1PREA

Proaerolysin
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
469
structure length
449
Chain Sequence
b'EPVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKTVVGWAVNDPQSGYDVTLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDWNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPLGLRLEIPLDAQELSGLGFNNVSLSVTPAANQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROAEROLYSIN
publication title Structure of the Aeromonas toxin proaerolysin in its water-soluble and membrane-channel states.
pubmed doi rcsb
source organism Aeromonas hydrophila
molecule tags Toxin (hemolytic polypeptide)
total genus 106
structure length 449
sequence length 469
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01117 Aerolysin Aerolysin toxin
A PF03440 APT Aerolysin/Pertussis toxin (APT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.15.10 Mainly Beta Beta Complex Proaerolysin; Chain A, domain 3 Proaerolysin, chain A, domain 3 1preA03
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1preA01
3.30.412.10 Alpha Beta 2-Layer Sandwich Proaerolysin; Chain A, domain 2 Proaerolysin, chain A, domain 2 1preA02
1W3GA 1PTOC 1UYJA 1PTOH 3C0MA 3G4OA 1BCPB 1PRTB 1W3AA 3C0NA 3G4NA 1PTOB 2D42A 1W3FA 1Z52A 1BCPC 1PRTC 1PREA 3C0OA 3ZJXA
chains in the Genus database with same CATH superfamily
1W3GA 1PTOC 1UYJA 1PTOH 3C0MA 3G4OA 1BCPB 1PRTB 1W3AA 3C0NA 3G4NA 1PTOB 2D42A 1W3FA 1Z52A 1BCPC 1PRTC 1PREA 3C0OA 3ZJXA
chains in the Genus database with same CATH topology
1W3GA 1PTOC 1UYJA 1PTOH 3C0MA 3G4OA 1BCPB 1PRTB 1W3AA 3C0NA 3G4NA 1PTOB 2D42A 1W3FA 1Z52A 1BCPC 1PRTC 1PREA 3C0OA 3ZJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W3G A;  1PTO C;  1UYJ A;  1PTO H;  3C0M A;  3G4O A;  1BCP B;  1PRT B;  1W3A A;  3C0N A;  3G4N A;  1PTO B;  2D42 A;  1W3F A;  1Z52 A;  1BCP C;  1PRT C;  1PRE A;  3C0O A;  3ZJX A; 
#chains in the Genus database with same CATH topology
 1W3G A;  1PTO C;  1UYJ A;  1PTO H;  3C0M A;  3G4O A;  1BCP B;  1PRT B;  1W3A A;  3C0N A;  3G4N A;  1PTO B;  2D42 A;  1W3F A;  1Z52 A;  1BCP C;  1PRT C;  1PRE A;  3C0O A;  3ZJX A; 
#chains in the Genus database with same CATH homology
 1W3G A;  1PTO C;  1UYJ A;  1PTO H;  3C0M A;  3G4O A;  1BCP B;  1PRT B;  1W3A A;  3C0N A;  3G4N A;  1PTO B;  2D42 A;  1W3F A;  1Z52 A;  1BCP C;  1PRT C;  1PRE A;  3C0O A;  3ZJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...