1PRBA

Structure of an albumin-binding domain, nmr, minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
53
structure length
53
Chain Sequence
TIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN PAB
publication title Solution structure of the albumin-binding GA module: a versatile bacterial protein domain.
pubmed doi rcsb
source organism Finegoldia magna atcc 29328
molecule tags Albumin-binding protein
total genus 12
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1997-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1prbA00
1GJTA 2FS1A 1TF0B 2J5YA 2JWSA 1PRBA 2LHGA 2LHCA 1GJSA 2VDBB 2KDLA 2N35A 1GABA 2MH8A
chains in the Genus database with same CATH superfamily
5FLXS 4S12A 3VDPA 4NXNM 3A98B 2UXDM 3GRVA 3MMPA 1NJFA 1Q02A 4X62M 2KNAA 2LVQD 3KS4A 2KNVA 1R2ZA 1VEGA 4G4NA 1IN4A 3M7GA 3QYBA 4M0WA 5ITYA 5ITQA 4DV5M 1R4GA 4LFBM 2R0IA 3GQ3A 1TH3A 1E94E 1HR0M 1NVMA 4I8OA 1G8PA 1Q39A 1TGUA 2LWXA 4CGYB 4P16A 5ITUA 3HWSA 1LV7A 3W67A 4IJEA 4GMQA 3B7ZA 4B7FA 1T3TA 1OIZA 1GJTA 2YQZA 3OTOM 2X8AA 3HU2A 1N78A 3A45A 4AKGA 4IJFA 2H5XA 1WXQA 4AI6A 2F4VM 4QHTA 2HKJA 1R6BX 2OOAA 2ZBKB 4D81A 1WHCA 3U60A 4JI0M 2JP7A 3HJ8A 1PM5A 2CHQA 2KEBA 4LF8M 4JXJA 3AL0C 5JI2E 4DR7M 5FTMA 4IBIA 4MGZE 4MGKE 4FWHA 3HX3A 4L6V6 1IN8A 4LF9M 4FCWA 2HAKA 3GLIA 4KHPM 4GHLA 4AKHA 2XFSA 1UM8A 2J5YA 1XNRM 4IBBA 3U6CA 1OKSA 3SMPA 1IBLM 2ZAOA 4FCVA 1T43A 2DAIA 2ZM6M 3I51A 4UN2B 1JR3E 2C96A 3FUTA 3ZCBB 1L2CA 1QDTA 1HQYE 4HEOA 1XWIA 3D8BA 3DFZA 3JAMS 4DV0M 2DWLA 4I5SA 3L29A 2XZUA 1KSFX 2KW0A 3ILKA 4NOOB 1CUKA 2C9OA 2EKKA 3FE3A 2OO9A 1ZAEA 2LNHC 2QBYA 3PVSA 3TWMA 3M6AA 1PJQA 4LJAA 2Z4SA 4LY6A 3E21A 3TE6A 4D80A 1SXJB 3I4VA 2FE8A 5A2QS 3C58A 3SARA 1L2DA 4DR4M 2APLA 1PRBA 5KPRA 3HJQA 2V1UA 4B3MM 3I01M 2K47A 1DGGA 3EIEA 3B7QA 5EXPA 1I4WA 2R65A 5IT9S 3U6LA 3NBXX 1G41A 1XXHB 3H4JA 2Y21A 2DHRA 3MJ5A 2RGOA 4M9ZA 3T6PA 1XC8A 3K9PA 2DWMA 4LJ9A 4I4LA 2LHCA 4NSRA 3JR4A 2RGHA 4CISA 4JI7M 2MH8A 3KOWE 1N75A 4JI5M 1HNZM 1QAMA 2HL7A 2JWSA 3CTWB 5E26A 1AIPC 1NY5A 1EFUB 3HU1A 1VDDA 3SAUA 2LVAA 4JV5M 1QQWA 3H4MA 2G8LA 5EXXA 1NNUC 2K9DA 2A5YB 3KP0E 2V1CA 1HQCA 2O5RA 3LMMA 5C18A 2NQ8C 3HGIA 2HWJA 3R8FA 1PJJA 3JR5A 1IM2A 2KNZA 3GLHB 2ZTCA 4IBDA 2M60A 4JI3M 4MB7A 3RGPA 4KO8A 5H37D 2C5RA 5L8RF 4K0KM 2W82A 2LVOC 2D7HA 5EP4A 2UXCM 1OAIA 1DGHB 1JQJC 5BR8M 4KLNA 4JYAM 4KT0F 3ZC7B 4FD2A 3AOGA 4JN6A 2P5TA 2Z7JA 1A5TA 2ZANA 1OJLA 2RRUA 1T6OA 3U61A 4IBFA 4X64M 4AKIA 1IY2A 4PD2A 3KFUG 2WSEF 1S3SA 4LF6M 3GRUA 4PDGA 1Z5BA 2QP9X 2BNKA 4LG2A 4L4UA 2ZTDA 2OPFA 1NJGA 4F2LA 3GPYA 2R18A 1YLAA 3FUUA 1N32M 3B74A 4A3VB 2EJSA 2JZ0A 2R4JA 3KSXA 5EP1A 1IQPA 3VKGA 3Q8GA 4F1IA 1J09A 4G6ZA 1MX0A 3HKPA 2CWBA 4IIWA 1N77A 3DA1A 2F5QA 2L2DA 4R3DA 4MH0E 4XK8F 4AG5A 4PCZA 1C7YA 1NSFA 1IBKM 4G4RA 4WW0A 2RKOA 2ERCA 1XB2B 2Y0TA 5BPVA 4WP2A 3KW6A 1D0MA 3U6SA 1OFIA 2ZAMA 3GRYA 5C1BA 1IY0A 2CUZA 1L1TA 1D2NA 4B08A 2AHMA 3U6MA 1EE8A 4OW0A 5ITXA 1WIVA 2JY7A 4Z8XA 3DOAA 4X66M 4PDIA 4YY3M 3GO8A 5IZ7D 1K82A 3TQSA 4TUWA 1W5SA 3GLFA 5EP2A 3U5ZA 3U60B 2UXBM 4GKKM 1ZMWA 2R4EA 3T38A 3KVWA 3BXWA 1ZMUA 3J2PB 3C3EA 1P3QQ 3IG5A 4AZFA 3E9SA 2L4FA 3GLGA 2YFQA 2DAKA 3GLIB 4NC6A 5EXSA 2CV0A 2X4AA 1L1ZA 4OVZB 1E9SA 2BWBA 2JY8A 1G4AE 2GNOA 5EXTA 1SG9A 1OFHA 1RU3A 2MR9A 1GL6A 4LJ8A 3UZUA 3GPPA 2DWZB 5EQTA 4DUYM 4G4QA 1IBMM 1V34A 2CHGA 2F5PA 4JI1M 3B9PA 3LCVB 1XNQM 3J80S 1DO0A 3K8ZA 3L27A 4OVZA 5GKNA 1GJSA 3VKHA 4LZZA 1IN6A 1NO1A 4LGYA 5EP3A 4RNAA 1IXSA 1K3XA 1VDLA 3M0EA 3J7BA 2R44A 5DYIA 4FWDA 5IREB 2QBYB 4IBEA 2DWNA 4NRVA 2KHHA 2O01F 3R9XB 1D0LA 1ZQ9A 2Q2EB 4QOZC 2JA2A 2M5ZA 1F4IA 2JY5A 2UUCM 4L16A 2QQ8A 1YE9A 1QZEA 3GLHE 4QNMA 3GRRA 2Z8YM 3FUXA 3UK6A 3WHKA 3KS8A 4DR3M 1WGLA 4KODA 3C9PA 1ZV1A 2YNMD 3IECA 4FWGA 1Z59A 4GKJM 4DR6M 2BJWA 4NXMM 4JI2M 1LTMA 1J5EM 1WJ7A 3SHFA 3AOEC 3LVWA 2XZFA 2XFTA 4QHSA 2HHHM 3MK6A 4QOSA 3HY5A 4DBGB 4DV2M 4MGHA 4XBOA 1MN3A 1FNNA 2D7EA 4LRSA 1GVNA 4R71A 2HCBA 2F5NA 3RGSA 3I04M 4LZJA 3PXGA 2C9CA 4LF5M 1HNWM 3LCUA 2CRUA 5EJCA 3KOYE 1YUBA 2XGNA 4RKUF 2K6BA 1XMQM 3KDSE 1OAOC 3LQQA 4II7A 3TWLA 4DR5M 1IN7A 2X49A 2XLJA 4Q7JA 2Y20A 1GO5A 4QNRA 1E32A 4GH9A 2QENA 2XH9A 2B3TA 2VIIA 4HLQA 1JR3D 2CE7A 3ZH9B 4IBGA 3VK7A 1PJTA 3THGA 3W0FA 3F92A 4LF4M 3BOSA 4X65M 2K0BX 5FTKA 4B3SM 2DAMA 3ZQJA 3U61B 1QANA 3SYKA 1WR1B 4L78A 3GQ5A 1J7KA 1QVRA 2R46A 3HZJA 5KQ8A 3UGJA 1VG5A 5FTLA 3U6QA 4DR1M 4IBCA 2JUJA 1GLNA 4CIZA 1DGBA 2JZ1A 3TPZA 2V6ZM 4YHHM 2UUBM 2MGWA 5LMUM 4MM3B 2DHYA 2LBCA 3HHWA 3RE8A 2QNJA 2DAEA 1HNXM 1L8QA 3B89A 5DYGA 4OX9M 4FCTA 1KFVA 1JR3A 1TR8A 3SC3A 2DKLA 2C99A 3GLIE 1XHBA 4DV3M 3J27B 4B7HA 4OU7A 1G3IA 4G4OA 2L4EA 4FVMA 4LGMA 2C98A 2QZ4A 2G5GX 4B3TM 3KOXE 1NV9A 3L2AA 1L2BA 2BWEA 3E4RA 1TDZA 3GPUA 1XMOM 3CF0A 2VQEM 1BVSA 1VEJA 2DNAA 3WHLA 3SAWA 2VQFM 2CV1A 2JNHA 1N34M 4LJ5A 1D0KA 4MGIE 1KYIA 5LMNM 4JI6M 4B3RM 1Z5CA 3GLFB 3U5ZB 4IBJA 4M9XA 2DZNB 1SXJC 3I4YA 2KZSA 2XSZA 3LQRA 3A46A 2VF8A 1MJGM 3AOEA 3U6PA 2H1RA 3K92A 4GEWA 4ITQA 4GITA 3T1YM 1IXZA 3KXEC 4ZPXA 2DXIA 1QAOA 1C1KA 1PGYA 1SXJE 2Z4RA 2I7NA 3BBZA 4XGIA 5KQDA 5ITRA 2WSFF 3GP1A 4BBAA 3GLGB 2KDLA 3PFIA 4AQYM 1VQ1A 2L7IA 1V33A 3IG8A 3K1JA 2CFOA 4M9SA 2Y0QA 2FFJA 4GHAA 3HJSA 1QDRA 1YSYA 1N36M 2VF7A 4DV4M 5E6JA 4EIWA 2L09A 4B7GA 1TDHA 5ITTA 2D7GA 3QAUA 4P17A 1G59A 1QZMA 3QYEA 2DVWB 4CHTB 3AJIB 3SMSA 4BB9A 3SASA 1XXHE 1Z6TA 4LCBA 1Z5AA 1TF0B 4Z6YA 1IXSB 8CATA 5JI3E 4LJ4A 3GQ4A 1DGFA 5KPTA 1V92A 2JY6B 1NNJA 2WSCF 3HU3A 3E46A 1QYRA 2QPAA 5KPZA 1WGNA 1FJGM 1OIPA 3L25A 2GQFA 5KO3A 1G71A 1Q3BA 3LW5F 5DNYA 2QHOB 2YR0A 2CV2A 3D8LA 3FRHA 5FSWA 2L6OA 1NHGC 3AKZA 2R45A 7CATA 4NRWA 2QSFX 3SHGB 4RF1A 1DO2A 1IY1A 4DR2M 3UMMA 1GL7A 1UFZA 2FS1A 3FUWA 4AG6A 4D82A 2EA0A 2J7OA 2LH0A 1SXJD 1I94M 1AUAA 1QUSA 1MU5A 3FRIA 4AW4A 3U6DA 1NHWC 1VEKA 3TWKA 4PT5A 2LHGA 3SAVA 1K3WA 3FUVA 4LFCM 3KSJA 4LJ6A 2FOIC 3GPXA 1E9RA 2LVPC 1R7RA 2R62A 3AV0A 2UUAM 2MJ5B 3PNVA 1EIJA 3U6EA 3FTCA 3T15A 4M0DA 3FTDA 4BLCA 1QAQA 1N33M 4REZA 2OQ4A 1PJIA 2BJVA 1TTEA 1PJSA 2KXEA 2CP8A 3FD9A 4G3OA 4GC9A 3VFDA 2CHVA 3HHXA 3V76A 2O25A 1HT2E 2UU9M 1SXJA 3AFHA 4ANRA 2EKFA 3FTFA 2VDBB 3W68A 4LF7M 2DI0A 3K9OA 2XF3A 3PNYA 3J7AS 4RF0A 3FTEA 4HL4A 5ITXE 1TH2A 1Y8GA 2KRKA 3FKEA 2LVNC 3KOZE 4GIPA 1Q3CA 3EIHA 2DZOB 4MGYE 3GLFE 2KZUA 5FTNA 3HHZA 3VDUA 2DAGA 2EUCA 2MROB 3NWLA 4CJ6A 1NY6A 4LRTA 5IWAM 2WZJA 1XXHA 1R2YA 4GRIA 3Q8XA 3CF2A 3NBIA 4LJ7A 2QCUA 4IBKA 3GLGE 2F5SA 4LFAM 1IN5A 3L26A 2LTUA 4FW9A 3J81S 1NV8A 5DFLA 1ZMVA 1ORYB 4NSOB 1R5LA 1W5TA 2JXNA 2G3QA 1QUTA 1JB0F 2KRUA 4DV1M 4WURA 3C3DA 4DUZM 3T1HM 2CEAA 3TL4X 1GABA 4JI4M 2XEPA 4DV6M 3L28A 4R7GA 2XSZD 4I81A 3LVVA 2L7HA 1X37A 3GLHA 3FYDA 3IHPA 3HHYA 3CF6E 3SYLA 3RFWA 3QWLA 2F5OA 2OOBA 4DV7M 5F3WA 1DGHA 1HJPA 1H6UA 2LXEA 2FNAA 2I7PA 2KA6B 3CGWA 3W0LB 1OTRA 1IXRC 2E5LM 3VLFB 4Y28F 5FTJA 2EO2A 3B7NA 3K2LA 1DV0A 4L8RC 4NL4H 2DENA 3U6OA 2J7NA 1OQYA 4L15A 2Z3XA 1HT1E 3DZDA 3A42A 3FYCA 3SATA 4JI8M 2N35A 3SFZA 1TH4A 2DZLA 1IFYA 3SBJA 1GKIA 4GC5A 3UJNA 2R6FA 3VK8A 2FH0A 3KP1E 4W5WA 3MHVC
chains in the Genus database with same CATH topology
1GJTA 2FS1A 1TF0B 2J5YA 2JWSA 1PRBA 2LHGA 2LHCA 1GJSA 2VDBB 2KDLA 2N35A 1GABA 2MH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJT A;  2FS1 A;  1TF0 B;  2J5Y A;  2JWS A;  1PRB A;  2LHG A;  2LHC A;  1GJS A;  2VDB B;  2KDL A;  2N35 A;  1GAB A;  2MH8 A; 
#chains in the Genus database with same CATH topology
 5FLX S;  4S12 A;  3VDP A;  4NXN M;  3A98 B;  2UXD M;  3GRV A;  3MMP A;  1NJF A;  1Q02 A;  4X62 M;  2KNA A;  2LVQ D;  3KS4 A;  2KNV A;  1R2Z A;  1VEG A;  4G4N A;  1IN4 A;  3M7G A;  3QYB A;  4M0W A;  5ITY A;  5ITQ A;  4DV5 M;  1R4G A;  4LFB M;  2R0I A;  3GQ3 A;  1TH3 A;  1E94 E;  1HR0 M;  1NVM A;  4I8O A;  1G8P A;  1Q39 A;  1TGU A;  2LWX A;  4CGY B;  4P16 A;  5ITU A;  3HWS A;  1LV7 A;  3W67 A;  4IJE A;  4GMQ A;  3B7Z A;  4B7F A;  1T3T A;  1OIZ A;  1GJT A;  2YQZ A;  3OTO M;  2X8A A;  3HU2 A;  1N78 A;  3A45 A;  4AKG A;  4IJF A;  2H5X A;  1WXQ A;  4AI6 A;  2F4V M;  4QHT A;  2HKJ A;  1R6B X;  2OOA A;  2ZBK B;  4D81 A;  1WHC A;  3U60 A;  4JI0 M;  2JP7 A;  3HJ8 A;  1PM5 A;  2CHQ A;  2KEB A;  4LF8 M;  4JXJ A;  3AL0 C;  5JI2 E;  4DR7 M;  5FTM A;  4IBI A;  4MGZ E;  4MGK E;  4FWH A;  3HX3 A;  4L6V 6;  1IN8 A;  4LF9 M;  4FCW A;  2HAK A;  3GLI A;  4KHP M;  4GHL A;  4AKH A;  2XFS A;  1UM8 A;  2J5Y A;  1XNR M;  4IBB A;  3U6C A;  1OKS A;  3SMP A;  1IBL M;  2ZAO A;  4FCV A;  1T43 A;  2DAI A;  2ZM6 M;  3I51 A;  4UN2 B;  1JR3 E;  2C96 A;  3FUT A;  3ZCB B;  1L2C A;  1QDT A;  1HQY E;  4HEO A;  1XWI A;  3D8B A;  3DFZ A;  3JAM S;  4DV0 M;  2DWL A;  4I5S A;  3L29 A;  2XZU A;  1KSF X;  2KW0 A;  3ILK A;  4NOO B;  1CUK A;  2C9O A;  2EKK A;  3FE3 A;  2OO9 A;  1ZAE A;  2LNH C;  2QBY A;  3PVS A;  3TWM A;  3M6A A;  1PJQ A;  4LJA A;  2Z4S A;  4LY6 A;  3E21 A;  3TE6 A;  4D80 A;  1SXJ B;  3I4V A;  2FE8 A;  5A2Q S;  3C58 A;  3SAR A;  1L2D A;  4DR4 M;  2APL A;  1PRB A;  5KPR A;  3HJQ A;  2V1U A;  4B3M M;  3I01 M;  2K47 A;  1DGG A;  3EIE A;  3B7Q A;  5EXP A;  1I4W A;  2R65 A;  5IT9 S;  3U6L A;  3NBX X;  1G41 A;  1XXH B;  3H4J A;  2Y21 A;  2DHR A;  3MJ5 A;  2RGO A;  4M9Z A;  3T6P A;  1XC8 A;  3K9P A;  2DWM A;  4LJ9 A;  4I4L A;  2LHC A;  4NSR A;  3JR4 A;  2RGH A;  4CIS A;  4JI7 M;  2MH8 A;  3KOW E;  1N75 A;  4JI5 M;  1HNZ M;  1QAM A;  2HL7 A;  2JWS A;  3CTW B;  5E26 A;  1AIP C;  1NY5 A;  1EFU B;  3HU1 A;  1VDD A;  3SAU A;  2LVA A;  4JV5 M;  1QQW A;  3H4M A;  2G8L A;  5EXX A;  1NNU C;  2K9D A;  2A5Y B;  3KP0 E;  2V1C A;  1HQC A;  2O5R A;  3LMM A;  5C18 A;  2NQ8 C;  3HGI A;  2HWJ A;  3R8F A;  1PJJ A;  3JR5 A;  1IM2 A;  2KNZ A;  3GLH B;  2ZTC A;  4IBD A;  2M60 A;  4JI3 M;  4MB7 A;  3RGP A;  4KO8 A;  5H37 D;  2C5R A;  5L8R F;  4K0K M;  2W82 A;  2LVO C;  2D7H A;  5EP4 A;  2UXC M;  1OAI A;  1DGH B;  1JQJ C;  5BR8 M;  4KLN A;  4JYA M;  4KT0 F;  3ZC7 B;  4FD2 A;  3AOG A;  4JN6 A;  2P5T A;  2Z7J A;  1A5T A;  2ZAN A;  1OJL A;  2RRU A;  1T6O A;  3U61 A;  4IBF A;  4X64 M;  4AKI A;  1IY2 A;  4PD2 A;  3KFU G;  2WSE F;  1S3S A;  4LF6 M;  3GRU A;  4PDG A;  1Z5B A;  2QP9 X;  2BNK A;  4LG2 A;  4L4U A;  2ZTD A;  2OPF A;  1NJG A;  4F2L A;  3GPY A;  2R18 A;  1YLA A;  3FUU A;  1N32 M;  3B74 A;  4A3V B;  2EJS A;  2JZ0 A;  2R4J A;  3KSX A;  5EP1 A;  1IQP A;  3VKG A;  3Q8G A;  4F1I A;  1J09 A;  4G6Z A;  1MX0 A;  3HKP A;  2CWB A;  4IIW A;  1N77 A;  3DA1 A;  2F5Q A;  2L2D A;  4R3D A;  4MH0 E;  4XK8 F;  4AG5 A;  4PCZ A;  1C7Y A;  1NSF A;  1IBK M;  4G4R A;  4WW0 A;  2RKO A;  2ERC A;  1XB2 B;  2Y0T A;  5BPV A;  4WP2 A;  3KW6 A;  1D0M A;  3U6S A;  1OFI A;  2ZAM A;  3GRY A;  5C1B A;  1IY0 A;  2CUZ A;  1L1T A;  1D2N A;  4B08 A;  2AHM A;  3U6M A;  1EE8 A;  4OW0 A;  5ITX A;  1WIV A;  2JY7 A;  4Z8X A;  3DOA A;  4X66 M;  4PDI A;  4YY3 M;  3GO8 A;  5IZ7 D;  1K82 A;  3TQS A;  4TUW A;  1W5S A;  3GLF A;  5EP2 A;  3U5Z A;  3U60 B;  2UXB M;  4GKK M;  1ZMW A;  2R4E A;  3T38 A;  3KVW A;  3BXW A;  1ZMU A;  3J2P B;  3C3E A;  1P3Q Q;  3IG5 A;  4AZF A;  3E9S A;  2L4F A;  3GLG A;  2YFQ A;  2DAK A;  3GLI B;  4NC6 A;  5EXS A;  2CV0 A;  2X4A A;  1L1Z A;  4OVZ B;  1E9S A;  2BWB A;  2JY8 A;  1G4A E;  2GNO A;  5EXT A;  1SG9 A;  1OFH A;  1RU3 A;  2MR9 A;  1GL6 A;  4LJ8 A;  3UZU A;  3GPP A;  2DWZ B;  5EQT A;  4DUY M;  4G4Q A;  1IBM M;  1V34 A;  2CHG A;  2F5P A;  4JI1 M;  3B9P A;  3LCV B;  1XNQ M;  3J80 S;  1DO0 A;  3K8Z A;  3L27 A;  4OVZ A;  5GKN A;  1GJS A;  3VKH A;  4LZZ A;  1IN6 A;  1NO1 A;  4LGY A;  5EP3 A;  4RNA A;  1IXS A;  1K3X A;  1VDL A;  3M0E A;  3J7B A;  2R44 A;  5DYI A;  4FWD A;  5IRE B;  2QBY B;  4IBE A;  2DWN A;  4NRV A;  2KHH A;  2O01 F;  3R9X B;  1D0L A;  1ZQ9 A;  2Q2E B;  4QOZ C;  2JA2 A;  2M5Z A;  1F4I A;  2JY5 A;  2UUC M;  4L16 A;  2QQ8 A;  1YE9 A;  1QZE A;  3GLH E;  4QNM A;  3GRR A;  2Z8Y M;  3FUX A;  3UK6 A;  3WHK A;  3KS8 A;  4DR3 M;  1WGL A;  4KOD A;  3C9P A;  1ZV1 A;  2YNM D;  3IEC A;  4FWG A;  1Z59 A;  4GKJ M;  4DR6 M;  2BJW A;  4NXM M;  4JI2 M;  1LTM A;  1J5E M;  1WJ7 A;  3SHF A;  3AOE C;  3LVW A;  2XZF A;  2XFT A;  4QHS A;  2HHH M;  3MK6 A;  4QOS A;  3HY5 A;  4DBG B;  4DV2 M;  4MGH A;  4XBO A;  1MN3 A;  1FNN A;  2D7E A;  4LRS A;  1GVN A;  4R71 A;  2HCB A;  2F5N A;  3RGS A;  3I04 M;  4LZJ A;  3PXG A;  2C9C A;  4LF5 M;  1HNW M;  3LCU A;  2CRU A;  5EJC A;  3KOY E;  1YUB A;  2XGN A;  4RKU F;  2K6B A;  1XMQ M;  3KDS E;  1OAO C;  3LQQ A;  4II7 A;  3TWL A;  4DR5 M;  1IN7 A;  2X49 A;  2XLJ A;  4Q7J A;  2Y20 A;  1GO5 A;  4QNR A;  1E32 A;  4GH9 A;  2QEN A;  2XH9 A;  2B3T A;  2VII A;  4HLQ A;  1JR3 D;  2CE7 A;  3ZH9 B;  4IBG A;  3VK7 A;  1PJT A;  3THG A;  3W0F A;  3F92 A;  4LF4 M;  3BOS A;  4X65 M;  2K0B X;  5FTK A;  4B3S M;  2DAM A;  3ZQJ A;  3U61 B;  1QAN A;  3SYK A;  1WR1 B;  4L78 A;  3GQ5 A;  1J7K A;  1QVR A;  2R46 A;  3HZJ A;  5KQ8 A;  3UGJ A;  1VG5 A;  5FTL A;  3U6Q A;  4DR1 M;  4IBC A;  2JUJ A;  1GLN A;  4CIZ A;  1DGB A;  2JZ1 A;  3TPZ A;  2V6Z M;  4YHH M;  2UUB M;  2MGW A;  5LMU M;  4MM3 B;  2DHY A;  2LBC A;  3HHW A;  3RE8 A;  2QNJ A;  2DAE A;  1HNX M;  1L8Q A;  3B89 A;  5DYG A;  4OX9 M;  4FCT A;  1KFV A;  1JR3 A;  1TR8 A;  3SC3 A;  2DKL A;  2C99 A;  3GLI E;  1XHB A;  4DV3 M;  3J27 B;  4B7H A;  4OU7 A;  1G3I A;  4G4O A;  2L4E A;  4FVM A;  4LGM A;  2C98 A;  2QZ4 A;  2G5G X;  4B3T M;  3KOX E;  1NV9 A;  3L2A A;  1L2B A;  2BWE A;  3E4R A;  1TDZ A;  3GPU A;  1XMO M;  3CF0 A;  2VQE M;  1BVS A;  1VEJ A;  2DNA A;  3WHL A;  3SAW A;  2VQF M;  2CV1 A;  2JNH A;  1N34 M;  4LJ5 A;  1D0K A;  4MGI E;  1KYI A;  5LMN M;  4JI6 M;  4B3R M;  1Z5C A;  3GLF B;  3U5Z B;  4IBJ A;  4M9X A;  2DZN B;  1SXJ C;  3I4Y A;  2KZS A;  2XSZ A;  3LQR A;  3A46 A;  2VF8 A;  1MJG M;  3AOE A;  3U6P A;  2H1R A;  3K92 A;  4GEW A;  4ITQ A;  4GIT A;  3T1Y M;  1IXZ A;  3KXE C;  4ZPX A;  2DXI A;  1QAO A;  1C1K A;  1PGY A;  1SXJ E;  2Z4R A;  2I7N A;  3BBZ A;  4XGI A;  5KQD A;  5ITR A;  2WSF F;  3GP1 A;  4BBA A;  3GLG B;  2KDL A;  3PFI A;  4AQY M;  1VQ1 A;  2L7I A;  1V33 A;  3IG8 A;  3K1J A;  2CFO A;  4M9S A;  2Y0Q A;  2FFJ A;  4GHA A;  3HJS A;  1QDR A;  1YSY A;  1N36 M;  2VF7 A;  4DV4 M;  5E6J A;  4EIW A;  2L09 A;  4B7G A;  1TDH A;  5ITT A;  2D7G A;  3QAU A;  4P17 A;  1G59 A;  1QZM A;  3QYE A;  2DVW B;  4CHT B;  3AJI B;  3SMS A;  4BB9 A;  3SAS A;  1XXH E;  1Z6T A;  4LCB A;  1Z5A A;  1TF0 B;  4Z6Y A;  1IXS B;  8CAT A;  5JI3 E;  4LJ4 A;  3GQ4 A;  1DGF A;  5KPT A;  1V92 A;  2JY6 B;  1NNJ A;  2WSC F;  3HU3 A;  3E46 A;  1QYR A;  2QPA A;  5KPZ A;  1WGN A;  1FJG M;  1OIP A;  3L25 A;  2GQF A;  5KO3 A;  1G71 A;  1Q3B A;  3LW5 F;  5DNY A;  2QHO B;  2YR0 A;  2CV2 A;  3D8L A;  3FRH A;  5FSW A;  2L6O A;  1NHG C;  3AKZ A;  2R45 A;  7CAT A;  4NRW A;  2QSF X;  3SHG B;  4RF1 A;  1DO2 A;  1IY1 A;  4DR2 M;  3UMM A;  1GL7 A;  1UFZ A;  2FS1 A;  3FUW A;  4AG6 A;  4D82 A;  2EA0 A;  2J7O A;  2LH0 A;  1SXJ D;  1I94 M;  1AUA A;  1QUS A;  1MU5 A;  3FRI A;  4AW4 A;  3U6D A;  1NHW C;  1VEK A;  3TWK A;  4PT5 A;  2LHG A;  3SAV A;  1K3W A;  3FUV A;  4LFC M;  3KSJ A;  4LJ6 A;  2FOI C;  3GPX A;  1E9R A;  2LVP C;  1R7R A;  2R62 A;  3AV0 A;  2UUA M;  2MJ5 B;  3PNV A;  1EIJ A;  3U6E A;  3FTC A;  3T15 A;  4M0D A;  3FTD A;  4BLC A;  1QAQ A;  1N33 M;  4REZ A;  2OQ4 A;  1PJI A;  2BJV A;  1TTE A;  1PJS A;  2KXE A;  2CP8 A;  3FD9 A;  4G3O A;  4GC9 A;  3VFD A;  2CHV A;  3HHX A;  3V76 A;  2O25 A;  1HT2 E;  2UU9 M;  1SXJ A;  3AFH A;  4ANR A;  2EKF A;  3FTF A;  2VDB B;  3W68 A;  4LF7 M;  2DI0 A;  3K9O A;  2XF3 A;  3PNY A;  3J7A S;  4RF0 A;  3FTE A;  4HL4 A;  5ITX E;  1TH2 A;  1Y8G A;  2KRK A;  3FKE A;  2LVN C;  3KOZ E;  4GIP A;  1Q3C A;  3EIH A;  2DZO B;  4MGY E;  3GLF E;  2KZU A;  5FTN A;  3HHZ A;  3VDU A;  2DAG A;  2EUC A;  2MRO B;  3NWL A;  4CJ6 A;  1NY6 A;  4LRT A;  5IWA M;  2WZJ A;  1XXH A;  1R2Y A;  4GRI A;  3Q8X A;  3CF2 A;  3NBI A;  4LJ7 A;  2QCU A;  4IBK A;  3GLG E;  2F5S A;  4LFA M;  1IN5 A;  3L26 A;  2LTU A;  4FW9 A;  3J81 S;  1NV8 A;  5DFL A;  1ZMV A;  1ORY B;  4NSO B;  1R5L A;  1W5T A;  2JXN A;  2G3Q A;  1QUT A;  1JB0 F;  2KRU A;  4DV1 M;  4WUR A;  3C3D A;  4DUZ M;  3T1H M;  2CEA A;  3TL4 X;  1GAB A;  4JI4 M;  2XEP A;  4DV6 M;  3L28 A;  4R7G A;  2XSZ D;  4I81 A;  3LVV A;  2L7H A;  1X37 A;  3GLH A;  3FYD A;  3IHP A;  3HHY A;  3CF6 E;  3SYL A;  3RFW A;  3QWL A;  2F5O A;  2OOB A;  4DV7 M;  5F3W A;  1DGH A;  1HJP A;  1H6U A;  2LXE A;  2FNA A;  2I7P A;  2KA6 B;  3CGW A;  3W0L B;  1OTR A;  1IXR C;  2E5L M;  3VLF B;  4Y28 F;  5FTJ A;  2EO2 A;  3B7N A;  3K2L A;  1DV0 A;  4L8R C;  4NL4 H;  2DEN A;  3U6O A;  2J7N A;  1OQY A;  4L15 A;  2Z3X A;  1HT1 E;  3DZD A;  3A42 A;  3FYC A;  3SAT A;  4JI8 M;  2N35 A;  3SFZ A;  1TH4 A;  2DZL A;  1IFY A;  3SBJ A;  1GKI A;  4GC5 A;  3UJN A;  2R6F A;  3VK8 A;  2FH0 A;  3KP1 E;  4W5W A;  3MHV C; 
#chains in the Genus database with same CATH homology
 1GJT A;  2FS1 A;  1TF0 B;  2J5Y A;  2JWS A;  1PRB A;  2LHG A;  2LHC A;  1GJS A;  2VDB B;  2KDL A;  2N35 A;  1GAB A;  2MH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...