1PRBA

Structure of an albumin-binding domain, nmr, minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
53
structure length
53
Chain Sequence
TIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN PAB
publication title Solution structure of the albumin-binding GA module: a versatile bacterial protein domain.
pubmed doi rcsb
source organism Finegoldia magna atcc 29328
molecule tags Albumin-binding protein
total genus 12
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1997-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1prbA00
1GJSA 2JWSA 1PRBA 1GJTA 2LHCA 2MH8A 1GABA 2FS1A 2N35A 2VDBB 1TF0B 2KDLA 2LHGA 2J5YA
chains in the Genus database with same CATH superfamily
3SBJA 1GABA 3HY5A 1TDHA 2YNMD 4LG2A 3U60A 1K3WA 2JP7A 1TH4A 5KPTA 2F5NA 4I8OA 3KOZE 2C9CA 2K9DA 4MM3B 2R4EA 3LVVA 1VG5A 3KSJA 3M0EA 4X65M 2CFOA 3IG8A 3LMMA 5FTKA 2ZM6M 3HU1A 2OPFA 1N34M 1IBLM 4NSRA 3JAMS 5FSWA 4JI1M 3C58A 3F92A 2R65A 4G3OA 4KT0F 1Y8GA 4FCTA 2YFQA 2Z4SA 3GLHA 2ZANA 3B74A 3KXEC 2Q2EB 3R9XB 3E46A 1IM2A 3EIHA 5ITXE 4I5SA 2EKKA 5EXXA 2EKFA 4GH9A 5L8RF 1N77A 2RKOA 4G6ZA 2YR0A 3U6PA 4GHLA 3A98B 3B7ZA 3WHLA 4QNMA 3GLIB 2FOIC 2K47A 3GLFA 3B9PA 2CWBA 2FNAA 4KODA 1QAQA 1XXHE 4FVMA 3RGSA 3SYKA 1G8PA 1KYIA 2BNKA 5ITTA 2Y0TA 1ZAEA 2V1CA 4GKJM 3GQ5A 1TR8A 2YQZA 2HHHM 2UXBM 3TQSA 1LV7A 4NC6A 2H5XA 4FWGA 1NV8A 5KQDA 1VEKA 3IHPA 1XMQM 5E26A 2LVNC 3I4VA 1NSFA 5EP3A 1Z5CA 4QNRA 4LFCM 4FD2A 3GLGE 2EO2A 1GKIA 3CF2A 3SMPA 1ZV1A 3KDSE 5KO3A 1Z6TA 1JR3E 3J81S 2DAIA 1MJGM 1IQPA 2RGHA 4IJFA 4NSOB 3VFDA 1JB0F 5ITUA 5LMNM 4G4OA 3T15A 2RGOA 4I4LA 5ITRA 4QOSA 1QVRA 3T1YM 1D0MA 1Z5AA 4LCBA 1NNUC 2HL7A 2JXNA 1HQCA 3FRIA 4L16A 2DXIA 2CE7A 2QQ8A 5FTLA 4GEWA 4OX9M 1SXJA 3U6DA 1HNZM 2MJ5B 2O5RA 4LJAA 2KRUA 4XBOA 1G3IA 1IN4A 2HKJA 4NXMM 2K0BX 1PRBA 3TWLA 3HU3A 1F4IA 3K9OA 4L8RC 3W0FA 5ITQA 3U61B 3HGIA 2L4EA 3C3DA 1W5TA 2DZOB 4LFAM 1XNQM 1V33A 2G8LA 2B3TA 2R4JA 3FRHA 2EUCA 1UFZA 4LF8M 2ERCA 4REZA 2XGNA 3SHFA 1GL7A 1ZMUA 3MJ5A 2DNAA 4W5WA 3PVSA 4LY6A 4OVZA 4JI6M 1PJTA 1N75A 3Q8XA 3ZCBB 4KO8A 2RRUA 3AJIB 3GLHE 1QQWA 2Y20A 4NXNM 3GP1A 4OU7A 1K3XA 2EJSA 2QBYB 1JR3A 2VQFM 2OO9A 1ZQ9A 4NRVA 3KS8A 4QHTA 1HT1E 1IN6A 1WGNA 3KVWA 4GRIA 3ZQJA 3GLFE 4KHPM 4WP2A 4K0KM 2CHGA 2LH0A 4CISA 2APLA 1IFYA 2FE8A 3UJNA 3K92A 2XFTA 1L1TA 3SATA 1XNRM 3DA1A 1R2ZA 1N32M 4LFBM 4FW9A 2C99A 1IN5A 4CGYB 3HJQA 3LVWA 3DZDA 3Q8GA 2DWZB 3KOYE 4R7GA 3H4MA 4UN2B 1J5EM 3FUVA 4IBDA 4Y28F 2LNHC 1SXJC 2C9OA 4HEOA 1OFHA 4M9ZA 4MGHA 5EQTA 1NY5A 3GLIA 3H4JA 2XEPA 1J09A 4LGYA 1WGLA 5FTNA 2DAEA 1PM5A 5BPVA 2L7HA 4LF7M 1ORYB 3SARA 2AHMA 2Z7JA 3CF6E 4M0WA 3OTOM 5IT9S 2QCUA 1RU3A 1IXSB 1TF0B 3FTDA 3HWSA 3GQ3A 1N33M 3B7NA 3HJSA 3BBZA 4Q7JA 4AKGA 1OTRA 4XK8F 1DV0A 1Q02A 2WSFF 3T6PA 2D7EA 2CUZA 5EP1A 2X49A 3E4RA 4IBCA 3T1HM 4GC9A 3HHZA 4IIWA 1SXJE 3GO8A 2R46A 2OQ4A 2UXCM 3V76A 1Z59A 4LRTA 2J7NA 5FLXS 4DV4M 4LZZA 1TGUA 3KOWE 2UUAM 2FS1A 3VKHA 2CEAA 4JI2M 1PJJA 4R3DA 3R8FA 1MX0A 1T43A 1QDRA 3A46A 2LTUA 4AZFA 2JWSA 4D81A 2FFJA 4DV3M 1GJSA 3QYBA 4GITA 4Z8XA 4P16A 2F5OA 4JI3M 3TWKA 1Q3BA 2XLJA 2O01F 2R18A 3L25A 2LVQD 4CIZA 3TWMA 5H37D 2KNVA 3C9PA 4MB7A 3GPPA 1I94M 4GKKM 2LXEA 3BXWA 1DGHB 3QAUA 4B7GA 1IBKM 1R7RA 2QENA 1DGFA 4CHTB 1IY0A 4L6V6 4LF5M 1QAMA 1DGGA 4BBAA 4G4RA 3M6AA 1L8QA 3CGWA 2Y21A 1D0LA 3GPXA 4JI0M 4BB9A 1YLAA 2WSCF 3U61A 4NRWA 1N78A 2H1RA 1HJPA 2BWBA 3UK6A 1NV9A 1R4GA 5FTJA 3VLFB 3L28A 4PT5A 4D80A 3D8BA 3SMSA 1E9SA 3FUTA 3HHYA 2D7HA 3FE3A 3SAVA 3GPYA 4DV1M 1NNJA 4DV7M 1OIZA 4II7A 4IJEA 3L29A 3NBXX 4B7FA 3U6CA 3AOEA 2QP9X 1OJLA 2ZBKB 4GMQA 4KLNA 1IN8A 1IXRC 2KDLA 2XF3A 1G41A 1R6BX 1TTEA 2KXEA 2QBYA 4YHHM 1E94E 2LBCA 1N36M 2BJWA 2JY8A 3LQQA 2LHGA 2E5LM 3NBIA 1G4AE 2J5YA 1PJQA 2LVAA 3FYDA 2KEBA 3GRUA 2LHCA 5KPRA 3ZH9B 4YY3M 4DUYM 2DAGA 2BJVA 1NY6A 1PGYA 3J27B 4CJ6A 3W0LB 2MGWA 5E6JA 3GLIE 1NJGA 2R0IA 3VK7A 2C96A 5C18A 1GJTA 2P5TA 1CUKA 3IECA 1QUSA 2XFSA 3ILKA 2F4VM 2UU9M 1IN7A 4DR5M 1J7KA 1VQ1A 2MR9A 3VDUA 3I01M 3HU2A 2XZFA 3I4YA 1WIVA 2ZTDA 4LGMA 1VDDA 8CATA 5DNYA 2EA0A 4WURA 3U5ZA 4B3RM 4RF1A 2QPAA 4DR3M 1XC8A 1EFUB 1OAIA 1Z5BA 2FH0A 1WXQA 2CV2A 4AW4A 4RKUF 4PD2A 3K8ZA 2CHVA 1DO0A 1V92A 2XSZD 4GIPA 5DFLA 3RGPA 2M5ZA 3U6MA 1TH3A 3J2PB 2GQFA 4FWDA 4IBKA 4IBIA 2LWXA 3E21A 5DYGA 2X4AA 3UZUA 3SASA 4JI4M 2DAMA 3LW5F 2DI0A 3L26A 2VDBB 1OAOC 2ZAMA 3M7GA 2ZAOA 1MU5A 1WR1B 4TUWA 3KSXA 2VIIA 5BR8M 3HKPA 3U6SA 3I51A 1WJ7A 2QZ4A 5EJCA 2KA6B 4L15A 3AOEC 4DR1M 2DHRA 4DV5M 3GRYA 4OW0A 2DWLA 3T38A 1NJFA 4FWHA 7CATA 3VK8A 2GNOA 1FNNA 4IBJA 3GRVA 4ANRA 1ZMWA 3D8LA 4LJ9A 1Q3CA 1V34A 4GC5A 4DR2M 3J7AS 2F5SA 1XXHB 2XH9A 1W5SA 3SHGB 1VEJA 2W82A 3AOGA 4I81A 4MGZE 1JQJC 3IG5A 4LJ5A 4F1IA 4R71A 2ZTCA 3QWLA 4IBBA 4IBGA 4LF4M 2DWNA 4DR6M 2JY7A 2QHOB 2R6FA 1DGHA 4D82A 2Y0QA 4MGKE 5IZ7D 4JI5M 5EXSA 2F5PA 3KP0E 1TDZA 1UM8A 1C1KA 3PNVA 1GO5A 4AG6A 3QYEA 5A2QS 1K82A 3KW6A 4WW0A 2DWMA 4JV5M 3LQRA 5C1BA 3SFZA 2QSFX 3HHWA 4JI8M 1HNWM 3GLGB 2KRKA 2XSZA 1QYRA 1AIPC 3J80S 1X37A 2C98A 2KHHA 5IREB 1XMOM 1L2CA 2N35A 4LF9M 1T6OA 2Z8YM 3FYCA 1WHCA 2JY5A 4L4UA 3B89A 3UMMA 2F5QA 2X8AA 4DV2M 2D7GA 2JA2A 3L2AA 4A3VB 2Z4RA 2Z3XA 1Q39A 2V6ZM 3AV0A 3SYLA 3DFZA 3DOAA 3VKGA 1QUTA 3KS4A 2HAKA 3TPZA 1OFIA 1HNXM 1OIPA 3FD9A 4DV6M 1DGBA 1QAOA 5ITYA 5EP4A 1SXJD 2DHYA 4MGYE 4RF0A 1GLNA 4LJ4A 3SAWA 1OQYA 2JY6B 4LF6M 1H6UA 2UXDM 3J7BA 2L7IA 2OOAA 3B7QA 3TL4X 1G71A 1QANA 1IY1A 2A5YB 2CHQA 4XGIA 1R2YA 1T3TA 1KFVA 1HT2E 3RE8A 2XZUA 2L6OA 4JXJA 4B3TM 3HJ8A 3U60B 1DO2A 5EXTA 3L27A 3AKZA 4LJ7A 4G4NA 3LCVB 4IBFA 3PXGA 3GQ4A 4M9SA 3FUUA 1OKSA 1D2NA 3K9PA 4G4QA 2MH8A 1L1ZA 4EIWA 3KOXE 3AFHA 1IBMM 4PDGA 1AUAA 2LVPC 3KP1E 3C3EA 3FTCA 2OOBA 3UGJA 3BOSA 3GLHB 2I7NA 2NQ8C 3U6EA 1NHWC 3K2LA 3U6OA 1VDLA 4LZJA 4PDIA 2UUBM 2DKLA 1YUBA 4NOOB 2J7OA 2VF7A 4X62M 1E32A 1JR3D 4MGIE 4AG5A 2KZSA 1G59A 1C7YA 4ZPXA 2CV1A 4X66M 1PJSA 5EXPA 3NWLA 3GLFB 2L4FA 1HR0M 2DENA 4QHSA 2BWEA 3W67A 2KNAA 4AKHA 2HCBA 1A5TA 2R44A 1QZEA 1IXZA 1E9RA 1I4WA 2WSEF 5FTMA 1QZMA 4HL4A 5ITXA 3U6QA 3KFUG 4DUZM 3I04M 2KNZA 3RFWA 3SAUA 2O25A 3LCUA 1NO1A 4PCZA 3K1JA 4L78A 1XHBA 5F3WA 4DBGB 5KPZA 3JR4A 2DZNB 2JZ0A 4MH0E 4B3SM 1L2BA 2HWJA 4DR7M 3HHXA 1YE9A 3A45A 2C5RA 1XXHA 1R5LA 5KQ8A 4JYAM 2JZ1A 3FUXA 1P3QQ 2R62A 2JNHA 4X64M 1IXSA 1XWIA 2JUJA 2G3QA 5DYIA 2VQEM 4AQYM 3JR5A 2CRUA 5IWAM 4AKIA 4FCVA 4ITQA 2LVOC 1LTMA 3CTWB 3MK6A 4NL4H 3W68A 2WZJA 1EE8A 1TH2A 1ZMVA 2L09A 3PNYA 4B7HA 4B08A 1NHGC 3HX3A 2L2DA 2DZLA 1GVNA 3VDPA 1SG9A 3GLGA 1PJIA 5JI2E 1SXJB 3A42A 3HZJA 3MHVC 3MMPA 3U6LA 3FTFA 4M9XA 5GKNA 3SC3A 1NVMA 4Z6YA 3EIEA 1D0KA 2KW0A 3GRRA 2CV0A 3FUWA 4RNAA 3AL0C 1HQYE 2MROB 3GPUA 3E9SA 1GL6A 1KSFX 4P17A 3WHKA 4DV0M 2R45A 4IBEA 4F2LA 2QNJA 1BVSA 4HLQA 3CF0A 4BLCA 4B3MM 1FJGM 5LMUM 4FCWA 2CP8A 4JN6A 1IY2A 4M0DA 3THGA 5JI3E 3FTEA 4QOZC 2I7PA 3ZC7B 4AI6A 2DAKA 3PFIA 4LJ6A 4DR4M 3TE6A 2V1UA 4GHAA 5EP2A 2UUCM 2G5GX 1YSYA 4S12A 1QDTA 2KZUA 1EIJA 3U5ZB 4LJ8A 1VEGA 4JI7M 1L2DA 2M60A 1MN3A 2K6BA 1S3SA 1XB2B 2DVWB 3FKEA 4LRSA 4OVZB 2VF8A
chains in the Genus database with same CATH topology
1GJSA 2JWSA 1PRBA 1GJTA 2LHCA 2MH8A 1GABA 2FS1A 2N35A 2VDBB 1TF0B 2KDLA 2LHGA 2J5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJS A;  2JWS A;  1PRB A;  1GJT A;  2LHC A;  2MH8 A;  1GAB A;  2FS1 A;  2N35 A;  2VDB B;  1TF0 B;  2KDL A;  2LHG A;  2J5Y A; 
#chains in the Genus database with same CATH topology
 3SBJ A;  1GAB A;  3HY5 A;  1TDH A;  2YNM D;  4LG2 A;  3U60 A;  1K3W A;  2JP7 A;  1TH4 A;  5KPT A;  2F5N A;  4I8O A;  3KOZ E;  2C9C A;  2K9D A;  4MM3 B;  2R4E A;  3LVV A;  1VG5 A;  3KSJ A;  3M0E A;  4X65 M;  2CFO A;  3IG8 A;  3LMM A;  5FTK A;  2ZM6 M;  3HU1 A;  2OPF A;  1N34 M;  1IBL M;  4NSR A;  3JAM S;  5FSW A;  4JI1 M;  3C58 A;  3F92 A;  2R65 A;  4G3O A;  4KT0 F;  1Y8G A;  4FCT A;  2YFQ A;  2Z4S A;  3GLH A;  2ZAN A;  3B74 A;  3KXE C;  2Q2E B;  3R9X B;  3E46 A;  1IM2 A;  3EIH A;  5ITX E;  4I5S A;  2EKK A;  5EXX A;  2EKF A;  4GH9 A;  5L8R F;  1N77 A;  2RKO A;  4G6Z A;  2YR0 A;  3U6P A;  4GHL A;  3A98 B;  3B7Z A;  3WHL A;  4QNM A;  3GLI B;  2FOI C;  2K47 A;  3GLF A;  3B9P A;  2CWB A;  2FNA A;  4KOD A;  1QAQ A;  1XXH E;  4FVM A;  3RGS A;  3SYK A;  1G8P A;  1KYI A;  2BNK A;  5ITT A;  2Y0T A;  1ZAE A;  2V1C A;  4GKJ M;  3GQ5 A;  1TR8 A;  2YQZ A;  2HHH M;  2UXB M;  3TQS A;  1LV7 A;  4NC6 A;  2H5X A;  4FWG A;  1NV8 A;  5KQD A;  1VEK A;  3IHP A;  1XMQ M;  5E26 A;  2LVN C;  3I4V A;  1NSF A;  5EP3 A;  1Z5C A;  4QNR A;  4LFC M;  4FD2 A;  3GLG E;  2EO2 A;  1GKI A;  3CF2 A;  3SMP A;  1ZV1 A;  3KDS E;  5KO3 A;  1Z6T A;  1JR3 E;  3J81 S;  2DAI A;  1MJG M;  1IQP A;  2RGH A;  4IJF A;  4NSO B;  3VFD A;  1JB0 F;  5ITU A;  5LMN M;  4G4O A;  3T15 A;  2RGO A;  4I4L A;  5ITR A;  4QOS A;  1QVR A;  3T1Y M;  1D0M A;  1Z5A A;  4LCB A;  1NNU C;  2HL7 A;  2JXN A;  1HQC A;  3FRI A;  4L16 A;  2DXI A;  2CE7 A;  2QQ8 A;  5FTL A;  4GEW A;  4OX9 M;  1SXJ A;  3U6D A;  1HNZ M;  2MJ5 B;  2O5R A;  4LJA A;  2KRU A;  4XBO A;  1G3I A;  1IN4 A;  2HKJ A;  4NXM M;  2K0B X;  1PRB A;  3TWL A;  3HU3 A;  1F4I A;  3K9O A;  4L8R C;  3W0F A;  5ITQ A;  3U61 B;  3HGI A;  2L4E A;  3C3D A;  1W5T A;  2DZO B;  4LFA M;  1XNQ M;  1V33 A;  2G8L A;  2B3T A;  2R4J A;  3FRH A;  2EUC A;  1UFZ A;  4LF8 M;  2ERC A;  4REZ A;  2XGN A;  3SHF A;  1GL7 A;  1ZMU A;  3MJ5 A;  2DNA A;  4W5W A;  3PVS A;  4LY6 A;  4OVZ A;  4JI6 M;  1PJT A;  1N75 A;  3Q8X A;  3ZCB B;  4KO8 A;  2RRU A;  3AJI B;  3GLH E;  1QQW A;  2Y20 A;  4NXN M;  3GP1 A;  4OU7 A;  1K3X A;  2EJS A;  2QBY B;  1JR3 A;  2VQF M;  2OO9 A;  1ZQ9 A;  4NRV A;  3KS8 A;  4QHT A;  1HT1 E;  1IN6 A;  1WGN A;  3KVW A;  4GRI A;  3ZQJ A;  3GLF E;  4KHP M;  4WP2 A;  4K0K M;  2CHG A;  2LH0 A;  4CIS A;  2APL A;  1IFY A;  2FE8 A;  3UJN A;  3K92 A;  2XFT A;  1L1T A;  3SAT A;  1XNR M;  3DA1 A;  1R2Z A;  1N32 M;  4LFB M;  4FW9 A;  2C99 A;  1IN5 A;  4CGY B;  3HJQ A;  3LVW A;  3DZD A;  3Q8G A;  2DWZ B;  3KOY E;  4R7G A;  3H4M A;  4UN2 B;  1J5E M;  3FUV A;  4IBD A;  4Y28 F;  2LNH C;  1SXJ C;  2C9O A;  4HEO A;  1OFH A;  4M9Z A;  4MGH A;  5EQT A;  1NY5 A;  3GLI A;  3H4J A;  2XEP A;  1J09 A;  4LGY A;  1WGL A;  5FTN A;  2DAE A;  1PM5 A;  5BPV A;  2L7H A;  4LF7 M;  1ORY B;  3SAR A;  2AHM A;  2Z7J A;  3CF6 E;  4M0W A;  3OTO M;  5IT9 S;  2QCU A;  1RU3 A;  1IXS B;  1TF0 B;  3FTD A;  3HWS A;  3GQ3 A;  1N33 M;  3B7N A;  3HJS A;  3BBZ A;  4Q7J A;  4AKG A;  1OTR A;  4XK8 F;  1DV0 A;  1Q02 A;  2WSF F;  3T6P A;  2D7E A;  2CUZ A;  5EP1 A;  2X49 A;  3E4R A;  4IBC A;  3T1H M;  4GC9 A;  3HHZ A;  4IIW A;  1SXJ E;  3GO8 A;  2R46 A;  2OQ4 A;  2UXC M;  3V76 A;  1Z59 A;  4LRT A;  2J7N A;  5FLX S;  4DV4 M;  4LZZ A;  1TGU A;  3KOW E;  2UUA M;  2FS1 A;  3VKH A;  2CEA A;  4JI2 M;  1PJJ A;  4R3D A;  3R8F A;  1MX0 A;  1T43 A;  1QDR A;  3A46 A;  2LTU A;  4AZF A;  2JWS A;  4D81 A;  2FFJ A;  4DV3 M;  1GJS A;  3QYB A;  4GIT A;  4Z8X A;  4P16 A;  2F5O A;  4JI3 M;  3TWK A;  1Q3B A;  2XLJ A;  2O01 F;  2R18 A;  3L25 A;  2LVQ D;  4CIZ A;  3TWM A;  5H37 D;  2KNV A;  3C9P A;  4MB7 A;  3GPP A;  1I94 M;  4GKK M;  2LXE A;  3BXW A;  1DGH B;  3QAU A;  4B7G A;  1IBK M;  1R7R A;  2QEN A;  1DGF A;  4CHT B;  1IY0 A;  4L6V 6;  4LF5 M;  1QAM A;  1DGG A;  4BBA A;  4G4R A;  3M6A A;  1L8Q A;  3CGW A;  2Y21 A;  1D0L A;  3GPX A;  4JI0 M;  4BB9 A;  1YLA A;  2WSC F;  3U61 A;  4NRW A;  1N78 A;  2H1R A;  1HJP A;  2BWB A;  3UK6 A;  1NV9 A;  1R4G A;  5FTJ A;  3VLF B;  3L28 A;  4PT5 A;  4D80 A;  3D8B A;  3SMS A;  1E9S A;  3FUT A;  3HHY A;  2D7H A;  3FE3 A;  3SAV A;  3GPY A;  4DV1 M;  1NNJ A;  4DV7 M;  1OIZ A;  4II7 A;  4IJE A;  3L29 A;  3NBX X;  4B7F A;  3U6C A;  3AOE A;  2QP9 X;  1OJL A;  2ZBK B;  4GMQ A;  4KLN A;  1IN8 A;  1IXR C;  2KDL A;  2XF3 A;  1G41 A;  1R6B X;  1TTE A;  2KXE A;  2QBY A;  4YHH M;  1E94 E;  2LBC A;  1N36 M;  2BJW A;  2JY8 A;  3LQQ A;  2LHG A;  2E5L M;  3NBI A;  1G4A E;  2J5Y A;  1PJQ A;  2LVA A;  3FYD A;  2KEB A;  3GRU A;  2LHC A;  5KPR A;  3ZH9 B;  4YY3 M;  4DUY M;  2DAG A;  2BJV A;  1NY6 A;  1PGY A;  3J27 B;  4CJ6 A;  3W0L B;  2MGW A;  5E6J A;  3GLI E;  1NJG A;  2R0I A;  3VK7 A;  2C96 A;  5C18 A;  1GJT A;  2P5T A;  1CUK A;  3IEC A;  1QUS A;  2XFS A;  3ILK A;  2F4V M;  2UU9 M;  1IN7 A;  4DR5 M;  1J7K A;  1VQ1 A;  2MR9 A;  3VDU A;  3I01 M;  3HU2 A;  2XZF A;  3I4Y A;  1WIV A;  2ZTD A;  4LGM A;  1VDD A;  8CAT A;  5DNY A;  2EA0 A;  4WUR A;  3U5Z A;  4B3R M;  4RF1 A;  2QPA A;  4DR3 M;  1XC8 A;  1EFU B;  1OAI A;  1Z5B A;  2FH0 A;  1WXQ A;  2CV2 A;  4AW4 A;  4RKU F;  4PD2 A;  3K8Z A;  2CHV A;  1DO0 A;  1V92 A;  2XSZ D;  4GIP A;  5DFL A;  3RGP A;  2M5Z A;  3U6M A;  1TH3 A;  3J2P B;  2GQF A;  4FWD A;  4IBK A;  4IBI A;  2LWX A;  3E21 A;  5DYG A;  2X4A A;  3UZU A;  3SAS A;  4JI4 M;  2DAM A;  3LW5 F;  2DI0 A;  3L26 A;  2VDB B;  1OAO C;  2ZAM A;  3M7G A;  2ZAO A;  1MU5 A;  1WR1 B;  4TUW A;  3KSX A;  2VII A;  5BR8 M;  3HKP A;  3U6S A;  3I51 A;  1WJ7 A;  2QZ4 A;  5EJC A;  2KA6 B;  4L15 A;  3AOE C;  4DR1 M;  2DHR A;  4DV5 M;  3GRY A;  4OW0 A;  2DWL A;  3T38 A;  1NJF A;  4FWH A;  7CAT A;  3VK8 A;  2GNO A;  1FNN A;  4IBJ A;  3GRV A;  4ANR A;  1ZMW A;  3D8L A;  4LJ9 A;  1Q3C A;  1V34 A;  4GC5 A;  4DR2 M;  3J7A S;  2F5S A;  1XXH B;  2XH9 A;  1W5S A;  3SHG B;  1VEJ A;  2W82 A;  3AOG A;  4I81 A;  4MGZ E;  1JQJ C;  3IG5 A;  4LJ5 A;  4F1I A;  4R71 A;  2ZTC A;  3QWL A;  4IBB A;  4IBG A;  4LF4 M;  2DWN A;  4DR6 M;  2JY7 A;  2QHO B;  2R6F A;  1DGH A;  4D82 A;  2Y0Q A;  4MGK E;  5IZ7 D;  4JI5 M;  5EXS A;  2F5P A;  3KP0 E;  1TDZ A;  1UM8 A;  1C1K A;  3PNV A;  1GO5 A;  4AG6 A;  3QYE A;  5A2Q S;  1K82 A;  3KW6 A;  4WW0 A;  2DWM A;  4JV5 M;  3LQR A;  5C1B A;  3SFZ A;  2QSF X;  3HHW A;  4JI8 M;  1HNW M;  3GLG B;  2KRK A;  2XSZ A;  1QYR A;  1AIP C;  3J80 S;  1X37 A;  2C98 A;  2KHH A;  5IRE B;  1XMO M;  1L2C A;  2N35 A;  4LF9 M;  1T6O A;  2Z8Y M;  3FYC A;  1WHC A;  2JY5 A;  4L4U A;  3B89 A;  3UMM A;  2F5Q A;  2X8A A;  4DV2 M;  2D7G A;  2JA2 A;  3L2A A;  4A3V B;  2Z4R A;  2Z3X A;  1Q39 A;  2V6Z M;  3AV0 A;  3SYL A;  3DFZ A;  3DOA A;  3VKG A;  1QUT A;  3KS4 A;  2HAK A;  3TPZ A;  1OFI A;  1HNX M;  1OIP A;  3FD9 A;  4DV6 M;  1DGB A;  1QAO A;  5ITY A;  5EP4 A;  1SXJ D;  2DHY A;  4MGY E;  4RF0 A;  1GLN A;  4LJ4 A;  3SAW A;  1OQY A;  2JY6 B;  4LF6 M;  1H6U A;  2UXD M;  3J7B A;  2L7I A;  2OOA A;  3B7Q A;  3TL4 X;  1G71 A;  1QAN A;  1IY1 A;  2A5Y B;  2CHQ A;  4XGI A;  1R2Y A;  1T3T A;  1KFV A;  1HT2 E;  3RE8 A;  2XZU A;  2L6O A;  4JXJ A;  4B3T M;  3HJ8 A;  3U60 B;  1DO2 A;  5EXT A;  3L27 A;  3AKZ A;  4LJ7 A;  4G4N A;  3LCV B;  4IBF A;  3PXG A;  3GQ4 A;  4M9S A;  3FUU A;  1OKS A;  1D2N A;  3K9P A;  4G4Q A;  2MH8 A;  1L1Z A;  4EIW A;  3KOX E;  3AFH A;  1IBM M;  4PDG A;  1AUA A;  2LVP C;  3KP1 E;  3C3E A;  3FTC A;  2OOB A;  3UGJ A;  3BOS A;  3GLH B;  2I7N A;  2NQ8 C;  3U6E A;  1NHW C;  3K2L A;  3U6O A;  1VDL A;  4LZJ A;  4PDI A;  2UUB M;  2DKL A;  1YUB A;  4NOO B;  2J7O A;  2VF7 A;  4X62 M;  1E32 A;  1JR3 D;  4MGI E;  4AG5 A;  2KZS A;  1G59 A;  1C7Y A;  4ZPX A;  2CV1 A;  4X66 M;  1PJS A;  5EXP A;  3NWL A;  3GLF B;  2L4F A;  1HR0 M;  2DEN A;  4QHS A;  2BWE A;  3W67 A;  2KNA A;  4AKH A;  2HCB A;  1A5T A;  2R44 A;  1QZE A;  1IXZ A;  1E9R A;  1I4W A;  2WSE F;  5FTM A;  1QZM A;  4HL4 A;  5ITX A;  3U6Q A;  3KFU G;  4DUZ M;  3I04 M;  2KNZ A;  3RFW A;  3SAU A;  2O25 A;  3LCU A;  1NO1 A;  4PCZ A;  3K1J A;  4L78 A;  1XHB A;  5F3W A;  4DBG B;  5KPZ A;  3JR4 A;  2DZN B;  2JZ0 A;  4MH0 E;  4B3S M;  1L2B A;  2HWJ A;  4DR7 M;  3HHX A;  1YE9 A;  3A45 A;  2C5R A;  1XXH A;  1R5L A;  5KQ8 A;  4JYA M;  2JZ1 A;  3FUX A;  1P3Q Q;  2R62 A;  2JNH A;  4X64 M;  1IXS A;  1XWI A;  2JUJ A;  2G3Q A;  5DYI A;  2VQE M;  4AQY M;  3JR5 A;  2CRU A;  5IWA M;  4AKI A;  4FCV A;  4ITQ A;  2LVO C;  1LTM A;  3CTW B;  3MK6 A;  4NL4 H;  3W68 A;  2WZJ A;  1EE8 A;  1TH2 A;  1ZMV A;  2L09 A;  3PNY A;  4B7H A;  4B08 A;  1NHG C;  3HX3 A;  2L2D A;  2DZL A;  1GVN A;  3VDP A;  1SG9 A;  3GLG A;  1PJI A;  5JI2 E;  1SXJ B;  3A42 A;  3HZJ A;  3MHV C;  3MMP A;  3U6L A;  3FTF A;  4M9X A;  5GKN A;  3SC3 A;  1NVM A;  4Z6Y A;  3EIE A;  1D0K A;  2KW0 A;  3GRR A;  2CV0 A;  3FUW A;  4RNA A;  3AL0 C;  1HQY E;  2MRO B;  3GPU A;  3E9S A;  1GL6 A;  1KSF X;  4P17 A;  3WHK A;  4DV0 M;  2R45 A;  4IBE A;  4F2L A;  2QNJ A;  1BVS A;  4HLQ A;  3CF0 A;  4BLC A;  4B3M M;  1FJG M;  5LMU M;  4FCW A;  2CP8 A;  4JN6 A;  1IY2 A;  4M0D A;  3THG A;  5JI3 E;  3FTE A;  4QOZ C;  2I7P A;  3ZC7 B;  4AI6 A;  2DAK A;  3PFI A;  4LJ6 A;  4DR4 M;  3TE6 A;  2V1U A;  4GHA A;  5EP2 A;  2UUC M;  2G5G X;  1YSY A;  4S12 A;  1QDT A;  2KZU A;  1EIJ A;  3U5Z B;  4LJ8 A;  1VEG A;  4JI7 M;  1L2D A;  2M60 A;  1MN3 A;  2K6B A;  1S3S A;  1XB2 B;  2DVW B;  3FKE A;  4LRS A;  4OVZ B;  2VF8 A; 
#chains in the Genus database with same CATH homology
 1GJS A;  2JWS A;  1PRB A;  1GJT A;  2LHC A;  2MH8 A;  1GAB A;  2FS1 A;  2N35 A;  2VDB B;  1TF0 B;  2KDL A;  2LHG A;  2J5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...