA 3ZV4A 1QQAA 4KXYA 1O89A 1IYZA 3EGEA 4HX5A 3WLFA 2BKXA 4HYTA 5L4NA 2IYOA 4IJQA 3W2IA 3VXKA 3L7AA 1K5HA