1PRAA

Determination of the nuclear magnetic resonance solution structure of the dna-binding domain (residues 1 to 69) of the 434 repressor and comparison with the x-ray crystal structure
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
69
structure length
69
Chain Sequence
SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWLLNGTSDSNVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of the nuclear magnetic resonance solution structure of the DNA-binding domain (residues 1 to 69) of the 434 repressor and comparison with the X-ray crystal structure.
pubmed doi rcsb
source organism Phage 434
molecule tags Gene regulating protein
molecule keywords 434 REPRESSOR
total genus 18
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1991-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1praA00
3BD1A 3SCFA 1RPEL 2OR1L 3R1FA 4Z58A 4F8DA 3EUSA 1QP4A 2AW6A 4O8BA 4PU8A 2XSDC 3O9XA 1VPWA 2CROA 1R69A 3RZZA 2LYSA 2LCVA 2IV1A 4I6UA 2L8NA 2AWIA 1XWRA 4IVZA 2GZUA 2KZ8A 3F6WA 4J1WA 1JFTA 1QPZA 2AXZA 2ICPA 1NEQA 1ZPQA 1YSEA 1RZSA 2HSGA 3SCHA 4JCYA 3QQ6A 2FJRA 3HZIB 1QQBA 3OQOA 4J1XA 2LYJA 2KEJA 1JWLA 1WH6A 1LMB3 2XI8A 2JCGA 1E3OC 4X4DA 3ZHMA 4FBIA 3UFDA 4I6TA 3L1PA 2EBYA 4X4CA 3S8QA 1X57A 3OP9A 2O4AA 1L1MA 3BDNA 4PU7A 4YG7B 2O38A 2WUSR 1PERL 2PUBA 2PPXA 3FMYA 1HF0A 2PUFA 3ZHIA 4JQDA 1X2LA 4JCXA 1WIZA 1ZUGA 2PUAA 1WETA 1ZZ7A 2LYQA 1PRAA 1JH9A 2CSFA 1R63A 3CECA 3TRBA 3CROL 2O49A 2GRMA 3OQNA 4FN3A 3F51A 1B0NA 2KEIA 4Y42A 2LYPA 1Y9QA 1DWKA 4Z5DA 2BJCA 1LLIA 1QP0A 3GN5A 4X4HA 5K98B 4PU4C 3ZKCA 3LFPA 1ZZ9A 2IVBA 3QWGA 4YG1A 1UXDA 1ZAYA 3KZ3A 3QYXA 1OSLA 1CQTA 2XCJA 3U3WA 1GT0C 4I8TA 2A6CA 2KPJA 2LYLA 4YBAA 3CLCA 1UXCA 2H8RA 3PXPA 3BS3A 1ZZBA 1LCCA 4IWRA 2B5AA 1RIOA 1S7EA 3VK0A 4YG4A 2PUCA 2PUDA 3JXBC 4MCXA 1UTXA 1IC8A 2GRLA 4YARA 3H5TA 4OB4A 2R63A 4X4BA 3FYAA 1ADRA 3QF3A 1ZS4A 3F52A 4X4EA 3GBFA 3KXAA 3IVPA 4NDWA 2D5VA 1O4XA 1NERA 1DW9A 1ZVVA 1RZRD 2LYKA 2R1JL 3D1NI 1OCTC 2PUEA 3JXCL 1LCDA 2LYRA 1JFSA 2AUWA 1ZZCA 2AXUA 2MEZA 2XJ3A 1BDIA 2MQKA 2XIUA 5A7LA 4X4IA 2OFYA 4I6RA 1LQCA 2BNNA 4Z59A 4PU3C 2ICTA 3JXDL 2PIJA 2KEKA 1EFAA 1QP7A 2WIUB 1PNRA 4X4GA 3KJXA 1PRVA 2IVQA 4Z5CA 2BNOA 3B7HA 3GN5B 3LISA 3DNVB 1QQAA 3MLFA 1CJGA 2JVLA 2PE5A 2EF8A 1AU7A 2IU7A 4Z5HA 1WH8A 3FYMA 4IA8A 1SQ8A 1RZRA 2IUOA 2PUGA 1Y7YA 3G7DA 2BNMA 4GHJA 3SCGA 4X4FA 2EWTA 2IVGA 1ZZ6A 1ZZ8A 4GQMA 3G5GA 2AXVA 4MCTA 1BDHA 2HINA 3OMTA 1PRUA 3OQMA 1POUA 2L49A
chains in the Genus database with same CATH superfamily
3SCFA 4Z58A 1QP4A 4PU8A 4EK9A 1VPWA 3ME5A 2LCVA 4I6UA 2L8NA 1XWRA 4EQZA 1ZPQA 3LQXA 5DTQA 4JCYA 3OQOA 2LYJA 3R09A 1JWLA 2V3CC 3KL4A 1L1MA 4PU7A 4HRAA 1WIZA 1ZUGA 1ZZ7A 1PRAA 1JH9A 2CSFA 2GRMA 3OQNA 2PXFA 4Z5DA 3LFPA 3QWGA 3KZ3A 3QYXA 2XCJA 1UXCA 2H8RA 3PXPA 1LCCA 4IWRA 1S7EA 3VK0A 4YARA 3H5TA 3FYAA 3GBFA 2D5VA 1O4XA 2ODRD 2PXBA 4WVLA 3D1NI 3JXCL 2MEZA 2AXUA 1BDIA 4X4IA 3A9ZA 3KJXA 2IVQA 2JVLA 2PE5A 1SQ8A 5DTRA 2BNMA 4X4FA 3NDBB 2HFZA 3VWSA 3OQMA 2HCSA 3BD1A 1RPEL 4F8DA 3EUSA 2XSDC 3O9XA 2IV1A 3G0TA 4Q2JA 3F6WA 1JFTA 1QPZA 2AXZA 2YBDA 2HSGA 3QQ6A 2FJRA 3HZIB 1QQBA 3PE5A 4X4DA 4FBIA 2L1PA 3S8QA 1X57A 3OP9A 2O4AA 4EKIA 3BDNA 2PUBA 2O38A 3FMYA 5DRTA 3CECA 3ZPXA 3F51A 2KEIA 4Y42A 2LYPA 1Y9QA 1DWKA 1LLIA 4EZIA 4X4HA 5K98B 3ZKCA 3DM5A 3NROA 1U2ZA 1UXDA 4ER0A 2PXVA 2HINA 2A6CA 2LYLA 3CLCA 2XXAA 2B5AA 4YG4A 3A9YA 3JXBC 1IC8A 2R63A 3QF3A 1ZS4A 3KXAA 1ZVVA 4ER3A 3QOXA 2AUWA 2XJ3A 2J7WA 4ER7A 4I6RA 2BNNA 3JXDL 1EFAA 2ICTA 2PIJA 5DTMA 1PNRA 1PRVA 3LISA 1CJGA 1DULA 1HQ1A 2J7UA 2IU7A 4Z5HA 1RZRA 2LNMA 3G7DA 2PXEA 4GHJA 1ZZ8A 4GQMA 2FFHA 1AU7A 1PRUA 2L49A 4ER5A 2AW6A 4O8BA 2CROA 1R69A 3QOWA 4IVZA 2GZUA 2ICPA 1YSEA 1RZSA 2PXDA 1LMB3 2XI8A 5DSXA 1E3OC 3TELA 3TEPA 3L1PA 2EBYA 4X4CA 4EKGA 1PERL 2PUFA 4JCXA 2PXKA 2PXUA 2LYQA 1R63A 5GAHi 4FN3A 1B0NA 2BJCA 1QP0A 3GN5A 4PU4C 1ZZ9A 2IVBA 1ZAYA 1CQTA 1OSLA 3U3WA 4I8TA 4YBAA 3BS3A 1ZZBA 2M4HA 3SR4A 2PUDA 2PUCA 4MCXA 4OB4A 5DRYA 1ADRA 3SX0A 2LLWA 4X4EA 3IVPA 4NDWA 1NERA 1RZRD 2R1JL 2PUEA 2LYRA 2PXPA 5A7LA 2XIUA 3A9XA 1MFQC 4Z59A 4PU3C 4DE9A 3DNVB 1QQAA 4X4GA 3B7HA 1NW3A 4DE8A 2PXLA 4IA8A 2IUOA 4OBMA 2IVGA 3G5GA 2AXVA 4MCTA 5GAGi 3OMTA 4YG7B 2PPXA 2OR1L 3R1FA 2PXTA 2XXPA 2LLVA 3RZZA 2LYSA 1QB2A 2AWIA 2KZ8A 4J1WA 1NEQA 3SCHA 4J1XA 1WH6A 2VEOA 2JCGA 3ZHMA 3UFDA 4I6TA 2JQEA 3GZDA 3MEJA 2WUSR 4JQDA 1HF0A 3ZHIA 1X2LA 5DT2A 4ER6A 2PUAA 1WETA 3TRBA 3CROL 2O49A 3OKZA 3OWQA 4YG1A 2PXQA 1QZXA 1GT0C 2MXDA 2KPJA 3UWPA 3QFIA 1RIOA 1UTXA 2GRLA 2XXQA 4X4BA 3NXHA 3F52A 3GUUA 3M9LA 1DW9A 2LYKA 1OCTC 3TFLA 3GZCA 1LCDA 1JFSA 1ZZCA 2MQKA 2OFYA 2KEKA 1LQCA 1QP7A 2WIUB 4Z5CA 2BNOA 3GN5B 5JUWA 3MLFA 2EF8A 2HCNA 3GZDC 1WH8A 3FYMA 2PUGA 1Y7YA 3SCGA 2EWTA 1ZZ6A 1BDHA 3NZLA 2KEJA 1POUA
chains in the Genus database with same CATH topology
3BD1A 3SCFA 1RPEL 2OR1L 3R1FA 4Z58A 4F8DA 3EUSA 1QP4A 2AW6A 4O8BA 4PU8A 2XSDC 3O9XA 1VPWA 2CROA 1R69A 3RZZA 2LYSA 2LCVA 2IV1A 4I6UA 2L8NA 2AWIA 1XWRA 4IVZA 2GZUA 2KZ8A 3F6WA 4J1WA 1JFTA 1QPZA 2AXZA 2ICPA 1NEQA 1ZPQA 1YSEA 1RZSA 2HSGA 3SCHA 4JCYA 3QQ6A 2FJRA 3HZIB 1QQBA 3OQOA 4J1XA 2LYJA 2KEJA 1JWLA 1WH6A 1LMB3 2XI8A 2JCGA 1E3OC 4X4DA 3ZHMA 4FBIA 3UFDA 4I6TA 3L1PA 2EBYA 4X4CA 3S8QA 1X57A 3OP9A 2O4AA 1L1MA 3BDNA 4PU7A 4YG7B 2O38A 2WUSR 1PERL 2PUBA 2PPXA 3FMYA 1HF0A 2PUFA 3ZHIA 4JQDA 1X2LA 4JCXA 1WIZA 1ZUGA 2PUAA 1WETA 1ZZ7A 2LYQA 1PRAA 1JH9A 2CSFA 1R63A 3CECA 3TRBA 3CROL 2O49A 2GRMA 3OQNA 4FN3A 3F51A 1B0NA 2KEIA 4Y42A 2LYPA 1Y9QA 1DWKA 4Z5DA 2BJCA 1LLIA 1QP0A 3GN5A 4X4HA 5K98B 4PU4C 3ZKCA 3LFPA 1ZZ9A 2IVBA 3QWGA 4YG1A 1UXDA 1ZAYA 3KZ3A 3QYXA 1OSLA 1CQTA 2XCJA 3U3WA 1GT0C 4I8TA 2A6CA 2KPJA 2LYLA 4YBAA 3CLCA 1UXCA 2H8RA 3PXPA 3BS3A 1ZZBA 1LCCA 4IWRA 2B5AA 1RIOA 1S7EA 3VK0A 4YG4A 2PUCA 2PUDA 3JXBC 4MCXA 1UTXA 1IC8A 2GRLA 4YARA 3H5TA 4OB4A 2R63A 4X4BA 3FYAA 1ADRA 3QF3A 1ZS4A 3F52A 4X4EA 3GBFA 3KXAA 3IVPA 4NDWA 2D5VA 1O4XA 1NERA 1DW9A 1ZVVA 1RZRD 2LYKA 2R1JL 3D1NI 1OCTC 2PUEA 3JXCL 1LCDA 2LYRA 1JFSA 2AUWA 1ZZCA 2AXUA 2MEZA 2XJ3A 1BDIA 2MQKA 2XIUA 5A7LA 4X4IA 2OFYA 4I6RA 1LQCA 2BNNA 4Z59A 4PU3C 2ICTA 3JXDL 2PIJA 2KEKA 1EFAA 1QP7A 2WIUB 1PNRA 4X4GA 3KJXA 1PRVA 2IVQA 4Z5CA 2BNOA 3B7HA 3GN5B 3LISA 3DNVB 1QQAA 3MLFA 1CJGA 2JVLA 2PE5A 2EF8A 1AU7A 2IU7A 4Z5HA 1WH8A 3FYMA 4IA8A 1SQ8A 1RZRA 2IUOA 2PUGA 1Y7YA 3G7DA 2BNMA 4GHJA 3SCGA 4X4FA 2EWTA 2IVGA 1ZZ6A 1ZZ8A 4GQMA 3G5GA 2AXVA 4MCTA 1BDHA 2HINA 3OMTA 1PRUA 3OQMA 1POUA 2L49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BD1 A;  3SCF A;  1RPE L;  2OR1 L;  3R1F A;  4Z58 A;  4F8D A;  3EUS A;  1QP4 A;  2AW6 A;  4O8B A;  4PU8 A;  2XSD C;  3O9X A;  1VPW A;  2CRO A;  1R69 A;  3RZZ A;  2LYS A;  2LCV A;  2IV1 A;  4I6U A;  2L8N A;  2AWI A;  1XWR A;  4IVZ A;  2GZU A;  2KZ8 A;  3F6W A;  4J1W A;  1JFT A;  1QPZ A;  2AXZ A;  2ICP A;  1NEQ A;  1ZPQ A;  1YSE A;  1RZS A;  2HSG A;  3SCH A;  4JCY A;  3QQ6 A;  2FJR A;  3HZI B;  1QQB A;  3OQO A;  4J1X A;  2LYJ A;  2KEJ A;  1JWL A;  1WH6 A;  1LMB 3;  2XI8 A;  2JCG A;  1E3O C;  4X4D A;  3ZHM A;  4FBI A;  3UFD A;  4I6T A;  3L1P A;  2EBY A;  4X4C A;  3S8Q A;  1X57 A;  3OP9 A;  2O4A A;  1L1M A;  3BDN A;  4PU7 A;  4YG7 B;  2O38 A;  2WUS R;  1PER L;  2PUB A;  2PPX A;  3FMY A;  1HF0 A;  2PUF A;  3ZHI A;  4JQD A;  1X2L A;  4JCX A;  1WIZ A;  1ZUG A;  2PUA A;  1WET A;  1ZZ7 A;  2LYQ A;  1PRA A;  1JH9 A;  2CSF A;  1R63 A;  3CEC A;  3TRB A;  3CRO L;  2O49 A;  2GRM A;  3OQN A;  4FN3 A;  3F51 A;  1B0N A;  2KEI A;  4Y42 A;  2LYP A;  1Y9Q A;  1DWK A;  4Z5D A;  2BJC A;  1LLI A;  1QP0 A;  3GN5 A;  4X4H A;  5K98 B;  4PU4 C;  3ZKC A;  3LFP A;  1ZZ9 A;  2IVB A;  3QWG A;  4YG1 A;  1UXD A;  1ZAY A;  3KZ3 A;  3QYX A;  1OSL A;  1CQT A;  2XCJ A;  3U3W A;  1GT0 C;  4I8T A;  2A6C A;  2KPJ A;  2LYL A;  4YBA A;  3CLC A;  1UXC A;  2H8R A;  3PXP A;  3BS3 A;  1ZZB A;  1LCC A;  4IWR A;  2B5A A;  1RIO A;  1S7E A;  3VK0 A;  4YG4 A;  2PUC A;  2PUD A;  3JXB C;  4MCX A;  1UTX A;  1IC8 A;  2GRL A;  4YAR A;  3H5T A;  4OB4 A;  2R63 A;  4X4B A;  3FYA A;  1ADR A;  3QF3 A;  1ZS4 A;  3F52 A;  4X4E A;  3GBF A;  3KXA A;  3IVP A;  4NDW A;  2D5V A;  1O4X A;  1NER A;  1DW9 A;  1ZVV A;  1RZR D;  2LYK A;  2R1J L;  3D1N I;  1OCT C;  2PUE A;  3JXC L;  1LCD A;  2LYR A;  1JFS A;  2AUW A;  1ZZC A;  2AXU A;  2MEZ A;  2XJ3 A;  1BDI A;  2MQK A;  2XIU A;  5A7L A;  4X4I A;  2OFY A;  4I6R A;  1LQC A;  2BNN A;  4Z59 A;  4PU3 C;  2ICT A;  3JXD L;  2PIJ A;  2KEK A;  1EFA A;  1QP7 A;  2WIU B;  1PNR A;  4X4G A;  3KJX A;  1PRV A;  2IVQ A;  4Z5C A;  2BNO A;  3B7H A;  3GN5 B;  3LIS A;  3DNV B;  1QQA A;  3MLF A;  1CJG A;  2JVL A;  2PE5 A;  2EF8 A;  1AU7 A;  2IU7 A;  4Z5H A;  1WH8 A;  3FYM A;  4IA8 A;  1SQ8 A;  1RZR A;  2IUO A;  2PUG A;  1Y7Y A;  3G7D A;  2BNM A;  4GHJ A;  3SCG A;  4X4F A;  2EWT A;  2IVG A;  1ZZ6 A;  1ZZ8 A;  4GQM A;  3G5G A;  2AXV A;  4MCT A;  1BDH A;  2HIN A;  3OMT A;  1PRU A;  3OQM A;  1POU A;  2L49 A; 
#chains in the Genus database with same CATH topology
 3SCF A;  4Z58 A;  1QP4 A;  4PU8 A;  4EK9 A;  1VPW A;  3ME5 A;  2LCV A;  4I6U A;  2L8N A;  1XWR A;  4EQZ A;  1ZPQ A;  3LQX A;  5DTQ A;  4JCY A;  3OQO A;  2LYJ A;  3R09 A;  1JWL A;  2V3C C;  3KL4 A;  1L1M A;  4PU7 A;  4HRA A;  1WIZ A;  1ZUG A;  1ZZ7 A;  1PRA A;  1JH9 A;  2CSF A;  2GRM A;  3OQN A;  2PXF A;  4Z5D A;  3LFP A;  3QWG A;  3KZ3 A;  3QYX A;  2XCJ A;  1UXC A;  2H8R A;  3PXP A;  1LCC A;  4IWR A;  1S7E A;  3VK0 A;  4YAR A;  3H5T A;  3FYA A;  3GBF A;  2D5V A;  1O4X A;  2ODR D;  2PXB A;  4WVL A;  3D1N I;  3JXC L;  2MEZ A;  2AXU A;  1BDI A;  4X4I A;  3A9Z A;  3KJX A;  2IVQ A;  2JVL A;  2PE5 A;  1SQ8 A;  5DTR A;  2BNM A;  4X4F A;  3NDB B;  2HFZ A;  3VWS A;  3OQM A;  2HCS A;  3BD1 A;  1RPE L;  4F8D A;  3EUS A;  2XSD C;  3O9X A;  2IV1 A;  3G0T A;  4Q2J A;  3F6W A;  1JFT A;  1QPZ A;  2AXZ A;  2YBD A;  2HSG A;  3QQ6 A;  2FJR A;  3HZI B;  1QQB A;  3PE5 A;  4X4D A;  4FBI A;  2L1P A;  3S8Q A;  1X57 A;  3OP9 A;  2O4A A;  4EKI A;  3BDN A;  2PUB A;  2O38 A;  3FMY A;  5DRT A;  3CEC A;  3ZPX A;  3F51 A;  2KEI A;  4Y42 A;  2LYP A;  1Y9Q A;  1DWK A;  1LLI A;  4EZI A;  4X4H A;  5K98 B;  3ZKC A;  3DM5 A;  3NRO A;  1U2Z A;  1UXD A;  4ER0 A;  2PXV A;  2HIN A;  2A6C A;  2LYL A;  3CLC A;  2XXA A;  2B5A A;  4YG4 A;  3A9Y A;  3JXB C;  1IC8 A;  2R63 A;  3QF3 A;  1ZS4 A;  3KXA A;  1ZVV A;  4ER3 A;  3QOX A;  2AUW A;  2XJ3 A;  2J7W A;  4ER7 A;  4I6R A;  2BNN A;  3JXD L;  1EFA A;  2ICT A;  2PIJ A;  5DTM A;  1PNR A;  1PRV A;  3LIS A;  1CJG A;  1DUL A;  1HQ1 A;  2J7U A;  2IU7 A;  4Z5H A;  1RZR A;  2LNM A;  3G7D A;  2PXE A;  4GHJ A;  1ZZ8 A;  4GQM A;  2FFH A;  1AU7 A;  1PRU A;  2L49 A;  4ER5 A;  2AW6 A;  4O8B A;  2CRO A;  1R69 A;  3QOW A;  4IVZ A;  2GZU A;  2ICP A;  1YSE A;  1RZS A;  2PXD A;  1LMB 3;  2XI8 A;  5DSX A;  1E3O C;  3TEL A;  3TEP A;  3L1P A;  2EBY A;  4X4C A;  4EKG A;  1PER L;  2PUF A;  4JCX A;  2PXK A;  2PXU A;  2LYQ A;  1R63 A;  5GAH i;  4FN3 A;  1B0N A;  2BJC A;  1QP0 A;  3GN5 A;  4PU4 C;  1ZZ9 A;  2IVB A;  1ZAY A;  1CQT A;  1OSL A;  3U3W A;  4I8T A;  4YBA A;  3BS3 A;  1ZZB A;  2M4H A;  3SR4 A;  2PUD A;  2PUC A;  4MCX A;  4OB4 A;  5DRY A;  1ADR A;  3SX0 A;  2LLW A;  4X4E A;  3IVP A;  4NDW A;  1NER A;  1RZR D;  2R1J L;  2PUE A;  2LYR A;  2PXP A;  5A7L A;  2XIU A;  3A9X A;  1MFQ C;  4Z59 A;  4PU3 C;  4DE9 A;  3DNV B;  1QQA A;  4X4G A;  3B7H A;  1NW3 A;  4DE8 A;  2PXL A;  4IA8 A;  2IUO A;  4OBM A;  2IVG A;  3G5G A;  2AXV A;  4MCT A;  5GAG i;  3OMT A;  4YG7 B;  2PPX A;  2OR1 L;  3R1F A;  2PXT A;  2XXP A;  2LLV A;  3RZZ A;  2LYS A;  1QB2 A;  2AWI A;  2KZ8 A;  4J1W A;  1NEQ A;  3SCH A;  4J1X A;  1WH6 A;  2VEO A;  2JCG A;  3ZHM A;  3UFD A;  4I6T A;  2JQE A;  3GZD A;  3MEJ A;  2WUS R;  4JQD A;  1HF0 A;  3ZHI A;  1X2L A;  5DT2 A;  4ER6 A;  2PUA A;  1WET A;  3TRB A;  3CRO L;  2O49 A;  3OKZ A;  3OWQ A;  4YG1 A;  2PXQ A;  1QZX A;  1GT0 C;  2MXD A;  2KPJ A;  3UWP A;  3QFI A;  1RIO A;  1UTX A;  2GRL A;  2XXQ A;  4X4B A;  3NXH A;  3F52 A;  3GUU A;  3M9L A;  1DW9 A;  2LYK A;  1OCT C;  3TFL A;  3GZC A;  1LCD A;  1JFS A;  1ZZC A;  2MQK A;  2OFY A;  2KEK A;  1LQC A;  1QP7 A;  2WIU B;  4Z5C A;  2BNO A;  3GN5 B;  5JUW A;  3MLF A;  2EF8 A;  2HCN A;  3GZD C;  1WH8 A;  3FYM A;  2PUG A;  1Y7Y A;  3SCG A;  2EWT A;  1ZZ6 A;  1BDH A;  3NZL A;  2KEJ A;  1POU A; 
#chains in the Genus database with same CATH homology
 3BD1 A;  3SCF A;  1RPE L;  2OR1 L;  3R1F A;  4Z58 A;  4F8D A;  3EUS A;  1QP4 A;  2AW6 A;  4O8B A;  4PU8 A;  2XSD C;  3O9X A;  1VPW A;  2CRO A;  1R69 A;  3RZZ A;  2LYS A;  2LCV A;  2IV1 A;  4I6U A;  2L8N A;  2AWI A;  1XWR A;  4IVZ A;  2GZU A;  2KZ8 A;  3F6W A;  4J1W A;  1JFT A;  1QPZ A;  2AXZ A;  2ICP A;  1NEQ A;  1ZPQ A;  1YSE A;  1RZS A;  2HSG A;  3SCH A;  4JCY A;  3QQ6 A;  2FJR A;  3HZI B;  1QQB A;  3OQO A;  4J1X A;  2LYJ A;  2KEJ A;  1JWL A;  1WH6 A;  1LMB 3;  2XI8 A;  2JCG A;  1E3O C;  4X4D A;  3ZHM A;  4FBI A;  3UFD A;  4I6T A;  3L1P A;  2EBY A;  4X4C A;  3S8Q A;  1X57 A;  3OP9 A;  2O4A A;  1L1M A;  3BDN A;  4PU7 A;  4YG7 B;  2O38 A;  2WUS R;  1PER L;  2PUB A;  2PPX A;  3FMY A;  1HF0 A;  2PUF A;  3ZHI A;  4JQD A;  1X2L A;  4JCX A;  1WIZ A;  1ZUG A;  2PUA A;  1WET A;  1ZZ7 A;  2LYQ A;  1PRA A;  1JH9 A;  2CSF A;  1R63 A;  3CEC A;  3TRB A;  3CRO L;  2O49 A;  2GRM A;  3OQN A;  4FN3 A;  3F51 A;  1B0N A;  2KEI A;  4Y42 A;  2LYP A;  1Y9Q A;  1DWK A;  4Z5D A;  2BJC A;  1LLI A;  1QP0 A;  3GN5 A;  4X4H A;  5K98 B;  4PU4 C;  3ZKC A;  3LFP A;  1ZZ9 A;  2IVB A;  3QWG A;  4YG1 A;  1UXD A;  1ZAY A;  3KZ3 A;  3QYX A;  1OSL A;  1CQT A;  2XCJ A;  3U3W A;  1GT0 C;  4I8T A;  2A6C A;  2KPJ A;  2LYL A;  4YBA A;  3CLC A;  1UXC A;  2H8R A;  3PXP A;  3BS3 A;  1ZZB A;  1LCC A;  4IWR A;  2B5A A;  1RIO A;  1S7E A;  3VK0 A;  4YG4 A;  2PUC A;  2PUD A;  3JXB C;  4MCX A;  1UTX A;  1IC8 A;  2GRL A;  4YAR A;  3H5T A;  4OB4 A;  2R63 A;  4X4B A;  3FYA A;  1ADR A;  3QF3 A;  1ZS4 A;  3F52 A;  4X4E A;  3GBF A;  3KXA A;  3IVP A;  4NDW A;  2D5V A;  1O4X A;  1NER A;  1DW9 A;  1ZVV A;  1RZR D;  2LYK A;  2R1J L;  3D1N I;  1OCT C;  2PUE A;  3JXC L;  1LCD A;  2LYR A;  1JFS A;  2AUW A;  1ZZC A;  2AXU A;  2MEZ A;  2XJ3 A;  1BDI A;  2MQK A;  2XIU A;  5A7L A;  4X4I A;  2OFY A;  4I6R A;  1LQC A;  2BNN A;  4Z59 A;  4PU3 C;  2ICT A;  3JXD L;  2PIJ A;  2KEK A;  1EFA A;  1QP7 A;  2WIU B;  1PNR A;  4X4G A;  3KJX A;  1PRV A;  2IVQ A;  4Z5C A;  2BNO A;  3B7H A;  3GN5 B;  3LIS A;  3DNV B;  1QQA A;  3MLF A;  1CJG A;  2JVL A;  2PE5 A;  2EF8 A;  1AU7 A;  2IU7 A;  4Z5H A;  1WH8 A;  3FYM A;  4IA8 A;  1SQ8 A;  1RZR A;  2IUO A;  2PUG A;  1Y7Y A;  3G7D A;  2BNM A;  4GHJ A;  3SCG A;  4X4F A;  2EWT A;  2IVG A;  1ZZ6 A;  1ZZ8 A;  4GQM A;  3G5G A;  2AXV A;  4MCT A;  1BDH A;  2HIN A;  3OMT A;  1PRU A;  3OQM A;  1POU A;  2L49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...