1PRBA

Structure of an albumin-binding domain, nmr, minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
53
structure length
53
Chain Sequence
TIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the albumin-binding GA module: a versatile bacterial protein domain.
pubmed doi rcsb
source organism Finegoldia magna atcc 29328
molecule tags Albumin-binding protein
molecule keywords PROTEIN PAB
total genus 12
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1997-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1prbA00
2VDBB 2LHCA 2FS1A 1GJSA 1GABA 2MH8A 1PRBA 1GJTA 1TF0B 2N35A 2KDLA 2J5YA 2JWSA 2LHGA
chains in the Genus database with same CATH superfamily
2L4EA 3KS4A 3GLHA 5DNYA 4FVMA 4LF8M 3ZH9B 3GRRA 1V33A 2GQFA 2F5QA 1E9SA 1T3TA 1DV0A 1OFIA 2DAEA 2DAMA 2M5ZA 3DFZA 3MMPA 5IZ7D 3GPPA 3GQ3A 2YFQA 2V1UA 4IIWA 2DWNA 5C18A 2KRUA 3HX3A 1IXSA 3HZJA 4KODA 1VEKA 4PD2A 4DV7M 3KFUG 3RE8A 3HHYA 5KPTA 4L6V6 5EP3A 1C1KA 2D7EA 1R5LA 2MH8A 2CV2A 2Y0TA 4LF7M 5EXSA 4JI3M 3I4YA 2DHRA 1Y8GA 2K47A 4AKGA 1IQPA 2QZ4A 1FNNA 4IBJA 4NC6A 1J5EM 4P17A 1X37A 4LF4M 4LF5M 3U6QA 3AOGA 3W0LB 1GL6A 3PFIA 1QDTA 2CUZA 4DV1M 3KW6A 2L2DA 4FCVA 2HL7A 2G3QA 2BWEA 4LJ5A 3SC3A 5LMNM 1L2BA 3MHVC 3U6PA 4MGKE 1J7KA 2DAKA 4MGYE 1OAIA 4M0WA 2KRKA 2JY5A 1UM8A 2LTUA 1IN7A 2Z8YM 2UU9M 4UN2B 3KOZE 2ZAOA 4HLQA 4IBFA 2AHMA 5EXXA 1GVNA 3ZCBB 3IECA 3R8FA 2JNHA 4QHSA 3GPUA 3GLFA 3FTEA 2A5YB 2DWZB 2KZSA 4I8OA 4XK8F 3RGPA 4Q7JA 3Q8GA 5IWAM 3I04M 4PDIA 2J7OA 1D0KA 1ZQ9A 2VIIA 2R4EA 2DHYA 1MX0A 2C9OA 1PJJA 3L25A 1ORYB 2Q2EB 3A45A 4JI4M 1N78A 3ZC7B 1QQWA 1SXJA 2JY7A 2LVNC 3D8BA 4R7GA 2VQFM 2D7GA 4I81A 3T1HM 3SASA 4Z8XA 2L7IA 2F5PA 4G4OA 4YY3M 5ITXE 5C1BA 2EO2A 4B3TM 3C3EA 3HWSA 3W67A 1UFZA 1V34A 1TDHA 4G4NA 4DV3M 1QAOA 3QWLA 5KPZA 3PNVA 4LJ9A 4DR5M 1L2CA 3B7QA 4AZFA 3KVWA 1IN8A 3U60B 1Z59A 3AOEC 4FWDA 1MN3A 1V92A 1NHWC 2Y0QA 4XGIA 2JY8A 4LFAM 2O5RA 1QUSA 2QHOB 2R45A 3VDUA 1XB2B 1N77A 1OAOC 2VDBB 5IT9S 3TWLA 2F5SA 3SYLA 4JXJA 2LNHC 5ITTA 3VKHA 5FLXS 4RNAA 1WXQA 2QBYB 1DGFA 4FW9A 3SHFA 1JR3D 2WZJA 4GC9A 1IM2A 2DAIA 5EXPA 1Q3BA 2H1RA 4R71A 3VK7A 1AUAA 3JR4A 4OU7A 1QVRA 4TUWA 3GLFE 2LVPC 1OJLA 1XWIA 3CF6E 4NOOB 1SXJC 3QYEA 4QNMA 1MU5A 3FRHA 1KFVA 3SAVA 1IY0A 4BB9A 4DR6M 1HQYE 4DV2M 1Q02A 1ZV1A 3CF0A 2BNKA 2ZTCA 2KZUA 4LGMA 8CATA 4DR1M 1DO0A 1IN5A 2WSCF 4CGYB 4F2LA 3SBJA 3R9XB 4IBEA 2FE8A 3J2PB 3M7GA 1GKIA 2EKKA 5BPVA 2HCBA 3FUUA 3GRVA 3UJNA 3J81S 1T43A 1JR3A 4DV5M 2ZBKB 5IREB 3C3DA 3SAWA 1I94M 3H4MA 2DZNB 3L28A 2D7HA 3GPYA 2KHHA 5LMUM 1N36M 2RGOA 1I4WA 3HHWA 2R62A 3QYBA 3U6OA 3SMPA 4Y28F 4GKKM 5FSWA 1G8PA 1VDLA 1VEGA 3U61A 2L4FA 4OVZB 2N35A 1G59A 3I4VA 4R3DA 1OKSA 2C9CA 2KNAA 3GRUA 2R0IA 4II7A 4L4UA 5ITRA 3GQ4A 1Q3CA 2EA0A 4LFBM 3E9SA 2DKLA 4GC5A 4L78A 5JI3E 2DZLA 2KNZA 2XGNA 1EE8A 4NSRA 4CHTB 1KSFX 2C99A 4B08A 4LFCM 5ITXA 3OTOM 2VQEM 1NNUC 2DI0A 4IBGA 4NRVA 2W82A 1H6UA 3C58A 1TGUA 2Y21A 1IXZA 4L8RC 1XNQM 3GLGB 2JZ1A 3CF2A 3PNYA 4X65M 2CP8A 1BVSA 4LCBA 3FTFA 2BWBA 1S3SA 2XEPA 4IBKA 2KDLA 4RF1A 1NV9A 2ZANA 2ZAMA 4GMQA 1TTEA 1NV8A 1XHBA 2JUJA 3SYKA 1R2ZA 2DNAA 1E94E 4DR3M 3NBIA 1TF0B 1XNRM 2EUCA 2K0BX 4LZZA 2V6ZM 4I4LA 2XZUA 3J7BA 2CHVA 3JAMS 4IBBA 3FKEA 5FTJA 2LVQD 2MGWA 2R65A 3IHPA 1TH4A 1D2NA 2OOBA 2DENA 2HKJA 2O01F 3IG5A 4MGZE 4GHAA 3I01M 1OIZA 3SATA 1EIJA 4B7HA 4WP2A 2DWMA 1NJGA 3B89A 4DV0M 4M9ZA 4JV5M 2X49A 4GIPA 2ZTDA 4B7FA 1KYIA 1CUKA 3L2AA 3VK8A 1Z5AA 4LJ4A 3VKGA 5FTNA 1D0LA 3TWMA 2R6FA 3MJ5A 2QP9X 1XXHE 1JR3E 1NY6A 1DGHB 2LHCA 2DAGA 4KT0F 2FNAA 4LRSA 3UMMA 4OVZA 3AJIB 3F92A 3UGJA 1QZEA 1R7RA 3KP1E 2GNOA 2YNMD 3DOAA 5KQDA 1WHCA 2QSFX 1IBMM 2EJSA 1P3QQ 2QNJA 1WIVA 1NVMA 4QNRA 3WHLA 1HNXM 2CV1A 2DXIA 1NHGC 4DR7M 2V1CA 4GITA 5A2QS 4HL4A 4NRWA 4Z6YA 2RGHA 5H37D 4LF9M 1JB0F 4DUYM 1N34M 5EP1A 5KO3A 2NQ8C 3LVVA 4LRTA 3M0EA 2CRUA 2KA6B 1IY2A 1W5TA 1HT1E 2F5NA 4DV4M 2FOIC 1OIPA 1YSYA 2JWSA 2MROB 3U6MA 3KP0E 3E46A 3THGA 4AW4A 2CWBA 2P5TA 4M9SA 2G8LA 5ITUA 3HJSA 4DBGB 1YUBA 2CFOA 3FYCA 3WHKA 3RFWA 4AG5A 2XF3A 4XBOA 1NO1A 3T6PA 3K8ZA 3K2LA 3FUTA 3BXWA 2MJ5B 7CATA 2HWJA 3U61B 1SXJD 2LVAA 2M60A 3AV0A 3L26A 3JR5A 4JI5M 3A42A 2L09A 2JXNA 3SFZA 1L8QA 3TWKA 3FE3A 3B7ZA 4LJAA 1R4GA 4JI6M 1TDZA 3LW5F 5EP2A 2UXCM 1WR1B 1XXHA 2FH0A 3LVWA 1PJIA 3SARA 1GJSA 3I51A 3KOYE 4IBCA 1ZMVA 1E9RA 2WSEF 3CGWA 3VDPA 4ANRA 2L6OA 1QUTA 1PM5A 1K82A 2EKFA 3FRIA 5ITYA 3GPXA 1QAMA 2F4VM 5L8RF 1XMOM 4F1IA 2CV0A 4NXNM 1IN4A 4BBAA 4GHLA 4LGYA 5DYIA 3ZQJA 1HQCA 2L7HA 1VEJA 4P16A 2J5YA 1TH3A 4FCTA 3K9PA 4X64M 3LQRA 3A46A 4IJFA 4G4QA 3EIEA 4B3RM 3HHZA 2LWXA 3GLGA 5GKNA 3HU3A 3L27A 4GKJM 2KNVA 3KSJA 4B3MM 4LJ7A 4AKIA 2ERCA 4ZPXA 3GLHE 5JI2E 2G5GX 1J09A 4MM3B 2C96A 1XC8A 4QOZC 1HR0M 3AOEA 3T1YM 1A5TA 5E6JA 5EQTA 1NJFA 2JP7A 1T6OA 5KQ8A 3ILKA 2F5OA 1DGGA 4GEWA 5FTLA 3U6CA 1HT2E 4G3OA 2XZFA 2C5RA 3QAUA 3U6LA 2OQ4A 3E4RA 1C7YA 5BR8M 1GABA 1G71A 2DWLA 4D82A 1RU3A 4JI0M 2YQZA 3PXGA 4JI7M 4LG2A 1YE9A 4A3VB 4NSOB 1NSFA 4G6ZA 4JI1M 1WGNA 3C9PA 1MJGM 1HNZM 4NL4H 1K3XA 5ITQA 3TQSA 1IN6A 4B7GA 3HU2A 1QANA 2QQ8A 4RF0A 2UUAM 1NY5A 3D8LA 2Y20A 3AKZA 1TH2A 1SXJE 3FD9A 4REZA 2QENA 4PT5A 4OX9M 2DVWB 1G3IA 2XH9A 2YR0A 5FTKA 4MGIE 1XXHB 2K9DA 2LH0A 3HGIA 3VLFB 3LQQA 1VG5A 1OFHA 3EIHA 4JI2M 3U6DA 3GLIA 3SAUA 3FUWA 1NNJA 1PRBA 1L1ZA 1PGYA 2LXEA 1PJSA 1SG9A 2HHHM 4I5SA 2CE7A 2UUBM 1QDRA 1GLNA 3J80S 1K3WA 3KDSE 2WSFF 2JZ0A 2OOAA 4L16A 3Q8XA 3U6SA 5E26A 3W68A 4DR4M 4AI6A 1IBLM 3HU1A 2XSZA 2Z7JA 3L29A 1G4AE 1JQJC 3FYDA 4FWHA 4KLNA 3T15A 1R6BX 3MK6A 2KEBA 2LHGA 1IFYA 3VFDA 2ZM6M 3GLIB 1ZMWA 1GJTA 2CHQA 2QCUA 4FD2A 4OW0A 4WW0A 4L15A 4X66M 2C98A 4WURA 3UK6A 2RRUA 3B9PA 1AIPC 1VQ1A 3BOSA 2QPAA 3SHGB 1QYRA 3V76A 1N75A 3GO8A 3TL4X 3NBXX 4LF6M 4X62M 4W5WA 4DV6M 3GRYA 5EP4A 1Q39A 3IG8A 4AKHA 3HKPA 1XMQM 4B3SM 3FTCA 2I7NA 4DUZM 1W5SA 4JN6A 2LVOC 3U6EA 4DR2M 1N32M 4JYAM 1IY1A 5F3WA 1G41A 1QAQA 4PCZA 1DGHA 3B7NA 3K1JA 2O25A 4LZJA 3LCUA 4D80A 1ZAEA 1Z5BA 1Z6TA 1EFUB 2R44A 1Z5CA 2XLJA 3T38A 1HNWM 3TPZA 2Z3XA 4K0KM 4IJEA 2XFTA 1N33M 1VDDA 3CTWB 1L2DA 4M0DA 1IXRC 1DO2A 3M6AA 2R18A 4KHPM 4MH0E 3AL0C 5EJCA 4ITQA 1ZMUA 2FS1A 4GH9A 3SMSA 4CIZA 4YHHM 3BBZA 1WJ7A 3J7AS 3FUVA 4GRIA 1R2YA 1IXSB 4PDGA 1F4IA 3W0FA 3K92A 1E32A 4AG6A 2APLA 3A98B 1L1TA 4AQYM 1DGBA 3KXEC 4IBIA 4IBDA 4JI8M 4RKUF 4S12A 3UZUA 3U60A 3GLGE 1PJTA 5DFLA 2X8AA 1TR8A 4BLCA 2E5LM 2R46A 3DZDA 3GLHB 2I7PA 2KXEA 4CISA 1WGLA 1D0MA 2JY6B 2Z4SA 3E21A 3KOWE 5KPRA 4NXMM 1OTRA 1HJPA 2XSZD 2Z4RA 3HJ8A 3NWLA 2UXDM 4QHTA 3KOXE 5DYGA 1QZMA 2OO9A 2OPFA 3U5ZA 2CHGA 1OQYA 3U5ZB 1FJGM 2X4AA 4KO8A 3KS8A 3AFHA 1SXJB 3FTDA 3LCVB 1LTMA 4MB7A 5EXTA 3PVSA 3B74A 5FTMA 4D81A 2LBCA 4EIWA 3TE6A 2J7NA 2CEAA 1GO5A 2XFSA 2R4JA 3GLFB 4CJ6A 2B3TA 2BJVA 2UXBM 3H4JA 2MR9A 3HHXA 2RKOA 1LV7A 2K6BA 2UUCM 2H5XA 1IBKM 2VF7A 3HY5A 4LJ6A 1PJQA 2JA2A 3RGSA 3K9OA 3LMMA 3GQ5A 4LY6A 1YLAA 2HAKA 3J27B 2QBYA 2BJWA 2VF8A 3FUXA 3DA1A 2KW0A 2DZOB 3HJQA 4HEOA 3KSXA 4LJ8A 4MGHA 4M9XA 4FCWA 3GP1A 1GL7A 3GLIE 4G4RA 2FFJA 4FWGA 4QOSA
chains in the Genus database with same CATH topology
2VDBB 2LHCA 2FS1A 1GJSA 1GABA 2MH8A 1PRBA 1GJTA 1TF0B 2N35A 2KDLA 2J5YA 2JWSA 2LHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDB B;  2LHC A;  2FS1 A;  1GJS A;  1GAB A;  2MH8 A;  1PRB A;  1GJT A;  1TF0 B;  2N35 A;  2KDL A;  2J5Y A;  2JWS A;  2LHG A; 
#chains in the Genus database with same CATH topology
 2L4E A;  3KS4 A;  3GLH A;  5DNY A;  4FVM A;  4LF8 M;  3ZH9 B;  3GRR A;  1V33 A;  2GQF A;  2F5Q A;  1E9S A;  1T3T A;  1DV0 A;  1OFI A;  2DAE A;  2DAM A;  2M5Z A;  3DFZ A;  3MMP A;  5IZ7 D;  3GPP A;  3GQ3 A;  2YFQ A;  2V1U A;  4IIW A;  2DWN A;  5C18 A;  2KRU A;  3HX3 A;  1IXS A;  3HZJ A;  4KOD A;  1VEK A;  4PD2 A;  4DV7 M;  3KFU G;  3RE8 A;  3HHY A;  5KPT A;  4L6V 6;  5EP3 A;  1C1K A;  2D7E A;  1R5L A;  2MH8 A;  2CV2 A;  2Y0T A;  4LF7 M;  5EXS A;  4JI3 M;  3I4Y A;  2DHR A;  1Y8G A;  2K47 A;  4AKG A;  1IQP A;  2QZ4 A;  1FNN A;  4IBJ A;  4NC6 A;  1J5E M;  4P17 A;  1X37 A;  4LF4 M;  4LF5 M;  3U6Q A;  3AOG A;  3W0L B;  1GL6 A;  3PFI A;  1QDT A;  2CUZ A;  4DV1 M;  3KW6 A;  2L2D A;  4FCV A;  2HL7 A;  2G3Q A;  2BWE A;  4LJ5 A;  3SC3 A;  5LMN M;  1L2B A;  3MHV C;  3U6P A;  4MGK E;  1J7K A;  2DAK A;  4MGY E;  1OAI A;  4M0W A;  2KRK A;  2JY5 A;  1UM8 A;  2LTU A;  1IN7 A;  2Z8Y M;  2UU9 M;  4UN2 B;  3KOZ E;  2ZAO A;  4HLQ A;  4IBF A;  2AHM A;  5EXX A;  1GVN A;  3ZCB B;  3IEC A;  3R8F A;  2JNH A;  4QHS A;  3GPU A;  3GLF A;  3FTE A;  2A5Y B;  2DWZ B;  2KZS A;  4I8O A;  4XK8 F;  3RGP A;  4Q7J A;  3Q8G A;  5IWA M;  3I04 M;  4PDI A;  2J7O A;  1D0K A;  1ZQ9 A;  2VII A;  2R4E A;  2DHY A;  1MX0 A;  2C9O A;  1PJJ A;  3L25 A;  1ORY B;  2Q2E B;  3A45 A;  4JI4 M;  1N78 A;  3ZC7 B;  1QQW A;  1SXJ A;  2JY7 A;  2LVN C;  3D8B A;  4R7G A;  2VQF M;  2D7G A;  4I81 A;  3T1H M;  3SAS A;  4Z8X A;  2L7I A;  2F5P A;  4G4O A;  4YY3 M;  5ITX E;  5C1B A;  2EO2 A;  4B3T M;  3C3E A;  3HWS A;  3W67 A;  1UFZ A;  1V34 A;  1TDH A;  4G4N A;  4DV3 M;  1QAO A;  3QWL A;  5KPZ A;  3PNV A;  4LJ9 A;  4DR5 M;  1L2C A;  3B7Q A;  4AZF A;  3KVW A;  1IN8 A;  3U60 B;  1Z59 A;  3AOE C;  4FWD A;  1MN3 A;  1V92 A;  1NHW C;  2Y0Q A;  4XGI A;  2JY8 A;  4LFA M;  2O5R A;  1QUS A;  2QHO B;  2R45 A;  3VDU A;  1XB2 B;  1N77 A;  1OAO C;  2VDB B;  5IT9 S;  3TWL A;  2F5S A;  3SYL A;  4JXJ A;  2LNH C;  5ITT A;  3VKH A;  5FLX S;  4RNA A;  1WXQ A;  2QBY B;  1DGF A;  4FW9 A;  3SHF A;  1JR3 D;  2WZJ A;  4GC9 A;  1IM2 A;  2DAI A;  5EXP A;  1Q3B A;  2H1R A;  4R71 A;  3VK7 A;  1AUA A;  3JR4 A;  4OU7 A;  1QVR A;  4TUW A;  3GLF E;  2LVP C;  1OJL A;  1XWI A;  3CF6 E;  4NOO B;  1SXJ C;  3QYE A;  4QNM A;  1MU5 A;  3FRH A;  1KFV A;  3SAV A;  1IY0 A;  4BB9 A;  4DR6 M;  1HQY E;  4DV2 M;  1Q02 A;  1ZV1 A;  3CF0 A;  2BNK A;  2ZTC A;  2KZU A;  4LGM A;  8CAT A;  4DR1 M;  1DO0 A;  1IN5 A;  2WSC F;  4CGY B;  4F2L A;  3SBJ A;  3R9X B;  4IBE A;  2FE8 A;  3J2P B;  3M7G A;  1GKI A;  2EKK A;  5BPV A;  2HCB A;  3FUU A;  3GRV A;  3UJN A;  3J81 S;  1T43 A;  1JR3 A;  4DV5 M;  2ZBK B;  5IRE B;  3C3D A;  3SAW A;  1I94 M;  3H4M A;  2DZN B;  3L28 A;  2D7H A;  3GPY A;  2KHH A;  5LMU M;  1N36 M;  2RGO A;  1I4W A;  3HHW A;  2R62 A;  3QYB A;  3U6O A;  3SMP A;  4Y28 F;  4GKK M;  5FSW A;  1G8P A;  1VDL A;  1VEG A;  3U61 A;  2L4F A;  4OVZ B;  2N35 A;  1G59 A;  3I4V A;  4R3D A;  1OKS A;  2C9C A;  2KNA A;  3GRU A;  2R0I A;  4II7 A;  4L4U A;  5ITR A;  3GQ4 A;  1Q3C A;  2EA0 A;  4LFB M;  3E9S A;  2DKL A;  4GC5 A;  4L78 A;  5JI3 E;  2DZL A;  2KNZ A;  2XGN A;  1EE8 A;  4NSR A;  4CHT B;  1KSF X;  2C99 A;  4B08 A;  4LFC M;  5ITX A;  3OTO M;  2VQE M;  1NNU C;  2DI0 A;  4IBG A;  4NRV A;  2W82 A;  1H6U A;  3C58 A;  1TGU A;  2Y21 A;  1IXZ A;  4L8R C;  1XNQ M;  3GLG B;  2JZ1 A;  3CF2 A;  3PNY A;  4X65 M;  2CP8 A;  1BVS A;  4LCB A;  3FTF A;  2BWB A;  1S3S A;  2XEP A;  4IBK A;  2KDL A;  4RF1 A;  1NV9 A;  2ZAN A;  2ZAM A;  4GMQ A;  1TTE A;  1NV8 A;  1XHB A;  2JUJ A;  3SYK A;  1R2Z A;  2DNA A;  1E94 E;  4DR3 M;  3NBI A;  1TF0 B;  1XNR M;  2EUC A;  2K0B X;  4LZZ A;  2V6Z M;  4I4L A;  2XZU A;  3J7B A;  2CHV A;  3JAM S;  4IBB A;  3FKE A;  5FTJ A;  2LVQ D;  2MGW A;  2R65 A;  3IHP A;  1TH4 A;  1D2N A;  2OOB A;  2DEN A;  2HKJ A;  2O01 F;  3IG5 A;  4MGZ E;  4GHA A;  3I01 M;  1OIZ A;  3SAT A;  1EIJ A;  4B7H A;  4WP2 A;  2DWM A;  1NJG A;  3B89 A;  4DV0 M;  4M9Z A;  4JV5 M;  2X49 A;  4GIP A;  2ZTD A;  4B7F A;  1KYI A;  1CUK A;  3L2A A;  3VK8 A;  1Z5A A;  4LJ4 A;  3VKG A;  5FTN A;  1D0L A;  3TWM A;  2R6F A;  3MJ5 A;  2QP9 X;  1XXH E;  1JR3 E;  1NY6 A;  1DGH B;  2LHC A;  2DAG A;  4KT0 F;  2FNA A;  4LRS A;  3UMM A;  4OVZ A;  3AJI B;  3F92 A;  3UGJ A;  1QZE A;  1R7R A;  3KP1 E;  2GNO A;  2YNM D;  3DOA A;  5KQD A;  1WHC A;  2QSF X;  1IBM M;  2EJS A;  1P3Q Q;  2QNJ A;  1WIV A;  1NVM A;  4QNR A;  3WHL A;  1HNX M;  2CV1 A;  2DXI A;  1NHG C;  4DR7 M;  2V1C A;  4GIT A;  5A2Q S;  4HL4 A;  4NRW A;  4Z6Y A;  2RGH A;  5H37 D;  4LF9 M;  1JB0 F;  4DUY M;  1N34 M;  5EP1 A;  5KO3 A;  2NQ8 C;  3LVV A;  4LRT A;  3M0E A;  2CRU A;  2KA6 B;  1IY2 A;  1W5T A;  1HT1 E;  2F5N A;  4DV4 M;  2FOI C;  1OIP A;  1YSY A;  2JWS A;  2MRO B;  3U6M A;  3KP0 E;  3E46 A;  3THG A;  4AW4 A;  2CWB A;  2P5T A;  4M9S A;  2G8L A;  5ITU A;  3HJS A;  4DBG B;  1YUB A;  2CFO A;  3FYC A;  3WHK A;  3RFW A;  4AG5 A;  2XF3 A;  4XBO A;  1NO1 A;  3T6P A;  3K8Z A;  3K2L A;  3FUT A;  3BXW A;  2MJ5 B;  7CAT A;  2HWJ A;  3U61 B;  1SXJ D;  2LVA A;  2M60 A;  3AV0 A;  3L26 A;  3JR5 A;  4JI5 M;  3A42 A;  2L09 A;  2JXN A;  3SFZ A;  1L8Q A;  3TWK A;  3FE3 A;  3B7Z A;  4LJA A;  1R4G A;  4JI6 M;  1TDZ A;  3LW5 F;  5EP2 A;  2UXC M;  1WR1 B;  1XXH A;  2FH0 A;  3LVW A;  1PJI A;  3SAR A;  1GJS A;  3I51 A;  3KOY E;  4IBC A;  1ZMV A;  1E9R A;  2WSE F;  3CGW A;  3VDP A;  4ANR A;  2L6O A;  1QUT A;  1PM5 A;  1K82 A;  2EKF A;  3FRI A;  5ITY A;  3GPX A;  1QAM A;  2F4V M;  5L8R F;  1XMO M;  4F1I A;  2CV0 A;  4NXN M;  1IN4 A;  4BBA A;  4GHL A;  4LGY A;  5DYI A;  3ZQJ A;  1HQC A;  2L7H A;  1VEJ A;  4P16 A;  2J5Y A;  1TH3 A;  4FCT A;  3K9P A;  4X64 M;  3LQR A;  3A46 A;  4IJF A;  4G4Q A;  3EIE A;  4B3R M;  3HHZ A;  2LWX A;  3GLG A;  5GKN A;  3HU3 A;  3L27 A;  4GKJ M;  2KNV A;  3KSJ A;  4B3M M;  4LJ7 A;  4AKI A;  2ERC A;  4ZPX A;  3GLH E;  5JI2 E;  2G5G X;  1J09 A;  4MM3 B;  2C96 A;  1XC8 A;  4QOZ C;  1HR0 M;  3AOE A;  3T1Y M;  1A5T A;  5E6J A;  5EQT A;  1NJF A;  2JP7 A;  1T6O A;  5KQ8 A;  3ILK A;  2F5O A;  1DGG A;  4GEW A;  5FTL A;  3U6C A;  1HT2 E;  4G3O A;  2XZF A;  2C5R A;  3QAU A;  3U6L A;  2OQ4 A;  3E4R A;  1C7Y A;  5BR8 M;  1GAB A;  1G71 A;  2DWL A;  4D82 A;  1RU3 A;  4JI0 M;  2YQZ A;  3PXG A;  4JI7 M;  4LG2 A;  1YE9 A;  4A3V B;  4NSO B;  1NSF A;  4G6Z A;  4JI1 M;  1WGN A;  3C9P A;  1MJG M;  1HNZ M;  4NL4 H;  1K3X A;  5ITQ A;  3TQS A;  1IN6 A;  4B7G A;  3HU2 A;  1QAN A;  2QQ8 A;  4RF0 A;  2UUA M;  1NY5 A;  3D8L A;  2Y20 A;  3AKZ A;  1TH2 A;  1SXJ E;  3FD9 A;  4REZ A;  2QEN A;  4PT5 A;  4OX9 M;  2DVW B;  1G3I A;  2XH9 A;  2YR0 A;  5FTK A;  4MGI E;  1XXH B;  2K9D A;  2LH0 A;  3HGI A;  3VLF B;  3LQQ A;  1VG5 A;  1OFH A;  3EIH A;  4JI2 M;  3U6D A;  3GLI A;  3SAU A;  3FUW A;  1NNJ A;  1PRB A;  1L1Z A;  1PGY A;  2LXE A;  1PJS A;  1SG9 A;  2HHH M;  4I5S A;  2CE7 A;  2UUB M;  1QDR A;  1GLN A;  3J80 S;  1K3W A;  3KDS E;  2WSF F;  2JZ0 A;  2OOA A;  4L16 A;  3Q8X A;  3U6S A;  5E26 A;  3W68 A;  4DR4 M;  4AI6 A;  1IBL M;  3HU1 A;  2XSZ A;  2Z7J A;  3L29 A;  1G4A E;  1JQJ C;  3FYD A;  4FWH A;  4KLN A;  3T15 A;  1R6B X;  3MK6 A;  2KEB A;  2LHG A;  1IFY A;  3VFD A;  2ZM6 M;  3GLI B;  1ZMW A;  1GJT A;  2CHQ A;  2QCU A;  4FD2 A;  4OW0 A;  4WW0 A;  4L15 A;  4X66 M;  2C98 A;  4WUR A;  3UK6 A;  2RRU A;  3B9P A;  1AIP C;  1VQ1 A;  3BOS A;  2QPA A;  3SHG B;  1QYR A;  3V76 A;  1N75 A;  3GO8 A;  3TL4 X;  3NBX X;  4LF6 M;  4X62 M;  4W5W A;  4DV6 M;  3GRY A;  5EP4 A;  1Q39 A;  3IG8 A;  4AKH A;  3HKP A;  1XMQ M;  4B3S M;  3FTC A;  2I7N A;  4DUZ M;  1W5S A;  4JN6 A;  2LVO C;  3U6E A;  4DR2 M;  1N32 M;  4JYA M;  1IY1 A;  5F3W A;  1G41 A;  1QAQ A;  4PCZ A;  1DGH A;  3B7N A;  3K1J A;  2O25 A;  4LZJ A;  3LCU A;  4D80 A;  1ZAE A;  1Z5B A;  1Z6T A;  1EFU B;  2R44 A;  1Z5C A;  2XLJ A;  3T38 A;  1HNW M;  3TPZ A;  2Z3X A;  4K0K M;  4IJE A;  2XFT A;  1N33 M;  1VDD A;  3CTW B;  1L2D A;  4M0D A;  1IXR C;  1DO2 A;  3M6A A;  2R18 A;  4KHP M;  4MH0 E;  3AL0 C;  5EJC A;  4ITQ A;  1ZMU A;  2FS1 A;  4GH9 A;  3SMS A;  4CIZ A;  4YHH M;  3BBZ A;  1WJ7 A;  3J7A S;  3FUV A;  4GRI A;  1R2Y A;  1IXS B;  4PDG A;  1F4I A;  3W0F A;  3K92 A;  1E32 A;  4AG6 A;  2APL A;  3A98 B;  1L1T A;  4AQY M;  1DGB A;  3KXE C;  4IBI A;  4IBD A;  4JI8 M;  4RKU F;  4S12 A;  3UZU A;  3U60 A;  3GLG E;  1PJT A;  5DFL A;  2X8A A;  1TR8 A;  4BLC A;  2E5L M;  2R46 A;  3DZD A;  3GLH B;  2I7P A;  2KXE A;  4CIS A;  1WGL A;  1D0M A;  2JY6 B;  2Z4S A;  3E21 A;  3KOW E;  5KPR A;  4NXM M;  1OTR A;  1HJP A;  2XSZ D;  2Z4R A;  3HJ8 A;  3NWL A;  2UXD M;  4QHT A;  3KOX E;  5DYG A;  1QZM A;  2OO9 A;  2OPF A;  3U5Z A;  2CHG A;  1OQY A;  3U5Z B;  1FJG M;  2X4A A;  4KO8 A;  3KS8 A;  3AFH A;  1SXJ B;  3FTD A;  3LCV B;  1LTM A;  4MB7 A;  5EXT A;  3PVS A;  3B74 A;  5FTM A;  4D81 A;  2LBC A;  4EIW A;  3TE6 A;  2J7N A;  2CEA A;  1GO5 A;  2XFS A;  2R4J A;  3GLF B;  4CJ6 A;  2B3T A;  2BJV A;  2UXB M;  3H4J A;  2MR9 A;  3HHX A;  2RKO A;  1LV7 A;  2K6B A;  2UUC M;  2H5X A;  1IBK M;  2VF7 A;  3HY5 A;  4LJ6 A;  1PJQ A;  2JA2 A;  3RGS A;  3K9O A;  3LMM A;  3GQ5 A;  4LY6 A;  1YLA A;  2HAK A;  3J27 B;  2QBY A;  2BJW A;  2VF8 A;  3FUX A;  3DA1 A;  2KW0 A;  2DZO B;  3HJQ A;  4HEO A;  3KSX A;  4LJ8 A;  4MGH A;  4M9X A;  4FCW A;  3GP1 A;  1GL7 A;  3GLI E;  4G4R A;  2FFJ A;  4FWG A;  4QOS A; 
#chains in the Genus database with same CATH homology
 2VDB B;  2LHC A;  2FS1 A;  1GJS A;  1GAB A;  2MH8 A;  1PRB A;  1GJT A;  1TF0 B;  2N35 A;  2KDL A;  2J5Y A;  2JWS A;  2LHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...