1PR6A

Escherichia coli purine nucleoside phosphorylase complexed with 9-beta-d-xylofuranosyladenine and phosphate/sulfate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
237
structure length
234
Chain Sequence
ATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRQTTAAERQTTFNDMIKIALESVLLGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity of Escherichia coli purine nucleoside phosphorylase.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 81
structure length 234
sequence length 237
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pr6A00
4R31A 3O6VA 4EARA 5F7XA 4YO8A 3F8WA 1CG6A 4M3NA 3K8OE 4K6OA 1Z38A 4TYMA 1PKEA 2AI1A 3BSFA 4DABA 2ISCA 4WKCA 3D1VA 2RJ3A 2H8GA 4E1VA 1PBNA 4FFSA 3PNSA 2B94A 1RXUA 3E9ZA 1A9OA 3FB1A 1PR0A 1SJ9A 2QTGA 3DPSA 4H1TA 3T94A 1RXYA 3E0QA 5CCDA 2OC9A 4TTAA 1ZL2A 1Y1SA 1A9PA 1PR5A 4BMZA 1N3IA 1JE0A 3BGSA 1LVUA 4ECEA 4QASA 4R2XA 1VHJA 1G2OA 3P0FA 2A8YA 1QE5A 2HN9A 1Y1QA 3TL6A 5KB3A 1Y6RA 1XE3A 1PR6A 2A0YA 4TXHA 1ODLA 4F2PA 3GB9A 1YBFA 3UAZA 4PR3A 4GKAA 1YRYE 1Z5PA 5IFKA 1U1FA 2OECA 2HSWA 4DA8A 1T8YA 5CYFA 4NS1A 4LZWA 4R2WA 1TCVA 2QTTA 1V41E 1Z33A 4D9HA 4TXLA 4L5CA 1Y1TA 1K3FA 3BL6A 5F7JA 1YQQA 4TXMA 1Z36A 4QATA 3EUEA 3EMVA 1LX7A 1OV6A 3QPBA 5B7PA 5B7QA 2QPLA 4F3CA 1I80A 3BJEA 5EUBA 5F73A 1T8WA 1TGVA 1A9RA 1A9QA 4D98A 3KVVA 5EPUA 2AC7A 4TTJA 4WKNA 1A9SA 1JDTA 4GMHA 1Y1RA 1JDSA 1PR2A 3NM4A 1M73E 3SCZA 3UAVA 4JWTA 2XRFA 1PF7E 1B8OA 3MMSA 2ON6A 2BSXA 3PNPA 4L5AA 1V2HE 4G41A 4OF4A 3UAWA 3FWPA 4X24A 4QARA 4MCIA 1WTAA 1Y6QA 5K1ZA 1SQ6A 3U40A 4L5YA 5FAKA 2QSUA 4EB8A 1ODJA 1JP7A 1JPVA 1SD1A 4YJKA 5CXSA 1ULAA 4GLJA 4QFBA 3PHBE 1CB0A 4OGLA 1B8NA 1PW7A 4DARA 3DJFA 1VMKA 4M7WA 2QDKA 1JDVA 1FXUA 1Z37A 1A69A 3FNQA 1V3QE 5F7OA 4TTIA 2A0XA 4YMLA 1U1DA 1OVGA 4LKRA 1JDUA 4F2WA 3OZCA 5F7ZA 1RYZA 3NBQA 4WKOA 4MARA 1RFGE 2Q7OE 3OPVA 1LV8A 4M1EA 4YNBA 3OF3A 2AI2A 1SD2A 4RJ2A 1RSZA 3K8QA 1T0UA 3FAZA 4DANA 1OTXA 3NM6B 3ODGA 3E9RA 1V45E 1YR3A 3KHSA 1ODKA 4OGKA 4DA7A 1Z5NA 1K27A 1PWYE 3LBAA 2AI3A 1RT9A 3INYA 4D8XA 4TXJA 3OOEA 3LGSA 4DAOA 1T8SA 3UAYA 1V4NA 3PHCA 3FUCA 4L6IA 4DA0A 1NW4A 1TGYA 3O4VA 4F1WA 5EFOA 1OU4A 3OCCA 2I8AA 3KU4A 1PK7A 3OZBA 5F77A 4QEZA 3OOHA 1U1GA 3EUFA 4NSNA 3LA8A 1RR6A 4DA6A 1ECPA 4P54A 4L0MA 1Q1GA 4JOSA 3FOWA 3NM5A 2PGAA 3DP9A 4U2KA 1ODIA 5DK6A 1U1EA 4F3KA 2IQ5A 4TS3A 1PR1A 1A9TA 4LNHA 3KVRA 1PR4A 5ETJA 3EEIA 2HWUA 4OEHA 2A0WA 1RCTE 4LNAA 1U1CA 1TD1A 3KUKA 4I2VA 1JYSA 5CYGA 4TXNA 3UT6A 4D8VA 4LDNA 5CCEA 1ULBA 1OUMA 3GGSA 1OTYA 4G89A 1Z35A 5B7NA 3C74A 4GLFA 4BMXA 2OXFA 1TCUA 3ONVA 2OC4A 3UAXA 5IU6A 4JP5A 1VHWA 4D8YA 4KN5A 4G8JA 4OY3A 3ENZA 4TS9A 5I3CA 1Z39A 4IP0A 3OZDA 5JPCA 4OJTA 4BN0A 1RXSA 1YQUA 1VFNA 1C3XA 4MCHA 1Z34A 5F76A 1V48A 2HRDA 3IEXA 5F78A 3DF9A 1NC1A 4WKPA 1NC3A 1RXCA 4BMYA 1JDZA 4WKBA 3DDOA 2I4TA 3KVYA 3MB8A 4DAEA 4UC0A 1JE1A 1ZOSA 1Z5OA 3P0EA 4NY1A 1T8RA 1K9SA 2GUWA 3OZEA 4PNPA 1PK9A 4QAQA 2P4SA 5C80A 5B7GA 5CXQA 3IOMA
chains in the Genus database with same CATH superfamily
5ELXA 1LPMA 4CKYA 3O6VA 4RHFA 4TOIA 5F7XA 4KIUA 4UU0A 2NG1A 1PTKA 1XZNA 4AN4A 1KQ3A 1UH5A 5C4IA 4I3FA 3SDSA 2A9QA 2PZKA 4Z3DA 3QHQA 2WWGA 5F1KA 5CJJA 1EP9A 4L4ZA 5GZ3A 1JEYA 2VSXA 3D7LA 5IXSA 3ETLA 4DABA 2R3SA 2CF6A 3RIHA 4ZJZA 3I3SR 2WYUA 1X70A 1PDWA 4B6EA 4BKPA 3LPDA 1G7TA 4DLZA 5FOXA 3RKUA 1PBNA 1YKGA 1EM8A 2F00A 2K7ZA 2TMDA 5DHFA 2Q0QA 3EIUA 3FGPA 3H2KA 2I80A 5IT5A 1NYQA 5MGBA 3DS8A 2G5TA 5TF0A 1DOAA 2VC2B 3ORQA 3MRVA 1KMIY 4M9CA 2H1OA 4E07A 1YR6A 1D2MA 2QENA 3U7QB 1LLUA 2VA9A 1I2BA 1VLVA 1EUQA 3UFXB 1IUKA 2BAGA 1JR3D 1ZH6A 2D4AA 2VEDA 1DG9A 3RB8A 2X8AA 1TYZA 3SI7A 5ISMA 5M7EA 5FTNA 3FSEA 5J5VA 3E58A 3C15C 4DMUB 4E7OA 4DV7B 5DPMA 1YS6A 4I6EA 4LIPD 2GHQA 1NM5C 3UJPA 2FN9A 1QG6A 2ZWVA 1DBWA 3DNMA 4CMHA 3TRHA 1CIVA 2XTAA 4Z53A 3IUYA 4OHUA 3AF3A 4TLDA 5H1YA 5IARA 4C29A 1VHJA 2BFEA 4B47A 5JZVA 5L7YA 1T2CA 3UPDA 4R9RA 1I4OA 5H02A 3TF5A 2VZ9A 1XEWX 2NUTB 1X0XA 3UQYS 3IE1A 3CRNA 5JWHA 2KE5A 4QPNA 1PL6A 2VT3A 4L27A 1Z7EA 2F7SA 1AV7A 1O87A 3FVQA 4TXHA 2V8OA 3KYBA 3FUWA 1IDN1 2YXLA 4RLSA 4KMOA 1SU6A 3PR3A 1M34A 1FS6A 1RAFA 1V8FA 4FQ5A 4DE5A 4X62B 3HR7A 5BSTA 521PA 4M99A 5TF4A 3UWOA 1H1DA 4AI6A 3ABSB 2IIVA 2PGLA 5B1SA 1GFZA 1NVMB 4EB0A 3H3FA 4JJGA 2HQOA 4BXOB 2C2KA 4K6CA 3AR5A 3LQKA 1SVUA 1T29A 3MCAA 4GKAA 1Q19A 2I78A 4X1OA 4DLAA 1TIKA 4R9NA 5AUQA 1GZ4A 1YRYE 2CLMB 2VDLB 2JGNA 5ALZA 1MOZA 5FI0B 4I4TA 2E4YA 2WI8A 4DMKA 1JTEA 5H3HA 2BI4A 3SR0A 1ZMOA 3S28A 2OHOA 1YA4A 2HHLA 4NS1A 4XCVA 2V6GA 3JQ8A 3GLVA 4P4NA 1E89A 2NSJA 3TQIA 3FIJA 4HZGA 1GPLA 3I6IA 2QL9A 2W6CX 1MO5A 1IIBA 4R0NA 1NYTA 2AH5A 2G0TA 2VDOB 1PZXA 1SY7A 3OQ6A 5CK5A 4Q9NA 1YZLA 2FZCA 3LPAA 4IIYA 4C0JA 2PJRA 4LHYA 2RHBA 4UQLA 3BL6A 1A7JA 4UOEA 2B3DA 1QK4A 5I8PA 2C7QA 1YQQA 2Q3JA 4YLYA 4ND3A 5EA2A 4KR7A 4MS3A 3BMQB 5L6LB 4RADA 4N7JA 4C2AA 4R0MA 4RSMA 1MCZA 1OV6A 2BMJA 4FJ2A 1T5TA 3P2IA 1CS0B 1KFEB 2FG6C 1QBKC 2O1WA 1HQDA 1OFUA 1Z74A 4ZAYA 2P4UA 4YJGB 2E87A 2XE6A 2DUNA 4FCCA 3R5KA 5EUBA 3L7CA 4E14A 2FSHA 4NDZA 4GMFA 4QBKA 4RFSB 5E6RA 1QP7A 2BEUA 2O05A 3DBOB 3GJ7A 1U3TA 2RKWA 3D0RA 3FDZB 4N3NA 1YZFA 1YDHA 2Q2NA 1X3SA 4DYDA 2PLFA 4UPEA 3L7NA 5KCZA 3CZ9A 1AKWA 1A0OA 2C7RA 2DKOA 4UTPA 4B3DA 3AGQA 1BOFA 3AOEA 2E49A 2KBEA 3ISVA 1UP6A 2J3HA 3HH8A 3ZQ4A 4Q24A 3WMFA 3EH2A 1DTWB 2FZWA 4DLTA 4Q7LA 3C7KA 5CG1A 5K3OA 3PC8A 1GDTA 1P60A 2VTKA 3QVGA 1II8B 4CLEA 2H9AA 4DQXA 2JFVA 1TAHA 3CUKA 3PUZA 2IUFA 4RKFA 5FTJA 4C1BA 1AXEA 3QP9A 2P2YA 3SC3A 3AFGA 1PLJA 1LDNA 2Q6IA 2I34A 2AX4A 3W5HA 1Y4AE 4J0HA 1QF9A 1RWNA 1E1QD 2RH4A 3LG2A 4E31A 3STXA 5KTRA 4U0KA 3U7GA 4BRWA 5IWAB 5L3RA 3NHAA 1USWA 5J4VA 2AG5A 5CIYA 4KEAA 4DXHA 4X24A 4NU6A 2NQ2C 5A1JA 1MORA 1XTBA 1QGAA 5AXAA 2GPBA 4Q18A 4LFCB 3UCXA 3RAEC 3WS7A 2JCBA 4JLBA 3O47A 1TKBA 1TEHA 1JG2A 1XNGA 5ALUA 3TD2A 1T15A 4OAQA 5G0VA 1F4LA 3QJ5A 4BQQA 1UFOA 1OFUX 1UOOA 4L5JA 1DUIA 5FAKA 4BNMA 3ZDZB 5A0TA 3HHEA 2PVPA 1R8XA 4GSLA 4XI9A 1W6UA 2H7VA 4AMUA 2WA2A 2GN9A 2D2XA 2WG2A 2XNHA 1SD1A 1RPNA 3WLPA 3F46A 1ULAA 4ZMSA 4MOWA 2HCTA 3K15A 4AXBA 1S3FA 2CXOA 4ZI3A 2I6QA 1ARZA 1TJYA 2H2GA 4IJ6A 5TPWB 3UK7A 1IN7A 2QBYB 4N3AA 5LXTA 3DLIA 2QYTA 5LB4A 1BU8A 1ZH4A 1EX7A 3TQTA 4EFDA 1B26A 1XZ8A 2XCOA 3FFBA 1D04A 3H2ZA 1R6DA 5F98A 5ECYA 3PCRB 4YCDA 5HIJA 4L5IA 4YJ2B 4GSKA 1LSSA 3FKQA 3ZHCA 1GHTA 1PWHA 3UUEA 2O59A 1NQVA 1M7GA 3WDLA 1PR3A 2OFWA 3MWKA 5ERGB 1UPFA 1CU1A 3FCCA 4MRVA 1KTVA 3B9PA 4KFCA 3VKHA 3DEZA 1V3QE 4EB6A 3COJA 1M6VA 4AZ0B 1J22A 1R0LA 4LOIA 4BLRA 2RAVA 4Z9YA 2XE7A 3EEBA 3ZW7A 5IYZA 4HLCA 4BVJA 5HRAA 3U3DA 1UBMS 2ZM6B 3BXOA 1ORRA 3WWZA 2C58A 10MHA 1YOVB 3E7XA 1HSOA 1L4LA 2D8MA 3TZKA 3LAWA 3QOFA 4CG1A 4RENA 5HW0A 5LQRA 4FGZA 3GEBA 3P2KA 1EWQA 1K66A 1VSVA 3PDUA 3N8GA 4WKOA 5LMCA 4FFRA 2C4MA 3P4UA 1L4UA 4KE8A 4FNMA 4ZAVA 4EBFA 4QQRA 4DV1B 4QPZA 2ZP1A 1YZQA 3O8QB 1RRFA 4K9SA 5B12A 1W85A 1QP0A 4O2BB 4W6ZA 3GUZA 1ZWLA 5IULC 1XNJA 2AA3A 4JQSA 4CGZA 1TL7C 1E79A 4ZVLA 1JIJA 5GV8A 1AH2A 4UXHA 1SWVA 5DDIP 3FSGA 4L75A 2WFMA 2ZS7A 3AV0B 4DHWA 5CA1F 1W44A 1Z62A 5EINA 4EY6A 1NJ2A 3UJ8A 5ULLA 3WK7A 1OYOA 1KL7A 3K9GA 2RHCA 3AF6A 4UAVA 4AZTA 4IUCS 4N8EA 2V59A 1OTXA 1UEJA 3OFND 4MQFB 1CY2A 3GELA 2W5UA 2P79A 2VATA 1YI8A 1MBZA 1DKUA 2R4TA 1C29B 1WF6A 2JGFA 2RGNC 5KNDD 5J23A 3KSBC 1ODSA 4OX9Y 2QG9A 2X23A 2AD5A 4AW9A 1EA7A 4N82A 1IH8A 1R0ZA 2DPMA 2GZRA 5B1DA 3FJOA 4PRLA 1O0BA 1AQUA 4C06A 4X3PA 2G77B 3SICE 2WPDD 1GDHA 3QUAA 4A23A 1YJQA 3HS3A 4HP8A 4P38A 1KR5A 3GO4A 5K8IA 1JEOA 1GYQA 3O26A 1RT9A 5IH7A 1R8SA 3ZIDA 4OI0A 4YRAA 4B87A 3K70B 3SIPA 4ND2A 1Q6YA 2A9RA 1VMAA 3EAFA 4HK4A 4QG7A 2LRHA 4ZO7A 1XJ5A 3AYXB 3NGXA 4LPKA 4G5HA 3R7AA 4XWOA 1WIWA 2BM0A 4L1KA 2F1JA 4PHCA 4P5EA 2JI9A 4U2GA 4KFTA 1DEKA 3JYLA 1B76A 1CS0A 2V58A 1RBMA 4GQAA 4XIIA 4M36A 2F17A 2NU8A 3T34A 2VSYA 3B53X 4RBNA 3VSEA 1RC8A 1QFSA 2HIAA 4ZWNA 2OCIA 1T4GA 1U5AA 3BB3A 3DFZA 3U60B 4DCGA 1UJ6A 5FI3A 4BLWA 1ZRHA 2OPBA 1JLLB 2BR5A 3BQMB 1US8B 3MTJA 1OI7A 3NATA 5E9QA 4HLNA 3KZOA 3ZHYA 1SIBE 3WGMA 3LQ1A 3VSAA 2Q7XA 3P0JA 2P9QA 3V5NA 4A15A 1EVLA 1K7YA 4RJTA 1ZW1A 5KKNB 5EIWA 3U4QA 4FMCB 2F2TA 1LZKA 3MSXA 3RFVA 3TJRA 4AY4A 1AHIA 1SXHA 4KK3A 3ZKWA 4AJEA 3R3VA 1O4VA 4FTWA 1QFJA 1R6BX 1NVFA 5EE1A 4L6CA 4KAFA 4XJSA 3PA8A 5B2FA 1DV2A 3KB1A 2G40A 4LRWA 3UOWA 5CDFA 2IXFA 5AQ1A 3PNVA 2ZK7A 4AVYA 5GGXA 1FQOA 1JG7A 1Y8QA 2ZYVX 3UENA 4TYQA 1N8TA 2HCBA 2Q9UA 1FUEA 2BEWB 3AJ9A 1U6KA 2YVQA 1NFFA 1O0SA 4IKPA 2A9OA 4Q0MA 1XTUA 2AR9A 4E30A 5DV9A 1GTG1 1XUOA 1GZSA 1PKXA 1SBHA 2FQXA 4Q3DA 3TXAA 3AL3A 2IDZA 4G4SO 4QXMA 2JGDB 3JWGA 4K88A 3W5VA 2FSVC 2QTBA 4FOLA 2FP4A 1A9TA 4LNHA 2WR8A 4AYXA 4D9NA 3LHSA 4O4LA 1SCNE 2WIKA 3AC0A 4N0DA 2WRZA 2WDPA 1VKJA 1FEZA 1D2GA 4M76B 1DRWA 1UXGA 2B4RO 3I1JA 3ONDA 5IVIA 4DJJA 2F62A 2PUAA 5K8CA 5AVJA 2NO6A 3JQ7B 4DJTA 1RU3A 1ZGBA 4K8RB 3EOZA 2RK6A 2AIRA 3MCWA 4R68A 2HYIC 1ONPA 1B15A 3KUXA 1TD1A 4QUHA 2GPYA 3UV3A 1GV1A 2P78A 4BFXA 4A10A 2ZI7A 3Q3HA 1WUJS 2M1XA 2R6GA 4MI1A 4NI5A 4YAEA 3TI9A 3UT6A 2BC9A 2ZUVA 3T7AA 3U1VA 1KI9A 1KYVA 4ZPJA 2Y0PA 5KAPA 4DF3A 1EFAA 5EWJB 3RT9A 3ZK8A 3UJNA 1U0NA 1CJUC 2YW9A 3SBDA 2HFJA 4DNQA 5JS7A 2IXDA 3BE6A 2LCFA 4FE4A 3B9RA 3R3SA 3GEIA 4EZIA 1FX1A 2XPCA 3WAGA 1QS0B 2GEVA 2OQIA 3GNTA 3KOXA 4RWZA 3CR3C 3RS7A 1FTGA 5L4LA 1TA0A 2HO4A 4O4HA 1MG5A 2HPHA 2ZRMA 4FHFA 2J9ZB 4GM1A 2BKEA 3S2YA 4FDAA 2PGDA 1D1SA 2BW0A 4EHBA 1PZHA 4LYEA 4CM7A 3QKSB 2OD9A 2DB3A 1EZ4A 1Q1EA 1SGWA 2R5FA 3D3KA 5AKYA 5FL3A 4XUGB 2G4VA 3NTVA 2H1HA 2ZE8A 3CLHA 4KACA 4NE7A 4B3MB 4QTYA 1JHOA 3K6KA 4JB2A 4QT0A 3UOAB 1MB2A 3FI9A 4C78A 1L5QA 4MRPA 4UTNA 1U04A 2Z4RA 4P4SB 5E8JA 5CB4A 5KYXB 1E8NA 1LWNA 1UM9A 2V9PA 4Q4AB 5KYNA 1UKEA 4ARAA 2BM9A 1OV4A 1CB7A 3EULA 4AKTA 1RXCA 2PUVA 2QRPA 4YLEA 1I3KA 3S44A 3SIRA 4PY2A 1E2QA 1XLTC 3U4MA 2KLBA 4TV9F 3ZWCA 1L3CA 3NVAA 1FTYA 1CQIA 1MOPA 1UKVY 3CRQA 3KVOA 3KVYA 3AEUB 3T7SA 3PFBA 1ZOSA 1WF3A 3T5PA 2JFUA 5A9TA 4YMUA 2V74B 2BD0A 3JAWB 5KSWB 2IHVA 2JGAA 4R69A 2FPKA 1BKYA 1TZ2A 2H85A 1F6BA 4H4EA 4BO6A 5IAOA 3HE3A 4URZR 5DYTA 3RSZA 3CE9A 4O4JF 2IQIA 4P33A 2IOHA 4ZYXA 1WOYA 4G9BA 5IJ0A 5K3AA 3A37A 2O8FA 2P4SA 1ETUA 2Z2JA 4Y1FA 4EMUA 1EA5A 4AWBA 4Z3OA 1R15A 3KB8A 3G9XA 3LQYA 2F3UA 1TAGA 4J91A 4ETNA 1T36B 1NFQA 4R0VA 2C9YA 3H1BA 4II3A 3HY4A 3TNDA 4XKJA 1EJ2A 4AS3A 2CLHB 3DT9A 1H4VB 3ZBUA 4HEA6 1KTIA 1W76A 2JGJA 3KTOA 1RQPA 1X14A 1WXGA 2BFBB 2RKBA 1MJHA 1M2NA 3DO8A 3TAUA 1M6HA 5A4FS 5JNVA 2IS1A 3N2LA 5IZCC 1T9BA 2VAXA 1MD9A 2FW6A 1I1QB 3ACBA 3OJWA 4LBWA 3ZDXB 5FOQA 1OZAA 1TVKB 2FV8A 3NT2A 5C8YB 2PX6A 1WS6A 1WZEA 1E69A 2ZRCA 1UINA 4KJZA 4MS4A 4G4GA 4X7PA 1JFRA 1P9NA 1GNQA 1OWMA 1AUQA 1M6NA 4TWRA 1JKJA 5FB3A 3VDQA 4LZNA 1S2GA 4F84A 1CZNA 4TVSA 4DLUA 4M0EA 2JEOA 3IGFA 2HTFA 4TUYA 1I3NA 4DQVA 2OBXA 2JJ1D 2WHPA 3DEFA 1C4XA 3NTOA 4U7FA 2NPIA 1Y1SA 4EF4A 1XPUA 5ALWA 3RT7A 5FI1B 1R0XA 2VK2A 4RVSA 3TH5A 1PI3A 2P3SA 3LE8A 4KSCA 3A3NA 1N2XA 2EX1A 1J8VA 4IPTA 3MMZA 4XDYA 2QN7A 3NAZA 4EDHA 2ACVA 2C4KA 2V6FA 1LVUA 2VK4A 4REQA 1V9SA 3CCCA 4GP7A 5GIOE 2H4JA 3MZ0A 3EIOA 1E98A 1XIVA 421PA 4W4TA 3O73A 2X0JA 2XYPA 3AR8A 3N70A 4KN6A 3R7NA 4KSYA 3GRYA 5DM0A 4AIRA 4YRMA 3TL6A 2WF5A 3HY3A 5HKOA 1ZOPA 4MDHA 4RHXA 3ZHRA 1E1LA 5A9SA 3WLHA 2GF9A 3RH0A 4PNEA 4UTRA 1JHMA 3V1UA 4QEKA 4F2PA 1JKFA 4GX5A 5J1TB 2VS1A 2VNSA 3VR1A 4W5HA 3FY4A 3KJHA 3GB9A 5ERXA 5F3DA 1HH4A 4TL6A 1PIWA 3JWEA 1VKHA 3F4KA 4NG5A 3UAZA 1IIRA 2CD9A 3OZRA 4QPCA 2IHBA 5E7QA 4RULA 3N9IA 3HCBA 1O89A 3PNYA 3PQCA 4M55A 1PNRA 5GV7A 3QENA 3DFUA 2WMYA 1PZGA 4TMTA 3IUQA 4IH1A 4CMAA 4L50A 5F2OA 3CLSD 4QD3A 1O5IA 1T5DX 1A9YA 4C08A 2D0OB 5ILOA 5JG7A 4D96A 3DUWA 3L43A 4DG5A 1YC2A 3CSDA 3IPYA 5LDDC 2H9YA 2MWMA 2JFNA 1ZU5A 3JAKB 1QK3A 3L6UA 4EJ2A 4QFDA 3LHKA 2IZ6A 4FGKA 3RSFA 3WP0A 4WIAA 1O6CA 3KFVA 3RG2A 4E12A 2ZT5A 2JASA 1UXJA 3KZKA 3QVMA 3Q2KA 4MUHA 1SOMA 2HMVA 3Q10A 2W2OA 4XM1A 1TF5A 4C30A 1RAIA 2CZQA 2RI0A 3M4JA 4M0DA 1KOGA 2P65A 3V1TC 4OH7A 2X0RA 4I14A 4UVIA 5IZ4A 2RBGA 4IQ0A 4BJHB 3IDZA 3PGVA 2Y1WA 3HXKA 2FZ5A 2GSDA 3QTTA 2D5AA 1NWHA 4U1RA 3E9MA 4XGQA 1HV8A 4D3ZA 4F6RA 1TJPB 3CZPA 3VKUA 3EH1A 5CFMA 1E61A 1ML4A 2HUNA 1T8WA 2XIJA 1K1EA 3IPRA 2ZIZA 3RRBA 3ZE7A 3S1SA 1H05A 1DCFA 3ZD9A 1T1EA 5FWDA 3RR2A 4X45A 4W8GA 1G0OA 1EUDA 2OB1A 4D1YA 2AC7A 4CLRB 2B92A 1EPUA 4R1OA 3FHLA 4OHCA 4HDSB 5DIZA 5DK4A 2IUSA 1OVMA 3EAQA 3TXXA 3TZEA 4XYLA 1SN7A 4BAZA 2P35A 2ZWAA 1VGRA 4D8WA 1K8QA 2JD0A 3TDKA 1P0IA 3K5HA 3JALA 1EIWA 1ZGGA 4U4AA 3DTVD 4N47A 2JIZD 5CMLA 2X0FA 2REBA 4FUQA 3L1IA 4NVRA 1JHYA 1P45A 3H6GA 1EGQA 3NORA 3I6YA 3UAVA 1T2DA 3FDFA 5IS2A 2M1ZA 1FOEB 2YYYA 5AKJA 5JMPA 4KPEC 1J0BA 1HYQA 3KR0A 4Y2RA 1BMQA 1SHJA 1GL9B 4IQ4A 4FHGA 5KNDA 1WZ2A 3DAHA 4B7ZA 4K9LA 1Q50A 1DXYA 2WVAA 1YR9A 3RFXA 4B3IA 1C3VA 1K6MA 2FSVA 3CLKA 1DX4A 2FEAA 2D62A 2QZ9A 1QH8A 2TS1A 2GEKA 2X13A 1DV1A 1IN6A 1UIMA 3B3QA 3HA2A 2P1ZA 2VKQA 1MXFA 2QRGA 3IB3A 3DKVA 3LC1O 3LQFA 3TNLA 4GYJA 4L5AA 5I9TA 1V2HE 4G41A 1N77A 3ZK7A 1YXMA 1BHQ1 3DQPA 4TTQA 5TT1A 2NYRA 1JEQA 4MHTA 2ID4A 1YB6A 4H7PA 4OU5A 2WWWA 2VLIA 4IIHA 4J0DA 4RACA 2EP7A 4DR2B 2AMVA 3OQBA 4E3ZA 4HRVA 4KL8S 1WTAA 3UJDA 3WO0A 2BI7A 2QTAA 1TNDA 1UBTS 1M34E 1FUYB 4M8LA 3U40A 4Y7DA 5J2TA 2FDRA 3K94A 4B45A 5JAIA 1BEUB 3DP7A 3IUJA 1CVRA 1Z4MA 4HRAA 4JZKA 3NWPA 5LM3A 1TU4A 3LPLA 3LUDA 5LWHA 1ODJA 1JP7A 1KVQA 3B3JA 1ZA2A 3HKEB 2ETVA 2HQRA 1CE8A 2EKDA 3AUTA 3STWA 3ZR4B 9ATCA 4N6GA 5BSVA 2XGJA 1OREA 1S6YA 5HUHA 1G41A 1EVJA 4CQLA 1CB0A 1TM7E 3DFKA 2BH9A 4OJMX 1YRWA 3U0BA 3QFFA 3P5SA 3FPLA 1G8FA 3PUVA 4URXR 3NH9A 4H17A 1W88B 5FUWA 5LQCA 2FOIA 5KNCD 3GR6A 1DARA 2FPLA 5EWMB 3DJFA 3HYCA 4J0IA 4HGPA 2GHIA 5JNSA 1S2DA 1P6UA 3K0BA 5JDIC 2C1XA 4MB6A 3DULA 1FFAA 1XXHE 4HRXA 1EJ0A 4DIKA 3CRW1 5A3RA 3S8YA 4LMBA 2G9ZA 2FRDA 1GPDG 4D9FA 3L6DA 2WA1A 5BYBA 5EJIA 1KOLA 3I23A 2QJFA 1IJKA 2ZVQX 3A26A 3L0OA 4TQ9A 4DCPA 2O8VA 2VJLA 4PO3X 1VIDA 4KLRA 2X8JA 2FU5C 1YOVA 4N54A 2F43A 4LKRA 1GPMA 3SJAA 5IM4A 1VLLA 2BJWA 1XQYA 1PLKA 3LKZA 1C9DB 4PANA 2RHLA 5E6SB 3QIAA 3ER9A 4WI1A 1E3JA 2FFBA 2COUA 4LZOA 2C96A 3VYTB 1LD3A 3H8VA 2EDCA 3SVLA 1BA2A 1WV1A 1NXTA 3MAGA 3BIOA 2QF7A 3AEQA 1E8DA 5F7ZA 1XVIA 3H4MA 1L7EA 2Z3WA 1RKBA 2N42A 2GEFA 3A14A 3L0ZA 4NDAA 2XEDA 4TN5A 3N2GA 4BAGA 3GJZA 2O0MA 5BWBA 1PFVA 5LP6A 1Z7YA 3Q1KA 3HKBA 4B3TB 3T38A 1O7JA 4IDCA 1NJ5A 1DO8A 2Z2XA 4URUR 3GYBA 4ZHQB 1IZZA 2B4TO 3DBHA 1UDCA 2EARA 4G0XA 3CVVA 1ML3A 1JXAA 3GZNA 1OX4B 1EAMA 3PXBA 1N5LA 1GM5A 3MHPA 1U2GA 2Y0BA 3C41J 4FYMA 5BNZA 3I42A 4JHXA 4YCCA 2IXAA 1F20A 3LDHA 3BH6A 4IDPA 4RJ2A 1L4EA 1YHYA 2ZLBA 2F1OA 3HP4A 2BBWA 5I7SA 1DGQA 1G8GA 4IIJF 1VIAA 5EIFA 3W78A 5JJBA 4LCEA 1G38A 2ENWA 2J59A 1V45E 1ZX1A 3PEFA 4JVSB 1OKKD 4EPXA 3V9AA 2PMKA 4HTAA 3DDUA 1NPYA 2ATEA 4XQ0A 3ZLBA 721PA 1U2GC 2ZIUB 1DG3A 1VCMA 1Q44A 1GPH1 3OWHA 3TYXA 3R9IA 4C20A 4PLCA 1CUYA 2Q29A 1UBCA 2VHVA 1BN6A 2QDXA 1G7RA 2O7VA 3BJRA 3LCMA 5BSKA 2JJQA 3AO0B 2HMWA 1TF2A 1OI4A 1A98A 1ZESA 2HBZA 4DEVA 3GRKA 2RH9B 3K70C 2XH8A 3F0TA 1NJSA 3A0UA 4RTOA 2XVAA 4AY6A 4AN0A 3GLHB 2I9PA 1JWBB 2O06A 4BNWA 3FFXA 3WLEA 2DXIA 1UBSB 5KTMA 1V6AA 1OXXK 1EFPA 1TGYA 2O2DA 3B1FA 2K2QB 3MD9A 3EZ9A 1FMLA 2RH8A 3UNXA 3KELA 1OU4A 2VKTA 5K3BA 5DO9A 4RCVA 1Z2PX 2ZRLA 5BYAA 1XZIA 3CJQA 5K0ZA 3K9FC 3R23A 2AOWA 2BRUA 5IJZA 4K3UA 2JBWA 1ZL0A 3EIXA 2ACEA 3JYOA 3L18A 1B3BA 2FMIA 1CQXA 1EH5A 3E70C 4Q9DA 4S1VA 4YGYA 3N2ZB 5EEHA 3WGJA 2V7XA 4RVHA 4YUAA 1V16A 2I3GA 4Z5XA 3A10A 1T8UA 2BJVA 3OC6A 3BDIA 1KVSA 1N0UA 3G2PA 4YJ2F 1G8SA 5P8WA 1T5SA 1G20E 1SQFA 1UWCA 1U28A 4J7UA 3EZGA 3FZGA 5K6TA 2BGMA 5K3DA 3NVMB 4IDHA 4H7HA 3ZVLA 1Z3CA 3QU9A 1WDKA 3WYFA 4IFBA 1NLYA 2CJWB 3CPHA 5TRTA 2ZBVA 4N8DA 1C7FA 4HBZA 1K8RA 1UBHS 3BBPA 3DP9A 1SCDA 2WMOB 3GRAA 1SCBA 4YVFA 3QLVA 1YT5A 3PVCA 1RQGA 4F3KA 1RC1A 1ZCAA 3OC0A 1H5QA 4GGOA 3AUXA 2G09A 4CLDA 1T9CA 2JFOA 5LBUA 4N48A 1NRJB 3FIUA 5EIAA 5BO5A 4DMLA 4FMDB 2ORED 5HKLA 3WDMA 4AK9A 1PR4A 1KYWA 3DVRX 1R5OA 2BFBA 1W4BA 3VVMA 4RVOA 4ZT4A 4XVHA 2Q1UA 4A2WA 1OT3A 1U7HA 5A03A 5I9IA 1HZZC 3LSYA 4ATNA 2ZOSA 2XLCA 1J0CA 3CZMA 4PC6A 5M34A 1TAUA 3G82C 5DN6D 2HLDD 1DIHA 2VDKB 3IODA 3LY5A 4LNAA 4N7RA 3H11B 2D59A 3QQPA 3Q3VA 4RD4A 2W42A 1E3LA 2XT0A 1L7BA 3RLIA 1JYSA 3KJXA 4Q6BA 3TW8A 5ARBA 4D8VA 5TQVA 1N6HA 4REMA 3OURA 4X90A 3QQ5A 3G85A 3FROA 4G89A 1PAUA 1Y6ZA 2HU2A 2KBFA 1CY7A 3OG9A 3R7WB 1OE0A 3SS9X 1XTSA 1ZNYA 4NBUA 2CXXA 4KPYA 8MHTA 1D4FA 1YTLA 2H17A 3PXUA 1USUA 2KQUA 1YKSA 2C95A 3W6PA 2BYTA 2GZSA 3CLUC 2Q0HA 3M5DA 2KX7A 2I6FA 2ZJ7A 3RUPA 5E4FA 3BHIA 1DKLA 2N3ZA 4XVRA 1NT2A 5JC1A 3ZKWB 4FYPA 4E5NA 3AIMA 3IXMA 4X20B 1OX5A 4J8PA 2C7BA 4GVLA 4XGNA 2ZZNA 2XCIA 3K35A 2BSAA 3M0EA 3U7JA 2EFJA 3C1OA 2GXQA 3JQBC 5CURA 4ZOBA 3W6NA 1O1YA 3GFPA 1G8PA 2WVGA 4HAVA 4HGYA 2IDMA 3BE8A 4HXEB 4W5WA 1X7GA 3HPQA 3HXLA 4F86A 3CVWA 4I9NA 2Y68A 3BRWA 3K2QA 2ONCA 4B3GA 5FUMA 5LQAA 3CEAA 1TJ5A 3IAM6 2HFKA 1RBYA 2H4FA 4FMCF 1A1VA 1E1CA 1TF7A 1GGEA 2BKXA 2LIPA 2F3PA 1CQWA 1C41A 5DGDA 4FEYA 2QRZA 2Y1LA 3L82B 2OVFA 1YKFA 4IUDS 4QWMA 1VECA 1Z4IA 4J0FA 1E60A 4WY2A 3OU7A 4KX3A 1NSYA 3I39X 2JGRA 3I2FA 1CWUA 13PKA 3PDCA 1Z83A 1SUBA 2EDAA 1H42A 3RC2A 1JJAA 3SM3A 4HPWA 2PUJA 3SSAA 2CB0A 1SOAA 2H59A 1VDMA 2MTBA 1JDZA 3FBTA 3K2EA 3ZUPA 1HXHA 1X1BA 5JQGB 4MYTA 3MB8A 4B0OA 4UC0A 3MUNA 4RAOA 1XVVA 2ZWOA 4FHEA 4YQFA 2G06A 3SY8A 4ARSA 4Z9BA 3BMCA 5BNWA 4WEOA 3GZNB 2I71A 4V0NA 3SYLA 2QRLA 3URKA 1GRVA 4G85A 4RKRA 2BUBA 5L7TA 1O03A 1ESNA 1YB2A 3OFNA 5D5PA 3S5JA 3QPVA 5EZYF 1IJEA 1KKLA 4XEHA 1FYVA 1PK9A 5FPYA 3ND6A 5NLLA 4FZ5A 4M54A 3FJYA 3NW9A 3RF6A 1QGED 2B4YA 3ZPXA 4K40A 3ZW9A 1ZR4A 4IIEA 4FOOA 2OEPA 4HGRA 3TLAA 2YASA 4PONA 2CC2A 4MQFA 4BLTA 1ISHA 3OBIA 1JXMA 1CW2B 1DRJA 4XB6B 5CW1A 2YW2A 1HQCA 5IASA 2CKMA 4OL0A 3OJXA 1H4TA 5AWFC 3VR5A 1OYVA 5HBRA 4YR9A 2ASVA 1OBFO 2XB8A 3IJRA 4AURA 5BSFA 2VPIA 1O08A 4AJJA 1M2KA 3FN4A 4K6MA 1I01A 4A0FA 4RD0A 1CY6A 4BFSA 5FKJA 1CUUA 2WAXA 5SYMA 4D9IA 3T4EA 2PMWB 1SUDA 3NWOA 4H77A 3S70A 2VSFA 2X6TA 2RJ3A 5LOVB 1VJDA 3MRTA 2LWIA 4E4YA 1D4ZA 3WWYA 4TV9B 1GLGA 3GK3A 4E7PA 4YLGA 2VPZA 2O1EA 2J9XB 4WLEA 5LQMA 4QIHA 3LJKA 1B1AA 2P6OA 3M6UA 1N2CA 5SZHB 1TK9A 1PL0A 4LE1A 5AM4A 4NEGA 2HMAA 3VU8A 1WZCA 1S5PA 2C3OA 2OGWA 4NZNA 2A1UB 2RGWA 2VRWA 5K0LA 1OXMA 2A30A 5B4VA 3G3EA 1W4ZA 1Q5PA 2QLBA 2V45A 5DX1A 3V4OA 3ABIA 4HWKA 2REQB 5EHZA 1QYWA 5D8DA 1W59A 1H8EA 2YTZA 4JGGA 4X1IB 5F1YA 4I5EA 2QIOA 3NIGB 4RESA 3UIEA 3VX3A 3EA0A 4CZ2A 3SF8B 1W5BA 1ZM7A 2E89A 2PGOA 4JUIA 4M49A 3UWPA 2XT9A 1WXEA 1RRCA 4B6FA 3R44A 1SIOA 5FA5A 1Q0SA 3KM0A 3KT8A 4FIDA 4RZHA 3P94A 3QKUA 4BNFA 1CVIA 4ESOA 2ZR0A 3RKSA 2Q5JA 3ROMA 1QDUA 1JIUA 2I62A 1XZJA 5DIFA 2DUWA 4BEBA 1CEQA 2VSQA 3KOUA 1GUZA 4YREA 2XAAA 4KPGA 3F5FA 4J90A 4LWZA 3ABRB 1JJFA 1FNBA 1XE3A 4INOA 1QVZA 4G25A 4RY8A 4ZVPA 1I33A 1PHPA 1WMBA 4RANA 4BS9A 3LXRA 4MYDA 1ZN8A 3V7NA 5ILGA 3TSCA 1Z7WA 2EBHX 3IP6A 4BLOA 2HA2A 3OM0A 2ODWA 1GPUA 1KYXA 4IH4A 5AKZA 1E20A 3WY9A 2YVUA 3QG5A 3IEMA 3AVVA 4IRUB 3FGNA 3DDWA 4NMMA 1RZVA 4M1ZA 5BQXA 4JI2B 4IR7A 1XU9A 2BEJA 4EO7A 2IYNA 3HLKA 3FE2A 3FYTA 1NNLA 1SO8A 1I7SB 1GNRA 2I7CA 5E6UA 5KAMA 4DCCA 2DY1A 4H16A 3X1DA 4AYTA 4F4HA 1F60A 4ETMA 5K6AC 1MNQA 2YRWA 1U1FA 5DLDA 5I3CA 1ZNWA 3FZQA 4LC1A 3ZWPA 2R1TB 2WD8A 4R71A 4I1OA 4CMKA 1S2LA 4K2AA 2FR8C 1WULS 1MC5A 4QQFA 4AJ1A 4LZWA 5BR4A 3I92A 5EHXA 1G63A 4I19A 2R11A 2BZ1A 2D2FA 3F6PA 3LX4A 3IAS6 1EVEA 1A88A 4D9HA 2YJ3A 2D2EA 2WJWA 3KB6A 1J00A 1R64A 3BD8A 5DNWA 1K6JA 1OLXA 4IO1A 1TK3A 1FP7A 4LYGA 4GLLA 1NDHA 3I52A 2O23A 2J30A 4OM8A 4RF4A 4O4JB 5JXWA 5F7JA 1VG0B 2PKEA 2QTVA 2VWHA 3PQ3A 2Q2VA 2XWSA 2CJFA 3E7FA 3Q0EA 1N0IA 2FQ1A 1EFUA 1ZHHA 5BQPA 1Y1PA 5FV7A 5EZYA 2DUJA 4AP5A 3HPRA 5BRAA 3O8OA 3ZV5A 3GV0A 1NVUQ 3NNDA 3M4YA 3RVJA 1CSEE 1FPMA 1MOSA 2QPLA 1BWQA 3I6ZA 2FCRA 4WJKB 3UEOA 3T3HA 4ZDWA 1Y8RA 1NG9A 2XUZA 2IYAA 4JU8A 1FFHA 4CODB 1WVIA 3NFYA 3R76A 4A8JC 2W2NA 3SWWA 4DKJA 4DEYA 1XTKA 1QZ3A 4G5QA 5I9SA 5TGDA 4NCBA 2PX2A 3MTGA 2LUOA 1WW2A 4P6VF 3NLLA 2B2NA 1P6XA 2B9VA 2OGZA 1KYTA 1O5OA 1ZRNA 2G63A 1L4FA 5HM6A 1IMJA 1FUIA 3RAPR 2AC2A 3NBXX 4OHPA 4EUEA 1O8CA 3WJ2A 5IHXA 1T2UA 2MSCB 4MP8A 3K09C 4PPQA 5I9MA 2IH2A 2YCBA 4OHWA 3RTEA 3QG1A 1XHLA 2QJWA 3M3PA 5LB2A 5I47A 4YP6A 5HNKA 4U2FA 3Q88A 5HRUA 5CB6A 3K0HA 4RZSA 2C1EA 3FH0A 3IKTA 4N9QA 2XUDA 4XEUA 1FL9A 3K4HA 2YVLA 3OM1A 4WACA 3CUEF 4KO1S 2XRFA 2IYTA 3JVUA 1IAQA 3LM8A 4K5QA 4UBOA 1CPYA 1NF3A 4Q4LA 1PYGA 3E18A 3SYNA 3ZCRA 3R75A 1GZ6A 1UOQA 1OJLA 3HC7A 4TMFA 2FWNA 4XRRA 1GZ5A 2APJA 3VYRB 3DMPA 3LVQE 4N65A 3MOIA 5C53B 2XGSA 3F7TA 1CLUA 1TKAA 3JATA 4G0OA 1RBQA 1Z68A 3UT5A 1YRQA 1S3SA 2CLDX 1DPGA 2POQX 2AOVA 3MQ4A 5MN4A 1EXWA 3MLEA 3DV0B 2JVIA 3MJVA 4P1ZA 3T95A 3TZLA 4CTKA 4E6EA 3C24A 2PV7A 1MG0A 3L02A 5EMKA 3GAMA 3MUEA 1DEAA 4F5EA 4R2HA 5DNVA 3TAXA 2IBSA 1FJGB 1JWLA 3O9VA 4HWPA 4E32A 2SKEA 4O59O 4QZVA 1Z12A 5E2IA 3PDIA 2ZXUA 5FBLB 4XWWA 3KT0A 4GX0A 2I91A 4JP8A 3B1XA 1XF9A 3H0CA 1T4CB 2H2IA 3R0ZA 3SD7A 2AUMA 1DKPA 2ZYWX 3NANA 3IT1A 1RRPA 2WE8A 4UPVA 1G7SA 3SLGA 3W8NA 4XCQA 1WDLA 3FNGA 2PCLA 3CLTD 1Q21A 3EVAA 2Z9BA 5AQEA 4KIGA 5JIBA 2IX3A 5LNK1 4AZSA 1DCTA 1ZIOA 1Z2AA 3A70A 3RLFA 1GLVA 2EZTA 3E84A 4OX9B 4YT5A 3O84A 4DLXA 4LAFA 5IYZF 3QEMB 3KS9A 2FI1A 2ABWA 1XEFA 3A4TA 4MJXA 1F8UA 2E4XA 2Y99A 2GOYA 1LLFA 5H7XA 5JV5A 3LK7A 5EP1A 1I2AA 3UWSA 1OVGA 1SEPA 1P4JA 3W5DA 4NJEA 3DTNA 1KAGA 4JJ7A 3EDRA 4NZ9A 3UATA 4ALLA 1NV9A 1PUIA 1Z6YA 2FUKA 4HUJA 3TBHA 4C87A 2ZBGA 1EP1B 3VQTA 3N7UA 1VSUA 3KE8A 1NJGA 4ZVQA 1UWVA 1TRKA 2PUEA 2RB4A 1XZBA 2AFIE 4ZYTA 3DV2A 1HA3A 3KV1A 3SKYA 3DTYA 4OFBA 3SM9A 5LLTA 5B57C 3GCGA 3AUUA 5D1NA 4HDNA 3QXHA 3OTIA 2UVQA 1RWMA 4HKTA 1XLVA 4C2BA 4MARA 5LBTA 2CNWD 5DGCA 4FILA 1JPUA 2X0IA 4A91A 3KUUA 1KDRA 3I9V6 5FWYA 1DAOA 2PH5A 3NXKA 4PC7A 3DD1A 3EMBA 3HDVA 2IBMA 2O48X 3F6SA 4NU5A 4M1EA 4QUIA 4LHWA 2LXNA 5HOEA 3JVVA 3DM9B 4AJHA 4RDHA 4D4LA 1XCJA 2NXJA 3KR9A 1HDZA 1S02A 3BG5A 4RXUA 1WPXA 5EQTA 2PNJA 1EZZA 3OLZA 5CLHA 4HVLA 3L84A 3RU9A 4KQ6A 1RRVA 3L7YA 1YS1X 2ODQA 4B6JA 5GTDA 4DILA 3ZXUB 3DOJA 3F5QA 3ASVA 1NLZA 3HXQA 5LCXA 5KYGA 1NBMD 4KGZA 4LCJA 3R8CA 3GGOA 1X15A 1XQ9A 5E3JA 1EESA 1BX0A 3OIYA 3G89A 1YR3A 3TL3A 3KHSA 3D4BA 5HRCA 1U0EA 1V8DA 2QP4A 1VE7A 3NAQA 4Y2XA 3EGXB 4G23A 2MOKA 1DWPA 2GQ0A 2O4UX 4J2TA 3LDAA 5A5GA 3C3CA 4FW8A 2BZSA 5FJJA 5YASA 4BGUA 2X5XA 3BE5A 3DOOA 2TRSB 4R1TA 4G1BA 3TOVA 4DUYB 3WL3A 3O7WA 3FCSB 2RJNA 3THXA 4KXXA 5IKMA 4COKA 4F46A 3TOXA 3T5DA 3UMFA 3L0YA 4BXOA 1SXJD 2JGEA 2FSSA 4S04A 2YJ5A 3EC7A 2HSZA 3V7UA 1LNSA 3UAYA 2GLUA 2X0DA 3S8MA 2VZLA 1GXSA 1QUEA 3C8UA 1Y7PA 1I3MA 2HF8A 2I7XA 3IEPA 3Q7TA 4LGMA 3JQEA 1E18A 4F3RA 3AB7A 4EW1A 2C9OA 1A95A 4BOYA 2OORC 3D2BA 5EFZA 5K9ZA 1B6TA 1E0DA 5DYGA 4MCJA 2HDOA 1GTRA 4C7JA 1JEDA 4FOTA 4DWJA 3WK4A 4WCFB 1NVTA 3K05A 3NAMA 4KK4A 2ZPTX 3LC2O 1OFVA 1T34A 3IKJA 4KLZA 2W00A 3R7FA 2CXNA 3SVZA 3ND9A 3H05A 3EXIB 2CN1A 3VV2A 3E9QA 1U9JA 4P22A 5EJMA 3HCDA 2Q99A 1TTTA 4U7WA 3BIWA 3M6FA 5EOVA 2VFAA 1RKVA 4TKUA 4DGSA 1EIZA 2WMNB 3K9BA 3AZQA 1S89A 4DGQA 4G1FA 3AVWA 4X41A 3KYCB 1IUNA 5T6BA 4RH1A 4Q7MB 3FAKA 1QPBA 1JFFA 4K6HA 1O5TA 1G3IA 4QBGB 3II6X 1RR6A 2XUFA 5C5DA 1CUDA 4A36A 1SC3A 5B4TA 2JH9A 2IOFA 3A1CA 1ADCA 4LKOA 3ONFA 1T5IA 4QGBA 5FBKA 2VSNA 4AFNA 4WWHA 1JMYA 1SZCA 2HBQA 3K20A 4KQMA 2D4HA 1IXSB 1DSSG 3CLTC 4FFPA 4BFLA 1SQSA 3MTEA 3X2EA 5IAAA 1LTQA 5DK6A 1NF9A 3QYJA 1KC3A 3UC5A 3C3KA 1E1CB 4YRNA 3TVTA 3TEJA 1FFXB 1V5EA 2FNAA 3D3WB 4YAKA 2EXXA 1F06A 3MWYW 3WGLA 2GT1A 1QX4A 2Y05A 3N6XA 4CV0A 2CHVA 1KKUA 1WU8A 2DULA 5GZ6A 2AEMA 3SZMA 4C3ZA 4YAGA 3D8SA 2HWUA 4LJSA 1Z7GA 2IXBA 3UW3A 1WABA 1NZFA 3KCQA 3GN1A 4LF8B 1OBOA 4PLZA 5IC5A 4OGWA 4HH1A 4H1HA 4CLHA 2IYOA 2GI4A 2BFCB 1XL1A 4HH0A 3VSBA 5I8WA 4DCOA 4YRIA 2OV1A 1MXHA 3AR6A 1UMDB 3DDSA 4H0NA 4ZHQF 3ESDA 2EV9A 3VO8A 3PUKA 3KQPA 1WY5A 4DJEC 1PWZA 3V1NA 1IXRC 1FLNA 1KJYA 3P9CA 3Q87B 3AERB 2FEMA 1HY3A 4KWHA 1GUFA 3V1LA 2X0EA 4JX8A 1E2JA 3KKNA 5AVQA 3ZHXA 1P44A 2C4VA 1T3LA 5DLQC 1RRKA 4U7GA 2W6QA 3E81A 2XRMA 3DGEC 4DR7B 3V42A 3ZWKA 1J2RA 1K5DA 5ALTA 1EFDN 1CFZA 1WR8A 4OQZA 5IKPA 1Y34E 2QRKA 1F12A 2OCBA 2RHJA 3JASA 6LDHA 3GHHA 3EPKA 1AXRA 4O63O 2VT7A 1ZSYA 3KJGA 1DKOA 4C4ZA 4TWBA 4BBJA 1VMIA 4I1SA 2GFQA 4N40A 4WNCA 4OXQA 4F5WA 3Q7RA 1ZFNA 3GPCA 3IP7A 5BW4A 4OFXA 1CJKC 1UPUA 2ZSBA 5CEJA 1P5JA 4WSOA 4CV1A 3FJ1A 5AVUA 2RG1A 1JRLA 2HXYA 3THOA 1MDFA 2HRBA 2OILA 1GGFA 2QX7A 2VYVD 3AM3A 1C30A 3I2IA 3K0KA 3JD3A 4YWJA 3T4XA 3GA0A 2WYOA 2HWKA 4QO8A 1E1NA 2YZGA 4RL4A 4CMIB 1O97C 3SAJA 1R66A 4YRSA 3RASA 2NUAA 2Z2YA 4YDRA 3GBPA 2NO7A 4NZYA 4DIMA 1PGJA 4RF2A 4P3PA 1LEHA 3ENWA 4B8YA 16PKA 5BN3A 1NJ6A 2A5YB 2VXBA 1AZTA 2AG8A 1XZHA 1OH5A 5I7RA 3WGVA 1I32A 3ZNOA 1RYEA 5BYKA 4ZVNA 3IDQA 4GR9A 2Z5GA 4LW8A 3K0AB 2X2OA 4MVJM 1NJ1A 3NWBA 1XKTA 5G4LA 1ZCZA 1IOVA 2ZUWA 4H6WA 1NBIA 1MRNA 3GFRA 4HFMA 4GR5A 4MS1A 1MPTA 1M1YA 2YOHA 3RVQA 3VR2A 1B0PA 1QH8B 1FJXA 3C4JA 1QDEA 2XMCA 1K08A 4HQRA 3H9BA 4RSRA 1ST2A 4MO2A 4PQFA 4Q1DA 1IY1A 5KTNA 2GSWA 4O6VA 4HB2A 3BDVA 3RSHA 1YRBA 3T61A 4D3DA 1YAHA 1G21A 1QOPB 3PC6A 1NONA 2GERA 2BGRA 4IJVA 4KWEA 2O9JA 4KLAA 1FDUA 2JIOA 2WPNA 1HUQA 2XWBF 3AUAA 4IS3A 1EGHA 2WJVA 4KBYA 5HSGA 5KOHA 1U90A 2FWRA 2VBIA 1W5TA 2ZUBA 3JSAA 1T2AA 4J7XA 4ECAA 3AVUA 2QM0A 4Z4CA 2JHCA 4BWGA 4J0QA 1SD5A 3IEVA 1MABB 1E2MA 4D42A 4EI9A 1T8PA 3ENNA 1G18A 1WAMA 2A9JA 3WGTA 3ZK9A 4Z8YA 2AFRA 1TM5E 4RLHA 2O54A 1JIKA 1T9GR 5T41A 2FPGA 3LUCA 4RKEA 2O2EA 4E09A 4EDFA 3PNSA 5LIRA 1IHDA 2VCEA 4JC0A 6CHYA 2R1TA 2AOUB 1RXUA 2Q5LA 4HSGA 2A35A 3AHIA 2XNKA 1EK1A 4IHJA 3R3HA 1KEWA 5B64A 2OAGA 4ZOEA 3BXGA 4PINA 2R85A 4IO0A 1XZPA 1SNYA 4HNGA 3TJZA 2FVYA 1I7PA 2RDMA 4FI3F 4BCBA 4BVLA 1I6WA 3ITEA 1K7FB 3D4LA 1PS9A 3B7WA 4ZFNA 3W9YA 1B00A 1NWCA 2GAJA 5CCDA 3T9FA 1OHHA 1SHTX 4TTAA 4ZRNA 6AT1A 4NYMQ 1PR5A 3DLCA 3IPAA 2NWQA 2Z5FA 1N3IA 4W1SA 4GM4A 1NAHA 4TTPA 4YPFA 5JAQA 3LLUA 3FNIA 4ZQCB 1RTKA 5FH9A 4EYKA 4JDUA 3ROTA 2P2SA 1RNLA 1CTQA 1ORWA 1UAYA 1U2QA 2PUTA 2RC6A 2ZJOA 2JIMA 1S01A 1XQXA 2QT9A 2WP8J 3LUJA 3QA9A 1N0VC 2IS4A 3SZUA 3ASZA 1F2TA 1F6DA 5CD9A 2R6HA 1O6FA 2XCQA 3QPCA 3W9SA 3HJCA 4HMPA 1QQBA 2H1FA 2Y0EA 2ERYA 4O2BF 2EFEB 3IQGX 1E5TA 2VHYA 2BSQA 1HYEA 4QUAA 3THRA 3KETA 2NO0A 4FNGA 3F74A 1G59A 4MQ5A 5IAJA 1AMOA 2EW8A 3BEOA 1GP2A 1NTRA 2YOGA 3FPCA 3O2QB 4G63A 4V3BA 4F04A 5FX2A 2AN1A 2ZWIA 1ENYA 1TU0A 1Z4LA 3BD7A 1WZIA 4RXTA 3ZBTA 4H60A 1EVIA 5EHNA 3K0FA 1K6EA 4FHZA 4QDZA 3A1SA 4ZU6X 3MRXA 3NRBA 3BJZA 2FW7A 4JVOA 2ZR8A 4QELA 2C0QA 1WUIS 1OHHD 3ICQB 2O3UA 4AZVA 1KE2A 3UHJA 4GKKB 1F6WA 1PEAA 5I7EA 4H7EA 4I9HA 4J0CA 1Z6QA 5HF8A 3TW6A 5C34B 5EG5A 3CKMA 3QELB 2M6RA 2FW0A 1T8YA 3EF3A 3TUJC 4OJQA 4FEEA 1I4EB 5FBHA 1CD5A 3TRKA 5LYJA 3O38A 3PHJA 1ZN9A 3ASYA 4NNPA 2GR9A 1M5UA 5AVXA 3CRRA 2VZEA 4WFJA 1L5OA 3UOGA 1G8KA 1U3DA 1LVGA 2G9RA 3DXZA 3HDTA 3KG2A 2X5JO 4NARA 4OHBA 4WBSA 5EWMA 4ZVOA 3FTEA 2C61A 4HH4A 4J0KA 1NXPA 3MWLA 5EZYB 3R3WA 3RPEA 2GBIA 2PR7A 4G8DA 3T3DA 5KOJB 2OM2A 1NNEA 2AT1A 1PDVA 3F3KA 3NTRA 1XWIA 3EGVA 5INTA 1FYWA 4D82A 4HOYA 4YJ3F 2X42A 3CE6A 3U9TA 3LCRA 3OEED 4L51A 5K03A 1LX7A 1KY5A 3GH3A 4OI4A 1NY5A 4EB6B 3IP5A 3PGXA 4KRYA 2NVUB 1AURA 2EFCB 2C3MA 2J3JA 3EZ7A 4DCVA 2UZAA 1WKVA 1RXEA 1BX1A 2X1HA 1J70A 4IYJA 1DLJA 4JUFA 4ZQIA 3ZNPA 3A9VA 1F2TB 2LBPA 4PZAA 1JI3A 3DCNA 3VX4A 1JAXA 1HE8B 1UPAA 2O7QA 4P7GA 1D9XA 3OIDA 4B83A 4E5DA 1QHNA 1PV1A 2CYAA 3TW8B 1JSXA 1SVOA 1EXVA 3ZIUA 2R97A 3S2EA 2ZRBA 1XKQA 3QGMA 3A06A 2IUEA 5HIAA 4WKNA 4QDKA 3OX2A 4MAFA 4ZIRA 3DFIA 3E8MA 2VCHA 3ZG6A 3FPBA 4WH0A 5B1IA 1CF9A 3Q11A 4MVJG 2UYQA 1O95D 2FPPB 2IHNA 4E5SA 4IHJF 4CN9A 1K0FA 2PY6A 3BTSA 3O9ZA 4K9PA 2XYGA 3DA8A 2DP4E 5E0KB 3WZMA 5E38A 3C2QA 1E2UA 4M89A 3MW8A 3SXPA 4WUVA 2VJYA 3KUDA 3WBBA 1R50A 1Y9DA 3PRHA 3ZC3A 3W05A 2QMEA 5DTQA 5C7LO 1OASA 3NP7A 4I3GA 2UXDB 3G5MA 2XB6A 1J2YA 2PG3A 4FX2A 2RGXA 4ALMA 4JBWA 3HU2A 3M5PA 3L79A 4ON9A 4WCVA 1LF0A 4R6WA 3EYAA 4EECA 4HB0A 1N1MA 1GPNA 3NDBB 2OFFA 1E2FA 3OE5A 4PAOA 2RJOA 4I50A 4WOBA 5G1PA 3U2QA 2VJCA 4OA8A 4ZT3A 5TQ0A 1SM4A 1YBHA 1VFPA 3KEQA 4YV1A 3DTVA 4WGFA 3HJNA 1U7WA 1Y6QA 3A1VA 5K1ZA 1ZCBA 8LDHA 4RTPA 2DHRA 2NUBA 1KORA 3GDGA 5CFNA 1C8VB 3WNDA 2O19A 1MPXA 2Q6OA 3UBTA 4ZCPA 4PYQA 4O2BA 1DQSA 2EERA 4BP1A 1UJBA 1YGPA 2BE9A 1XJ0A 4BU0A 1MP0A 2GYUA 5EP3A 1JQLB 1PBTA 3A32A 1DDGA 3QMMA 1RXIA 5H9VA 2B61A 3J7AC 3C3MA 2CLLB 3CEMA 1AKNA 1HDIA 1SCIA 2B6NA 2BFAA 3BH0A 4C0LA 4CMIA 3I5YA 2C7PA 5LA6B 1P4GA 2DR0A 3STVA 5COBA 2UUCB 1YUBA 3UGKA 2FGKA 4HN4B 4XWGA 5ES3A 3WLIA 3B1KA 1X1EA 1VMKA 1Y4SA 1AS0A 3HJFA 4QPDA 3BXXA 1H8ED 3LDGA 1FP6A 4GI5A 3JQ9C 4IMPA 4PF1A 2OMKA 4UVGA 3RHSA 1F0PA 2JK1A 1B6RA 3GAFA 2E4WA 3OLXA 3RRNA 4EPTA 4DLSA 2H0AA 3PFFA 2XWPA 3TKLA 5AHWA 4JNKA 4JU9A 1QMPA 4NKRA 1M1UA 4YMLA 3GFGA 3HZOA 4D8TA 5KC8A 3JAMA 1CQJA 1F14A 3GAZA 4D4KA 1Y8CA 4EO4A 1E7SA 3R5HA 4LXIA 5AI0A 2QL5A 5HJEA 4OGGA 2H1SA 4R8SA 5A4AA 1XJWA 5EE9A 3VZBA 5IVHA 1L9XA 4MKHA 2B5OA 2XB9A 4KVFA 1FMTA 1RAEA 3FI0A 3QOXA 1YZNA 4JLAA 2M6LA 3SR4A 3T1TA 1C2TA 4DLPA 1Y7IA 1CK4A 2RCNA 2AFHE 2WTNA 4G1UC 3V97A 4N39A 2D5LA 2KMLA 3GRRA 3LBNA 1P8AA 4GEGA 4UMFA 1RWVA 3DTVB 4ALNA 1BCSB 1MVLA 1BW9A 5A9SB 1T4MA 3K6SA 4DV5B 3A2KA 1DU4A 2CHQA 2X5KO 2AS0A 3PWKA 4DOMA 1OX4A 3QIVA 2FMFA 1XTIA 3N5CA 1LJUA 3LP6A 4IH9A 4KVZA 4OYYA 4NCXA 3CTMA 4UDOA 1C3EA 1NBME 2OFOA 2R6JA 6PFKA 2ZSUA 4US0R 2I29A 4DIOA 1SMKA 4MMZB 1UL1X 3ONNA 2VK1A 1FDOA 4IIFA 4PSUA 4X6XA 5CA0F 5CFLA 4NIMA 4NV1A 2ZKLA 1FXWF 5AJVB 1MHTA 4MWZA 4DSUA 3WE7A 3X44A 1A4UA 1R27A 4CFZA 1FZTA 2E4AA 2ZPUA 4CG2A 4NPCA 5KNBD 1T6BY 3H2SA 4R7ZA 4KMRA 3JW8A 2FPIA 3PZBA 1GWNA 1QPZA 1MV8A 5AIAA 4E4TA 2ZYHA 4C01A 4C05A 4NYJQ 3E9RA 3FF1A 2X3FA 4RTMA 3QWBA 4GQIA 5SZKB 1W581 4JLJA 3GLIA 4K0KB 3O0TA 1SBIA 3V6LA 3A3YA 2N75A 1V37A 4YR7A 3B70A 5FYQA 3I1FA 5FUBA 2AJDA 4FGSA 4JEUA 3FD8A 3F6CA 4EQ6B 4BTVA 1RLTA 4F3TA 4XR4A 2R2GA 4TXJA 1IXZA 1QIJA 1YFKA 4QUBA 2GWRA 1P5HA 1W5AA 1UT8A 1NFRA 2O3SA 2X7XA 1BHJA 5CDGA 1S0UA 3D6FA 3GOHA 3J81k 1TQ6A 1A2QA 2O3RA 3U44A 3P9IA 1N2IA 4LRSB 4UTZA 1JGTA 3RAJA 3I6MA 1GPWB 3SC4A 2OXIA 1OROA 2W2MA 4O25A 4PS0A 5FLEX 2ECPA 2CLFB 3PPIA 1J1IA 3LNCA 4TMXA 4CUZA 1P7VA 1XD2A 2HWWA 1K5PA 3IHKA 3K72B 5HP4A 4RDXA 1VBFA 3F5SA 5EFOA 2A4MA 2PMDA 1M0SA 3HK2A 1GN9A 4LZLA 4PQYA 2E3JA 3OCCA 1JR3A 2ZBUA 5G1OA 5TMBA 4V03A 2XVYA 3JPYA 4KO3S 1E7QA 1EI9A 2CBGA 2Q8QA 1EWYA 3L5KA 3K1ZA 4H15A 4I5GA 5TDHA 2ST1A 4FZJA 1FIUA 2QX6A 3EW9A 2WFZA 5TLSA 2ZVJA 5BR8B 1I7LA 1DC6A 2ECKA 3K9CA 4OO3A 1WEKA 3Q3CA 4XQEA 3OE1A 3GT0A 1JSLA 1XDWA 3BILA 3WB0A 2J67A 2C2BA 3AIOA 3R7BA 1H0KA 1XLUA 3DEIA 4PZPA 4RORA 4EEXA 4Q93A 3B2NA 1EMDA 3ROKA 3G59A 4FYKA 1SBNE 2H7YA 3K32A 3R9WA 4FP9A 3CQ9A 3MIIA 4X8OA 1NXXA 3RTAA 4U2KA 4CMCA 5A5EA 1SVKA 4KQHA 2P5SA 1AK1A 5BSUA 4AYWA 1EWRA 3GJ5A 3OESA 2H29A 4P4SA 4HYQA 4A0GA 1U1EA 2I2CA 2O2YA 1U7DA 1UF9A 2PKXA 5F5XA 4DV3B 4YRDA 4H3HB 1MGPA 2A4KA 2HA7A 1V1MA 2QM7A 2ZGVA 3L8EA 1T3HA 2VF5X 1PCXA 5KDDA 3OCZA 2Q5HA 1BFUA 3A6LA 2AB0A 4FR5A 4I99A 1F0NA 1PEDA 1QHHA 2Q5FA 4I9UA 3U5TA 5D5QA 1JR3E 2X1LA 1QYXA 1ORDA 3OBBA 2A6PA 2PHZA 5H3CA 3ZI7A 3UHOA 3GUHA 2H1WA 4NESA 4OQYA 1KC1A 3DMTC 2WSYB 1DQPA 4TT3A 4UDYX 1FS4A 5ER9A 1YONA 3UXMA 4B3HA 3NFRA 4MEJA 2FJUA 4U7TB 3GDFA 3WYNA 1NSFA 2IYLD 3FHOA 4HWGA 4KKVA 3UYLA 4DUZB 1F9AA 2NZVG 4AG6A 4DV6B 4YGXB 1F8FA 2IELA 2J5KA 3ORSA 1O2DA 5ALFA 4FLFA 4WOCA 3P9XA 1K68A 4PAMA 3EK2A 3CLRD 1URPA 3Q2OA 1IC6A 3GCWA 1RKXA 1U5CA 1L5VA 1T5OA 3EZLA 2DR3A 4MS3B 4J3FA 2EKBA 1A5AB 1C4KA 2QRVB 3AIIA 2OUKA 5IDYA 3SHVA 1XXHA 2AJ8A 2ORYA 4U3JA 2Y8EA 4EG5A 3B6ZA 2A92A 3KNZA 4WW0A 5ALMA 5EJAA 2P9YA 1TDJA 1Y3HA 3NIBA 3FKSD 1E3MA 5IBCA 2IHKA 1C0IA 2OM6A 2PWZA 4K1LA 2BHLA 3QEMA 4YJHA 1DIRA 4YRRA 3CVXA 1QO0D 1P9OA 4KRFA 2WVHA 2ZB8A 4ZCTA 4KPUB 3ETDA 2OG1A 3IE2A 3OJEA 4PSCA 5EJFA 5C9ZA 2AF4C 5JPCA 1H4SA 2QG6A 2J5RA 4IVPA 2D5CA 2FPGB 3D6NB 4TGLA 2AOTA 3SYRA 1CEXA 1G9XA 2QAIA 3HHPA 3O0DA 4G1VA 1G5TA 1P39A 3D7MA 3PRJA 4J03A 2OZLB 3WIUA 1FZQA 4NJEB 1ZBQA 4OG2A 4FB4A 3BK7A 5AFSA 4MHSA 1UZMA 2QM3A 4AECA 1YCFA 3GF4A 3O21A 2AEFA 1TVCA 5J4KA 3KJFA 4EG4A 2HRDA 3HJGA 3JALB 5GM2A 1GRQA 1R5NA 2WWXA 3IVGA 5DULA 1NVGA 4A4DA 1I4LD 2FPMA 1OLSA 4WKPA 3UHAA 4CTJA 4D4IA 1TW3A 1PS0A 4Q4HB 4BKQA 1Q6ZA 4DLVA 5FO1A 3UYKA 1GSAA 5AVTA 1SG6A 4MZDA 1DKRA 4DDUA 3M9WA 1F48A 3NBKA 2V3VA 2QUKA 1Z5OA 2C31A 2EFYA 1J0XO 4HHEA 3OHMA 4JEHA 2VRCA 4YA6A 3RUCA 3V4SA 1EAYA 4D41A 5DBEX 4EI8A 3KQQA 3KL4A 1ENOA 4ZJUA 3K6SB 1ULHA 2HRRA 4OYLA 4MNTA 4HNTA 4EM6A 1X94A 4CCAA 2YVKA 5DMXA 1FU7A 1TMGE 1J8DA 5DWVA 2BTQB 2R7MA 2W7TA 1TT7A 1NV8A 2PZ8A 1TRHA 1N8NA 4J76A 4MVJH 4P86A 4CMBA 1JTFA 5L3SB 1GRRA 3HBJA 1L5HB 4C1NA 3RC9A 3T7JA 5HWSA 2A58A 2D1FA 5JCJD 2FMKA 4MRRA 4MROA 2R8BA 5K3FB 1U7PA 3ZVKA 2IKSA 4WK2B 1SPBS 4ZCQA 4K6OA 2GFIA 4QDXA 1XA0A 3MCUA 2A88A 4BNDB 1Z6PA 4X9XA 3ZBQA 1U2SA 4Y0VA 3F98A 2RI1A 4LC0A 1KDYA 2QYHA 4ZCIA 3KXIA 5I9NA 1J07A 3HR8A 3ILVA 1Y5RA 5TS2A 2ANBA 1YDEA 3K9WA 3PRYA 3KZXA 2BGIA 2QT1A 3LUAA 1H6BA 2J4FA 1OF1A 3U7HB 3IBSA 3A6ZA 3OIVA 3VMFA 2WJGA 4YUYA 2G07A 1YJ8A 5CB8A 4IIUA 1R88A 5CJPA 3MJRA 1PNTA 3HBNA 3L2OB 3Q7IA 3QNMA 3QW4B 4NMLA 3RWOA 2B8JA 3NWEA 3ZTTA 2Y3IA 1FYEA 5A4IS 4IXNA 1XCBA 3O8RA 3UKJA 1RYFA 2WU8A 3CT6A 1WBJB 3B48A 1DMSA 5CVEA 5A3SA 1I2DA 1X1AA 3MGBA 3W8DA 3KAPA 2YCLA 3IO5A 4TL9A 1A9PA 2W6ID 4MHOA 4MA0A 2VTDA 4G9EA 4MI6A 1XXLA 4W8HA 2Z1DA 3RC7A 1JE0A 1N2HA 1K0UA 3AB8A 4HH3C 3IQWA 1J9EA 1DDIA 2ZUUA 4PLGA 5KNCA 5A6VA 2GM4A 2V4ZA 4QOGA 4Q4CA 5CJ2A 4OK3A 4LS3A 4QFCA 2JJ8A 1GRNA 3BUSA 4ZO6A 3KQUA 1DBRA 1RBZA 3WBJA 3PC8C 3F1KA 1HDEA 4E1BA 4TZ6A 4RFVA 4I4LA 5L40A 2XOKA 1YGYA 5KB3A 3ZWVA 2JAPA 1DBVO 1PR6A 4TRMA 2YBEA 1MJGA 2YL2A 4MKZA 3EXEB 1Y8QB 4ZT2A 5KTKA 1CF4A 4Y0NA 4DIFA 1TLLA 2NT4A 2WIGA 2XTJA 1FVOA 1UPTA 3DPIA 4Q4HA 3X1ZA 3T6KA 4ND1A 5AJXA 1TJ3A 4TVKA 1NMEA 4DNOA 1XRQA 2YC2C 4CPDA 5DI9A 1J99A 2XBUA 2R5WA 4OB6A 3FMFA 2FOXA 4XTRA 4PGAA 2FEXA 2BGJA 5F1PA 1U99A 4M0CA 4XJXA 2DUMA 1PUJA 4M1OA 5FOUA 2B25A 3E9YA 1VHDA 4P81A 3NX4A 5I4CA 3U4QB 1GPYA 2PX4A 4KX5A 3HG7A 5GQSA 3AF1A 1MC1A 5CX1B 1DCKA 3LNTA 4QQ8A 4EW6A 4TM8A 2I1LA 1TMKA 4PO9A 4M88A 4R2WA 3DWEX 4LF4B 5C7OO 1WPQA 4BFZA 3D4PA 3EF1A 2J9FA 3LV8A 3A4VA 4CCSA 1W87A 4TSRA 2JH8A 4DLLA 3D5QA 1V41E 1KFKB 3K1JA 4PHFA 4P83A 3EXHC 4TXLA 4XDHA 3BSSA 4ONEA 4KE7A 3Q8LA 2HUPA 2WWFA 1PFGA 5L3SA 5TV2A 3EIQA 4L0DA 5T4EA 3OFVA 4TMYA 3N28A 5LQNA 2H51A 5TMPA 1VPVA 5KZMB 4FB5A 4MUFA 4C04A 3DV9A 1E5VA 1G21E 2D0IA 3WB2A 4BQPA 2CNBA 1Q84A 2YJ4A 1FFDA 2Q8NA 3I6BA 4Z2AA 2QRMA 1JFLA 3R0VA 3RVPA 2LDBA 1YQ9A 2RHOA 2I4OA 1G64A 2OZVA 2V6BA 1RHUA 4HAWA 4E2YA 2AMYA 2CDNA 1JPJA 4XWTA 4K86A 4LNUA 1TVMA 1E9FA 1P7WA 4QQNA 2BISA 1AXGA 4Q03A 3AVXA 4YMIA 2XOXA 4RX1A 1E6CA 1HMYA 3TLXA 1BS9A 1OBVA 5K0NA 3ZU6A 5JTTA 1WEHA 3TCKA 1BRMA 2BCEA 3SNHA 4E94A 4A26A 1OI3A 4D98A 3MXOA 3IBCA 2ORIA 3I3OA 4D0GA 4QFMA 4TMWA 4WNAA 1LQ2A 4O4IF 4ARIA 4KU4A 2Z83A 3J81A 4CIVA 3TZQA 4F7WA 4RELA 2TSYB 1ZIXA 3PL1A 1PVOA 2M2IA 2CHGA 3H13A 1YZHA 1U8YA 1KAEA 2PFGA 3NM4A 4KAXA 4WZAA 3VNBA 1IOLA 1SA0A 2AEEA 4B76A 5BPFA 5K0TA 1OXVA 1GSOA 5HCNA 3VRHA 4PXYA 4Y9SA 5E1OA 5KJFA 4U6NA 3TDNA 3WRWA 2PSJA 4BQEA 2WIBA 1NP7A 4REOA 1WDTA 1Z2EA 1XZEA 1KRHA 1ZK3A 3Q4GA 4FQ7A 1CERA 1L0BA 5CX4A 1UCFA 3EMKA 4B1FA 4B85A 3CH5A 2R8EA 2I4RA 5BQ5A 2BEWA 3R0IA 3T1VA 2J3IA 2YXNA 4F5YA 1JIIA 4G0YA 1BCRB 4C4RA 3WNZA 5B5SA 4RV4A 5AK6A 3LP8A 4LYJA 2QD5A 2NAFA 1WWKA 3W6ZA 4BB6A 1N1DA 4LHZA 1JHVA 3HU1A 1N5JA 2GVDC 3VC2A 2Y0CA 4RJIA 3S5UA 2PUCA 5G2OA 1GDDA 2Y1EA 2Y2VA 4S1OA 1YOBA 1MO4A 2HIMA 2YUIA 2G0AA 3ZDBA 1FSPA 4GMGA 3SXUB 2C59A 1E9CA 4H08A 2CSUA 2IZOA 2H63A 5I9BA 2PFSA 3HKEA 4Q15A 3GDHA 3A7DA 2IHTA 3GLUA 4BWYA 4BMPB 1AQJA 3PFGA 3O8BA 2R47A 2EEZA 5DGIA 1R9GA 3GJTA 4HNVA 3IQXA 1CDEA 3CX3A 3BXHA 4HDRA 4UUOA 5CXSA 3SXJA 1Q7TA 3LWNA 3HADA 1ZD9A 4BX9A 2BPOA 3MGKA 1JG6A 3PHBE 4YJ3B 4R7GA 5HZKA 3EXFA 3G8AA 4RY2A 1EZ1A 1NLMA 1SBYA 4B6PA 4IHJB 4OGLA 5J3JA 2DLNA 1X7HA 1JJIA 1C80A 4YWHA 3KOYA 4GOKA 3HVRA 1L7RA 2QK4A 4KUEA 1S2NA 1H8HD 3V8VA 4R2MA 2HLDA 5IN4A 2AXPA 1JDBB 1ILWA 1LQTA 4RTJA 3RSLA 1BE1A 2SCUB 4M0KA 4QOEA 5K09A 5J2UF 1FXUA 5T4HA 5JSZB 3KOOA 1KNQA 1KDOA 1Z37A 4Q7KA 2GPTA 4D02A 1NE2A 4PCUA 4YCAA 1UXIA 4TRJA 4PLYA 2RG7A 4YB8A 3IC5A 4MP6A 4GQBA 1C50A 1NUUA 3CFYA 2GNOA 3C7AA 1PE0A 2WTXA 4R3UC 4CMEC 3F78A 5IXJA 1B93A 4EG3A 1PT5A 4EL5A 1ID1A 4LF5B 3DJYA 3U1TA 4IJKA 2I0FA 4GZMA 3CR7A 5FLKA 1HEYA 4L4RA 3C85A 5DGXA 3RIMA 4WN9A 5IUKC 3V32A 4AMBA 4CHTA 1QTQA 3U4CA 3L4SO 3QNUA 3AR7A 2BFFB 4IGFA 4NCHA 3WQQA 5JBIA 2F8MA 1CZOA 1RZUA 4WBNA 2ZRQA 4UU1A 1GITA 1B4DA 3WQRA 1R18A 3UUFA 4M1YA 4BVGA 2CUKA 4UNPA 4QUJA 1U9IC 4JVMA 4HBGA 3S40A 3N3BC 2HJRA 3HJUA 1U8ZA 2I65A 5HBGA 1TC2A 1ZYUA 3K73O 3W4IA 1C0LA 4GLOA 5BWLA 1NVVQ 2JFQA 2C9CA 2JLBA 3M81A 3Q8MA 2J5XA 3UK1A 1ITZA 1GUAA 1S4QA 3MCVA 3GP8A 1OZ0A 1BROA 5G4KB 2EJBA 4UVEA 1KI3A 1Q7BA 1YHZA 1FP4B 2V54A 4L95C 3DONA 5AMXA 5KX5A 2N0SA 3HFSA 2CJWA 5HILA 1MRZA 2XNJA 1QH1A 4HAZA 1SUCA 2Z09A 3PI7A 3NR2A 2MINB 3AV3A 3COVA 1SVIA 2HYDA 2AK2A 3A4NA 1X1DA 5DCLA 4EWLA 1KE1A 4RVNA 2C98A 5EKSA 1UBEA 5NULA 2QN1A 4DZZA 3WG9A 4PYMA 4HS9A 4V0QA 4HNUA 1WVMA 1PT7A 3RQSA 3F6BX 3JQPA 3G7SA 2ZB2A 3CG0A 4HX2A 2I9KA 1QCZA 4CF3A 1LF5A 5CVJA 3ZX5A 3VJRA 3DZJA 2WLSA 2W70A 4UPDA 5ADWA 1DAFA 5ESDA 1CZHA 1YWGO 4MIKA 2C77A 2X8WA 2Z2KA 4TZKA 2KPOA 4W82A 3VC1A 6GPBA 3VHRA 3WV5A 3O4FA 3DKPA 2XB2A 2PZFA 4NS4A 5E2BA 4ZVRA 1SBZA 4AP9A 1JEJA 4X94A 3FUCA 1N0HA 2C5EA 3EXHA 1YJXA 5C8XA 1T25A 1NI3A 3LZDA 1K6IA 4TWAA 3SQWA 4H0FA 3RIYA 5I51A 3TFWA 2VQFB 5BSRA 3VR6H 1ZR2A 1U0OC 1ZU4A 4LXYA 3DAFA 5DM60 4P08A 5IHPA 2Q8PA 4Q3LA 1JX6A 1VC2A 2G1PA 1RM4A 2ECFA 1IMOA 2XDWA 2XCLA 4B7AA 1G16A 2ATIA 2GRAA 3AYZB 3VR5H 1NW7A 3NV7A 3PU6A 3PXGA 1V43A 3ETCA 3KOWA 1DFGA 3SSMA 4I3HA 2VHTA 3JSXA 3SBEA 4ER0A 5K4HA 1T2NA 2YX1A 1EHCA 5JVDF 4I4TB 1JF8A 5K6RA 5CVDA 1R4NB 2PX0A 4PZUA 3R3YA 1B3RA 4HWOA 4B82A 2C84A 2YMLA 4ESHA 4B3SB 2CMFA 3GJXC 2VXCA 3HB1A 1XU4A 1IM8A 3NZEA 1Y98A 3H2BA 2P3QA 2PSSA 4UJ3A 2FLWA 4YFYA 5JCOA 1R12A 1CNFA 1Q0TA 3WISA 1GPAA 2WF9A 1J39A 3ZQJA 3FYDA 2N1MA 3ZDQA 3IP8A 1J0DA 4DB2A 1KMQA 4FZ3A 1T24A 2IEGA 3NM5A 3SOZA 5JRZA 1O77A 1U8CB 2XMRA 4FVTA 4M8IA 4NG4A 3G0CA 3QVVA 1ODIA 2Q6KA 2QI9C 4PGGA 4QGSA 5FV4A 3MF4A 3JYPA 1B41A 2AXQA 3M1YA 4BYMA 1F5SA 2FCAA 1GAXA 3DAPA 4D9KA 1LSOA 2R68A 4RA6B 4D9EA 3VR3A 3GRFA 4W63A 3AEYA 1R5BA 2O52A 2QQGA 4ZHQA 3P4YA 2HSJA 1GPKA 3KFLA 4IFEA 6NULA 3ZE2B 2XNDA 4AX8A 3ZJ4A 3TLBA 3U3JA 1IJFA 2F48A 4ILKA 3FCYA 4JBXA 4MK4A 1SC9A 1VG1A 4J43A 4TT3D 1DBIA 2P8SA 4EVRA 5KSZA 4Q3AA 5EJ5A 1PJTA 4NYIQ 1UBOS 1XBTA 4YAJA 4BV3A 4E21A 3ZJVA 1S3GA 4MW1A 3B85A 5KWVA 4RVDA 4LRQA 3RYFB 3UMBA 2DE0X 2FWBA 2GTHA 3H5RA 4HQOA 1N2ZA 3GGSA 5LUBA 5E3HA 1DL5A 1ZA1A 1BDJA 1B74A 3I73A 4KWCA 1XYYA 1VCNA 2R8OA 4UM7A 1E1RD 3R40A 2NV6A 4NMHA 4OAPA 2OXFA 3I53A 2ONZA 7REQB 2CHEA 3ZWNA 5JROA 1TUGA 1E4VA 3H87A 3OPYA 4CM9A 4BPRA 4CCWA 5JY1A 4RNCA 1YZGA 2ISQA 1L7NA 1CZKA 1ECBA 4FSXA 4OXKA 5LSAA 3DKIA 4HJXA 4ZC1A 1VP9A 3KX2A 2MMCA 4JSRA 3ADBA 1CZUA 3ENZA 4PZ9A 4TS9A 4G8CA 4GO1A 5DT2A 2DWOA 4WFKA 4LJ5A 5ALLA 4IHQA 4BUZA 1E7MA 1L5RA 1Z39A 4IEEA 4WXYB 3TR5A 4RGVA 3C4QA 3EGWA 2ZUDA 3LBFA 5F52A 2BP7B 2WU1A 1YB4A 3E22B 2HJWA 3U39A 1GTJ1 3FDJA 1IAVA 2AFIA 1UFRA 4BY9E 2OT3B 4EA9A 2MSWA 3WOHA 2G8NA 1K4MA 3VR4D 2HC9A 3CF4G 3GLSA 3P2OA 2F3RA 5CM9C 4ZHSA 4NTZA 4RE5A 3DAYA 4M7OA 1H2AS 3I6QA 3GRZA 2KI5A 3CB4A 1KOJA 4I6GA 5EXXA 4JI4B 3RM3A 1UQUA 4EGCB 2AR7A 2PBLA 1IU9A 4L7QA 4PX9A 3TNFA 1MJ5A 4UCWA 4MUBA 3QZUA 4WKBA 4OM7A 1AJEA 2WSSD 5B30A 5FWYB 1E6MA 4UUMA 3MCTA 1JVBA 3AKCA 3B12A 3BWDD 2F1HA 4L8LA 4C3UA 3V7FA 2EHJA 3O4HA 2ZDGA 4IF4A 3UCFA 4MYHA 1IOWA 5B1YA 2JI6A 1UMBA 5G0TA 1NA5A 3T99A 4Z0NA 5DM70 4X8MA 2NZUG 2P7IA 3W8EA 3NI2A 5BQFA 1DXHA 2OHGA 4IZHA 4LJ4A 3WMRA 4ZV4A 4CEHB 1XCOA 2NUTA 5C80A 3OEHD 4WV3A 4M0MA 5E4TA 3FPHA 4NBLA 5EWJA 1XG5A 2BMWA 4MRMB 5ALVA 2YNMA 1EFTA 1SC6A 1VKNA 4R31A 4Z9XA 4LRUA 2NYVA 2WOJA 3ZY6A 2NVWA 5L4SA 1LKZA 1B2LA 1MEOA 1EK6A 1M0TA 1PG5A 2F64A 4K6KA 2X2FA 5AXBA 4RFLA 4TYMA 4X54A 4R8MA 3WWEA 2GB4A 1M2WA 4J94A 4MH0R 4YIKA 4RMIA 4OI1A 4BZPA 1QQTA 3MJCA 4EQ6A 2UUAB 2EWWA 3JQ7A 3LRPA 5K3SA 3TR6A 3C6QA 1AOXA 4EL0A 2X3YA 4B3XA 2J4DA 3WMEA 4QBIA 1R8YA 1I3LA 1ZP6A 2V7GA 3NBMA 3P2JA 2XMSA 1IG3A 1HE4A 3CXRA 3F67A 5IC4A 4GG1A 3UFXA 3UICA 1TB4A 4KGVA 4ZI2A 1O95A 4WZZA 4ZCRA 3OI7A 2IPXA 2IODA 3BD6A 5BN5A 3HGMA 1EQAA 2QW0X 1U3VA 1BDMA 3A04A 2QTGA 2WSLA 3BFPA 4G9GA 4NFLA 1XB2A 2FPOA 5EGSA 5HJ2A 3T06B 4E5MA 3EVTA 3I45A 3Q5GA 3X2SA 3QMWA 5T3YA 1GNVA 2F6RA 3VZRA 2IEAA 3EWIA 3HUEA 1XA4A 4B6SA 2ADOA 2VTVA 2C92A 4IIJB 3WRVA 1FBNA 2X5NA 2MT9A 3OOWA 4IBOA 1B0ZA 5ERYA 1P19A 5IZCA 5JR3A 4IVQA 1ISSA 1HF3A 1UPXA 1VYUA 3BYZA 3G9QA 1KJWA 4MIOA 3I0MA 4IV0A 4IZIA 4Q47A 4F38A 5ICEA 2R25B 3V34A 2LNDA 1XQWA 4UFOA 4YI3A 4RHTA 2AF3C 1SVWA 3UH1A 4EO9A 4YAUA 1HT1E 4UUQA 1HG0A 4TRRA 3CB2A 1NQTA 3G6WA 2WUDA 1VHLA 1P4AA 4HNRA 3IERA 1JVNA 3Q98A 4ED9A 4DV0B 4BLQA 4KMMA 5B53A 3R77A 2YHIA 4MGEA 4MR9B 5EMJA 4C4SA 4GZ3A 5KWIA 4CNBA 4ZYUA 1ODLA 5CG2A 1IWPB 4RF5A 4IDFA 1QG2A 4IWYA 3KQNA 1W25A