1PRLC

Two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-SRC TYROSINE KINASE SH3 DOMAIN
publication title Two binding orientations for peptides to the Src SH3 domain: development of a general model for SH3-ligand interactions.
pubmed rcsb
source organism Gallus gallus
molecule tags Complex (signal transduction/peptide)
total genus 4
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1prlC00
2KGTA 1T3LA 2KBTA 3THKA 1AWJA 1KSWA 2O31A 2YSQA 1JXOA 2FPDA 2C0OA 2DNUA 2DL7A 3U23A 1AD5A 2KYBA 3VRYA 1T3SA 4JZ3A 1W70A 1HD3A 1K4US 2KEAA 3UA7A 2JW4A 4EIKA 2KRMA 2KT1A 2DYBA 2VWFA 4J9EA 5IXFA 3JV3A 1M3CA 2VKNA 1GL5A 2A37A 1NYFA 4GBQA 5FWCA 2JM9A 1Y57A 2RPNA 5IHIA 1YWOA 2CUBA 2SEMA 4ZNXA 4DEYA 1AOJA 2D8JA 3SHWA 4J9DA 1RI9A 4X1VA 1TUCA 2JMAA 2RQVA 2G6FX 1GFCA 4IIMA 2K79A 2BZXA 2KXDA 2RF0A 2X3XD 1Z9QA 1PKSA 1JXMA 1PNJA 4LE9A 3I5RA 4OMNA 1W6XA 4JPBW 1UJYA 2ROTA 2YUQA 2A36A 1SSHA 2CUDA 4LUDA 4LN2A 5I11A 2CSIA 1SEMA 2EYWA 1AWXA 1TG0A 1G2BA 4HVVA 1UG1A 1GBRA 1E7OA 1N5ZA 2DA9A 1MUZA 1BBZA 1M27C 1JQQA 4ORZA 3FJ5A 2K9GA 1UECA 2AKLA 2P4RA 2V1QA 1U3OA 2RQWA 4Z8AA 1X27A 2LNHB 2J6OA 4LUEA 2CT4A 3IQLA 3GBQA 4RTZA 2GGRA 1UJ0A 2ED0A 2KRNA 1K76A 1VYVA 2H8HA 2EGEA 2J6KA 4AFUC 1V1CA 2KRSA 2D8HA 3REBB 2DL3A 1NM7A 1ARKA 3EHRA 3NPFA 1Y0MA 3UATA 1CSKA 2ECZA 1QCFA 1GCPA 4D8KA 2GNCA 5FWBA 1HSQA 2LQNA 1WXUA 3ULRB 2PNIA 5GJWB 1BU1A 1XOVA 1NEBA 2LMJA 1K0XA 4D8DA 1FYNA 2GQIA 4J9HA 3QWXX 2PZ1A 4AFSC 3NMZC 1WI7A 3VRZA 1K0SA 1WFWA 4DEXA 4RTVA 2EGCA 4FSSA 4AFQC 4KRTA 3PVQA 3KFVA 2JM8A 2ROLA 1PHTA 4CC7A 1KIKA 1M30A 2CH4W 2L3PA 2HCKA 1B3QA 2J7IA 2KE9A 1JEGA 1ZBJA 2GBQA 4F16A 1ABOA 2DILA 2DX1A 2KROA 2YUNA 2X3WD 2DJQA 4JJCA 3RNJA 1IO6A 2FRYA 1M8MA 2JT4A 2DL8A 1KFZA 2EGAA 2JS0A 1K9AA 1OV3A 3H41A 2O9SA 1VYTA 1MV3A 4HVWA 2GTJA 1I07A 2M0YA 4CC3A 1WIEA 1GRIA 1CKBA 2JMCA 1NLPC 1QLYA 1FMKA 3M0QA 3O5ZA 3ZL7C 2EYZA 1B07A 4R0KA 1EFNA 2D0NA 2NWMA 1WXBA 2F2VA 1LCKA 1OOTA 1X69A 2LJ0A 2YUPA 1T0JA 2A08A 2K3BA 2XMFA 3NHNA 2OI3A 2CH4A 1VA7A 4WCIA 1RUWA 3VS3A 1UE9A 2DE0X 1SPKA 3TSZA 2J6FA 2AKKA 2EKHA 2I0NA 2YUOA 4QT7A 3CQTA 1GBQA 2K6DA 2DLPA 2DL5A 1E6HA 2M51A 3H0IA 1BB9A 4RUGA 2BTTA 2K2MA 1RLQC 2F2XA 2DBMA 2YT6A 3M0UA 2HDAA 2JS2A 3C0CA 3M0TA 1I1JA 2C0IA 2RQTA 2DL4A 3EG2A 2NUZA 2ESWA 1T0HA 1GCQC 1ZX6A 2F2WA 3EGUA 2RN8A 3NGPA 1PKTA 2LZ6B 3RBBB 1W1FA 2ENMA 2RNAA 1JU5C 3UA6A 5IXBA 5I22A 4CC4B 5FW9A 1ZUUA 1RLPC 3TSWA 3REAB 2FPEA 5L23A 2V1RA 2AZSA 2OJ2A 2EW3A 3H0FA 4AG1C 1SHFA 2L3SA 2ABLA 1NEGA 1X43A 1OPKA 1U06A 3A98A 2CSQA 1WDXA 4RTYA 2LP5A 2OAWA 3VS4A 1SRMA 1UUEA 1X2QA 3R6NA 2HSPA 4IIOA 2BZ8A 4J9IA 2VVKA 5HCKA 2DBKA 1I0CA 4RTXA 1QKWA 2LQWA 1M3AA 2HEQA 2K7AA 1WLPB 3SEMA 3M0PA 1NLOC 2D1XA 4OMQA 3H0HA 2JXBA 1QWEA 1E6GA 2YDLA 1YNZA 1UHFA 2FPFA 2RQRA 1H3HA 1K1ZA 2LJ3A 1AWOA 1ABQA 4J9CA 1AZEA 1X2KA 2KT8A 4AFZC 3I5SA 1H8KA 4J9BA 1U5SA 1PRLC 2EYYA 1UTIA 2EYXA 4OMOA 2FO0A 3PVLA 3EG1A 2EPDA 1ZUKA 1X6BA 1X6GA 2BZYA 1Z9ZA 4RTTA 4E6RA 2DM1A 3EG3A 2DRMA 3VS6A 1AVZC 5IHNA 1MV0B 1UFFA 2FG0A 4Z88A 1ZSGA 1JO8A 3QWYA 4JZ4A 2O88A 2JTEA 1PRMC 3M0RA 2RQUA 1HJDA 2QDLA 2RMOA 2W10A 5GJVB 4K11A 5EC7A 1TUDA 1UHCA 1YCSB 2J05A 1UDLA 4RTUA 1YN8A 1ZLMA 1SHGA 2FRWA 1WA7A 2KYMA 2O9VA 2W0ZA 2GTOA 1UGVA 2EVRA 3VS5A 1OPLA 2KR3A 2IIMA 1ZUYA 4F17A 2DRKA 2LJ1A 4Z89A 1J3TA 3EG0A 4ESRA 3LH5A 2EQIA 2LCSA 1WXTA 1AEYA 1NG2A 1QKXA 2C0TA 2PTKA 4A63B 4HCKA 1YWPA 2HBWA 2MIOA 3VS1A 4Y92A 5IHKA 3M0SA 2SRCA 4AG2C 2DMOA 5ECAA 3TVTA 1A0NB 2CREA 1AWWA 2L2PA 2E5KA 3VS7A 2CT3A 3I35A 3I9QA 1YP5A 3UF4A 1S1NA 3PE0A 4M4ZA 4OMPA 4F14A 2B86A 2MOXA 1KJWA 2KNBB 1G83A 4CC2A 2L3QA 4HVUA 2O2OA 2A28A 2ED1A 1QWFA 3EHQA 1H92A 5IH2A 1BK2A 2L0AA 1OEBA 4JJDA 2DVJA 4J9GA 2DF6A 2LX7A 3VS0A 4RTWA 2CDTA 4LNPA 4JJBA 4J9FA 1M3BA 2FEIA 2MCNA 3VS2A 1AZGB 1NYGA 1CKAA 2J06A 1WYXA 1GCQA 1VYUA 4OMLA 2AZVA 2AK5A 1GFDA 1PWTA 4HXJA 1WX6A 4GLMA 1SRLA 2EBPA 2KXCA 4OMMA
chains in the Genus database with same CATH superfamily
2KK4A 4M77C 2V8JA 4ME7A 4KGXB 2KBTA 4QVCA 2RJCA 2QA4A 4M7AD 3CBMA 2O31A 5LJ5f 4Y91A 2C0OA 1AD5A 4OGCA 4CI0C 3EGXA 3VRYA 1T3SA 3I56Q 1TWBA 1HD3A 3PNWC 1NPPA 3A5ZB 4FU6A 2ZPEB 4J83A 1KHCA 2VWFA 4M75A 3RESA 5IXFA 4NL3A 1HK9A 1RAGB 2A37A 4GBQA 3CCJT 5HK3A 2P0KA 1BI1A 2CUBA 4PFPA 3OYNA 4PJOC 5I2MA 1VQ8Q 5IN1A 1LOJA 2D8JA 3SHWA 1RI9A 1M1GA 2JMAA 2EWNA 4XTWA 2ZCFB 2ZPFB 3OW2S 1YJNT 4IIMA 4J6WA 3OY9A 2F1LA 2X3XD 4LE9A 1PNJA 3I5RA 3LWHA 1UJYA 2A36A 4LN2A 3CCEA 3M4GA 1TG0A 4L5GA 1YI2Q 2JOYA 1GBRA 1E7OA 3DLMA 1PC0A 4KUIA 1N5ZA 5GANd 4BE1A 5GAOn 1BBZA 4MDXA 3DKMA 5GMKl 4C5IA 3M9QA 3QJ6A 3I56T 1VQ8A 3FJ5A 2CYZB 1QVFP 1OI1A 3S3MA 1ZSZB 1YJ9T 2P4RA 2WSFE 1RAAB 2LNHB 4XTZA 3J80E 4IURA 2VC8A 3MP6A 4PK4A 1LJOA 4LDUA 2E64A 5D6YA 1WQ7A 2H8HA 1OQKA 3G6EQ 1WZOA 1F1BB 2X9HA 4AFUC 3CMAT 3RKYA 5AT1B 1WHJA 1JB0E 3UATA 1QCFA 1M4ZA 1N9SA 2ZPHB 2LQNA 1KG1A 1JBMA 2QAZA 1TSFA 3CCSQ 1YI2T 2LMJA 2Y90A 4D8DA 1WQWA 2DKGA 2GQIA 3LW5E 4RG8A 2PZ1A 3EFOA 1WI7A 1DJ7B 1WFWA 4PJMA 4D6WA 3G6EA 1IHVA 1H641 3JB9I 1N8RC 5KYXA 4M7AE 4JLIA 5CR2A 2EJFA 3L2ZA 2CH4W 5LJ5h 2HCKA 3TQ7P 1ZBJA 3ZBDA 1M1KR 3CCSA 2HL3A 3OYKA 1Q81R 2DX1A 2KROA 2YUNA 3ZEHA 3FDRA 1K9MU 2QTVA 3MPUB 4E2FB 2E41A 1M8MA 3CCLQ 2DEUA 2R5AA 2ZAEA 1XJWB 2RHUA 1OV3A 2DTOA 4C8QG 4HVWA 4LD9K 2GTJA 2MI6A 5A0GA 4CC3A 1WIEA 3DB3A 1TU0B 2JTFA 3G4SQ 3SWNB 3BDLA 4C8QF 1QLYA 1FMKA 3I55T 2KY9A 2EYZA 4M78G 1B07A 2LRQA 3HSBA 1QVGS 3EG9B 1WXBA 4M77G 1LCKA 3CCLA 2JTMA 3JRZA 2A08A 2K3BA 2OI3A 1KQSS 4E47A 3KXTA 3L2QA 4M78F 3VV0A 3VS3A 4P5NA 1Y7XA 1SPKA 2H3EB 2HSEB 3CPWP 4HKEA 2EKHA 1G5VA 2YUOA 3G4SA 4C5EA 4DQ2A 2DLPA 5GAN2 3CXCA 3L2VA 4PL6A 4RUGA 5CQXA 2K2MA 1UGPB 1YHQT 1M2VB 2F2XA 4KGVB 5FU6C 3CCQT 2HDAA 2FZCB 1GXIE 2NUZA 2OTLQ 2JJ9A 2DERA 3NGPA 1PKTA 2R58A 4HCZA 3RBBB 1W1FA 4PJOG 5I22A 4M7AC 2DIGA 1ZUUA 4BACA 2XKOC 3REAB 2AZSA 2X4YA 3VKIA 4PJOF 8ATCB 5GANg 1X43A 5GAOq 1U06A 3A98A 2XDBA 4DOVA 2MF2A 2OTLA 5GAN7 2F5KA 1IRXA 2LP5A 2E10A 1BIAA 2NLUA 4PLIA 3LWIA 1ZBXA 2HSPA 1WHMA 2VVKA 4AT1B 1QKWA 2HEQA 1WLPB 4NL2A 2YLCA 2LC4A 3UWNA 1NLOC 1KD1U 1Q82C 4C92A 3H0HA 3VJPA 3X28B 2V8IA 4F7UG 2RQRA 4Y28E 2EQKA 4M7AA 2OX7A 2LJ3A 1H3ZA 3PTAA 4J9CA 3QPHA 1QMCA 3TU4K 2M0OA 1U5SA 4C8QB 1MMGA 4XAXB 1VQNT 1X6BA 4E7IA 1G3YA 4C8QD 1D3BA 2O01E 2O4XA 2DRMA 1PSEA 1VOMA 4ATOA 1ZSGA 2L8DA 3HTRA 3CCVQ 4LDWA 2B8AA 2QDLA 2RMOA 3QDFA 4K11A 4E7LA 5EC7A 1TUDA 1ZSZC 2XU8A 3HRUA 5CCAA 2RJDA 1C0MA 1YN8A 5GAN3 1UGSB 1WA7A 4XU0A 2O9VA 3EFRA 2W0ZA 1OU8A 3VS5A 1QW1A 1FWZA 3GP8A 2IIMA 1ZUYA 2LCCA 4Z89A 2QQSA 1Y96B 3CCVA 3M53A 1WXTA 4MZMA 2R57A 1QKXA 2YRCA 1YITQ 3CPFA 3Q1JA 4L6V5 2PUOB 3VS1A 3JB9D 2SRCA 2DMOA 2CREA 1IGUA 3QYHB 3VUZA 2L2PA 3MHXA 3VS7A 4IKFA 2CT3A 3I9QA 4M7DB 2MOXA 2QEXQ 3NTIA 2LT1A 4OMFB 4R55A 1X6OA 1G83A 4M7DD 2L5QA 1QWFA 1IHWA 4FW2A 4JJNK 1BK2A 4JJDA 1OX9A 4EMKB 4MDWA 4AMCA 1KC8C 2Y4XA 5KH6A 4N0AA 2PQWA 2OAUA 3CC2Q 2QXFA 3N5BB 3QO3A 2QEXA 1GCQA 2AHJB 2KVQG 3QYGB 2NUTB 2K4YA 1VYUA 3HPWA 4BDZA 1YITT 2CP0A 3UT1A 1G3WA 2QYZA 2YXYA 1QVFA 1Q81C 2EBPA 2AIRB 1N8RR 4OMMA 1BI3A 3SWNC 2JNGA 4X9DA 1AHJB 1M90U 1BKBA 3H8ZA 3P8DA 3THKA 1SG5A 4M7AG 2DZCA 3CC2A 2FL7A 4C8QE 1KSWA 3CC7T 4ELYC 4PKCC 1JXOA 3RUXA 4NOYA 4JLGA 2FPDA 2DNUA 1Q86U 3U23A 1JJ2P 3CD6T 4BE2A 4FSXA 5GANj 4JRPA 3RMQA 1W70A 1FXXA 5GMKm 4QKUA 2HMAA 1FX7A 3CCMA 3UA7A 2LDMA 3GLXA 2JW4A 3X20B 2KRMA 5KYWA 1SF9A 3JV3A 2COYA 3HKSA 3R6OA 1NYFA 5CQYA 3EGDA 4N4HA 4FM4B 3OS1A 4WF2A 2SEMA 2DK3A 4XU2A 4DEYA 1VQPQ 3EG9A 4J9DA 1B7TA 1OULA 2K79A 2BZXA 2LT4A 1PKSA 1JXMA 1SSFA 1W6XA 4JPBW 2F69A 3G71T 1SSHA 1VQKQ 2CSIA 1SEMA 2EYWA 2QDYB 1KQ1A 4ZTFA 3RIRA 2X4WA 3HRTA 5FROA 5DY9A 4PFOA 4RKUE 3QSUA 3BW1A 1VQPA 1VQ5T 4ORZA 2K9GA 3OS0A 2GCXA 2AKLA 1M2VA 4J6YA 3PIOA 1K8AU 3CMEQ 1U3OA 4M7DE 1ZA1B 1X27A 2J6OA 5GANf 2GGRA 1K73U 2KRNA 5J39A 1U8RA 2HZYA 2D8HA 3REBB 2DL3A 1NM7A 1BCMA 1ARKA 3NPFA 1Y0MA 2QA4Q 2RA2A 3CMEA 2XDDA 1VQ9A 4JRQA 2GNCA 3UDCA 1VQKT 3CPWA 1HSQA 4MMKA 3ULRB 1YJWA 2RK2A 4BE0A 2BUDA 2DXBA 4Z02A 5CKEA 3VRZA 5FLXE 1K0SA 3M58A 3OYMA 3FIFA 4RTVA 2EGCA 3VYGA 1Q7YC 5GMKj 2K5IA 3CXCS 1PHTA 1Q82R 5CKDA 4PJLA 1RAIB 3CBPA 3LGFA 1B3QA 2E3HA 2GBQA 4F16A 4HA8A 4RG2A 2X3WD 2CP2A 5D7UA 4A4GA 2DJQA 4C8QA 1M8VA 4JJCA 4GY5A 2JT4A 2DL8A 1KFZA 2EGAA 1D09B 1M1FA 1YIJA 1BIBA 2O9SA 1ZHIA 1VYTA 4N4IA 3CCEQ 4BI4A 3OSVA 2EYQA 1B34B 1U1TA 2FZKB 3CEYA 4M78A 2M0YA 2CZ0B 4M77A 1CKBA 5GANe 2QG9B 4BB7A 5CO7A 3O5ZA 2RJEA 3DB4A 4C0ZA 1TXQA 1OOTA 1TS9A 1X69A 2EJGA 2VGMA 4M7DC 1T0JA 4A4EA 1M5Q1 5L8RE 3NHNA 3QDRB 1VA7A 4WCIA 1RAFB 1UE9A 5A0DA 2J6FA 5GAMj 2I0NA 2K5LA 1Y96A 5KCHA 1GBQA 3LH0A 2FVUA 2DL5A 4EMKC 3H0IA 2RO0A 3FLGA 3CCUA 3PIPA 2DBMA 4ZN3A 5GANh 2YT6A 3CCET 4PJOA 2DL4A 2RM4A 1LVKA 1N9RA 2YWWA 1ZX6A 3DLLA 2NUPB 1IXDA 2LZ6B 2FZGB 1VQ8T 1RI0A 4ANJA 4CC4B 3VUBA 1RLPC 3QG1A 2FPEA 5IAYA 4JRIA 1VQLQ 2DTIA 4EDUA 4E7ZA 2EW3A 3H0FA 1S72Q 3TREA 4FYXB 1NEGA 1YBYA 4EMKA 4IUTA 2EKOA 3WXMB 2OAWA 1KC8R 3VS4A 3H6ZA 3OYYA 2NYSA 4IIOA 4F7UA 5HCKA 2HBPA 3SEMA 5GAMf 1QP2A 1VQLA 3M0PA 3V8JA 4OMQA 3L42A 1I5OB 1QWEA 5DLOA 3JCMQ 4ELZC 1S72A 1LPLA 1R0CB 5CKFA 2FPFA 4KH1B 5KYYA 1H3HA 1K1ZA 2MPXC 4LD6A 4XU1A 3G6ET 4DBFA 1RABB 1R8OB 2KT8A 5GMKe 3I5SA 1H8KA 3FJPA 2VB6A 1PRLC 2EYYA 4OMOA 3PVLA 4F04B 1ZUKA 3OYHA 1X6GA 2BZYA 2MYSA 4RTTA 2DVEA 4XTUA 4E6RA 3CCST 2RHZA 3VS6A 1UFFA 2CS7A 4Z88A 1JO8A 2O88A 2JTEA 2DXCA 1HJDA 5KYUA 4B6MA 1YCSB 4RTUA 1SHGA 2EQMA 3JCMb 2KYMA 5GMKh 2GTOA 1UGVA 1MMNA 4Q5WA 1OPLA 2KR3A 2F5TX 4II1A 5DLQE 1VIFA 3RMSA 1QVFS 1J3TA 2X4XA 3EG0A 4ESRA 1FMVA 5GMKi 3CCLT 4BUGA 3EH1A 4XTYA 3LGLA 1ZQ1A 1AEYA 1NG2A 2C0TA 1JJ2A 2HBWA 5GAMe 2DIQA 5GAOl 1WGSA 3JB9G 4OVAA 4Y92A 3JCMX 5IHKA 3M0SA 4AG2C 5ECAA 3G4ST 1K9MC 1QQJA 3TVTA 2HQHA 2ZPBB 1M90R 3I35A 1VUBA 3UF4A 3JB9F 2EFIA 2HQEA 4PJNA 1UGRB 4E7KA 1D0ZA 3QKJA 4M7DG 3MEAA 2L3QA 3OYBA 1Q86R 2RK1A 2ED1A 5GAMd 1Y07A 2YRDA 3EHQA 4LDYA 2RI3A 1OEBA 2BKDN 2DVJA 4M7DF 4VUBA 2LX7A 3HP9A 3VS0A 4RTWA 4LNPA 2E12A 1M3BA 2MCNA 1YCYA 3VS2A 1NYGA 5GAMh 2J06A 2GFUA 1PD1A 1I5LA 4MMLA 3QIIA 1D0XA 2OTLT 1PWTA 3OS5A 1WX6A 2CGHA 2KXCA 4OP0A 1Q7YR 1AWJA 5HY6A 1VQ6A 2ATCB 2E6ZA 2YSQA 3E19A 3BFMA 2LQKA 3EFSA 4BDYA 3OBWA 1VQOQ 1VQ7Q 2KYBA 5C0MA 2FYKA 2QGGA 3EGXB 1TUGB 3GF5A 1RAEB 2KEAA 4KULA 2E5QA 2D6FA 3V7RA 3JCMg 4J9EA 1NJIU 5GAOr 1M3CA 2PU9B 2VKNA 1RAHB 3AT1B 1GL5A 3CPWS 3LLRA 4M75B 2VXFA 2A7YA 5FWCA 1VQOA 1Y57A 3CBOA 4FL6A 4XTVA 3PGGA 1VQ7A 2IPOB 4QW2A 4QVDA 3SFMA 4M75D 2XI9A 1EZZB 3P8HA 2ZZDA 3OYDA 4FT4A 1W2BP 1VQ4Q 2KXDA 3J7AF 3GOXA 4OMNA 3A8LB 2E70A 1KD1C 2CUDA 3OMCA 5I11A 2EJ9A 4HVVA 4JDSA 1G3TA 1M1KU 4O5VA 2DA9A 9ATCB 2KSSA 1BYMA 2K3XA 4IUVA 1M27C 4QQDA 2OTJQ 1ZSZA 3E1SA 3HRSA 3CCVT 1XQHA 1WHHA 1FMWA 1QCOA 2A3LA 3OB9A 1VQ4A 3BY7A 4Z8AA 4LUEA 4C0GA 2CT4A 4KH0B 3IQLA 3GBQA 4RTZA 3V7CA 3CCRQ 2ED0A 1KHIA 2HL5C 1N27A 1K76A 2XK0A 2DFUA 2XD0A 2EGEA 1W4SA 3L2RA 2M1HA 2LX9A 2KRSA 5LJ3g 2RJFA 2OTJA 2KQWA 3LYIA 6AT1B 3UPUA 5FRNA 4PFZA 1CSKA 2C06A 2GF7A 5M9OA 2LTOA 5D6WA 2LQ8A 2Z0WA 2PNIA 3A8OB 1XOVA 1NEBA 1VQMQ 1FYNA 4J9HA 1MNEA 1V29B 3CCRA 1HXDA 4AFSC 1TH7A 3O8VA 4J8OA 1ACMB 4FSSA 4AFQC 2K57A 5KYXB 3OYFA 3PVQA 4FYVB 3CCMQ 3KFVA 2JM8A 2ROLA 3E2UA 2QEXT 3A1PA 4CC7A 2VUBA 1N6AA 5GAMg 1M30A 2L3PA 1JEGA 2QQRA 2CZ6B 2HKNA 4DBRA 2KDSA 1VQMA 2DILA 5KCOA 1I4K1 2QK0A 4HCBA 3RNJA 1IO6A 3OYJA 2FRYA 4V2SA 2JS0A 3D7SB 4ZN1A 3CC2T 1D1AA 1K9AA 4XTXA 2RI5A 1EX4A 5J26A 2K2VA 3HFNA 1MV3A 1I07A 3OS2A 3SWNA 1GRIA 3QHSA 3CC4A 3X26B 4M75E 4A4HA 2DETA 3M0QA 3M59A 3A8MB 3ZL7C 3TCJA 1EFNA 2D0NA 2F2VA 4ZTJA 2LJ0A 3ASKA 1D1BA 2YRVA 3G71A 2EQUA 3BDUA 2BE7D 4JS4A 2DE0X 3TSZA 3MJXA 2AKKA 2A0FB 4QT7A 2COWA 1HYOA 2K6DA 1E6HA 1M90C 4KUDK 2JVVA 1BB9A 1NPRA 3F70A 3PMTA 1V76A 2BTTA 3OW2P 3EH2A 1VQ9Q 3URGA 1RLQC 4BD3A 2RHXA 2MMPA 1YJWQ 3EG2A 2WSCE 1Q86C 1T0HA 3EGUA 1K9MR 3G1JA 4OGEA 1VQPT 1KK7A 2ENMA 2RNAA 2DXTA 2G3RA 3TSWA 5L23A 2EAYA 2CP7A 2L3SA 2ABLA 3JCMJ 3M4YA 3JCMW 4ZGDB 3FEOA 4C5HA 7AT1B 3AHUA 1SRMA 1UUEA 1PSFA 2BZ8A 1G8XA 1YIJQ 1I0CA 2LQWA 1M3AA 3OSSC 3V7SA 3CMET 2K3YA 1VQ9T 2KI7A 4LDXA 4KGZB 1M2OA 1E6GA 1YJWT 4C92B 3CCJQ 1JJ2S 1AWOA 4FT2A 4M75C 1ABQA 2V8KA 4FIBA 4RCCA 3QUIA 4C92D 1X2KA 1Y71A 1K8AC 4AFZC 4KBMB 1YJNQ 4JS5A 1WHKA 4J9BA 2QA4T 5LJ3j 1I8FA 1UTIA 2EYXA 3JCMf 3V8LA 2EPDA 2QQAA 4XK8E 1K73C 1P92A 2VGNA 2DM1A 3CCJA 2JUFA 1D3BB 5GAOm 2O4XB 4J7IA 1MV0B 2FG0A 2DTHA 2M16A 3QWYA 2XICA 2JN0A 1YJ9Q 2RQUA 1YIJT 5FRMA 3CCUQ 1YJNA 4OB0B 5GJVB 2QQBA 2KMTA 1RADB 4PJJA 2MK5A 4OB1B 2PVGB 2FRWA 3JB9H 3QBYA 4X34A 3META 4BI8B 2DD4A 4YTLA 4J6XA 3CMAQ 4F17A 2LJ1A 2QASA 3RDVA 4ZGJB 2QI2A 3M57A 5KE3A 3I56A 1N8RU 2IG0A 1X01A 2JZ2A 5C6SA 1YJ9A 2P84A 1QVGP 1NZ9A 2COZA 1KD1R 3OQ5A 2XIDA 4FW1A 2PTKA 4A63B 1YWPA 3MKDA 3M54A 4RCBA 3OYCA 1KQSP 4ZGEB 2DAQA 4OB2B 4IUUA 3C4SA 1WHLA 1A0NB 4B9WA 5LJ3f 4M7DA 2E5KA 3CMAA 1TTHB 1YP5A 4E7HA 1S1NA 4M4ZA 3CCUT 4OMPA 3QZ5B 1PM3A 5D6XA 1M9SA 4E7JA 4HVUA 2A28A 3OYAA 1YI2A 3JCMe 5IH2A 1YFNA 3G7ZA 2DF6A 5LJ5e 2CP6A 1W2BA 4JJBA 3S3NA 4J9FA 4KT0E 4BY6B 2NUTA 5CKHA 1NJIR 1MGQA 4C0DB 4A4FA 2X51A 3H9NA 2E4HA 3JCMd 4C92E 2AZVA 1GFDA 3QZ9B 1WJQA 5LJ5d 3I55Q 4GLMA 4QVZA 1VIEA 2LVMA 2KGTA 2RB6A 5CVIA 1O9SA 1T3LA 2LCLA 3E9FA 3JCMh 1VQLT 2MAMA 4EMHA 2HQXA 1S72T 4E7SA 2DL7A 2X4JA 3M56A 5KE2A 2X35A 1WNLA 2ZPIB 1PG5B 3I55A 1BI0A 4FYWB 2HAXA 3OMGA 3ME9A 4JZ3A 2E65A 3VYHB 1K4US 5LJ3e 4J5YA 1YHQQ 1EIFA 4EIKA 3CCQQ 2KT1A 3OYGA 2DYBA 4LDVA 1NE8A 5KYWB 5IT9E 2GQVA 4M7AB 2LNVA 2JM9A 2RPNA 5IHIA 1YWOA 3EGDB 4ZNXA 1AOJA 4M75G 4X1VA 5HKCA 1TUCA 2RQVA 2G6FX 1GFCA 2AT1B 2P0QA 4DBHA 2GFAA 2RF0A 5LJ3d 1Z9QA 3SDZA 2QTXA 2M02A 4M75F 4X9CA 1QVPA 2ROTA 1D1CA 2YUQA 3NTKA 4A4KA 1YHQA 4LUDA 1Q82U 5I2SA 3CCQA 3MEWA 1AWXA 1OYXA 4M77F 1G2BA 4EPCA 1UG1A 3FC3A 1MUZA 5LJ3h 5FU7C 2WSEE 2E3IA 2D9TA 1JQQA 4OB3B 1C1AA 1WJRA 3S6WA 1UECA 1NBEB 2V1QA 2VYTA 2ZPGB 2RQWA 2DXUA 4HT9A 1UJ0A 5A0LA 2EQJA 4A53A 4C92C 1VYVA 1IREB 4A54A 2J6KA 3QXEB 1V1CA 3MEVA 1IB8A 3EHRA 4R56A 2PVOB 1VQ6Q 2ECZA 1GCPA 4D8KA 4RMOA 5FWBA 1VQNQ 1WXUA 3WVEB 1LNXA 4IUPA 5GJWB 4JRKA 1BU1A 1K0XA 1JRIA 2DEQA 4MZTA 3QWXX 2ZGWA 3NMZC 1OU9A 2KAFA 4DEXA 3QJYA 3OW2A 3RERA 2L3RA 4KRTA 4EMGA 4C5GA 2P4TA 2QQ9A 4CRIA 1KIKA 1IZ6A 2MWOA 1VQNA 1U1SA 2J7IA 2KE9A 1MNDA 2V26A 1R77A 1ABOA 4F7UF 1K8AR 2BIVA 1WJSA 1MMDA 2YHTA 4MZPA 1VQ6T 2DZ9A 3H41A 3JCMc 3HHTB 1B34A 1PCXA 2VV5A 3FB9A 1K73R 2CP3A 4TVRA 3OA6A 1IGQA 2XG8D 3C95A 5LJ5g 2HD0A 2JMCA 1NLPC 2P0PA 4M78B 3VU3C 5LL6S 4HT8A 3FRNA 4M77B 2CZ1B 3JCMV 5KYNA 1KC8U 2D0QB 1UGQB 3MCAB 4LXCA 4R0KA 4M78D 2NWMA 4DBQA 4M77D 2YUPA 4C0FA 1C6VX 2XMFA 4WTOB 2RHIA 3TEEA 2CH4A 3SB2A 1RUWA 3MP8A 1D0YA 3V8KA 3X24B 1VQOT 1VQ7T 4QQ6A 3CQTA 3NFCA 1Q81U 5GAN6 2M51A 2DJZA 1QCNA 3ZFJA 5GAOp 3RKXA 4N0AC 4BY6C 3M0UA 2JS2A 3C0CA 3M0TA 1I1JA 2C0IA 2RQTA 4BI3A 5GAN8 3J81E 4C0DC 3A8GB 2EIFA 2NUPA 2ESWA 4PJOB 1GCQC 3SD4A 4XU3A 2F2WA 3L1AA 3BE3A 2RN8A 3KBGA 2FB7A 1JU5C 3EAEA 3UA6A 5IXBA 4PJOD 5FW9A 3HFOA 3GNGA 5A2QE 1VQ4T 2V1RA 1OZ2A 2DD5A 3CC7Q 3ER0A 2OJ2A 1NJIC 4AG1C 1SHFA 1YITA 1MMAA 4DOWA 1OPKA 3CD6Q 1OX8A 2CSQA 1WDXA 2DPPB 3X25B 3JCMP 4RTYA 3MP1A 1KQ2A 4IUQA 3E9GA 2BE9B 1OZ3A 1QVGA 2VXEA 1X2QA 3EFOB 2OTJT 3R6NA 1XTDA 4J9IA 2DBKA 4RTXA 1KQSA 3GIBA 2K7AA 1WPYA 1XNIA 3KUFA 4F7UB 5GAN4 2D1XA 4DA4A 2JXBA 3C94A 3CC7A 1O75A 2MWPA 1G3SA 2YDLA 1YNZA 1UHFA 3CC4Q 3CCRT 1M1KC 5J3BA 3CD6A 5KYYB 3S3OA 4N4GA 4QQGA 4C92G 1AZEA 1PD0A 1BI2A 2RD1A 2R5MA 5DM7R 4OF1A 3RR6A 3L2UA 4FYYB 3L2WA 1ZA2B 3HL8A 2L89A 3JB9J 5CKBA 4C92F 3G71Q 2FO0A 2CP5A 3CXCP 2DO3A 3EG1A 4GLKA 2FHDA 3INZA 1Z9ZA 4M7AF 1SKUB 3EG3A 1VQMT 2CKKA 1AVZC 5IHNA 4M78E 2DYIA 1VQ5Q 4M77E 4JZ4A 1PRMC 2HKQB 3M0RA 4PLLA 5HK0A 1W2BS 2W10A 3RKWA 3CCMT 1UHCA 2J05A 5KYUB 1UDLA 4HCCA 1ZLMA 1Q95G 1RACB 3M5AA 4XQ3A 5CK9A 2PVDB 3CC4T 3GNFB 5GAN5 2RH2A 2EVRA 2Y4YA 3PMIA 3OYLA 4FCYA 2XDPA 3C12A 2DRKA 1VQ5A 2I2LA 3LH5A 1Q7YU 2EQIA 4O6JA 2LCSA 5CIUA 1UEBA 1WHGA 2CZ7B 1MHNA 4HCKA 3OYEA 2WACA 2MIOA 4PJOE 3OBYA 1AT1B 1UB4A 2E1HA 5LJ5j 1QP3A 1AWWA 5CAIA 3PT9A 3M55A 2RHYA 2XHCA 3PE0A 4F14A 2B86A 1TOVA 1KJWA 2KNBB 2K5FA 2M9UA 4J7FA 3T9NA 1VQKA 4CC2A 1R0BG 2O2OA 2E6NA 1I81A 2YLBA 1BCOA 1H92A 3OYIA 5FU7B 2L0AA 4B9XA 4J9GA 2CDTA 3NTHA 4L59A 2FEIA 3A8HB 3WVDB 1AZGB 1CKAA 3LX7A 2IVWA 3MEUA 5FU6B 3GPLA 1WYXA 2HNIA 4PNOA 3JAME 5I21A 5AYFA 4C8QC 2VASA 3JSCA 4F7UE 5EG2A 4JUVA 2RI2A 3PFSA 4OMLA 2PUKB 4UC4A 8AT1B 2QGFB 1X75C 3P8BB 2AK5A 3MO8A 4HXJA 1SRLA 4NS5A 4M78C 2H3JA 1RL2A
chains in the Genus database with same CATH topology
2KGTA 1T3LA 2KBTA 3THKA 1AWJA 1KSWA 2O31A 2YSQA 1JXOA 2FPDA 2C0OA 2DNUA 2DL7A 3U23A 1AD5A 2KYBA 3VRYA 1T3SA 4JZ3A 1W70A 1HD3A 1K4US 2KEAA 3UA7A 2JW4A 4EIKA 2KRMA 2KT1A 2DYBA 2VWFA 4J9EA 5IXFA 3JV3A 1M3CA 2VKNA 1GL5A 2A37A 1NYFA 4GBQA 5FWCA 2JM9A 1Y57A 2RPNA 5IHIA 1YWOA 2CUBA 2SEMA 4ZNXA 4DEYA 1AOJA 2D8JA 3SHWA 4J9DA 1RI9A 4X1VA 1TUCA 2JMAA 2RQVA 2G6FX 1GFCA 4IIMA 2K79A 2BZXA 2KXDA 2RF0A 2X3XD 1Z9QA 1PKSA 1JXMA 1PNJA 4LE9A 3I5RA 4OMNA 1W6XA 4JPBW 1UJYA 2ROTA 2YUQA 2A36A 1SSHA 2CUDA 4LUDA 4LN2A 5I11A 2CSIA 1SEMA 2EYWA 1AWXA 1TG0A 1G2BA 4HVVA 1UG1A 1GBRA 1E7OA 1N5ZA 2DA9A 1MUZA 1BBZA 1M27C 1JQQA 4ORZA 3FJ5A 2K9GA 1UECA 2AKLA 2P4RA 2V1QA 1U3OA 2RQWA 4Z8AA 1X27A 2LNHB 2J6OA 4LUEA 2CT4A 3IQLA 3GBQA 4RTZA 2GGRA 1UJ0A 2ED0A 2KRNA 1K76A 1VYVA 2H8HA 2EGEA 2J6KA 4AFUC 1V1CA 2KRSA 2D8HA 3REBB 2DL3A 1NM7A 1ARKA 3EHRA 3NPFA 1Y0MA 3UATA 1CSKA 2ECZA 1QCFA 1GCPA 4D8KA 2GNCA 5FWBA 1HSQA 2LQNA 1WXUA 3ULRB 2PNIA 5GJWB 1BU1A 1XOVA 1NEBA 2LMJA 1K0XA 4D8DA 1FYNA 2GQIA 4J9HA 3QWXX 2PZ1A 4AFSC 3NMZC 1WI7A 3VRZA 1K0SA 1WFWA 4DEXA 4RTVA 2EGCA 4FSSA 4AFQC 4KRTA 3PVQA 3KFVA 2JM8A 2ROLA 1PHTA 4CC7A 1KIKA 1M30A 2CH4W 2L3PA 2HCKA 1B3QA 2J7IA 2KE9A 1JEGA 1ZBJA 2GBQA 4F16A 1ABOA 2DILA 2DX1A 2KROA 2YUNA 2X3WD 2DJQA 4JJCA 3RNJA 1IO6A 2FRYA 1M8MA 2JT4A 2DL8A 1KFZA 2EGAA 2JS0A 1K9AA 1OV3A 3H41A 2O9SA 1VYTA 1MV3A 4HVWA 2GTJA 1I07A 2M0YA 4CC3A 1WIEA 1GRIA 1CKBA 2JMCA 1NLPC 1QLYA 1FMKA 3M0QA 3O5ZA 3ZL7C 2EYZA 1B07A 4R0KA 1EFNA 2D0NA 2NWMA 1WXBA 2F2VA 1LCKA 1OOTA 1X69A 2LJ0A 2YUPA 1T0JA 2A08A 2K3BA 2XMFA 3NHNA 2OI3A 2CH4A 1VA7A 4WCIA 1RUWA 3VS3A 1UE9A 2DE0X 1SPKA 3TSZA 2J6FA 2AKKA 2EKHA 2I0NA 2YUOA 4QT7A 3CQTA 1GBQA 2K6DA 2DLPA 2DL5A 1E6HA 2M51A 3H0IA 1BB9A 4RUGA 2BTTA 2K2MA 1RLQC 2F2XA 2DBMA 2YT6A 3M0UA 2HDAA 2JS2A 3C0CA 3M0TA 1I1JA 2C0IA 2RQTA 2DL4A 3EG2A 2NUZA 2ESWA 1T0HA 1GCQC 1ZX6A 2F2WA 3EGUA 2RN8A 3NGPA 1PKTA 2LZ6B 3RBBB 1W1FA 2ENMA 2RNAA 1JU5C 3UA6A 5IXBA 5I22A 4CC4B 5FW9A 1ZUUA 1RLPC 3TSWA 3REAB 2FPEA 5L23A 2V1RA 2AZSA 2OJ2A 2EW3A 3H0FA 4AG1C 1SHFA 2L3SA 2ABLA 1NEGA 1X43A 1OPKA 1U06A 3A98A 2CSQA 1WDXA 4RTYA 2LP5A 2OAWA 3VS4A 1SRMA 1UUEA 1X2QA 3R6NA 2HSPA 4IIOA 2BZ8A 4J9IA 2VVKA 5HCKA 2DBKA 1I0CA 4RTXA 1QKWA 2LQWA 1M3AA 2HEQA 2K7AA 1WLPB 3SEMA 3M0PA 1NLOC 2D1XA 4OMQA 3H0HA 2JXBA 1QWEA 1E6GA 2YDLA 1YNZA 1UHFA 2FPFA 2RQRA 1H3HA 1K1ZA 2LJ3A 1AWOA 1ABQA 4J9CA 1AZEA 1X2KA 2KT8A 4AFZC 3I5SA 1H8KA 4J9BA 1U5SA 1PRLC 2EYYA 1UTIA 2EYXA 4OMOA 2FO0A 3PVLA 3EG1A 2EPDA 1ZUKA 1X6BA 1X6GA 2BZYA 1Z9ZA 4RTTA 4E6RA 2DM1A 3EG3A 2DRMA 3VS6A 1AVZC 5IHNA 1MV0B 1UFFA 2FG0A 4Z88A 1ZSGA 1JO8A 3QWYA 4JZ4A 2O88A 2JTEA 1PRMC 3M0RA 2RQUA 1HJDA 2QDLA 2RMOA 2W10A 5GJVB 4K11A 5EC7A 1TUDA 1UHCA 1YCSB 2J05A 1UDLA 4RTUA 1YN8A 1ZLMA 1SHGA 2FRWA 1WA7A 2KYMA 2O9VA 2W0ZA 2GTOA 1UGVA 2EVRA 3VS5A 1OPLA 2KR3A 2IIMA 1ZUYA 4F17A 2DRKA 2LJ1A 4Z89A 1J3TA 3EG0A 4ESRA 3LH5A 2EQIA 2LCSA 1WXTA 1AEYA 1NG2A 1QKXA 2C0TA 2PTKA 4A63B 4HCKA 1YWPA 2HBWA 2MIOA 3VS1A 4Y92A 5IHKA 3M0SA 2SRCA 4AG2C 2DMOA 5ECAA 3TVTA 1A0NB 2CREA 1AWWA 2L2PA 2E5KA 3VS7A 2CT3A 3I35A 3I9QA 1YP5A 3UF4A 1S1NA 3PE0A 4M4ZA 4OMPA 4F14A 2B86A 2MOXA 1KJWA 2KNBB 1G83A 4CC2A 2L3QA 4HVUA 2O2OA 2A28A 2ED1A 1QWFA 3EHQA 1H92A 5IH2A 1BK2A 2L0AA 1OEBA 4JJDA 2DVJA 4J9GA 2DF6A 2LX7A 3VS0A 4RTWA 2CDTA 4LNPA 4JJBA 4J9FA 1M3BA 2FEIA 2MCNA 3VS2A 1AZGB 1NYGA 1CKAA 2J06A 1WYXA 1GCQA 1VYUA 4OMLA 2AZVA 2AK5A 1GFDA 1PWTA 4HXJA 1WX6A 4GLMA 1SRLA 2EBPA 2KXCA 4OMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGT A;  1T3L A;  2KBT A;  3THK A;  1AWJ A;  1KSW A;  2O31 A;  2YSQ A;  1JXO A;  2FPD A;  2C0O A;  2DNU A;  2DL7 A;  3U23 A;  1AD5 A;  2KYB A;  3VRY A;  1T3S A;  4JZ3 A;  1W70 A;  1HD3 A;  1K4U S;  2KEA A;  3UA7 A;  2JW4 A;  4EIK A;  2KRM A;  2KT1 A;  2DYB A;  2VWF A;  4J9E A;  5IXF A;  3JV3 A;  1M3C A;  2VKN A;  1GL5 A;  2A37 A;  1NYF A;  4GBQ A;  5FWC A;  2JM9 A;  1Y57 A;  2RPN A;  5IHI A;  1YWO A;  2CUB A;  2SEM A;  4ZNX A;  4DEY A;  1AOJ A;  2D8J A;  3SHW A;  4J9D A;  1RI9 A;  4X1V A;  1TUC A;  2JMA A;  2RQV A;  2G6F X;  1GFC A;  4IIM A;  2K79 A;  2BZX A;  2KXD A;  2RF0 A;  2X3X D;  1Z9Q A;  1PKS A;  1JXM A;  1PNJ A;  4LE9 A;  3I5R A;  4OMN A;  1W6X A;  4JPB W;  1UJY A;  2ROT A;  2YUQ A;  2A36 A;  1SSH A;  2CUD A;  4LUD A;  4LN2 A;  5I11 A;  2CSI A;  1SEM A;  2EYW A;  1AWX A;  1TG0 A;  1G2B A;  4HVV A;  1UG1 A;  1GBR A;  1E7O A;  1N5Z A;  2DA9 A;  1MUZ A;  1BBZ A;  1M27 C;  1JQQ A;  4ORZ A;  3FJ5 A;  2K9G A;  1UEC A;  2AKL A;  2P4R A;  2V1Q A;  1U3O A;  2RQW A;  4Z8A A;  1X27 A;  2LNH B;  2J6O A;  4LUE A;  2CT4 A;  3IQL A;  3GBQ A;  4RTZ A;  2GGR A;  1UJ0 A;  2ED0 A;  2KRN A;  1K76 A;  1VYV A;  2H8H A;  2EGE A;  2J6K A;  4AFU C;  1V1C A;  2KRS A;  2D8H A;  3REB B;  2DL3 A;  1NM7 A;  1ARK A;  3EHR A;  3NPF A;  1Y0M A;  3UAT A;  1CSK A;  2ECZ A;  1QCF A;  1GCP A;  4D8K A;  2GNC A;  5FWB A;  1HSQ A;  2LQN A;  1WXU A;  3ULR B;  2PNI A;  5GJW B;  1BU1 A;  1XOV A;  1NEB A;  2LMJ A;  1K0X A;  4D8D A;  1FYN A;  2GQI A;  4J9H A;  3QWX X;  2PZ1 A;  4AFS C;  3NMZ C;  1WI7 A;  3VRZ A;  1K0S A;  1WFW A;  4DEX A;  4RTV A;  2EGC A;  4FSS A;  4AFQ C;  4KRT A;  3PVQ A;  3KFV A;  2JM8 A;  2ROL A;  1PHT A;  4CC7 A;  1KIK A;  1M30 A;  2CH4 W;  2L3P A;  2HCK A;  1B3Q A;  2J7I A;  2KE9 A;  1JEG A;  1ZBJ A;  2GBQ A;  4F16 A;  1ABO A;  2DIL A;  2DX1 A;  2KRO A;  2YUN A;  2X3W D;  2DJQ A;  4JJC A;  3RNJ A;  1IO6 A;  2FRY A;  1M8M A;  2JT4 A;  2DL8 A;  1KFZ A;  2EGA A;  2JS0 A;  1K9A A;  1OV3 A;  3H41 A;  2O9S A;  1VYT A;  1MV3 A;  4HVW A;  2GTJ A;  1I07 A;  2M0Y A;  4CC3 A;  1WIE A;  1GRI A;  1CKB A;  2JMC A;  1NLP C;  1QLY A;  1FMK A;  3M0Q A;  3O5Z A;  3ZL7 C;  2EYZ A;  1B07 A;  4R0K A;  1EFN A;  2D0N A;  2NWM A;  1WXB A;  2F2V A;  1LCK A;  1OOT A;  1X69 A;  2LJ0 A;  2YUP A;  1T0J A;  2A08 A;  2K3B A;  2XMF A;  3NHN A;  2OI3 A;  2CH4 A;  1VA7 A;  4WCI A;  1RUW A;  3VS3 A;  1UE9 A;  2DE0 X;  1SPK A;  3TSZ A;  2J6F A;  2AKK A;  2EKH A;  2I0N A;  2YUO A;  4QT7 A;  3CQT A;  1GBQ A;  2K6D A;  2DLP A;  2DL5 A;  1E6H A;  2M51 A;  3H0I A;  1BB9 A;  4RUG A;  2BTT A;  2K2M A;  1RLQ C;  2F2X A;  2DBM A;  2YT6 A;  3M0U A;  2HDA A;  2JS2 A;  3C0C A;  3M0T A;  1I1J A;  2C0I A;  2RQT A;  2DL4 A;  3EG2 A;  2NUZ A;  2ESW A;  1T0H A;  1GCQ C;  1ZX6 A;  2F2W A;  3EGU A;  2RN8 A;  3NGP A;  1PKT A;  2LZ6 B;  3RBB B;  1W1F A;  2ENM A;  2RNA A;  1JU5 C;  3UA6 A;  5IXB A;  5I22 A;  4CC4 B;  5FW9 A;  1ZUU A;  1RLP C;  3TSW A;  3REA B;  2FPE A;  5L23 A;  2V1R A;  2AZS A;  2OJ2 A;  2EW3 A;  3H0F A;  4AG1 C;  1SHF A;  2L3S A;  2ABL A;  1NEG A;  1X43 A;  1OPK A;  1U06 A;  3A98 A;  2CSQ A;  1WDX A;  4RTY A;  2LP5 A;  2OAW A;  3VS4 A;  1SRM A;  1UUE A;  1X2Q A;  3R6N A;  2HSP A;  4IIO A;  2BZ8 A;  4J9I A;  2VVK A;  5HCK A;  2DBK A;  1I0C A;  4RTX A;  1QKW A;  2LQW A;  1M3A A;  2HEQ A;  2K7A A;  1WLP B;  3SEM A;  3M0P A;  1NLO C;  2D1X A;  4OMQ A;  3H0H A;  2JXB A;  1QWE A;  1E6G A;  2YDL A;  1YNZ A;  1UHF A;  2FPF A;  2RQR A;  1H3H A;  1K1Z A;  2LJ3 A;  1AWO A;  1ABQ A;  4J9C A;  1AZE A;  1X2K A;  2KT8 A;  4AFZ C;  3I5S A;  1H8K A;  4J9B A;  1U5S A;  1PRL C;  2EYY A;  1UTI A;  2EYX A;  4OMO A;  2FO0 A;  3PVL A;  3EG1 A;  2EPD A;  1ZUK A;  1X6B A;  1X6G A;  2BZY A;  1Z9Z A;  4RTT A;  4E6R A;  2DM1 A;  3EG3 A;  2DRM A;  3VS6 A;  1AVZ C;  5IHN A;  1MV0 B;  1UFF A;  2FG0 A;  4Z88 A;  1ZSG A;  1JO8 A;  3QWY A;  4JZ4 A;  2O88 A;  2JTE A;  1PRM C;  3M0R A;  2RQU A;  1HJD A;  2QDL A;  2RMO A;  2W10 A;  5GJV B;  4K11 A;  5EC7 A;  1TUD A;  1UHC A;  1YCS B;  2J05 A;  1UDL A;  4RTU A;  1YN8 A;  1ZLM A;  1SHG A;  2FRW A;  1WA7 A;  2KYM A;  2O9V A;  2W0Z A;  2GTO A;  1UGV A;  2EVR A;  3VS5 A;  1OPL A;  2KR3 A;  2IIM A;  1ZUY A;  4F17 A;  2DRK A;  2LJ1 A;  4Z89 A;  1J3T A;  3EG0 A;  4ESR A;  3LH5 A;  2EQI A;  2LCS A;  1WXT A;  1AEY A;  1NG2 A;  1QKX A;  2C0T A;  2PTK A;  4A63 B;  4HCK A;  1YWP A;  2HBW A;  2MIO A;  3VS1 A;  4Y92 A;  5IHK A;  3M0S A;  2SRC A;  4AG2 C;  2DMO A;  5ECA A;  3TVT A;  1A0N B;  2CRE A;  1AWW A;  2L2P A;  2E5K A;  3VS7 A;  2CT3 A;  3I35 A;  3I9Q A;  1YP5 A;  3UF4 A;  1S1N A;  3PE0 A;  4M4Z A;  4OMP A;  4F14 A;  2B86 A;  2MOX A;  1KJW A;  2KNB B;  1G83 A;  4CC2 A;  2L3Q A;  4HVU A;  2O2O A;  2A28 A;  2ED1 A;  1QWF A;  3EHQ A;  1H92 A;  5IH2 A;  1BK2 A;  2L0A A;  1OEB A;  4JJD A;  2DVJ A;  4J9G A;  2DF6 A;  2LX7 A;  3VS0 A;  4RTW A;  2CDT A;  4LNP A;  4JJB A;  4J9F A;  1M3B A;  2FEI A;  2MCN A;  3VS2 A;  1AZG B;  1NYG A;  1CKA A;  2J06 A;  1WYX A;  1GCQ A;  1VYU A;  4OML A;  2AZV A;  2AK5 A;  1GFD A;  1PWT A;  4HXJ A;  1WX6 A;  4GLM A;  1SRL A;  2EBP A;  2KXC A;  4OMM A; 
#chains in the Genus database with same CATH topology
 2KK4 A;  4M77 C;  2V8J A;  4ME7 A;  4KGX B;  2KBT A;  4QVC A;  2RJC A;  2QA4 A;  4M7A D;  3CBM A;  2O31 A;  5LJ5 f;  4Y91 A;  2C0O A;  1AD5 A;  4OGC A;  4CI0 C;  3EGX A;  3VRY A;  1T3S A;  3I56 Q;  1TWB A;  1HD3 A;  3PNW C;  1NPP A;  3A5Z B;  4FU6 A;  2ZPE B;  4J83 A;  1KHC A;  2VWF A;  4M75 A;  3RES A;  5IXF A;  4NL3 A;  1HK9 A;  1RAG B;  2A37 A;  4GBQ A;  3CCJ T;  5HK3 A;  2P0K A;  1BI1 A;  2CUB A;  4PFP A;  3OYN A;  4PJO C;  5I2M A;  1VQ8 Q;  5IN1 A;  1LOJ A;  2D8J A;  3SHW A;  1RI9 A;  1M1G A;  2JMA A;  2EWN A;  4XTW A;  2ZCF B;  2ZPF B;  3OW2 S;  1YJN T;  4IIM A;  4J6W A;  3OY9 A;  2F1L A;  2X3X D;  4LE9 A;  1PNJ A;  3I5R A;  3LWH A;  1UJY A;  2A36 A;  4LN2 A;  3CCE A;  3M4G A;  1TG0 A;  4L5G A;  1YI2 Q;  2JOY A;  1GBR A;  1E7O A;  3DLM A;  1PC0 A;  4KUI A;  1N5Z A;  5GAN d;  4BE1 A;  5GAO n;  1BBZ A;  4MDX A;  3DKM A;  5GMK l;  4C5I A;  3M9Q A;  3QJ6 A;  3I56 T;  1VQ8 A;  3FJ5 A;  2CYZ B;  1QVF P;  1OI1 A;  3S3M A;  1ZSZ B;  1YJ9 T;  2P4R A;  2WSF E;  1RAA B;  2LNH B;  4XTZ A;  3J80 E;  4IUR A;  2VC8 A;  3MP6 A;  4PK4 A;  1LJO A;  4LDU A;  2E64 A;  5D6Y A;  1WQ7 A;  2H8H A;  1OQK A;  3G6E Q;  1WZO A;  1F1B B;  2X9H A;  4AFU C;  3CMA T;  3RKY A;  5AT1 B;  1WHJ A;  1JB0 E;  3UAT A;  1QCF A;  1M4Z A;  1N9S A;  2ZPH B;  2LQN A;  1KG1 A;  1JBM A;  2QAZ A;  1TSF A;  3CCS Q;  1YI2 T;  2LMJ A;  2Y90 A;  4D8D A;  1WQW A;  2DKG A;  2GQI A;  3LW5 E;  4RG8 A;  2PZ1 A;  3EFO A;  1WI7 A;  1DJ7 B;  1WFW A;  4PJM A;  4D6W A;  3G6E A;  1IHV A;  1H64 1;  3JB9 I;  1N8R C;  5KYX A;  4M7A E;  4JLI A;  5CR2 A;  2EJF A;  3L2Z A;  2CH4 W;  5LJ5 h;  2HCK A;  3TQ7 P;  1ZBJ A;  3ZBD A;  1M1K R;  3CCS A;  2HL3 A;  3OYK A;  1Q81 R;  2DX1 A;  2KRO A;  2YUN A;  3ZEH A;  3FDR A;  1K9M U;  2QTV A;  3MPU B;  4E2F B;  2E41 A;  1M8M A;  3CCL Q;  2DEU A;  2R5A A;  2ZAE A;  1XJW B;  2RHU A;  1OV3 A;  2DTO A;  4C8Q G;  4HVW A;  4LD9 K;  2GTJ A;  2MI6 A;  5A0G A;  4CC3 A;  1WIE A;  3DB3 A;  1TU0 B;  2JTF A;  3G4S Q;  3SWN B;  3BDL A;  4C8Q F;  1QLY A;  1FMK A;  3I55 T;  2KY9 A;  2EYZ A;  4M78 G;  1B07 A;  2LRQ A;  3HSB A;  1QVG S;  3EG9 B;  1WXB A;  4M77 G;  1LCK A;  3CCL A;  2JTM A;  3JRZ A;  2A08 A;  2K3B A;  2OI3 A;  1KQS S;  4E47 A;  3KXT A;  3L2Q A;  4M78 F;  3VV0 A;  3VS3 A;  4P5N A;  1Y7X A;  1SPK A;  2H3E B;  2HSE B;  3CPW P;  4HKE A;  2EKH A;  1G5V A;  2YUO A;  3G4S A;  4C5E A;  4DQ2 A;  2DLP A;  5GAN 2;  3CXC A;  3L2V A;  4PL6 A;  4RUG A;  5CQX A;  2K2M A;  1UGP B;  1YHQ T;  1M2V B;  2F2X A;  4KGV B;  5FU6 C;  3CCQ T;  2HDA A;  2FZC B;  1GXI E;  2NUZ A;  2OTL Q;  2JJ9 A;  2DER A;  3NGP A;  1PKT A;  2R58 A;  4HCZ A;  3RBB B;  1W1F A;  4PJO G;  5I22 A;  4M7A C;  2DIG A;  1ZUU A;  4BAC A;  2XKO C;  3REA B;  2AZS A;  2X4Y A;  3VKI A;  4PJO F;  8ATC B;  5GAN g;  1X43 A;  5GAO q;  1U06 A;  3A98 A;  2XDB A;  4DOV A;  2MF2 A;  2OTL A;  5GAN 7;  2F5K A;  1IRX A;  2LP5 A;  2E10 A;  1BIA A;  2NLU A;  4PLI A;  3LWI A;  1ZBX A;  2HSP A;  1WHM A;  2VVK A;  4AT1 B;  1QKW A;  2HEQ A;  1WLP B;  4NL2 A;  2YLC A;  2LC4 A;  3UWN A;  1NLO C;  1KD1 U;  1Q82 C;  4C92 A;  3H0H A;  3VJP A;  3X28 B;  2V8I A;  4F7U G;  2RQR A;  4Y28 E;  2EQK A;  4M7A A;  2OX7 A;  2LJ3 A;  1H3Z A;  3PTA A;  4J9C A;  3QPH A;  1QMC A;  3TU4 K;  2M0O A;  1U5S A;  4C8Q B;  1MMG A;  4XAX B;  1VQN T;  1X6B A;  4E7I A;  1G3Y A;  4C8Q D;  1D3B A;  2O01 E;  2O4X A;  2DRM A;  1PSE A;  1VOM A;  4ATO A;  1ZSG A;  2L8D A;  3HTR A;  3CCV Q;  4LDW A;  2B8A A;  2QDL A;  2RMO A;  3QDF A;  4K11 A;  4E7L A;  5EC7 A;  1TUD A;  1ZSZ C;  2XU8 A;  3HRU A;  5CCA A;  2RJD A;  1C0M A;  1YN8 A;  5GAN 3;  1UGS B;  1WA7 A;  4XU0 A;  2O9V A;  3EFR A;  2W0Z A;  1OU8 A;  3VS5 A;  1QW1 A;  1FWZ A;  3GP8 A;  2IIM A;  1ZUY A;  2LCC A;  4Z89 A;  2QQS A;  1Y96 B;  3CCV A;  3M53 A;  1WXT A;  4MZM A;  2R57 A;  1QKX A;  2YRC A;  1YIT Q;  3CPF A;  3Q1J A;  4L6V 5;  2PUO B;  3VS1 A;  3JB9 D;  2SRC A;  2DMO A;  2CRE A;  1IGU A;  3QYH B;  3VUZ A;  2L2P A;  3MHX A;  3VS7 A;  4IKF A;  2CT3 A;  3I9Q A;  4M7D B;  2MOX A;  2QEX Q;  3NTI A;  2LT1 A;  4OMF B;  4R55 A;  1X6O A;  1G83 A;  4M7D D;  2L5Q A;  1QWF A;  1IHW A;  4FW2 A;  4JJN K;  1BK2 A;  4JJD A;  1OX9 A;  4EMK B;  4MDW A;  4AMC A;  1KC8 C;  2Y4X A;  5KH6 A;  4N0A A;  2PQW A;  2OAU A;  3CC2 Q;  2QXF A;  3N5B B;  3QO3 A;  2QEX A;  1GCQ A;  2AHJ B;  2KVQ G;  3QYG B;  2NUT B;  2K4Y A;  1VYU A;  3HPW A;  4BDZ A;  1YIT T;  2CP0 A;  3UT1 A;  1G3W A;  2QYZ A;  2YXY A;  1QVF A;  1Q81 C;  2EBP A;  2AIR B;  1N8R R;  4OMM A;  1BI3 A;  3SWN C;  2JNG A;  4X9D A;  1AHJ B;  1M90 U;  1BKB A;  3H8Z A;  3P8D A;  3THK A;  1SG5 A;  4M7A G;  2DZC A;  3CC2 A;  2FL7 A;  4C8Q E;  1KSW A;  3CC7 T;  4ELY C;  4PKC C;  1JXO A;  3RUX A;  4NOY A;  4JLG A;  2FPD A;  2DNU A;  1Q86 U;  3U23 A;  1JJ2 P;  3CD6 T;  4BE2 A;  4FSX A;  5GAN j;  4JRP A;  3RMQ A;  1W70 A;  1FXX A;  5GMK m;  4QKU A;  2HMA A;  1FX7 A;  3CCM A;  3UA7 A;  2LDM A;  3GLX A;  2JW4 A;  3X20 B;  2KRM A;  5KYW A;  1SF9 A;  3JV3 A;  2COY A;  3HKS A;  3R6O A;  1NYF A;  5CQY A;  3EGD A;  4N4H A;  4FM4 B;  3OS1 A;  4WF2 A;  2SEM A;  2DK3 A;  4XU2 A;  4DEY A;  1VQP Q;  3EG9 A;  4J9D A;  1B7T A;  1OUL A;  2K79 A;  2BZX A;  2LT4 A;  1PKS A;  1JXM A;  1SSF A;  1W6X A;  4JPB W;  2F69 A;  3G71 T;  1SSH A;  1VQK Q;  2CSI A;  1SEM A;  2EYW A;  2QDY B;  1KQ1 A;  4ZTF A;  3RIR A;  2X4W A;  3HRT A;  5FRO A;  5DY9 A;  4PFO A;  4RKU E;  3QSU A;  3BW1 A;  1VQP A;  1VQ5 T;  4ORZ A;  2K9G A;  3OS0 A;  2GCX A;  2AKL A;  1M2V A;  4J6Y A;  3PIO A;  1K8A U;  3CME Q;  1U3O A;  4M7D E;  1ZA1 B;  1X27 A;  2J6O A;  5GAN f;  2GGR A;  1K73 U;  2KRN A;  5J39 A;  1U8R A;  2HZY A;  2D8H A;  3REB B;  2DL3 A;  1NM7 A;  1BCM A;  1ARK A;  3NPF A;  1Y0M A;  2QA4 Q;  2RA2 A;  3CME A;  2XDD A;  1VQ9 A;  4JRQ A;  2GNC A;  3UDC A;  1VQK T;  3CPW A;  1HSQ A;  4MMK A;  3ULR B;  1YJW A;  2RK2 A;  4BE0 A;  2BUD A;  2DXB A;  4Z02 A;  5CKE A;  3VRZ A;  5FLX E;  1K0S A;  3M58 A;  3OYM A;  3FIF A;  4RTV A;  2EGC A;  3VYG A;  1Q7Y C;  5GMK j;  2K5I A;  3CXC S;  1PHT A;  1Q82 R;  5CKD A;  4PJL A;  1RAI B;  3CBP A;  3LGF A;  1B3Q A;  2E3H A;  2GBQ A;  4F16 A;  4HA8 A;  4RG2 A;  2X3W D;  2CP2 A;  5D7U A;  4A4G A;  2DJQ A;  4C8Q A;  1M8V A;  4JJC A;  4GY5 A;  2JT4 A;  2DL8 A;  1KFZ A;  2EGA A;  1D09 B;  1M1F A;  1YIJ A;  1BIB A;  2O9S A;  1ZHI A;  1VYT A;  4N4I A;  3CCE Q;  4BI4 A;  3OSV A;  2EYQ A;  1B34 B;  1U1T A;  2FZK B;  3CEY A;  4M78 A;  2M0Y A;  2CZ0 B;  4M77 A;  1CKB A;  5GAN e;  2QG9 B;  4BB7 A;  5CO7 A;  3O5Z A;  2RJE A;  3DB4 A;  4C0Z A;  1TXQ A;  1OOT A;  1TS9 A;  1X69 A;  2EJG A;  2VGM A;  4M7D C;  1T0J A;  4A4E A;  1M5Q 1;  5L8R E;  3NHN A;  3QDR B;  1VA7 A;  4WCI A;  1RAF B;  1UE9 A;  5A0D A;  2J6F A;  5GAM j;  2I0N A;  2K5L A;  1Y96 A;  5KCH A;  1GBQ A;  3LH0 A;  2FVU A;  2DL5 A;  4EMK C;  3H0I A;  2RO0 A;  3FLG A;  3CCU A;  3PIP A;  2DBM A;  4ZN3 A;  5GAN h;  2YT6 A;  3CCE T;  4PJO A;  2DL4 A;  2RM4 A;  1LVK A;  1N9R A;  2YWW A;  1ZX6 A;  3DLL A;  2NUP B;  1IXD A;  2LZ6 B;  2FZG B;  1VQ8 T;  1RI0 A;  4ANJ A;  4CC4 B;  3VUB A;  1RLP C;  3QG1 A;  2FPE A;  5IAY A;  4JRI A;  1VQL Q;  2DTI A;  4EDU A;  4E7Z A;  2EW3 A;  3H0F A;  1S72 Q;  3TRE A;  4FYX B;  1NEG A;  1YBY A;  4EMK A;  4IUT A;  2EKO A;  3WXM B;  2OAW A;  1KC8 R;  3VS4 A;  3H6Z A;  3OYY A;  2NYS A;  4IIO A;  4F7U A;  5HCK A;  2HBP A;  3SEM A;  5GAM f;  1QP2 A;  1VQL A;  3M0P A;  3V8J A;  4OMQ A;  3L42 A;  1I5O B;  1QWE A;  5DLO A;  3JCM Q;  4ELZ C;  1S72 A;  1LPL A;  1R0C B;  5CKF A;  2FPF A;  4KH1 B;  5KYY A;  1H3H A;  1K1Z A;  2MPX C;  4LD6 A;  4XU1 A;  3G6E T;  4DBF A;  1RAB B;  1R8O B;  2KT8 A;  5GMK e;  3I5S A;  1H8K A;  3FJP A;  2VB6 A;  1PRL C;  2EYY A;  4OMO A;  3PVL A;  4F04 B;  1ZUK A;  3OYH A;  1X6G A;  2BZY A;  2MYS A;  4RTT A;  2DVE A;  4XTU A;  4E6R A;  3CCS T;  2RHZ A;  3VS6 A;  1UFF A;  2CS7 A;  4Z88 A;  1JO8 A;  2O88 A;  2JTE A;  2DXC A;  1HJD A;  5KYU A;  4B6M A;  1YCS B;  4RTU A;  1SHG A;  2EQM A;  3JCM b;  2KYM A;  5GMK h;  2GTO A;  1UGV A;  1MMN A;  4Q5W A;  1OPL A;  2KR3 A;  2F5T X;  4II1 A;  5DLQ E;  1VIF A;  3RMS A;  1QVF S;  1J3T A;  2X4X A;  3EG0 A;  4ESR A;  1FMV A;  5GMK i;  3CCL T;  4BUG A;  3EH1 A;  4XTY A;  3LGL A;  1ZQ1 A;  1AEY A;  1NG2 A;  2C0T A;  1JJ2 A;  2HBW A;  5GAM e;  2DIQ A;  5GAO l;  1WGS A;  3JB9 G;  4OVA A;  4Y92 A;  3JCM X;  5IHK A;  3M0S A;  4AG2 C;  5ECA A;  3G4S T;  1K9M C;  1QQJ A;  3TVT A;  2HQH A;  2ZPB B;  1M90 R;  3I35 A;  1VUB A;  3UF4 A;  3JB9 F;  2EFI A;  2HQE A;  4PJN A;  1UGR B;  4E7K A;  1D0Z A;  3QKJ A;  4M7D G;  3MEA A;  2L3Q A;  3OYB A;  1Q86 R;  2RK1 A;  2ED1 A;  5GAM d;  1Y07 A;  2YRD A;  3EHQ A;  4LDY A;  2RI3 A;  1OEB A;  2BKD N;  2DVJ A;  4M7D F;  4VUB A;  2LX7 A;  3HP9 A;  3VS0 A;  4RTW A;  4LNP A;  2E12 A;  1M3B A;  2MCN A;  1YCY A;  3VS2 A;  1NYG A;  5GAM h;  2J06 A;  2GFU A;  1PD1 A;  1I5L A;  4MML A;  3QII A;  1D0X A;  2OTL T;  1PWT A;  3OS5 A;  1WX6 A;  2CGH A;  2KXC A;  4OP0 A;  1Q7Y R;  1AWJ A;  5HY6 A;  1VQ6 A;  2ATC B;  2E6Z A;  2YSQ A;  3E19 A;  3BFM A;  2LQK A;  3EFS A;  4BDY A;  3OBW A;  1VQO Q;  1VQ7 Q;  2KYB A;  5C0M A;  2FYK A;  2QGG A;  3EGX B;  1TUG B;  3GF5 A;  1RAE B;  2KEA A;  4KUL A;  2E5Q A;  2D6F A;  3V7R A;  3JCM g;  4J9E A;  1NJI U;  5GAO r;  1M3C A;  2PU9 B;  2VKN A;  1RAH B;  3AT1 B;  1GL5 A;  3CPW S;  3LLR A;  4M75 B;  2VXF A;  2A7Y A;  5FWC A;  1VQO A;  1Y57 A;  3CBO A;  4FL6 A;  4XTV A;  3PGG A;  1VQ7 A;  2IPO B;  4QW2 A;  4QVD A;  3SFM A;  4M75 D;  2XI9 A;  1EZZ B;  3P8H A;  2ZZD A;  3OYD A;  4FT4 A;  1W2B P;  1VQ4 Q;  2KXD A;  3J7A F;  3GOX A;  4OMN A;  3A8L B;  2E70 A;  1KD1 C;  2CUD A;  3OMC A;  5I11 A;  2EJ9 A;  4HVV A;  4JDS A;  1G3T A;  1M1K U;  4O5V A;  2DA9 A;  9ATC B;  2KSS A;  1BYM A;  2K3X A;  4IUV A;  1M27 C;  4QQD A;  2OTJ Q;  1ZSZ A;  3E1S A;  3HRS A;  3CCV T;  1XQH A;  1WHH A;  1FMW A;  1QCO A;  2A3L A;  3OB9 A;  1VQ4 A;  3BY7 A;  4Z8A A;  4LUE A;  4C0G A;  2CT4 A;  4KH0 B;  3IQL A;  3GBQ A;  4RTZ A;  3V7C A;  3CCR Q;  2ED0 A;  1KHI A;  2HL5 C;  1N27 A;  1K76 A;  2XK0 A;  2DFU A;  2XD0 A;  2EGE A;  1W4S A;  3L2R A;  2M1H A;  2LX9 A;  2KRS A;  5LJ3 g;  2RJF A;  2OTJ A;  2KQW A;  3LYI A;  6AT1 B;  3UPU A;  5FRN A;  4PFZ A;  1CSK A;  2C06 A;  2GF7 A;  5M9O A;  2LTO A;  5D6W A;  2LQ8 A;  2Z0W A;  2PNI A;  3A8O B;  1XOV A;  1NEB A;  1VQM Q;  1FYN A;  4J9H A;  1MNE A;  1V29 B;  3CCR A;  1HXD A;  4AFS C;  1TH7 A;  3O8V A;  4J8O A;  1ACM B;  4FSS A;  4AFQ C;  2K57 A;  5KYX B;  3OYF A;  3PVQ A;  4FYV B;  3CCM Q;  3KFV A;  2JM8 A;  2ROL A;  3E2U A;  2QEX T;  3A1P A;  4CC7 A;  2VUB A;  1N6A A;  5GAM g;  1M30 A;  2L3P A;  1JEG A;  2QQR A;  2CZ6 B;  2HKN A;  4DBR A;  2KDS A;  1VQM A;  2DIL A;  5KCO A;  1I4K 1;  2QK0 A;  4HCB A;  3RNJ A;  1IO6 A;  3OYJ A;  2FRY A;  4V2S A;  2JS0 A;  3D7S B;  4ZN1 A;  3CC2 T;  1D1A A;  1K9A A;  4XTX A;  2RI5 A;  1EX4 A;  5J26 A;  2K2V A;  3HFN A;  1MV3 A;  1I07 A;  3OS2 A;  3SWN A;  1GRI A;  3QHS A;  3CC4 A;  3X26 B;  4M75 E;  4A4H A;  2DET A;  3M0Q A;  3M59 A;  3A8M B;  3ZL7 C;  3TCJ A;  1EFN A;  2D0N A;  2F2V A;  4ZTJ A;  2LJ0 A;  3ASK A;  1D1B A;  2YRV A;  3G71 A;  2EQU A;  3BDU A;  2BE7 D;  4JS4 A;  2DE0 X;  3TSZ A;  3MJX A;  2AKK A;  2A0F B;  4QT7 A;  2COW A;  1HYO A;  2K6D A;  1E6H A;  1M90 C;  4KUD K;  2JVV A;  1BB9 A;  1NPR A;  3F70 A;  3PMT A;  1V76 A;  2BTT A;  3OW2 P;  3EH2 A;  1VQ9 Q;  3URG A;  1RLQ C;  4BD3 A;  2RHX A;  2MMP A;  1YJW Q;  3EG2 A;  2WSC E;  1Q86 C;  1T0H A;  3EGU A;  1K9M R;  3G1J A;  4OGE A;  1VQP T;  1KK7 A;  2ENM A;  2RNA A;  2DXT A;  2G3R A;  3TSW A;  5L23 A;  2EAY A;  2CP7 A;  2L3S A;  2ABL A;  3JCM J;  3M4Y A;  3JCM W;  4ZGD B;  3FEO A;  4C5H A;  7AT1 B;  3AHU A;  1SRM A;  1UUE A;  1PSF A;  2BZ8 A;  1G8X A;  1YIJ Q;  1I0C A;  2LQW A;  1M3A A;  3OSS C;  3V7S A;  3CME T;  2K3Y A;  1VQ9 T;  2KI7 A;  4LDX A;  4KGZ B;  1M2O A;  1E6G A;  1YJW T;  4C92 B;  3CCJ Q;  1JJ2 S;  1AWO A;  4FT2 A;  4M75 C;  1ABQ A;  2V8K A;  4FIB A;  4RCC A;  3QUI A;  4C92 D;  1X2K A;  1Y71 A;  1K8A C;  4AFZ C;  4KBM B;  1YJN Q;  4JS5 A;  1WHK A;  4J9B A;  2QA4 T;  5LJ3 j;  1I8F A;  1UTI A;  2EYX A;  3JCM f;  3V8L A;  2EPD A;  2QQA A;  4XK8 E;  1K73 C;  1P92 A;  2VGN A;  2DM1 A;  3CCJ A;  2JUF A;  1D3B B;  5GAO m;  2O4X B;  4J7I A;  1MV0 B;  2FG0 A;  2DTH A;  2M16 A;  3QWY A;  2XIC A;  2JN0 A;  1YJ9 Q;  2RQU A;  1YIJ T;  5FRM A;  3CCU Q;  1YJN A;  4OB0 B;  5GJV B;  2QQB A;  2KMT A;  1RAD B;  4PJJ A;  2MK5 A;  4OB1 B;  2PVG B;  2FRW A;  3JB9 H;  3QBY A;  4X34 A;  3MET A;  4BI8 B;  2DD4 A;  4YTL A;  4J6X A;  3CMA Q;  4F17 A;  2LJ1 A;  2QAS A;  3RDV A;  4ZGJ B;  2QI2 A;  3M57 A;  5KE3 A;  3I56 A;  1N8R U;  2IG0 A;  1X01 A;  2JZ2 A;  5C6S A;  1YJ9 A;  2P84 A;  1QVG P;  1NZ9 A;  2COZ A;  1KD1 R;  3OQ5 A;  2XID A;  4FW1 A;  2PTK A;  4A63 B;  1YWP A;  3MKD A;  3M54 A;  4RCB A;  3OYC A;  1KQS P;  4ZGE B;  2DAQ A;  4OB2 B;  4IUU A;  3C4S A;  1WHL A;  1A0N B;  4B9W A;  5LJ3 f;  4M7D A;  2E5K A;  3CMA A;  1TTH B;  1YP5 A;  4E7H A;  1S1N A;  4M4Z A;  3CCU T;  4OMP A;  3QZ5 B;  1PM3 A;  5D6X A;  1M9S A;  4E7J A;  4HVU A;  2A28 A;  3OYA A;  1YI2 A;  3JCM e;  5IH2 A;  1YFN A;  3G7Z A;  2DF6 A;  5LJ5 e;  2CP6 A;  1W2B A;  4JJB A;  3S3N A;  4J9F A;  4KT0 E;  4BY6 B;  2NUT A;  5CKH A;  1NJI R;  1MGQ A;  4C0D B;  4A4F A;  2X51 A;  3H9N A;  2E4H A;  3JCM d;  4C92 E;  2AZV A;  1GFD A;  3QZ9 B;  1WJQ A;  5LJ5 d;  3I55 Q;  4GLM A;  4QVZ A;  1VIE A;  2LVM A;  2KGT A;  2RB6 A;  5CVI A;  1O9S A;  1T3L A;  2LCL A;  3E9F A;  3JCM h;  1VQL T;  2MAM A;  4EMH A;  2HQX A;  1S72 T;  4E7S A;  2DL7 A;  2X4J A;  3M56 A;  5KE2 A;  2X35 A;  1WNL A;  2ZPI B;  1PG5 B;  3I55 A;  1BI0 A;  4FYW B;  2HAX A;  3OMG A;  3ME9 A;  4JZ3 A;  2E65 A;  3VYH B;  1K4U S;  5LJ3 e;  4J5Y A;  1YHQ Q;  1EIF A;  4EIK A;  3CCQ Q;  2KT1 A;  3OYG A;  2DYB A;  4LDV A;  1NE8 A;  5KYW B;  5IT9 E;  2GQV A;  4M7A B;  2LNV A;  2JM9 A;  2RPN A;  5IHI A;  1YWO A;  3EGD B;  4ZNX A;  1AOJ A;  4M75 G;  4X1V A;  5HKC A;  1TUC A;  2RQV A;  2G6F X;  1GFC A;  2AT1 B;  2P0Q A;  4DBH A;  2GFA A;  2RF0 A;  5LJ3 d;  1Z9Q A;  3SDZ A;  2QTX A;  2M02 A;  4M75 F;  4X9C A;  1QVP A;  2ROT A;  1D1C A;  2YUQ A;  3NTK A;  4A4K A;  1YHQ A;  4LUD A;  1Q82 U;  5I2S A;  3CCQ A;  3MEW A;  1AWX A;  1OYX A;  4M77 F;  1G2B A;  4EPC A;  1UG1 A;  3FC3 A;  1MUZ A;  5LJ3 h;  5FU7 C;  2WSE E;  2E3I A;  2D9T A;  1JQQ A;  4OB3 B;  1C1A A;  1WJR A;  3S6W A;  1UEC A;  1NBE B;  2V1Q A;  2VYT A;  2ZPG B;  2RQW A;  2DXU A;  4HT9 A;  1UJ0 A;  5A0L A;  2EQJ A;  4A53 A;  4C92 C;  1VYV A;  1IRE B;  4A54 A;  2J6K A;  3QXE B;  1V1C A;  3MEV A;  1IB8 A;  3EHR A;  4R56 A;  2PVO B;  1VQ6 Q;  2ECZ A;  1GCP A;  4D8K A;  4RMO A;  5FWB A;  1VQN Q;  1WXU A;  3WVE B;  1LNX A;  4IUP A;  5GJW B;  4JRK A;  1BU1 A;  1K0X A;  1JRI A;  2DEQ A;  4MZT A;  3QWX X;  2ZGW A;  3NMZ C;  1OU9 A;  2KAF A;  4DEX A;  3QJY A;  3OW2 A;  3RER A;  2L3R A;  4KRT A;  4EMG A;  4C5G A;  2P4T A;  2QQ9 A;  4CRI A;  1KIK A;  1IZ6 A;  2MWO A;  1VQN A;  1U1S A;  2J7I A;  2KE9 A;  1MND A;  2V26 A;  1R77 A;  1ABO A;  4F7U F;  1K8A R;  2BIV A;  1WJS A;  1MMD A;  2YHT A;  4MZP A;  1VQ6 T;  2DZ9 A;  3H41 A;  3JCM c;  3HHT B;  1B34 A;  1PCX A;  2VV5 A;  3FB9 A;  1K73 R;  2CP3 A;  4TVR A;  3OA6 A;  1IGQ A;  2XG8 D;  3C95 A;  5LJ5 g;  2HD0 A;  2JMC A;  1NLP C;  2P0P A;  4M78 B;  3VU3 C;  5LL6 S;  4HT8 A;  3FRN A;  4M77 B;  2CZ1 B;  3JCM V;  5KYN A;  1KC8 U;  2D0Q B;  1UGQ B;  3MCA B;  4LXC A;  4R0K A;  4M78 D;  2NWM A;  4DBQ A;  4M77 D;  2YUP A;  4C0F A;  1C6V X;  2XMF A;  4WTO B;  2RHI A;  3TEE A;  2CH4 A;  3SB2 A;  1RUW A;  3MP8 A;  1D0Y A;  3V8K A;  3X24 B;  1VQO T;  1VQ7 T;  4QQ6 A;  3CQT A;  3NFC A;  1Q81 U;  5GAN 6;  2M51 A;  2DJZ A;  1QCN A;  3ZFJ A;  5GAO p;  3RKX A;  4N0A C;  4BY6 C;  3M0U A;  2JS2 A;  3C0C A;  3M0T A;  1I1J A;  2C0I A;  2RQT A;  4BI3 A;  5GAN 8;  3J81 E;  4C0D C;  3A8G B;  2EIF A;  2NUP A;  2ESW A;  4PJO B;  1GCQ C;  3SD4 A;  4XU3 A;  2F2W A;  3L1A A;  3BE3 A;  2RN8 A;  3KBG A;  2FB7 A;  1JU5 C;  3EAE A;  3UA6 A;  5IXB A;  4PJO D;  5FW9 A;  3HFO A;  3GNG A;  5A2Q E;  1VQ4 T;  2V1R A;  1OZ2 A;  2DD5 A;  3CC7 Q;  3ER0 A;  2OJ2 A;  1NJI C;  4AG1 C;  1SHF A;  1YIT A;  1MMA A;  4DOW A;  1OPK A;  3CD6 Q;  1OX8 A;  2CSQ A;  1WDX A;  2DPP B;  3X25 B;  3JCM P;  4RTY A;  3MP1 A;  1KQ2 A;  4IUQ A;  3E9G A;  2BE9 B;  1OZ3 A;  1QVG A;  2VXE A;  1X2Q A;  3EFO B;  2OTJ T;  3R6N A;  1XTD A;  4J9I A;  2DBK A;  4RTX A;  1KQS A;  3GIB A;  2K7A A;  1WPY A;  1XNI A;  3KUF A;  4F7U B;  5GAN 4;  2D1X A;  4DA4 A;  2JXB A;  3C94 A;  3CC7 A;  1O75 A;  2MWP A;  1G3S A;  2YDL A;  1YNZ A;  1UHF A;  3CC4 Q;  3CCR T;  1M1K C;  5J3B A;  3CD6 A;  5KYY B;  3S3O A;  4N4G A;  4QQG A;  4C92 G;  1AZE A;  1PD0 A;  1BI2 A;  2RD1 A;  2R5M A;  5DM7 R;  4OF1 A;  3RR6 A;  3L2U A;  4FYY B;  3L2W A;  1ZA2 B;  3HL8 A;  2L89 A;  3JB9 J;  5CKB A;  4C92 F;  3G71 Q;  2FO0 A;  2CP5 A;  3CXC P;  2DO3 A;  3EG1 A;  4GLK A;  2FHD A;  3INZ A;  1Z9Z A;  4M7A F;  1SKU B;  3EG3 A;  1VQM T;  2CKK A;  1AVZ C;  5IHN A;  4M78 E;  2DYI A;  1VQ5 Q;  4M77 E;  4JZ4 A;  1PRM C;  2HKQ B;  3M0R A;  4PLL A;  5HK0 A;  1W2B S;  2W10 A;  3RKW A;  3CCM T;  1UHC A;  2J05 A;  5KYU B;  1UDL A;  4HCC A;  1ZLM A;  1Q95 G;  1RAC B;  3M5A A;  4XQ3 A;  5CK9 A;  2PVD B;  3CC4 T;  3GNF B;  5GAN 5;  2RH2 A;  2EVR A;  2Y4Y A;  3PMI A;  3OYL A;  4FCY A;  2XDP A;  3C12 A;  2DRK A;  1VQ5 A;  2I2L A;  3LH5 A;  1Q7Y U;  2EQI A;  4O6J A;  2LCS A;  5CIU A;  1UEB A;  1WHG A;  2CZ7 B;  1MHN A;  4HCK A;  3OYE A;  2WAC A;  2MIO A;  4PJO E;  3OBY A;  1AT1 B;  1UB4 A;  2E1H A;  5LJ5 j;  1QP3 A;  1AWW A;  5CAI A;  3PT9 A;  3M55 A;  2RHY A;  2XHC A;  3PE0 A;  4F14 A;  2B86 A;  1TOV A;  1KJW A;  2KNB B;  2K5F A;  2M9U A;  4J7F A;  3T9N A;  1VQK A;  4CC2 A;  1R0B G;  2O2O A;  2E6N A;  1I81 A;  2YLB A;  1BCO A;  1H92 A;  3OYI A;  5FU7 B;  2L0A A;  4B9X A;  4J9G A;  2CDT A;  3NTH A;  4L59 A;  2FEI A;  3A8H B;  3WVD B;  1AZG B;  1CKA A;  3LX7 A;  2IVW A;  3MEU A;  5FU6 B;  3GPL A;  1WYX A;  2HNI A;  4PNO A;  3JAM E;  5I21 A;  5AYF A;  4C8Q C;  2VAS A;  3JSC A;  4F7U E;  5EG2 A;  4JUV A;  2RI2 A;  3PFS A;  4OML A;  2PUK B;  4UC4 A;  8AT1 B;  2QGF B;  1X75 C;  3P8B B;  2AK5 A;  3MO8 A;  4HXJ A;  1SRL A;  4NS5 A;  4M78 C;  2H3J A;  1RL2 A; 
#chains in the Genus database with same CATH homology
 2KGT A;  1T3L A;  2KBT A;  3THK A;  1AWJ A;  1KSW A;  2O31 A;  2YSQ A;  1JXO A;  2FPD A;  2C0O A;  2DNU A;  2DL7 A;  3U23 A;  1AD5 A;  2KYB A;  3VRY A;  1T3S A;  4JZ3 A;  1W70 A;  1HD3 A;  1K4U S;  2KEA A;  3UA7 A;  2JW4 A;  4EIK A;  2KRM A;  2KT1 A;  2DYB A;  2VWF A;  4J9E A;  5IXF A;  3JV3 A;  1M3C A;  2VKN A;  1GL5 A;  2A37 A;  1NYF A;  4GBQ A;  5FWC A;  2JM9 A;  1Y57 A;  2RPN A;  5IHI A;  1YWO A;  2CUB A;  2SEM A;  4ZNX A;  4DEY A;  1AOJ A;  2D8J A;  3SHW A;  4J9D A;  1RI9 A;  4X1V A;  1TUC A;  2JMA A;  2RQV A;  2G6F X;  1GFC A;  4IIM A;  2K79 A;  2BZX A;  2KXD A;  2RF0 A;  2X3X D;  1Z9Q A;  1PKS A;  1JXM A;  1PNJ A;  4LE9 A;  3I5R A;  4OMN A;  1W6X A;  4JPB W;  1UJY A;  2ROT A;  2YUQ A;  2A36 A;  1SSH A;  2CUD A;  4LUD A;  4LN2 A;  5I11 A;  2CSI A;  1SEM A;  2EYW A;  1AWX A;  1TG0 A;  1G2B A;  4HVV A;  1UG1 A;  1GBR A;  1E7O A;  1N5Z A;  2DA9 A;  1MUZ A;  1BBZ A;  1M27 C;  1JQQ A;  4ORZ A;  3FJ5 A;  2K9G A;  1UEC A;  2AKL A;  2P4R A;  2V1Q A;  1U3O A;  2RQW A;  4Z8A A;  1X27 A;  2LNH B;  2J6O A;  4LUE A;  2CT4 A;  3IQL A;  3GBQ A;  4RTZ A;  2GGR A;  1UJ0 A;  2ED0 A;  2KRN A;  1K76 A;  1VYV A;  2H8H A;  2EGE A;  2J6K A;  4AFU C;  1V1C A;  2KRS A;  2D8H A;  3REB B;  2DL3 A;  1NM7 A;  1ARK A;  3EHR A;  3NPF A;  1Y0M A;  3UAT A;  1CSK A;  2ECZ A;  1QCF A;  1GCP A;  4D8K A;  2GNC A;  5FWB A;  1HSQ A;  2LQN A;  1WXU A;  3ULR B;  2PNI A;  5GJW B;  1BU1 A;  1XOV A;  1NEB A;  2LMJ A;  1K0X A;  4D8D A;  1FYN A;  2GQI A;  4J9H A;  3QWX X;  2PZ1 A;  4AFS C;  3NMZ C;  1WI7 A;  3VRZ A;  1K0S A;  1WFW A;  4DEX A;  4RTV A;  2EGC A;  4FSS A;  4AFQ C;  4KRT A;  3PVQ A;  3KFV A;  2JM8 A;  2ROL A;  1PHT A;  4CC7 A;  1KIK A;  1M30 A;  2CH4 W;  2L3P A;  2HCK A;  1B3Q A;  2J7I A;  2KE9 A;  1JEG A;  1ZBJ A;  2GBQ A;  4F16 A;  1ABO A;  2DIL A;  2DX1 A;  2KRO A;  2YUN A;  2X3W D;  2DJQ A;  4JJC A;  3RNJ A;  1IO6 A;  2FRY A;  1M8M A;  2JT4 A;  2DL8 A;  1KFZ A;  2EGA A;  2JS0 A;  1K9A A;  1OV3 A;  3H41 A;  2O9S A;  1VYT A;  1MV3 A;  4HVW A;  2GTJ A;  1I07 A;  2M0Y A;  4CC3 A;  1WIE A;  1GRI A;  1CKB A;  2JMC A;  1NLP C;  1QLY A;  1FMK A;  3M0Q A;  3O5Z A;  3ZL7 C;  2EYZ A;  1B07 A;  4R0K A;  1EFN A;  2D0N A;  2NWM A;  1WXB A;  2F2V A;  1LCK A;  1OOT A;  1X69 A;  2LJ0 A;  2YUP A;  1T0J A;  2A08 A;  2K3B A;  2XMF A;  3NHN A;  2OI3 A;  2CH4 A;  1VA7 A;  4WCI A;  1RUW A;  3VS3 A;  1UE9 A;  2DE0 X;  1SPK A;  3TSZ A;  2J6F A;  2AKK A;  2EKH A;  2I0N A;  2YUO A;  4QT7 A;  3CQT A;  1GBQ A;  2K6D A;  2DLP A;  2DL5 A;  1E6H A;  2M51 A;  3H0I A;  1BB9 A;  4RUG A;  2BTT A;  2K2M A;  1RLQ C;  2F2X A;  2DBM A;  2YT6 A;  3M0U A;  2HDA A;  2JS2 A;  3C0C A;  3M0T A;  1I1J A;  2C0I A;  2RQT A;  2DL4 A;  3EG2 A;  2NUZ A;  2ESW A;  1T0H A;  1GCQ C;  1ZX6 A;  2F2W A;  3EGU A;  2RN8 A;  3NGP A;  1PKT A;  2LZ6 B;  3RBB B;  1W1F A;  2ENM A;  2RNA A;  1JU5 C;  3UA6 A;  5IXB A;  5I22 A;  4CC4 B;  5FW9 A;  1ZUU A;  1RLP C;  3TSW A;  3REA B;  2FPE A;  5L23 A;  2V1R A;  2AZS A;  2OJ2 A;  2EW3 A;  3H0F A;  4AG1 C;  1SHF A;  2L3S A;  2ABL A;  1NEG A;  1X43 A;  1OPK A;  1U06 A;  3A98 A;  2CSQ A;  1WDX A;  4RTY A;  2LP5 A;  2OAW A;  3VS4 A;  1SRM A;  1UUE A;  1X2Q A;  3R6N A;  2HSP A;  4IIO A;  2BZ8 A;  4J9I A;  2VVK A;  5HCK A;  2DBK A;  1I0C A;  4RTX A;  1QKW A;  2LQW A;  1M3A A;  2HEQ A;  2K7A A;  1WLP B;  3SEM A;  3M0P A;  1NLO C;  2D1X A;  4OMQ A;  3H0H A;  2JXB A;  1QWE A;  1E6G A;  2YDL A;  1YNZ A;  1UHF A;  2FPF A;  2RQR A;  1H3H A;  1K1Z A;  2LJ3 A;  1AWO A;  1ABQ A;  4J9C A;  1AZE A;  1X2K A;  2KT8 A;  4AFZ C;  3I5S A;  1H8K A;  4J9B A;  1U5S A;  1PRL C;  2EYY A;  1UTI A;  2EYX A;  4OMO A;  2FO0 A;  3PVL A;  3EG1 A;  2EPD A;  1ZUK A;  1X6B A;  1X6G A;  2BZY A;  1Z9Z A;  4RTT A;  4E6R A;  2DM1 A;  3EG3 A;  2DRM A;  3VS6 A;  1AVZ C;  5IHN A;  1MV0 B;  1UFF A;  2FG0 A;  4Z88 A;  1ZSG A;  1JO8 A;  3QWY A;  4JZ4 A;  2O88 A;  2JTE A;  1PRM C;  3M0R A;  2RQU A;  1HJD A;  2QDL A;  2RMO A;  2W10 A;  5GJV B;  4K11 A;  5EC7 A;  1TUD A;  1UHC A;  1YCS B;  2J05 A;  1UDL A;  4RTU A;  1YN8 A;  1ZLM A;  1SHG A;  2FRW A;  1WA7 A;  2KYM A;  2O9V A;  2W0Z A;  2GTO A;  1UGV A;  2EVR A;  3VS5 A;  1OPL A;  2KR3 A;  2IIM A;  1ZUY A;  4F17 A;  2DRK A;  2LJ1 A;  4Z89 A;  1J3T A;  3EG0 A;  4ESR A;  3LH5 A;  2EQI A;  2LCS A;  1WXT A;  1AEY A;  1NG2 A;  1QKX A;  2C0T A;  2PTK A;  4A63 B;  4HCK A;  1YWP A;  2HBW A;  2MIO A;  3VS1 A;  4Y92 A;  5IHK A;  3M0S A;  2SRC A;  4AG2 C;  2DMO A;  5ECA A;  3TVT A;  1A0N B;  2CRE A;  1AWW A;  2L2P A;  2E5K A;  3VS7 A;  2CT3 A;  3I35 A;  3I9Q A;  1YP5 A;  3UF4 A;  1S1N A;  3PE0 A;  4M4Z A;  4OMP A;  4F14 A;  2B86 A;  2MOX A;  1KJW A;  2KNB B;  1G83 A;  4CC2 A;  2L3Q A;  4HVU A;  2O2O A;  2A28 A;  2ED1 A;  1QWF A;  3EHQ A;  1H92 A;  5IH2 A;  1BK2 A;  2L0A A;  1OEB A;  4JJD A;  2DVJ A;  4J9G A;  2DF6 A;  2LX7 A;  3VS0 A;  4RTW A;  2CDT A;  4LNP A;  4JJB A;  4J9F A;  1M3B A;  2FEI A;  2MCN A;  3VS2 A;  1AZG B;  1NYG A;  1CKA A;  2J06 A;  1WYX A;  1GCQ A;  1VYU A;  4OML A;  2AZV A;  2AK5 A;  1GFD A;  1PWT A;  4HXJ A;  1WX6 A;  4GLM A;  1SRL A;  2EBP A;  2KXC A;  4OMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...