1PRLC

Two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-SRC TYROSINE KINASE SH3 DOMAIN
publication title Two binding orientations for peptides to the Src SH3 domain: development of a general model for SH3-ligand interactions.
pubmed rcsb
source organism Gallus gallus
molecule tags Complex (signal transduction/peptide)
total genus 4
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1prlC00
4D8KA 1ABQA 3U23A 1X2KA 2DBMA 2D0NA 2X3XD 3EGUA 2CREA 3M0PA 2SRCA 2ENMA 2J6KA 2K2MA 5HCKA 2YUQA 2O31A 2FRWA 4F16A 3RNJA 1IO6A 4JJDA 2KXDA 1NM7A 5IXBA 4J9IA 2DF6A 3I5RA 1M27C 1ZUUA 2A36A 2NUZA 3EG0A 4ZNXA 1SPKA 2YSQA 2KROA 2DL3A 1TUDA 2LJ0A 4M4ZA 1ZLMA 5ECAA 2J06A 4RTUA 2CH4W 1UECA 2F2WA 2GBQA 2JS2A 2DJQA 1QCFA 1M30A 2A37A 5FWCA 3UA6A 1PWTA 2JTEA 2YUPA 2LP5A 2HCKA 2M51A 4RTWA 3REBB 3H41A 4IIMA 2EYZA 5IHNA 3PVQA 4IIOA 1BBZA 3TVTA 4DEXA 4AG1C 2ESWA 1CKAA 3EG1A 2PTKA 2GGRA 2EGEA 1FYNA 1OPKA 1GRIA 1UUEA 2LZ6B 5IHIA 1MV0B 2KEAA 3GBQA 3CQTA 1TG0A 2W10A 4AFSC 1JQQA 4OMQA 3SEMA 1H8KA 2C0OA 2CT4A 2DRMA 4R0KA 5FWBA 2D8JA 1VA7A 4AFUC 1TUCA 4RUGA 2K79A 1U5SA 2O2OA 3UATA 1G2BA 2ECZA 2F2VA 1KJWA 4QT7A 1X6GA 1GCPA 2DL4A 2EGAA 1UGVA 1PHTA 2B86A 3M0TA 2KE9A 2OAWA 1UFFA 1QKXA 3NPFA 3NHNA 1K0SA 2JS0A 2RQTA 1I0CA 4ESRA 1J3TA 1T3SA 1UJ0A 4EIKA 1K0XA 2KRSA 2YUNA 4HXJA 2J7IA 2J6FA 3C0CA 1RI9A 4GBQA 1MV3A 1X27A 2GTJA 2LNHB 1PRLC 2GNCA 2JM8A 3TSWA 1X43A 1NEBA 1RLQC 4RTZA 4J9GA 1VYUA 1BB9A 1B3QA 1H92A 1SHGA 1ZX6A 1NLOC 1YWOA 1SEMA 1WFWA 1WI7A 5GJVB 2DL5A 1T3LA 1BK2A 3PVLA 1OPLA 1S1NA 5GJWB 1RUWA 3VS4A 1WXUA 1U3OA 2K9GA 2JMCA 1X2QA 5EC7A 4J9FA 4J9EA 1AVZC 2M0YA 2SEMA 2A28A 4OMPA 2HEQA 2V1RA 1Y57A 4HCKA 1JXMA 2VWFA 2DRKA 2DBKA 1W70A 1UJYA 4DEYA 2RQRA 1XOVA 1W1FA 1NG2A 1I1JA 2JM9A 2DM1A 2CH4A 1JU5C 1UHFA 3LH5A 1PKTA 2L3QA 1AWXA 3EG2A 3VS7A 2BZYA 2AKKA 4AG2C 1Z9QA 2KYBA 1UHCA 2DVJA 4J9DA 1YNZA 1E7OA 2CDTA 3H0HA 1U06A 1M3BA 1GFCA 2CT3A 2HBWA 1WLPB 1ABOA 1OEBA 1T0HA 2K3BA 4CC3A 2F2XA 1SSHA 1E6GA 2L0AA 1GBRA 1PNJA 2LQNA 2YT6A 2P4RA 2EYYA 3EG3A 1ARKA 1I07A 4CC7A 3THKA 4LNPA 2JXBA 1AEYA 1FMKA 1WXBA 1B07A 2RQWA 2EW3A 3REAB 4E6RA 2KYMA 1YN8A 2KRMA 5I11A 2EVRA 4J9HA 3EHRA 3JV3A 4RTYA 3PE0A 2KGTA 2ABLA 4RTTA 1QKWA 3QWYA 2DNUA 1HJDA 5IHKA 1AZGB 1GCQA 1UG1A 2HSPA 2YUOA 3H0IA 4JPBW 4F17A 1AWJA 2DA9A 3I5SA 3ZL7C 1ZUYA 2EGCA 3EHQA 1QWFA 4D8DA 3QWXX 1SRLA 3SHWA 3KFVA 2J6OA 2L3SA 1LCKA 1YP5A 4J9CA 3VS2A 2LX7A 1M3AA 2JT4A 4OMOA 3M0RA 2LJ1A 2DL8A 2CSIA 4JZ4A 1HSQA 3M0QA 1X69A 2L2PA 2HDAA 2KT1A 1CSKA 1K4US 1NYFA 1Y0MA 2KBTA 2KRNA 3I9QA 3VRYA 1AWOA 1EFNA 5L23A 1BU1A 4HVWA 4CC2A 4LUDA 2AZVA 1GBQA 3ULRB 1M3CA 1NLPC 3I35A 1JXOA 4J9BA 1WDXA 2OI3A 3M0UA 2FPDA 1N5ZA 3A98A 2MCNA 2C0IA 4F14A 4OMNA 1YWPA 2LQWA 1E6HA 2CUDA 2GTOA 1WIEA 1MUZA 2RQUA 1WXTA 1Z9ZA 2CUBA 2DYBA 2AZSA 2DE0X 1KFZA 2D1XA 3H0FA 1VYTA 2J05A 1OOTA 2XMFA 4GLMA 3R6NA 2JW4A 2RN8A 2A08A 2DMOA 3M0SA 2KT8A 2DLPA 1A0NB 1PKSA 2VKNA 2DX1A 2O9VA 2NWMA 3VS3A 3VS5A 2RF0A 3IQLA 1AOJA 1PRMC 2FEIA 2K6DA 4CC4B 2L3PA 2BZXA 2I0NA 2RNAA 3UA7A 4Z89A 4RTXA 2O88A 2EQIA 1AWWA 1KIKA 1UE9A 1UTIA 4OMLA 2FPEA 1GFDA 4LE9A 1WYXA 4JZ3A 2KNBB 2YDLA 1GCQC 1KSWA 1NEGA 2ED1A 3RBBB 2LJ3A 1H3HA 5IXFA 4Z88A 1SHFA 4A63B 1WA7A 2BZ8A 2D8HA 4WCIA 1NYGA 2LMJA 1X6BA 1V1CA 2BTTA 1T0JA 2DL7A 2FO0A 2X3WD 2PZ1A 1K76A 1RLPC 2DILA 2KR3A 4JJCA 2C0TA 3VS6A 3VS1A 2KXCA 2MIOA 1QLYA 1AD5A 2EBPA 2EYWA 2VVKA 1WX6A 5I22A 1CKBA 4RTVA 2RPNA 1ZBJA 2W0ZA 1YCSB 3UF4A 2JMAA 2K7AA 2OJ2A 2FG0A 1OV3A 2ROLA 2EKHA 4HVUA 2V1QA 4KRTA 1GL5A 2PNIA 2EPDA 4LN2A 1QWEA 2ED0A 1AZEA 5IH2A 3FJ5A 2EYXA 1UDLA 4AFQC 1VYVA 3NGPA 4JJBA 2G6FX 3NMZC 2H8HA 1K1ZA 2RQVA 2O9SA 1ZUKA 4X1VA 4K11A 2LCSA 1W6XA 2IIMA 3O5ZA 4Y92A 3VRZA 2FRYA 1K9AA 4Z8AA 3TSZA 2MOXA 4HVVA 1G83A 4ORZA 2CSQA 4AFZC 2E5KA 2AKLA 4LUEA 4FSSA 1JEGA 2GQIA 2FPFA 1JO8A 4OMMA 1HD3A 1M8MA 2ROTA 2AK5A 1SRMA 3VS0A 1ZSGA 2QDLA 2RMOA 5FW9A
chains in the Genus database with same CATH superfamily
1ABQA 1O75A 2ZPBB 3U23A 2D0NA 3CCUA 3M0PA 1YIJQ 2ENMA 2FYKA 1VQLA 4M7DE 3LGLA 2KXDA 2NUPA 2VXFA 4KT0E 1KHIA 2DF6A 2X4YA 4M7DF 5GANf 3A1PA 1JRIA 4NOYA 2DL3A 4M4ZA 1YHQT 2GBQA 2FB7A 3FRNA 1VQOA 1O9SA 2JS2A 3RMSA 3CPWS 1Q81U 2NLUA 3UA6A 1NE8A 4C5HA 3REBB 2HQHA 5IHNA 5KE3A 5C6SA 2FHDA 3KBGA 2EWNA 3V7CA 1G3WA 1YJNT 3CMEQ 1HXDA 5KYXB 2HAXA 2R5MA 1VQNT 4OB2B 2LZ6B 2QQBA 3P8BB 2KEAA 5KYUA 2DZ9A 3PIOA 4M78G 1TG0A 2W10A 2LCLA 4V2SA 1JQQA 3HFOA 4JLGA 5LJ3g 2EKOA 2NUTA 1QVGS 3OS1A 1YJWA 2CT4A 2QTVA 3JCMP 1R0CB 1TUCA 3RESA 2CZ6B 4OVAA 3G71A 2O2OA 1G2BA 3HRUA 2F2VA 5KYNA 3QYHB 1X6GA 1GCPA 2LT4A 1Q7YC 3E9GA 1QKXA 4X9DA 3NPFA 1IGQA 3VV0A 2RQTA 4ESRA 3G4SA 3MEUA 3JSCA 2P0PA 4EIKA 2CZ1B 3CMAQ 5GAOr 3QHSA 2R57A 2KY9A 5GAN8 5GAMd 5CIUA 4F04B 3GNGA 1ZX6A 1YWOA 2HMAA 1EIFA 5GJVB 2DL5A 3PVLA 1S1NA 3VS4A 3MCAB 2DYIA 3JCMh 1K9MU 3OYDA 1Q95G 1ZA2B 3BDUA 2A28A 2V26A 4M77A 4F7UB 4HCKA 1TH7A 4C92D 2DBKA 4DEYA 1X75C 4B9XA 5GAOn 1I1JA 2DM1A 1JU5C 1UHFA 3BY7A 5AYFA 4C0ZA 4FSXA 2BZYA 1BCOA 4P5NA 4AG2C 1YJ9A 2JN0A 1B34B 3H6ZA 1UHCA 5LJ3f 4VUBA 4J9DA 5D6YA 2XKOC 2CDTA 1PM3A 2HBWA 2MYSA 1OEBA 1U1SA 8AT1B 3CCRQ 4CC3A 2L0AA 2V8KA 2LQNA 2MWPA 3HRSA 4KH0B 2DETA 4J6YA 2IG0A 1WJQA 2JXBA 4LDUA 2WACA 3M5AA 3M4GA 5I11A 5LJ5f 3CCLA 2E3IA 1RAAB 3JV3A 3P8HA 4RTYA 1FMWA 4AT1B 1IHVA 1QKWA 1D0YA 2K3YA 3H0IA 2HSPA 2YUOA 4F17A 3H9NA 4BE2A 4M7AA 4N4GA 1VQ6A 3ZL7C 1ZUYA 4D8DA 2F1LA 4FIBA 3KFVA 2J6OA 2L3SA 5GAMg 4JS4A 2MPXC 3RMQA 4OMOA 1OI1A 4OB3B 5LJ3e 1S72T 1RAIB 4JZ4A 1YHQA 4N0AA 3V8KA 4DBFA 4RMOA 3OYFA 4C8QB 1PG5B 1BI3A 1VQMA 4R56A 3QSUA 1K4US 1NYFA 2KBTA 4B6MA 5FROA 1VQLQ 2KRNA 1EFNA 2LDMA 4HVWA 4LD6A 4CC2A 4MMKA 1M3CA 1NLPC 4ZGEB 4MDXA 4PJOA 4J9BA 3NTKA 2G3RA 3ZBDA 2FPDA 4C92G 3WVEB 3SD4A 4HA8A 1ZA1B 4F14A 1XJWB 1WQWA 3CCJA 5I2SA 1YWPA 1E6HA 1HYOA 4KULA 3CXCP 2HNIA 2R58A 3TQ7P 2FZKB 4M77E 1UGSB 2JVVA 3L2UA 2AZSA 2DXUA 4BACA 1VYTA 2NYSA 1ZQ1A 2DAQA 2DFUA 2VV5A 3OYHA 1OOTA 5FU6C 1KD1U 2QK0A 4M77F 5KYYB 1OULA 4BB7A 4GLMA 9ATCB 3R6NA 2A08A 2X35A 2KT8A 4EMGA 1PKSA 2DX1A 1NZ9A 4DQ2A 1VQPT 1KG1A 3LX7A 3FC3A 2RF0A 4ELYC 4LXCA 2FEIA 3E1SA 2RNAA 2E12A 4Z89A 3I56T 1AWWA 3JB9J 1RAHB 1UTIA 1KD1R 5KYWB 4OMLA 3G7ZA 1GFDA 3CCSQ 4LE9A 5GAMf 2OTLQ 5M9OA 4EDUA 3CCET 3C95A 3P8DA 4PLIA 1I5LA 3CC2A 1JJ2P 5CKBA 2LJ3A 5CQXA 4D6WA 4A63B 4PKCC 1WA7A 2BZ8A 5CKEA 2D8HA 3CCQQ 2OTJQ 3A8MB 3PIPA 2CP2A 4J8OA 3VJPA 2X3WD 2PZ1A 4F7UG 2LTOA 2XG8D 4M7AE 2KR3A 4JJCA 1VQ5T 2DO3A 2XU8A 2DXBA 3ZEHA 3VS6A 4JS5A 3VS1A 4CI0C 3F70A 1LNXA 1OX8A 1TU0B 4XU0A 4M7AF 1NJIR 4E7ZA 1V29B 2VASA 2DVEA 2PNIA 3TREA 2EPDA 2A7YA 2CP7A 1WHMA 1AZEA 2RM4A 5GAMe 3CD6Q 2HBPA 5IH2A 5GANd 3CBPA 4DBQA 3OBYA 2O4XB 2JTFA 1KC8C 3NGPA 2PUOB 4PJOE 3OYAA 1K1ZA 4PJMA 3L1AA 4M75B 4X1VA 2DTHA 3O5ZA 4Y92A 4PJOF 2DKGA 1K9AA 2COZA 2RI3A 3VUZA 2KQWA 2E5KA 2AKLA 4LUEA 4HT9A 3JB9I 1IRXA 4M78B 2ROTA 3CEYA 2YLBA 3GLXA 1D1BA 4ZGJB 1VQ8Q 1M2VA 2CREA 2SRCA 2L8DA 3FEOA 5HCKA 1S72A 3EG9B 3QYGB 2FRWA 1FWZA 2I2LA 4F16A 1NM7A 2X4WA 5IXBA 4C8QC 4BY6B 4J9IA 3M54A 1SG5A 3I5RA 3L2QA 1M27C 1ZUUA 2WSEE 1SPKA 3QG1A 1TUDA 2LJ0A 3CC4Q 1U1TA 4RTUA 2QEXA 2F2WA 2QAZA 5CKHA 2YRDA 2DJQA 4FT4A 5D6XA 1M30A 4FM4B 5FWCA 1YITT 1PWTA 1I81A 1KHCA 5HY6A 2PQWA 3H41A 1M2OA 4IIMA 2AT1B 2FZCB 1BBZA 4WTOB 3OQ5A 4R55A 1DJ7B 3TVTA 4DEXA 1WHLA 1NPRA 1JBMA 3S3NA 1EZZB 1CKAA 6AT1B 1WHKA 2GGRA 3RKWA 3QIIA 4II1A 4JRQA 4LDWA 1UUEA 4M75D 5GANg 1MV0B 3QJ6A 4PFOA 1EX4A 5KCOA 3ME9A 1I5OB 2Z0WA 4BUGA 2LVMA 3SEMA 1VQPA 2XD0A 1H8KA 1K8AR 2C0OA 3Q1JA 2DRMA 4R0KA 1D1AA 4MZPA 2D8JA 3I56A 4AFUC 1U5SA 3UATA 4QT7A 2DL4A 3OYYA 1UGVA 1FMVA 2KE9A 1VQ7A 3LGFA 3CCEA 3NHNA 3CCVT 4HT8A 1J3TA 1WJRA 3CD6T 3QZ9B 4QQGA 1UJ0A 1K0XA 2KRSA 2RHZA 4HXJA 3G6EQ 3C0CA 4GBQA 1MV3A 2F5TX 3WXMB 5DLQE 2JM8A 3TSWA 2AHJB 1Q86C 1BIAA 2YRCA 1BB9A 4LDYA 2D6FA 3GOXA 1NLOC 1SEMA 1YI2T 1WI7A 2QQ9A 4XTWA 1T3LA 1BK2A 2P0QA 1VQ5A 4ATOA 5A0LA 1Q82U 3PFSA 1WXUA 1M1GA 1U3OA 2E70A 2K9GA 2L3RA 5A0GA 5LJ5d 4J9EA 2JJ9A 1SF9A 3A8HB 3QUIA 2SEMA 4KGXB 4OMPA 1Y57A 2VWFA 3CC7Q 3M9QA 4FYVB 1UJYA 2RQRA 5I2MA 1XOVA 3JB9H 1NG2A 2JM9A 5CVIA 3E19A 2CH4A 3URGA 1MHNA 3LH5A 4ZGDB 5AT1B 5FRMA 2D9TA 1IHWA 4M7DD 3QDRB 2E6ZA 4E7KA 2CP0A 1Z9QA 3JB9F 4OGCA 4A4FA 5DM7R 1UEBA 5CK9A 1K73U 2RI2A 1E7OA 3H0HA 1U06A 1GFCA 2RHXA 4M75G 2XICA 4C5IA 4BDZA 1VQ4Q 2K3BA 3FB9A 2F2XA 4IURA 1GBRA 1PNJA 4X9CA 2YT6A 4JRIA 2EYYA 1ARKA 3LLRA 4C92B 1I07A 3THKA 4NS5A 4XTVA 3X26B 2QQRA 1FMKA 1WXBA 4EMHA 2RQWA 2EW3A 4E6RA 2XHCA 1ZSZA 1Q81R 2COWA 3QBYA 1NJIC 2PVOB 2HKNA 2EVRA 4J9HA 1LPLA 2M1HA 2NUPB 4M78C 4E7SA 1W4SA 4RTTA 4KGVB 2BE9B 1VQ9A 1HJDA 3S6WA 5IHKA 1VQKT 1UG1A 2QA4T 2LQKA 3CPWP 2M0OA 1H3ZA 3I5SA 5DLOA 5CKFA 3S3OA 1N8RC 2EGCA 1QWFA 2L5QA 3MO8A 4GY5A 1QW1A 1LCKA 3LW5E 4XAXB 5GANe 1RABB 1MMAA 4RCBA 2QQAA 2LX7A 2ZPHB 3M0RA 5IN1A 4BY6C 2JZ2A 1BIBA 2CSIA 5KCHA 2L2PA 2HDAA 2KT1A 5GMKe 1CSKA 3SFMA 5LJ5g 3J80E 1PD0A 1RAGB 3VRYA 1YITA 4QVCA 2AZVA 3ULRB 2EQJA 2ZGWA 1M1KC 1Y96A 3I35A 3BFMA 3G6ET 3M0UA 3MKDA 2NUTB 1N5ZA 3H8ZA 1M9SA 3OYNA 2MCNA 2C0IA 4IUTA 4OMNA 5CO7A 5IT9E 2LT1A 3X20B 3OY9A 1MUZA 1PC0A 3HFNA 2HL3A 2RB6A 2RH2A 1WXTA 4M7DG 4KBMB 4ZTFA 4ELZC 1M90U 3OYCA 2DE0X 3CCMA 4XTYA 2PUKB 3OYLA 1H641 2A3LA 1P92A 1YIJT 2JW4A 3OYJA 2DLPA 5GMKi 1K9MR 3GPLA 1I8FA 2DD4A 2O9VA 2HD0A 2NWMA 3VS3A 3JCMW 3AT1B 2RJFA 2FVUA 3MHXA 3IQLA 1MNEA 2BZXA 2QXFA 2I0NA 1M90R 3G1JA 3CCVA 2QASA 2EJFA 4N4IA 2YHTA 1WHGA 1WYXA 4JZ3A 2KNBB 1GCQC 3CXCA 1TWBA 1KSWA 4DOVA 1TOVA 2X4JA 3RBBB 1N9SA 2PU9B 5CR2A 3SWNA 4M77B 1VQ7Q 2E41A 1QP3A 3I55Q 3OW2A 1YI2A 3OS5A 3TU4K 3GF5A 4WCIA 1NYGA 2LMJA 1X6BA 3L42A 3A8GB 1K8AC 3CMET 4L6V5 2BTTA 3JCMV 4C8QA 2FO0A 3L2VA 1UGQB 4FW2A 2DILA 4QQ6A 2XK0A 2C0TA 1G3TA 2PVGB 2QGGA 1M1FA 1QLYA 3JCMQ 1WX6A 5I22A 4FCYA 4RTVA 2YWWA 3HRTA 2RPNA 2KK4A 1R0BG 1QMCA 2BE7D 4LD9K 2RA2A 5GAN4 2ROLA 4HVUA 3CCUQ 4KRTA 1JJ2A 1TS9A 1ZBXA 3OS2A 2MK5A 4OP0A 3MEAA 3TCJA 4MZTA 1IZ6A 4E7IA 3C94A 5GAN6 4DOWA 4L59A 1UDLA 1VYVA 2D0QB 3CMAT 2QGFB 3NMZC 4RG2A 1VOMA 4IUVA 1PSEA 2MF2A 2O9SA 1KQSA 4C92C 1ZUKA 1YJNA 3OS0A 4K11A 5LJ5e 2DIQA 3UWNA 1VQOQ 3VKIA 4M7AB 2FRYA 3KUFA 5GANh 3RERA 4PJJA 1VQNA 4JLIA 4ME7A 1F1BB 3LYIA 1G83A 1IB8A 4PFZA 3EGXA 2MAMA 4DBRA 3C12A 5KYWA 1BCMA 2XIDA 1VQKA 2FPFA 5GMKh 2MWOA 1FXXA 3HPWA 4EMKA 2QA4A 3OW2P 4OB1B 3R6OA 4M77D 1HD3A 4PLLA 4FU6A 2AK5A 1NPPA 1I4K1 2KMTA 3OMCA 1ZSGA 3EFOB 1FX7A 2LCCA 5FW9A 2X4XA 1X2KA 2X3XD 2J6KA 2DJZA 1RAFB 2O31A 2QTXA 2GFUA 4Q5WA 3HKSA 3RNJA 1YJWQ 1IO6A 3SDZA 1SKUB 4PL6A 3HTRA 3G71Q 4FYYB 2A36A 4ZNXA 5GAN7 2K4YA 4E7LA 5GANj 2JNGA 1ZLMA 2J06A 1UECA 1Q81C 3CCRT 1QCFA 2P4TA 2A37A 3G4SQ 3J7AF 2JTEA 2EQMA 5GMKj 2LP5A 2E4HA 2M51A 2MMPA 4MDWA 4MMLA 3LWHA 3PVQA 4IIOA 3I55T 3EGDA 4C8QE 4AG1C 1D3BA 3AHUA 2YXYA 4FW1A 1X01A 5KH6A 1W2BA 2ESWA 1KQSP 3EG1A 1FYNA 4C8QF 5IHIA 4ANJA 1B7TA 1YIJA 4M7AD 4AFSC 2RJCA 2RI5A 2Y90A 3MPUB 1WPYA 4QKUA 5FWBA 3RIRA 1N8RU 4C0FA 4DBHA 5KE2A 2ECZA 4QVZA 1KJWA 5CKDA 1PHTA 3M0TA 4C0DB 3MJXA 2K2VA 1Q7YU 1RL2A 1K0SA 4ZN3A 1VQLT 2EYQA 2JS0A 4M78A 1YJ9Q 4PJNA 5GAN5 2CS7A 1UGRB 1WGSA 1OU8A 1LJOA 4M77G 4M77C 4TVRA 4PJOD 2P84A 2AIRB 1RI9A 5GAN2 5IAYA 2LNHB 4E7JA 2VC8A 1PRLC 8ATCB 2GNCA 1IXDA 1X43A 5LJ3h 1RLQC 4RTZA 1VQOT 4J9GA 3CMEA 3V7RA 3QZ5B 1M1KU 1IGUA 1H92A 1SHGA 5HK3A 4Z02A 1WFWA 4PNOA 2V8JA 1OPLA 3L2ZA 1K9MC 1RUWA 2YLCA 3PTAA 2O01E 3DKMA 1AVZC 2ZCFB 2QG9B 2HEQA 2V1RA 3CCLQ 3PNWC 2CKKA 2WSCE 3JCMJ 2BKDN 1W2BP 4XTZA 4ZN1A 1W70A 2VB6A 5GAOq 3EAEA 3RDVA 1OU9A 2DEQA 1VQ6Q 2CP6A 3EG2A 1TUGB 1BYMA 3CCST 2KYBA 2DVJA 1MNDA 5L8RE 3HP9A 3CMAA 5LJ3j 1YNZA 2OTLT 1YHQQ 4OGEA 3A8OB 1WLPB 2WSFE 2ZPFB 1PD1A 5A0DA 1VQMQ 1T0HA 3JCMf 4M7AG 3QO3A 2P4RA 3EG3A 5LL6S 3G4ST 2K5FA 1M2VB 1AEYA 1D0ZA 2FL7A 3CCQT 2OTJT 2E5QA 2EQKA 2EJGA 1YN8A 2E3HA 5D7UA 4M7DB 1D1CA 5LJ5j 3CCJQ 4JUVA 2ABLA 3HL8A 1ACMB 3NTHA 4EPCA 1AZGB 1GCQA 4JPBW 1AWJA 2DTOA 3VUBA 2DA9A 1QVFS 3SHWA 3FDRA 4PJOG 1YP5A 3NTIA 3S3MA 3VS2A 1M3AA 2JT4A 5HK0A 2DL8A 2DEUA 2GF7A 2XDPA 3INZA 1GXIE 4M78E 3M0QA 3HSBA 3CCRA 4XU1A 2DIGA 1KQ1A 3VYHB 4M78F 3FJPA 5L23A 1YJ9T 1GBQA 5EG2A 4IUUA 1OX9A 2C06A 3UDCA 3JCMb 1JXOA 4KUIA 1WDXA 2OI3A 1AT1B 5GMKm 3A98A 1AHJB 3CPWA 3CC2Q 5DY9A 3EH1A 3NFCA 5GAMh 2LQWA 2CUDA 3N5BB 1YBYA 1XNIA 2RQUA 2RHYA 2CUBA 4RCCA 1KD1C 2D1XA 3H0FA 1KFZA 5FU7B 1VQ8T 2XMFA 1QCOA 2DMOA 3M0SA 3V7SA 1Q82R 4C92A 2VKNA 1TSFA 3VS5A 2DPPB 1AOJA 4XQ3A 2HZYA 2ZZDA 2L3PA 2QQSA 1QVGA 5KYXA 3JB9D 4C0DC 1VQ6T 2O88A 2M16A 2JUFA 4BI3A 4KUDK 4J5YA 3ZFJA 3CC4T 2QDYB 4PK4A 4M75C 4Y28E 3M53A 4X34A 3UT1A 4BE1A 1NEGA 3JRZA 5GAMj 2ED1A 1KQ2A 3KXTA 2VYTA 2EIFA 3OB9A 5GAN3 1VQMT 2HQXA 3OMGA 1BKBA 4E2FB 1H3HA 1K73R 4Z88A 1SHFA 2HL5C 4A53A 3OYBA 2CP3A 2M9UA 3M56A 1V1CA 4IKFA 3M58A 4QQDA 1G3SA 1T0JA 3OYGA 4A54A 4J83A 2E10A 1RLPC 3CCJT 1XQHA 4OF1A 4J6XA 1WJSA 2RJEA 1UGPB 1AD5A 2A0FB 1CKBA 4YTLA 3JCMX 2DD5A 3V8LA 4J7FA 1ZBJA 1KK7A 3EFRA 1LVKA 5FU6B 3M59A 2OJ2A 2FG0A 4HKEA 3VU3C 2V1QA 3CCSA 1GL5A 1S72Q 2RK1A 1C0MA 2OTLA 1ZSZB 4DA4A 4F7UA 2F69A 3QPHA 4N4HA 5J26A 3FJ5A 5KYUB 1LOJA 4E7HA 1QVGP 4AFQC 4J6WA 2G6FX 2RQVA 1KC8U 2EJ9A 3M4YA 1MMGA 1M5Q1 2VGMA 2CYZB 4PFPA 4BI4A 2QEXQ 3CCQA 2OTJA 2LCSA 1W6XA 2GQVA 3LH0A 3VRZA 4Z8AA 1RI0A 2MOXA 3OYEA 2Y4XA 1TXQA 3RKYA 1N6AA 1B34A 3L2RA 2CSQA 2VUBA 4AFZC 3CC2T 3RR6A 4M7DC 3JB9G 3MEWA 2QI2A 3BW1A 3J81E 1KC8R 3MEVA 2XDBA 4B9WA 3DLMA 1M8MA 2LX9A 3CC7T 4C92E 4D8KA 3FIFA 4HCBA 2DBMA 3EGUA 4A4GA 1U8RA 2K2MA 2P0KA 4WF2A 3E9FA 4C92F 3OYKA 2YUQA 1VQPQ 1Y96B 3CD6A 3MP1A 2LRQA 4XU2A 4JJDA 3GP8A 1C1AA 3I56Q 2DXCA 2BIVA 5J39A 2E6NA 1D09B 2KVQG 2KAFA 2NUZA 3EG0A 3SB2A 2GCXA 2KROA 2YSQA 2LNVA 2BUDA 5ECAA 2CH4W 4JJNK 3X24B 4HCZA 5I21A 2JTMA 4GLKA 1VQ4T 1OZ3A 3T9NA 1YCYA 3CCEQ 2YUPA 2K5LA 2RO0A 2HCKA 4RTWA 2EYZA 4RG8A 4C5GA 2H3JA 1OQKA 1QCNA 3TEEA 3CBOA 3FLGA 2ZPGB 2PTKA 1BI0A 2EGEA 1OPKA 5GAOm 1WNLA 3DLLA 1VQ8A 5FU7C 1GRIA 3OSSC 4OMFB 3GBQA 2CP5A 1VQ5Q 3CQTA 1NBEB 5C0MA 3META 4OMQA 1QP2A 3PT9A 4QVDA 5GAOp 4FYXB 2B8AA 2R5AA 1VA7A 3SWNB 2CZ7B 3M55A 4RUGA 2RK2A 3PMTA 2K79A 2EFIA 5GMKl 2RHIA 1YFNA 2KDSA 3CXCS 4F7UE 3CC4A 2EGAA 2B86A 4FYWB 2OAWA 1UFFA 2MI6A 5KYYA 4F7UF 4LDXA 1I0CA 1T3SA 3PMIA 2LQ8A 1QQJA 2X51A 3OW2S 1WHJA 1V76A 3EFOA 1X6OA 2YUNA 4AMCA 2J7IA 2J6FA 1X27A 2GTJA 3WVDB 3JCMd 2PVDB 1OYXA 1NEBA 2OX7A 2QEXT 1Q86U 2DTIA 1VYUA 2QYZA 1B3QA 4BDYA 1Y71A 3OA6A 1Q82C 5GJWB 5FRNA 3L2WA 1M8VA 2JMCA 1X2QA 5EC7A 4J9FA 3A5ZB 2M0YA 3OBWA 5HKCA 1JXMA 3EFSA 4A4KA 4KH1B 2DRKA 2V8IA 1Q86R 1JJ2S 1VQ9Q 4UC4A 1N9RA 1WQ7A 1W1FA 4BD3A 4PJOB 3X25B 3OYIA 4JRPA 4E47A 1PKTA 2L3QA 1AWXA 1OZ2A 3VS7A 3QKJA 2AKKA 1WZOA 1ZSZC 1K73C 3V8JA 7AT1B 4FT2A 3JAME 3EGXB 1KQSS 2K3XA 1BI2A 3CBMA 4HCCA 3G6EA 1M3BA 2CT3A 1ABOA 4EMKB 2E65A 2K57A 1VQ7T 1SSHA 1E6GA 2RJDA 1YITQ 2IVWA 4CC7A 3JCMc 4LNPA 4C5EA 1B07A 2Y4YA 3REAB 1UB4A 2ZAEA 2DZCA 2KYMA 4KGZB 2KRMA 4C8QD 3ASKA 2DK3A 4A4HA 1NJIU 3EHRA 2O4XA 1Y07A 3CC7A 3PE0A 3QJYA 2KGTA 2OAUA 2ATCB 3QWYA 2LC4A 4IUQA 5D6WA 2DNUA 4M75A 2IPOB 1HK9A 4O6JA 3CCMQ 1QVPA 3EHQA 3QWXX 1SRLA 4PJLA 3JCMg 3DB4A 4J9CA 1PSFA 2JOYA 4A4EA 3CCUT 3BE3A 1N27A 2LJ1A 2KSSA 1HSQA 3EGDB 1X69A 1D3BB 4RKUE 2DERA 4JRKA 1VQ4A 4O5VA 3O8VA 1Y0MA 3BDLA 2E64A 3CCVQ 1N8RR 1D0XA 1AWOA 3I9QA 2KI7A 2DXTA 1C6VX 4C0GA 1BU1A 2ZPIB 4LUDA 3EG9A 1W2BS 4XU3A 4NL2A 1Q7YR 4L5GA 3MP8A 4IUPA 1VIFA 4NL3A 2GTOA 5CAIA 3ER0A 1WIEA 3GNFB 1YI2Q 3GIBA 5A2QE 1M90C 1Z9ZA 1G3YA 2DYBA 1R8OB 1IREB 2HKQB 2J05A 1SSFA 3VYGA 2H3EB 1M1KR 5LJ5h 4BE0A 2RN8A 4CRIA 4ZTJA 1A0NB 3SWNC 1VQ9T 2E1HA 1MGQA 1XTDA 1PRMC 2K6DA 1YJWT 4CC4B 3UA7A 4RTXA 1KIKA 2EQIA 3C4SA 5FLXE 1QVFA 1UE9A 3G71T 1ZHIA 4M7DA 1VIEA 2FPEA 4C8QG 2EQUA 2YDLA 1G5VA 3HHTB 5GAOl 2RHUA 1BI1A 4XK8E 2ZPEB 2CGHA 2XDDA 4M7AC 4MZMA 1JB0E 1G8XA 3UPUA 5IXFA 4Y91A 3OYMA 4XTXA 4XTUA 5CCAA 4OB0B 1YJNQ 1VUBA 1RADB 2YRVA 1M4ZA 4N0AC 3QXEB 3LWIA 1RAEB 4FL6A 2F5KA 1VQNQ 1K8AU 2DL7A 4M75E 4QW2A 1TTHB 1K76A 3CPFA 2KXCA 2MIOA 2L89A 2EYWA 4M75F 2EBPA 2VVKA 2QA4Q 1VQKQ 2X9HA 3DB3A 4PJOC 3RKXA 5CQYA 2W0ZA 1YCSB 3CCMT 3UF4A 1Y7XA 4LDVA 5J3BA 2JMAA 2K7AA 1OV3A 2EKHA 3QDFA 2M02A 4LN2A 3RUXA 1QWEA 2HSEB 2ED0A 3JCMe 1PCXA 4M78D 2GFAA 2HQEA 1MMNA 2VGNA 3MP6A 3M57A 4EMKC 2EYXA 3E2UA 4JDSA 3I55A 1RACB 4JJBA 2H8HA 5LJ3d 1QVFP 2RD1A 3X28B 2IIMA 1R77A 4BI8B 2XI9A 3TSZA 3PGGA 1WHHA 1MMDA 4HVVA 4ORZA 2K5IA 4J7IA 3EH2A 4FSSA 1JEGA 2FZGB 3A8LB 2GQIA 2VXEA 2COYA 1JO8A 4OMMA 3OSVA 3CCLT 3D7SB 1SRMA 2CZ0B 3VS0A 2QDLA 2EAYA 2RMOA
chains in the Genus database with same CATH topology
4D8KA 1ABQA 3U23A 1X2KA 2DBMA 2D0NA 2X3XD 3EGUA 2CREA 3M0PA 2SRCA 2ENMA 2J6KA 2K2MA 5HCKA 2YUQA 2O31A 2FRWA 4F16A 3RNJA 1IO6A 4JJDA 2KXDA 1NM7A 5IXBA 4J9IA 2DF6A 3I5RA 1M27C 1ZUUA 2A36A 2NUZA 3EG0A 4ZNXA 1SPKA 2YSQA 2KROA 2DL3A 1TUDA 2LJ0A 4M4ZA 1ZLMA 5ECAA 2J06A 4RTUA 2CH4W 1UECA 2F2WA 2GBQA 2JS2A 2DJQA 1QCFA 1M30A 2A37A 5FWCA 3UA6A 1PWTA 2JTEA 2YUPA 2LP5A 2HCKA 2M51A 4RTWA 3REBB 3H41A 4IIMA 2EYZA 5IHNA 3PVQA 4IIOA 1BBZA 3TVTA 4DEXA 4AG1C 2ESWA 1CKAA 3EG1A 2PTKA 2GGRA 2EGEA 1FYNA 1OPKA 1GRIA 1UUEA 2LZ6B 5IHIA 1MV0B 2KEAA 3GBQA 3CQTA 1TG0A 2W10A 4AFSC 1JQQA 4OMQA 3SEMA 1H8KA 2C0OA 2CT4A 2DRMA 4R0KA 5FWBA 2D8JA 1VA7A 4AFUC 1TUCA 4RUGA 2K79A 1U5SA 2O2OA 3UATA 1G2BA 2ECZA 2F2VA 1KJWA 4QT7A 1X6GA 1GCPA 2DL4A 2EGAA 1UGVA 1PHTA 2B86A 3M0TA 2KE9A 2OAWA 1UFFA 1QKXA 3NPFA 3NHNA 1K0SA 2JS0A 2RQTA 1I0CA 4ESRA 1J3TA 1T3SA 1UJ0A 4EIKA 1K0XA 2KRSA 2YUNA 4HXJA 2J7IA 2J6FA 3C0CA 1RI9A 4GBQA 1MV3A 1X27A 2GTJA 2LNHB 1PRLC 2GNCA 2JM8A 3TSWA 1X43A 1NEBA 1RLQC 4RTZA 4J9GA 1VYUA 1BB9A 1B3QA 1H92A 1SHGA 1ZX6A 1NLOC 1YWOA 1SEMA 1WFWA 1WI7A 5GJVB 2DL5A 1T3LA 1BK2A 3PVLA 1OPLA 1S1NA 5GJWB 1RUWA 3VS4A 1WXUA 1U3OA 2K9GA 2JMCA 1X2QA 5EC7A 4J9FA 4J9EA 1AVZC 2M0YA 2SEMA 2A28A 4OMPA 2HEQA 2V1RA 1Y57A 4HCKA 1JXMA 2VWFA 2DRKA 2DBKA 1W70A 1UJYA 4DEYA 2RQRA 1XOVA 1W1FA 1NG2A 1I1JA 2JM9A 2DM1A 2CH4A 1JU5C 1UHFA 3LH5A 1PKTA 2L3QA 1AWXA 3EG2A 3VS7A 2BZYA 2AKKA 4AG2C 1Z9QA 2KYBA 1UHCA 2DVJA 4J9DA 1YNZA 1E7OA 2CDTA 3H0HA 1U06A 1M3BA 1GFCA 2CT3A 2HBWA 1WLPB 1ABOA 1OEBA 1T0HA 2K3BA 4CC3A 2F2XA 1SSHA 1E6GA 2L0AA 1GBRA 1PNJA 2LQNA 2YT6A 2P4RA 2EYYA 3EG3A 1ARKA 1I07A 4CC7A 3THKA 4LNPA 2JXBA 1AEYA 1FMKA 1WXBA 1B07A 2RQWA 2EW3A 3REAB 4E6RA 2KYMA 1YN8A 2KRMA 5I11A 2EVRA 4J9HA 3EHRA 3JV3A 4RTYA 3PE0A 2KGTA 2ABLA 4RTTA 1QKWA 3QWYA 2DNUA 1HJDA 5IHKA 1AZGB 1GCQA 1UG1A 2HSPA 2YUOA 3H0IA 4JPBW 4F17A 1AWJA 2DA9A 3I5SA 3ZL7C 1ZUYA 2EGCA 3EHQA 1QWFA 4D8DA 3QWXX 1SRLA 3SHWA 3KFVA 2J6OA 2L3SA 1LCKA 1YP5A 4J9CA 3VS2A 2LX7A 1M3AA 2JT4A 4OMOA 3M0RA 2LJ1A 2DL8A 2CSIA 4JZ4A 1HSQA 3M0QA 1X69A 2L2PA 2HDAA 2KT1A 1CSKA 1K4US 1NYFA 1Y0MA 2KBTA 2KRNA 3I9QA 3VRYA 1AWOA 1EFNA 5L23A 1BU1A 4HVWA 4CC2A 4LUDA 2AZVA 1GBQA 3ULRB 1M3CA 1NLPC 3I35A 1JXOA 4J9BA 1WDXA 2OI3A 3M0UA 2FPDA 1N5ZA 3A98A 2MCNA 2C0IA 4F14A 4OMNA 1YWPA 2LQWA 1E6HA 2CUDA 2GTOA 1WIEA 1MUZA 2RQUA 1WXTA 1Z9ZA 2CUBA 2DYBA 2AZSA 2DE0X 1KFZA 2D1XA 3H0FA 1VYTA 2J05A 1OOTA 2XMFA 4GLMA 3R6NA 2JW4A 2RN8A 2A08A 2DMOA 3M0SA 2KT8A 2DLPA 1A0NB 1PKSA 2VKNA 2DX1A 2O9VA 2NWMA 3VS3A 3VS5A 2RF0A 3IQLA 1AOJA 1PRMC 2FEIA 2K6DA 4CC4B 2L3PA 2BZXA 2I0NA 2RNAA 3UA7A 4Z89A 4RTXA 2O88A 2EQIA 1AWWA 1KIKA 1UE9A 1UTIA 4OMLA 2FPEA 1GFDA 4LE9A 1WYXA 4JZ3A 2KNBB 2YDLA 1GCQC 1KSWA 1NEGA 2ED1A 3RBBB 2LJ3A 1H3HA 5IXFA 4Z88A 1SHFA 4A63B 1WA7A 2BZ8A 2D8HA 4WCIA 1NYGA 2LMJA 1X6BA 1V1CA 2BTTA 1T0JA 2DL7A 2FO0A 2X3WD 2PZ1A 1K76A 1RLPC 2DILA 2KR3A 4JJCA 2C0TA 3VS6A 3VS1A 2KXCA 2MIOA 1QLYA 1AD5A 2EBPA 2EYWA 2VVKA 1WX6A 5I22A 1CKBA 4RTVA 2RPNA 1ZBJA 2W0ZA 1YCSB 3UF4A 2JMAA 2K7AA 2OJ2A 2FG0A 1OV3A 2ROLA 2EKHA 4HVUA 2V1QA 4KRTA 1GL5A 2PNIA 2EPDA 4LN2A 1QWEA 2ED0A 1AZEA 5IH2A 3FJ5A 2EYXA 1UDLA 4AFQC 1VYVA 3NGPA 4JJBA 2G6FX 3NMZC 2H8HA 1K1ZA 2RQVA 2O9SA 1ZUKA 4X1VA 4K11A 2LCSA 1W6XA 2IIMA 3O5ZA 4Y92A 3VRZA 2FRYA 1K9AA 4Z8AA 3TSZA 2MOXA 4HVVA 1G83A 4ORZA 2CSQA 4AFZC 2E5KA 2AKLA 4LUEA 4FSSA 1JEGA 2GQIA 2FPFA 1JO8A 4OMMA 1HD3A 1M8MA 2ROTA 2AK5A 1SRMA 3VS0A 1ZSGA 2QDLA 2RMOA 5FW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D8K A;  1ABQ A;  3U23 A;  1X2K A;  2DBM A;  2D0N A;  2X3X D;  3EGU A;  2CRE A;  3M0P A;  2SRC A;  2ENM A;  2J6K A;  2K2M A;  5HCK A;  2YUQ A;  2O31 A;  2FRW A;  4F16 A;  3RNJ A;  1IO6 A;  4JJD A;  2KXD A;  1NM7 A;  5IXB A;  4J9I A;  2DF6 A;  3I5R A;  1M27 C;  1ZUU A;  2A36 A;  2NUZ A;  3EG0 A;  4ZNX A;  1SPK A;  2YSQ A;  2KRO A;  2DL3 A;  1TUD A;  2LJ0 A;  4M4Z A;  1ZLM A;  5ECA A;  2J06 A;  4RTU A;  2CH4 W;  1UEC A;  2F2W A;  2GBQ A;  2JS2 A;  2DJQ A;  1QCF A;  1M30 A;  2A37 A;  5FWC A;  3UA6 A;  1PWT A;  2JTE A;  2YUP A;  2LP5 A;  2HCK A;  2M51 A;  4RTW A;  3REB B;  3H41 A;  4IIM A;  2EYZ A;  5IHN A;  3PVQ A;  4IIO A;  1BBZ A;  3TVT A;  4DEX A;  4AG1 C;  2ESW A;  1CKA A;  3EG1 A;  2PTK A;  2GGR A;  2EGE A;  1FYN A;  1OPK A;  1GRI A;  1UUE A;  2LZ6 B;  5IHI A;  1MV0 B;  2KEA A;  3GBQ A;  3CQT A;  1TG0 A;  2W10 A;  4AFS C;  1JQQ A;  4OMQ A;  3SEM A;  1H8K A;  2C0O A;  2CT4 A;  2DRM A;  4R0K A;  5FWB A;  2D8J A;  1VA7 A;  4AFU C;  1TUC A;  4RUG A;  2K79 A;  1U5S A;  2O2O A;  3UAT A;  1G2B A;  2ECZ A;  2F2V A;  1KJW A;  4QT7 A;  1X6G A;  1GCP A;  2DL4 A;  2EGA A;  1UGV A;  1PHT A;  2B86 A;  3M0T A;  2KE9 A;  2OAW A;  1UFF A;  1QKX A;  3NPF A;  3NHN A;  1K0S A;  2JS0 A;  2RQT A;  1I0C A;  4ESR A;  1J3T A;  1T3S A;  1UJ0 A;  4EIK A;  1K0X A;  2KRS A;  2YUN A;  4HXJ A;  2J7I A;  2J6F A;  3C0C A;  1RI9 A;  4GBQ A;  1MV3 A;  1X27 A;  2GTJ A;  2LNH B;  1PRL C;  2GNC A;  2JM8 A;  3TSW A;  1X43 A;  1NEB A;  1RLQ C;  4RTZ A;  4J9G A;  1VYU A;  1BB9 A;  1B3Q A;  1H92 A;  1SHG A;  1ZX6 A;  1NLO C;  1YWO A;  1SEM A;  1WFW A;  1WI7 A;  5GJV B;  2DL5 A;  1T3L A;  1BK2 A;  3PVL A;  1OPL A;  1S1N A;  5GJW B;  1RUW A;  3VS4 A;  1WXU A;  1U3O A;  2K9G A;  2JMC A;  1X2Q A;  5EC7 A;  4J9F A;  4J9E A;  1AVZ C;  2M0Y A;  2SEM A;  2A28 A;  4OMP A;  2HEQ A;  2V1R A;  1Y57 A;  4HCK A;  1JXM A;  2VWF A;  2DRK A;  2DBK A;  1W70 A;  1UJY A;  4DEY A;  2RQR A;  1XOV A;  1W1F A;  1NG2 A;  1I1J A;  2JM9 A;  2DM1 A;  2CH4 A;  1JU5 C;  1UHF A;  3LH5 A;  1PKT A;  2L3Q A;  1AWX A;  3EG2 A;  3VS7 A;  2BZY A;  2AKK A;  4AG2 C;  1Z9Q A;  2KYB A;  1UHC A;  2DVJ A;  4J9D A;  1YNZ A;  1E7O A;  2CDT A;  3H0H A;  1U06 A;  1M3B A;  1GFC A;  2CT3 A;  2HBW A;  1WLP B;  1ABO A;  1OEB A;  1T0H A;  2K3B A;  4CC3 A;  2F2X A;  1SSH A;  1E6G A;  2L0A A;  1GBR A;  1PNJ A;  2LQN A;  2YT6 A;  2P4R A;  2EYY A;  3EG3 A;  1ARK A;  1I07 A;  4CC7 A;  3THK A;  4LNP A;  2JXB A;  1AEY A;  1FMK A;  1WXB A;  1B07 A;  2RQW A;  2EW3 A;  3REA B;  4E6R A;  2KYM A;  1YN8 A;  2KRM A;  5I11 A;  2EVR A;  4J9H A;  3EHR A;  3JV3 A;  4RTY A;  3PE0 A;  2KGT A;  2ABL A;  4RTT A;  1QKW A;  3QWY A;  2DNU A;  1HJD A;  5IHK A;  1AZG B;  1GCQ A;  1UG1 A;  2HSP A;  2YUO A;  3H0I A;  4JPB W;  4F17 A;  1AWJ A;  2DA9 A;  3I5S A;  3ZL7 C;  1ZUY A;  2EGC A;  3EHQ A;  1QWF A;  4D8D A;  3QWX X;  1SRL A;  3SHW A;  3KFV A;  2J6O A;  2L3S A;  1LCK A;  1YP5 A;  4J9C A;  3VS2 A;  2LX7 A;  1M3A A;  2JT4 A;  4OMO A;  3M0R A;  2LJ1 A;  2DL8 A;  2CSI A;  4JZ4 A;  1HSQ A;  3M0Q A;  1X69 A;  2L2P A;  2HDA A;  2KT1 A;  1CSK A;  1K4U S;  1NYF A;  1Y0M A;  2KBT A;  2KRN A;  3I9Q A;  3VRY A;  1AWO A;  1EFN A;  5L23 A;  1BU1 A;  4HVW A;  4CC2 A;  4LUD A;  2AZV A;  1GBQ A;  3ULR B;  1M3C A;  1NLP C;  3I35 A;  1JXO A;  4J9B A;  1WDX A;  2OI3 A;  3M0U A;  2FPD A;  1N5Z A;  3A98 A;  2MCN A;  2C0I A;  4F14 A;  4OMN A;  1YWP A;  2LQW A;  1E6H A;  2CUD A;  2GTO A;  1WIE A;  1MUZ A;  2RQU A;  1WXT A;  1Z9Z A;  2CUB A;  2DYB A;  2AZS A;  2DE0 X;  1KFZ A;  2D1X A;  3H0F A;  1VYT A;  2J05 A;  1OOT A;  2XMF A;  4GLM A;  3R6N A;  2JW4 A;  2RN8 A;  2A08 A;  2DMO A;  3M0S A;  2KT8 A;  2DLP A;  1A0N B;  1PKS A;  2VKN A;  2DX1 A;  2O9V A;  2NWM A;  3VS3 A;  3VS5 A;  2RF0 A;  3IQL A;  1AOJ A;  1PRM C;  2FEI A;  2K6D A;  4CC4 B;  2L3P A;  2BZX A;  2I0N A;  2RNA A;  3UA7 A;  4Z89 A;  4RTX A;  2O88 A;  2EQI A;  1AWW A;  1KIK A;  1UE9 A;  1UTI A;  4OML A;  2FPE A;  1GFD A;  4LE9 A;  1WYX A;  4JZ3 A;  2KNB B;  2YDL A;  1GCQ C;  1KSW A;  1NEG A;  2ED1 A;  3RBB B;  2LJ3 A;  1H3H A;  5IXF A;  4Z88 A;  1SHF A;  4A63 B;  1WA7 A;  2BZ8 A;  2D8H A;  4WCI A;  1NYG A;  2LMJ A;  1X6B A;  1V1C A;  2BTT A;  1T0J A;  2DL7 A;  2FO0 A;  2X3W D;  2PZ1 A;  1K76 A;  1RLP C;  2DIL A;  2KR3 A;  4JJC A;  2C0T A;  3VS6 A;  3VS1 A;  2KXC A;  2MIO A;  1QLY A;  1AD5 A;  2EBP A;  2EYW A;  2VVK A;  1WX6 A;  5I22 A;  1CKB A;  4RTV A;  2RPN A;  1ZBJ A;  2W0Z A;  1YCS B;  3UF4 A;  2JMA A;  2K7A A;  2OJ2 A;  2FG0 A;  1OV3 A;  2ROL A;  2EKH A;  4HVU A;  2V1Q A;  4KRT A;  1GL5 A;  2PNI A;  2EPD A;  4LN2 A;  1QWE A;  2ED0 A;  1AZE A;  5IH2 A;  3FJ5 A;  2EYX A;  1UDL A;  4AFQ C;  1VYV A;  3NGP A;  4JJB A;  2G6F X;  3NMZ C;  2H8H A;  1K1Z A;  2RQV A;  2O9S A;  1ZUK A;  4X1V A;  4K11 A;  2LCS A;  1W6X A;  2IIM A;  3O5Z A;  4Y92 A;  3VRZ A;  2FRY A;  1K9A A;  4Z8A A;  3TSZ A;  2MOX A;  4HVV A;  1G83 A;  4ORZ A;  2CSQ A;  4AFZ C;  2E5K A;  2AKL A;  4LUE A;  4FSS A;  1JEG A;  2GQI A;  2FPF A;  1JO8 A;  4OMM A;  1HD3 A;  1M8M A;  2ROT A;  2AK5 A;  1SRM A;  3VS0 A;  1ZSG A;  2QDL A;  2RMO A;  5FW9 A; 
#chains in the Genus database with same CATH topology
 1ABQ A;  1O75 A;  2ZPB B;  3U23 A;  2D0N A;  3CCU A;  3M0P A;  1YIJ Q;  2ENM A;  2FYK A;  1VQL A;  4M7D E;  3LGL A;  2KXD A;  2NUP A;  2VXF A;  4KT0 E;  1KHI A;  2DF6 A;  2X4Y A;  4M7D F;  5GAN f;  3A1P A;  1JRI A;  4NOY A;  2DL3 A;  4M4Z A;  1YHQ T;  2GBQ A;  2FB7 A;  3FRN A;  1VQO A;  1O9S A;  2JS2 A;  3RMS A;  3CPW S;  1Q81 U;  2NLU A;  3UA6 A;  1NE8 A;  4C5H A;  3REB B;  2HQH A;  5IHN A;  5KE3 A;  5C6S A;  2FHD A;  3KBG A;  2EWN A;  3V7C A;  1G3W A;  1YJN T;  3CME Q;  1HXD A;  5KYX B;  2HAX A;  2R5M A;  1VQN T;  4OB2 B;  2LZ6 B;  2QQB A;  3P8B B;  2KEA A;  5KYU A;  2DZ9 A;  3PIO A;  4M78 G;  1TG0 A;  2W10 A;  2LCL A;  4V2S A;  1JQQ A;  3HFO A;  4JLG A;  5LJ3 g;  2EKO A;  2NUT A;  1QVG S;  3OS1 A;  1YJW A;  2CT4 A;  2QTV A;  3JCM P;  1R0C B;  1TUC A;  3RES A;  2CZ6 B;  4OVA A;  3G71 A;  2O2O A;  1G2B A;  3HRU A;  2F2V A;  5KYN A;  3QYH B;  1X6G A;  1GCP A;  2LT4 A;  1Q7Y C;  3E9G A;  1QKX A;  4X9D A;  3NPF A;  1IGQ A;  3VV0 A;  2RQT A;  4ESR A;  3G4S A;  3MEU A;  3JSC A;  2P0P A;  4EIK A;  2CZ1 B;  3CMA Q;  5GAO r;  3QHS A;  2R57 A;  2KY9 A;  5GAN 8;  5GAM d;  5CIU A;  4F04 B;  3GNG A;  1ZX6 A;  1YWO A;  2HMA A;  1EIF A;  5GJV B;  2DL5 A;  3PVL A;  1S1N A;  3VS4 A;  3MCA B;  2DYI A;  3JCM h;  1K9M U;  3OYD A;  1Q95 G;  1ZA2 B;  3BDU A;  2A28 A;  2V26 A;  4M77 A;  4F7U B;  4HCK A;  1TH7 A;  4C92 D;  2DBK A;  4DEY A;  1X75 C;  4B9X A;  5GAO n;  1I1J A;  2DM1 A;  1JU5 C;  1UHF A;  3BY7 A;  5AYF A;  4C0Z A;  4FSX A;  2BZY A;  1BCO A;  4P5N A;  4AG2 C;  1YJ9 A;  2JN0 A;  1B34 B;  3H6Z A;  1UHC A;  5LJ3 f;  4VUB A;  4J9D A;  5D6Y A;  2XKO C;  2CDT A;  1PM3 A;  2HBW A;  2MYS A;  1OEB A;  1U1S A;  8AT1 B;  3CCR Q;  4CC3 A;  2L0A A;  2V8K A;  2LQN A;  2MWP A;  3HRS A;  4KH0 B;  2DET A;  4J6Y A;  2IG0 A;  1WJQ A;  2JXB A;  4LDU A;  2WAC A;  3M5A A;  3M4G A;  5I11 A;  5LJ5 f;  3CCL A;  2E3I A;  1RAA B;  3JV3 A;  3P8H A;  4RTY A;  1FMW A;  4AT1 B;  1IHV A;  1QKW A;  1D0Y A;  2K3Y A;  3H0I A;  2HSP A;  2YUO A;  4F17 A;  3H9N A;  4BE2 A;  4M7A A;  4N4G A;  1VQ6 A;  3ZL7 C;  1ZUY A;  4D8D A;  2F1L A;  4FIB A;  3KFV A;  2J6O A;  2L3S A;  5GAM g;  4JS4 A;  2MPX C;  3RMQ A;  4OMO A;  1OI1 A;  4OB3 B;  5LJ3 e;  1S72 T;  1RAI B;  4JZ4 A;  1YHQ A;  4N0A A;  3V8K A;  4DBF A;  4RMO A;  3OYF A;  4C8Q B;  1PG5 B;  1BI3 A;  1VQM A;  4R56 A;  3QSU A;  1K4U S;  1NYF A;  2KBT A;  4B6M A;  5FRO A;  1VQL Q;  2KRN A;  1EFN A;  2LDM A;  4HVW A;  4LD6 A;  4CC2 A;  4MMK A;  1M3C A;  1NLP C;  4ZGE B;  4MDX A;  4PJO A;  4J9B A;  3NTK A;  2G3R A;  3ZBD A;  2FPD A;  4C92 G;  3WVE B;  3SD4 A;  4HA8 A;  1ZA1 B;  4F14 A;  1XJW B;  1WQW A;  3CCJ A;  5I2S A;  1YWP A;  1E6H A;  1HYO A;  4KUL A;  3CXC P;  2HNI A;  2R58 A;  3TQ7 P;  2FZK B;  4M77 E;  1UGS B;  2JVV A;  3L2U A;  2AZS A;  2DXU A;  4BAC A;  1VYT A;  2NYS A;  1ZQ1 A;  2DAQ A;  2DFU A;  2VV5 A;  3OYH A;  1OOT A;  5FU6 C;  1KD1 U;  2QK0 A;  4M77 F;  5KYY B;  1OUL A;  4BB7 A;  4GLM A;  9ATC B;  3R6N A;  2A08 A;  2X35 A;  2KT8 A;  4EMG A;  1PKS A;  2DX1 A;  1NZ9 A;  4DQ2 A;  1VQP T;  1KG1 A;  3LX7 A;  3FC3 A;  2RF0 A;  4ELY C;  4LXC A;  2FEI A;  3E1S A;  2RNA A;  2E12 A;  4Z89 A;  3I56 T;  1AWW A;  3JB9 J;  1RAH B;  1UTI A;  1KD1 R;  5KYW B;  4OML A;  3G7Z A;  1GFD A;  3CCS Q;  4LE9 A;  5GAM f;  2OTL Q;  5M9O A;  4EDU A;  3CCE T;  3C95 A;  3P8D A;  4PLI A;  1I5L A;  3CC2 A;  1JJ2 P;  5CKB A;  2LJ3 A;  5CQX A;  4D6W A;  4A63 B;  4PKC C;  1WA7 A;  2BZ8 A;  5CKE A;  2D8H A;  3CCQ Q;  2OTJ Q;  3A8M B;  3PIP A;  2CP2 A;  4J8O A;  3VJP A;  2X3W D;  2PZ1 A;  4F7U G;  2LTO A;  2XG8 D;  4M7A E;  2KR3 A;  4JJC A;  1VQ5 T;  2DO3 A;  2XU8 A;  2DXB A;  3ZEH A;  3VS6 A;  4JS5 A;  3VS1 A;  4CI0 C;  3F70 A;  1LNX A;  1OX8 A;  1TU0 B;  4XU0 A;  4M7A F;  1NJI R;  4E7Z A;  1V29 B;  2VAS A;  2DVE A;  2PNI A;  3TRE A;  2EPD A;  2A7Y A;  2CP7 A;  1WHM A;  1AZE A;  2RM4 A;  5GAM e;  3CD6 Q;  2HBP A;  5IH2 A;  5GAN d;  3CBP A;  4DBQ A;  3OBY A;  2O4X B;  2JTF A;  1KC8 C;  3NGP A;  2PUO B;  4PJO E;  3OYA A;  1K1Z A;  4PJM A;  3L1A A;  4M75 B;  4X1V A;  2DTH A;  3O5Z A;  4Y92 A;  4PJO F;  2DKG A;  1K9A A;  2COZ A;  2RI3 A;  3VUZ A;  2KQW A;  2E5K A;  2AKL A;  4LUE A;  4HT9 A;  3JB9 I;  1IRX A;  4M78 B;  2ROT A;  3CEY A;  2YLB A;  3GLX A;  1D1B A;  4ZGJ B;  1VQ8 Q;  1M2V A;  2CRE A;  2SRC A;  2L8D A;  3FEO A;  5HCK A;  1S72 A;  3EG9 B;  3QYG B;  2FRW A;  1FWZ A;  2I2L A;  4F16 A;  1NM7 A;  2X4W A;  5IXB A;  4C8Q C;  4BY6 B;  4J9I A;  3M54 A;  1SG5 A;  3I5R A;  3L2Q A;  1M27 C;  1ZUU A;  2WSE E;  1SPK A;  3QG1 A;  1TUD A;  2LJ0 A;  3CC4 Q;  1U1T A;  4RTU A;  2QEX A;  2F2W A;  2QAZ A;  5CKH A;  2YRD A;  2DJQ A;  4FT4 A;  5D6X A;  1M30 A;  4FM4 B;  5FWC A;  1YIT T;  1PWT A;  1I81 A;  1KHC A;  5HY6 A;  2PQW A;  3H41 A;  1M2O A;  4IIM A;  2AT1 B;  2FZC B;  1BBZ A;  4WTO B;  3OQ5 A;  4R55 A;  1DJ7 B;  3TVT A;  4DEX A;  1WHL A;  1NPR A;  1JBM A;  3S3N A;  1EZZ B;  1CKA A;  6AT1 B;  1WHK A;  2GGR A;  3RKW A;  3QII A;  4II1 A;  4JRQ A;  4LDW A;  1UUE A;  4M75 D;  5GAN g;  1MV0 B;  3QJ6 A;  4PFO A;  1EX4 A;  5KCO A;  3ME9 A;  1I5O B;  2Z0W A;  4BUG A;  2LVM A;  3SEM A;  1VQP A;  2XD0 A;  1H8K A;  1K8A R;  2C0O A;  3Q1J A;  2DRM A;  4R0K A;  1D1A A;  4MZP A;  2D8J A;  3I56 A;  4AFU C;  1U5S A;  3UAT A;  4QT7 A;  2DL4 A;  3OYY A;  1UGV A;  1FMV A;  2KE9 A;  1VQ7 A;  3LGF A;  3CCE A;  3NHN A;  3CCV T;  4HT8 A;  1J3T A;  1WJR A;  3CD6 T;  3QZ9 B;  4QQG A;  1UJ0 A;  1K0X A;  2KRS A;  2RHZ A;  4HXJ A;  3G6E Q;  3C0C A;  4GBQ A;  1MV3 A;  2F5T X;  3WXM B;  5DLQ E;  2JM8 A;  3TSW A;  2AHJ B;  1Q86 C;  1BIA A;  2YRC A;  1BB9 A;  4LDY A;  2D6F A;  3GOX A;  1NLO C;  1SEM A;  1YI2 T;  1WI7 A;  2QQ9 A;  4XTW A;  1T3L A;  1BK2 A;  2P0Q A;  1VQ5 A;  4ATO A;  5A0L A;  1Q82 U;  3PFS A;  1WXU A;  1M1G A;  1U3O A;  2E70 A;  2K9G A;  2L3R A;  5A0G A;  5LJ5 d;  4J9E A;  2JJ9 A;  1SF9 A;  3A8H B;  3QUI A;  2SEM A;  4KGX B;  4OMP A;  1Y57 A;  2VWF A;  3CC7 Q;  3M9Q A;  4FYV B;  1UJY A;  2RQR A;  5I2M A;  1XOV A;  3JB9 H;  1NG2 A;  2JM9 A;  5CVI A;  3E19 A;  2CH4 A;  3URG A;  1MHN A;  3LH5 A;  4ZGD B;  5AT1 B;  5FRM A;  2D9T A;  1IHW A;  4M7D D;  3QDR B;  2E6Z A;  4E7K A;  2CP0 A;  1Z9Q A;  3JB9 F;  4OGC A;  4A4F A;  5DM7 R;  1UEB A;  5CK9 A;  1K73 U;  2RI2 A;  1E7O A;  3H0H A;  1U06 A;  1GFC A;  2RHX A;  4M75 G;  2XIC A;  4C5I A;  4BDZ A;  1VQ4 Q;  2K3B A;  3FB9 A;  2F2X A;  4IUR A;  1GBR A;  1PNJ A;  4X9C A;  2YT6 A;  4JRI A;  2EYY A;  1ARK A;  3LLR A;  4C92 B;  1I07 A;  3THK A;  4NS5 A;  4XTV A;  3X26 B;  2QQR A;  1FMK A;  1WXB A;  4EMH A;  2RQW A;  2EW3 A;  4E6R A;  2XHC A;  1ZSZ A;  1Q81 R;  2COW A;  3QBY A;  1NJI C;  2PVO B;  2HKN A;  2EVR A;  4J9H A;  1LPL A;  2M1H A;  2NUP B;  4M78 C;  4E7S A;  1W4S A;  4RTT A;  4KGV B;  2BE9 B;  1VQ9 A;  1HJD A;  3S6W A;  5IHK A;  1VQK T;  1UG1 A;  2QA4 T;  2LQK A;  3CPW P;  2M0O A;  1H3Z A;  3I5S A;  5DLO A;  5CKF A;  3S3O A;  1N8R C;  2EGC A;  1QWF A;  2L5Q A;  3MO8 A;  4GY5 A;  1QW1 A;  1LCK A;  3LW5 E;  4XAX B;  5GAN e;  1RAB B;  1MMA A;  4RCB A;  2QQA A;  2LX7 A;  2ZPH B;  3M0R A;  5IN1 A;  4BY6 C;  2JZ2 A;  1BIB A;  2CSI A;  5KCH A;  2L2P A;  2HDA A;  2KT1 A;  5GMK e;  1CSK A;  3SFM A;  5LJ5 g;  3J80 E;  1PD0 A;  1RAG B;  3VRY A;  1YIT A;  4QVC A;  2AZV A;  3ULR B;  2EQJ A;  2ZGW A;  1M1K C;  1Y96 A;  3I35 A;  3BFM A;  3G6E T;  3M0U A;  3MKD A;  2NUT B;  1N5Z A;  3H8Z A;  1M9S A;  3OYN A;  2MCN A;  2C0I A;  4IUT A;  4OMN A;  5CO7 A;  5IT9 E;  2LT1 A;  3X20 B;  3OY9 A;  1MUZ A;  1PC0 A;  3HFN A;  2HL3 A;  2RB6 A;  2RH2 A;  1WXT A;  4M7D G;  4KBM B;  4ZTF A;  4ELZ C;  1M90 U;  3OYC A;  2DE0 X;  3CCM A;  4XTY A;  2PUK B;  3OYL A;  1H64 1;  2A3L A;  1P92 A;  1YIJ T;  2JW4 A;  3OYJ A;  2DLP A;  5GMK i;  1K9M R;  3GPL A;  1I8F A;  2DD4 A;  2O9V A;  2HD0 A;  2NWM A;  3VS3 A;  3JCM W;  3AT1 B;  2RJF A;  2FVU A;  3MHX A;  3IQL A;  1MNE A;  2BZX A;  2QXF A;  2I0N A;  1M90 R;  3G1J A;  3CCV A;  2QAS A;  2EJF A;  4N4I A;  2YHT A;  1WHG A;  1WYX A;  4JZ3 A;  2KNB B;  1GCQ C;  3CXC A;  1TWB A;  1KSW A;  4DOV A;  1TOV A;  2X4J A;  3RBB B;  1N9S A;  2PU9 B;  5CR2 A;  3SWN A;  4M77 B;  1VQ7 Q;  2E41 A;  1QP3 A;  3I55 Q;  3OW2 A;  1YI2 A;  3OS5 A;  3TU4 K;  3GF5 A;  4WCI A;  1NYG A;  2LMJ A;  1X6B A;  3L42 A;  3A8G B;  1K8A C;  3CME T;  4L6V 5;  2BTT A;  3JCM V;  4C8Q A;  2FO0 A;  3L2V A;  1UGQ B;  4FW2 A;  2DIL A;  4QQ6 A;  2XK0 A;  2C0T A;  1G3T A;  2PVG B;  2QGG A;  1M1F A;  1QLY A;  3JCM Q;  1WX6 A;  5I22 A;  4FCY A;  4RTV A;  2YWW A;  3HRT A;  2RPN A;  2KK4 A;  1R0B G;  1QMC A;  2BE7 D;  4LD9 K;  2RA2 A;  5GAN 4;  2ROL A;  4HVU A;  3CCU Q;  4KRT A;  1JJ2 A;  1TS9 A;  1ZBX A;  3OS2 A;  2MK5 A;  4OP0 A;  3MEA A;  3TCJ A;  4MZT A;  1IZ6 A;  4E7I A;  3C94 A;  5GAN 6;  4DOW A;  4L59 A;  1UDL A;  1VYV A;  2D0Q B;  3CMA T;  2QGF B;  3NMZ C;  4RG2 A;  1VOM A;  4IUV A;  1PSE A;  2MF2 A;  2O9S A;  1KQS A;  4C92 C;  1ZUK A;  1YJN A;  3OS0 A;  4K11 A;  5LJ5 e;  2DIQ A;  3UWN A;  1VQO Q;  3VKI A;  4M7A B;  2FRY A;  3KUF A;  5GAN h;  3RER A;  4PJJ A;  1VQN A;  4JLI A;  4ME7 A;  1F1B B;  3LYI A;  1G83 A;  1IB8 A;  4PFZ A;  3EGX A;  2MAM A;  4DBR A;  3C12 A;  5KYW A;  1BCM A;  2XID A;  1VQK A;  2FPF A;  5GMK h;  2MWO A;  1FXX A;  3HPW A;  4EMK A;  2QA4 A;  3OW2 P;  4OB1 B;  3R6O A;  4M77 D;  1HD3 A;  4PLL A;  4FU6 A;  2AK5 A;  1NPP A;  1I4K 1;  2KMT A;  3OMC A;  1ZSG A;  3EFO B;  1FX7 A;  2LCC A;  5FW9 A;  2X4X A;  1X2K A;  2X3X D;  2J6K A;  2DJZ A;  1RAF B;  2O31 A;  2QTX A;  2GFU A;  4Q5W A;  3HKS A;  3RNJ A;  1YJW Q;  1IO6 A;  3SDZ A;  1SKU B;  4PL6 A;  3HTR A;  3G71 Q;  4FYY B;  2A36 A;  4ZNX A;  5GAN 7;  2K4Y A;  4E7L A;  5GAN j;  2JNG A;  1ZLM A;  2J06 A;  1UEC A;  1Q81 C;  3CCR T;  1QCF A;  2P4T A;  2A37 A;  3G4S Q;  3J7A F;  2JTE A;  2EQM A;  5GMK j;  2LP5 A;  2E4H A;  2M51 A;  2MMP A;  4MDW A;  4MML A;  3LWH A;  3PVQ A;  4IIO A;  3I55 T;  3EGD A;  4C8Q E;  4AG1 C;  1D3B A;  3AHU A;  2YXY A;  4FW1 A;  1X01 A;  5KH6 A;  1W2B A;  2ESW A;  1KQS P;  3EG1 A;  1FYN A;  4C8Q F;  5IHI A;  4ANJ A;  1B7T A;  1YIJ A;  4M7A D;  4AFS C;  2RJC A;  2RI5 A;  2Y90 A;  3MPU B;  1WPY A;  4QKU A;  5FWB A;  3RIR A;  1N8R U;  4C0F A;  4DBH A;  5KE2 A;  2ECZ A;  4QVZ A;  1KJW A;  5CKD A;  1PHT A;  3M0T A;  4C0D B;  3MJX A;  2K2V A;  1Q7Y U;  1RL2 A;  1K0S A;  4ZN3 A;  1VQL T;  2EYQ A;  2JS0 A;  4M78 A;  1YJ9 Q;  4PJN A;  5GAN 5;  2CS7 A;  1UGR B;  1WGS A;  1OU8 A;  1LJO A;  4M77 G;  4M77 C;  4TVR A;  4PJO D;  2P84 A;  2AIR B;  1RI9 A;  5GAN 2;  5IAY A;  2LNH B;  4E7J A;  2VC8 A;  1PRL C;  8ATC B;  2GNC A;  1IXD A;  1X43 A;  5LJ3 h;  1RLQ C;  4RTZ A;  1VQO T;  4J9G A;  3CME A;  3V7R A;  3QZ5 B;  1M1K U;  1IGU A;  1H92 A;  1SHG A;  5HK3 A;  4Z02 A;  1WFW A;  4PNO A;  2V8J A;  1OPL A;  3L2Z A;  1K9M C;  1RUW A;  2YLC A;  3PTA A;  2O01 E;  3DKM A;  1AVZ C;  2ZCF B;  2QG9 B;  2HEQ A;  2V1R A;  3CCL Q;  3PNW C;  2CKK A;  2WSC E;  3JCM J;  2BKD N;  1W2B P;  4XTZ A;  4ZN1 A;  1W70 A;  2VB6 A;  5GAO q;  3EAE A;  3RDV A;  1OU9 A;  2DEQ A;  1VQ6 Q;  2CP6 A;  3EG2 A;  1TUG B;  1BYM A;  3CCS T;  2KYB A;  2DVJ A;  1MND A;  5L8R E;  3HP9 A;  3CMA A;  5LJ3 j;  1YNZ A;  2OTL T;  1YHQ Q;  4OGE A;  3A8O B;  1WLP B;  2WSF E;  2ZPF B;  1PD1 A;  5A0D A;  1VQM Q;  1T0H A;  3JCM f;  4M7A G;  3QO3 A;  2P4R A;  3EG3 A;  5LL6 S;  3G4S T;  2K5F A;  1M2V B;  1AEY A;  1D0Z A;  2FL7 A;  3CCQ T;  2OTJ T;  2E5Q A;  2EQK A;  2EJG A;  1YN8 A;  2E3H A;  5D7U A;  4M7D B;  1D1C A;  5LJ5 j;  3CCJ Q;  4JUV A;  2ABL A;  3HL8 A;  1ACM B;  3NTH A;  4EPC A;  1AZG B;  1GCQ A;  4JPB W;  1AWJ A;  2DTO A;  3VUB A;  2DA9 A;  1QVF S;  3SHW A;  3FDR A;  4PJO G;  1YP5 A;  3NTI A;  3S3M A;  3VS2 A;  1M3A A;  2JT4 A;  5HK0 A;  2DL8 A;  2DEU A;  2GF7 A;  2XDP A;  3INZ A;  1GXI E;  4M78 E;  3M0Q A;  3HSB A;  3CCR A;  4XU1 A;  2DIG A;  1KQ1 A;  3VYH B;  4M78 F;  3FJP A;  5L23 A;  1YJ9 T;  1GBQ A;  5EG2 A;  4IUU A;  1OX9 A;  2C06 A;  3UDC A;  3JCM b;  1JXO A;  4KUI A;  1WDX A;  2OI3 A;  1AT1 B;  5GMK m;  3A98 A;  1AHJ B;  3CPW A;  3CC2 Q;  5DY9 A;  3EH1 A;  3NFC A;  5GAM h;  2LQW A;  2CUD A;  3N5B B;  1YBY A;  1XNI A;  2RQU A;  2RHY A;  2CUB A;  4RCC A;  1KD1 C;  2D1X A;  3H0F A;  1KFZ A;  5FU7 B;  1VQ8 T;  2XMF A;  1QCO A;  2DMO A;  3M0S A;  3V7S A;  1Q82 R;  4C92 A;  2VKN A;  1TSF A;  3VS5 A;  2DPP B;  1AOJ A;  4XQ3 A;  2HZY A;  2ZZD A;  2L3P A;  2QQS A;  1QVG A;  5KYX A;  3JB9 D;  4C0D C;  1VQ6 T;  2O88 A;  2M16 A;  2JUF A;  4BI3 A;  4KUD K;  4J5Y A;  3ZFJ A;  3CC4 T;  2QDY B;  4PK4 A;  4M75 C;  4Y28 E;  3M53 A;  4X34 A;  3UT1 A;  4BE1 A;  1NEG A;  3JRZ A;  5GAM j;  2ED1 A;  1KQ2 A;  3KXT A;  2VYT A;  2EIF A;  3OB9 A;  5GAN 3;  1VQM T;  2HQX A;  3OMG A;  1BKB A;  4E2F B;  1H3H A;  1K73 R;  4Z88 A;  1SHF A;  2HL5 C;  4A53 A;  3OYB A;  2CP3 A;  2M9U A;  3M56 A;  1V1C A;  4IKF A;  3M58 A;  4QQD A;  1G3S A;  1T0J A;  3OYG A;  4A54 A;  4J83 A;  2E10 A;  1RLP C;  3CCJ T;  1XQH A;  4OF1 A;  4J6X A;  1WJS A;  2RJE A;  1UGP B;  1AD5 A;  2A0F B;  1CKB A;  4YTL A;  3JCM X;  2DD5 A;  3V8L A;  4J7F A;  1ZBJ A;  1KK7 A;  3EFR A;  1LVK A;  5FU6 B;  3M59 A;  2OJ2 A;  2FG0 A;  4HKE A;  3VU3 C;  2V1Q A;  3CCS A;  1GL5 A;  1S72 Q;  2RK1 A;  1C0M A;  2OTL A;  1ZSZ B;  4DA4 A;  4F7U A;  2F69 A;  3QPH A;  4N4H A;  5J26 A;  3FJ5 A;  5KYU B;  1LOJ A;  4E7H A;  1QVG P;  4AFQ C;  4J6W A;  2G6F X;  2RQV A;  1KC8 U;  2EJ9 A;  3M4Y A;  1MMG A;  1M5Q 1;  2VGM A;  2CYZ B;  4PFP A;  4BI4 A;  2QEX Q;  3CCQ A;  2OTJ A;  2LCS A;  1W6X A;  2GQV A;  3LH0 A;  3VRZ A;  4Z8A A;  1RI0 A;  2MOX A;  3OYE A;  2Y4X A;  1TXQ A;  3RKY A;  1N6A A;  1B34 A;  3L2R A;  2CSQ A;  2VUB A;  4AFZ C;  3CC2 T;  3RR6 A;  4M7D C;  3JB9 G;  3MEW A;  2QI2 A;  3BW1 A;  3J81 E;  1KC8 R;  3MEV A;  2XDB A;  4B9W A;  3DLM A;  1M8M A;  2LX9 A;  3CC7 T;  4C92 E;  4D8K A;  3FIF A;  4HCB A;  2DBM A;  3EGU A;  4A4G A;  1U8R A;  2K2M A;  2P0K A;  4WF2 A;  3E9F A;  4C92 F;  3OYK A;  2YUQ A;  1VQP Q;  1Y96 B;  3CD6 A;  3MP1 A;  2LRQ A;  4XU2 A;  4JJD A;  3GP8 A;  1C1A A;  3I56 Q;  2DXC A;  2BIV A;  5J39 A;  2E6N A;  1D09 B;  2KVQ G;  2KAF A;  2NUZ A;  3EG0 A;  3SB2 A;  2GCX A;  2KRO A;  2YSQ A;  2LNV A;  2BUD A;  5ECA A;  2CH4 W;  4JJN K;  3X24 B;  4HCZ A;  5I21 A;  2JTM A;  4GLK A;  1VQ4 T;  1OZ3 A;  3T9N A;  1YCY A;  3CCE Q;  2YUP A;  2K5L A;  2RO0 A;  2HCK A;  4RTW A;  2EYZ A;  4RG8 A;  4C5G A;  2H3J A;  1OQK A;  1QCN A;  3TEE A;  3CBO A;  3FLG A;  2ZPG B;  2PTK A;  1BI0 A;  2EGE A;  1OPK A;  5GAO m;  1WNL A;  3DLL A;  1VQ8 A;  5FU7 C;  1GRI A;  3OSS C;  4OMF B;  3GBQ A;  2CP5 A;  1VQ5 Q;  3CQT A;  1NBE B;  5C0M A;  3MET A;  4OMQ A;  1QP2 A;  3PT9 A;  4QVD A;  5GAO p;  4FYX B;  2B8A A;  2R5A A;  1VA7 A;  3SWN B;  2CZ7 B;  3M55 A;  4RUG A;  2RK2 A;  3PMT A;  2K79 A;  2EFI A;  5GMK l;  2RHI A;  1YFN A;  2KDS A;  3CXC S;  4F7U E;  3CC4 A;  2EGA A;  2B86 A;  4FYW B;  2OAW A;  1UFF A;  2MI6 A;  5KYY A;  4F7U F;  4LDX A;  1I0C A;  1T3S A;  3PMI A;  2LQ8 A;  1QQJ A;  2X51 A;  3OW2 S;  1WHJ A;  1V76 A;  3EFO A;  1X6O A;  2YUN A;  4AMC A;  2J7I A;  2J6F A;  1X27 A;  2GTJ A;  3WVD B;  3JCM d;  2PVD B;  1OYX A;  1NEB A;  2OX7 A;  2QEX T;  1Q86 U;  2DTI A;  1VYU A;  2QYZ A;  1B3Q A;  4BDY A;  1Y71 A;  3OA6 A;  1Q82 C;  5GJW B;  5FRN A;  3L2W A;  1M8V A;  2JMC A;  1X2Q A;  5EC7 A;  4J9F A;  3A5Z B;  2M0Y A;  3OBW A;  5HKC A;  1JXM A;  3EFS A;  4A4K A;  4KH1 B;  2DRK A;  2V8I A;  1Q86 R;  1JJ2 S;  1VQ9 Q;  4UC4 A;  1N9R A;  1WQ7 A;  1W1F A;  4BD3 A;  4PJO B;  3X25 B;  3OYI A;  4JRP A;  4E47 A;  1PKT A;  2L3Q A;  1AWX A;  1OZ2 A;  3VS7 A;  3QKJ A;  2AKK A;  1WZO A;  1ZSZ C;  1K73 C;  3V8J A;  7AT1 B;  4FT2 A;  3JAM E;  3EGX B;  1KQS S;  2K3X A;  1BI2 A;  3CBM A;  4HCC A;  3G6E A;  1M3B A;  2CT3 A;  1ABO A;  4EMK B;  2E65 A;  2K57 A;  1VQ7 T;  1SSH A;  1E6G A;  2RJD A;  1YIT Q;  2IVW A;  4CC7 A;  3JCM c;  4LNP A;  4C5E A;  1B07 A;  2Y4Y A;  3REA B;  1UB4 A;  2ZAE A;  2DZC A;  2KYM A;  4KGZ B;  2KRM A;  4C8Q D;  3ASK A;  2DK3 A;  4A4H A;  1NJI U;  3EHR A;  2O4X A;  1Y07 A;  3CC7 A;  3PE0 A;  3QJY A;  2KGT A;  2OAU A;  2ATC B;  3QWY A;  2LC4 A;  4IUQ A;  5D6W A;  2DNU A;  4M75 A;  2IPO B;  1HK9 A;  4O6J A;  3CCM Q;  1QVP A;  3EHQ A;  3QWX X;  1SRL A;  4PJL A;  3JCM g;  3DB4 A;  4J9C A;  1PSF A;  2JOY A;  4A4E A;  3CCU T;  3BE3 A;  1N27 A;  2LJ1 A;  2KSS A;  1HSQ A;  3EGD B;  1X69 A;  1D3B B;  4RKU E;  2DER A;  4JRK A;  1VQ4 A;  4O5V A;  3O8V A;  1Y0M A;  3BDL A;  2E64 A;  3CCV Q;  1N8R R;  1D0X A;  1AWO A;  3I9Q A;  2KI7 A;  2DXT A;  1C6V X;  4C0G A;  1BU1 A;  2ZPI B;  4LUD A;  3EG9 A;  1W2B S;  4XU3 A;  4NL2 A;  1Q7Y R;  4L5G A;  3MP8 A;  4IUP A;  1VIF A;  4NL3 A;  2GTO A;  5CAI A;  3ER0 A;  1WIE A;  3GNF B;  1YI2 Q;  3GIB A;  5A2Q E;  1M90 C;  1Z9Z A;  1G3Y A;  2DYB A;  1R8O B;  1IRE B;  2HKQ B;  2J05 A;  1SSF A;  3VYG A;  2H3E B;  1M1K R;  5LJ5 h;  4BE0 A;  2RN8 A;  4CRI A;  4ZTJ A;  1A0N B;  3SWN C;  1VQ9 T;  2E1H A;  1MGQ A;  1XTD A;  1PRM C;  2K6D A;  1YJW T;  4CC4 B;  3UA7 A;  4RTX A;  1KIK A;  2EQI A;  3C4S A;  5FLX E;  1QVF A;  1UE9 A;  3G71 T;  1ZHI A;  4M7D A;  1VIE A;  2FPE A;  4C8Q G;  2EQU A;  2YDL A;  1G5V A;  3HHT B;  5GAO l;  2RHU A;  1BI1 A;  4XK8 E;  2ZPE B;  2CGH A;  2XDD A;  4M7A C;  4MZM A;  1JB0 E;  1G8X A;  3UPU A;  5IXF A;  4Y91 A;  3OYM A;  4XTX A;  4XTU A;  5CCA A;  4OB0 B;  1YJN Q;  1VUB A;  1RAD B;  2YRV A;  1M4Z A;  4N0A C;  3QXE B;  3LWI A;  1RAE B;  4FL6 A;  2F5K A;  1VQN Q;  1K8A U;  2DL7 A;  4M75 E;  4QW2 A;  1TTH B;  1K76 A;  3CPF A;  2KXC A;  2MIO A;  2L89 A;  2EYW A;  4M75 F;  2EBP A;  2VVK A;  2QA4 Q;  1VQK Q;  2X9H A;  3DB3 A;  4PJO C;  3RKX A;  5CQY A;  2W0Z A;  1YCS B;  3CCM T;  3UF4 A;  1Y7X A;  4LDV A;  5J3B A;  2JMA A;  2K7A A;  1OV3 A;  2EKH A;  3QDF A;  2M02 A;  4LN2 A;  3RUX A;  1QWE A;  2HSE B;  2ED0 A;  3JCM e;  1PCX A;  4M78 D;  2GFA A;  2HQE A;  1MMN A;  2VGN A;  3MP6 A;  3M57 A;  4EMK C;  2EYX A;  3E2U A;  4JDS A;  3I55 A;  1RAC B;  4JJB A;  2H8H A;  5LJ3 d;  1QVF P;  2RD1 A;  3X28 B;  2IIM A;  1R77 A;  4BI8 B;  2XI9 A;  3TSZ A;  3PGG A;  1WHH A;  1MMD A;  4HVV A;  4ORZ A;  2K5I A;  4J7I A;  3EH2 A;  4FSS A;  1JEG A;  2FZG B;  3A8L B;  2GQI A;  2VXE A;  2COY A;  1JO8 A;  4OMM A;  3OSV A;  3CCL T;  3D7S B;  1SRM A;  2CZ0 B;  3VS0 A;  2QDL A;  2EAY A;  2RMO A; 
#chains in the Genus database with same CATH homology
 4D8K A;  1ABQ A;  3U23 A;  1X2K A;  2DBM A;  2D0N A;  2X3X D;  3EGU A;  2CRE A;  3M0P A;  2SRC A;  2ENM A;  2J6K A;  2K2M A;  5HCK A;  2YUQ A;  2O31 A;  2FRW A;  4F16 A;  3RNJ A;  1IO6 A;  4JJD A;  2KXD A;  1NM7 A;  5IXB A;  4J9I A;  2DF6 A;  3I5R A;  1M27 C;  1ZUU A;  2A36 A;  2NUZ A;  3EG0 A;  4ZNX A;  1SPK A;  2YSQ A;  2KRO A;  2DL3 A;  1TUD A;  2LJ0 A;  4M4Z A;  1ZLM A;  5ECA A;  2J06 A;  4RTU A;  2CH4 W;  1UEC A;  2F2W A;  2GBQ A;  2JS2 A;  2DJQ A;  1QCF A;  1M30 A;  2A37 A;  5FWC A;  3UA6 A;  1PWT A;  2JTE A;  2YUP A;  2LP5 A;  2HCK A;  2M51 A;  4RTW A;  3REB B;  3H41 A;  4IIM A;  2EYZ A;  5IHN A;  3PVQ A;  4IIO A;  1BBZ A;  3TVT A;  4DEX A;  4AG1 C;  2ESW A;  1CKA A;  3EG1 A;  2PTK A;  2GGR A;  2EGE A;  1FYN A;  1OPK A;  1GRI A;  1UUE A;  2LZ6 B;  5IHI A;  1MV0 B;  2KEA A;  3GBQ A;  3CQT A;  1TG0 A;  2W10 A;  4AFS C;  1JQQ A;  4OMQ A;  3SEM A;  1H8K A;  2C0O A;  2CT4 A;  2DRM A;  4R0K A;  5FWB A;  2D8J A;  1VA7 A;  4AFU C;  1TUC A;  4RUG A;  2K79 A;  1U5S A;  2O2O A;  3UAT A;  1G2B A;  2ECZ A;  2F2V A;  1KJW A;  4QT7 A;  1X6G A;  1GCP A;  2DL4 A;  2EGA A;  1UGV A;  1PHT A;  2B86 A;  3M0T A;  2KE9 A;  2OAW A;  1UFF A;  1QKX A;  3NPF A;  3NHN A;  1K0S A;  2JS0 A;  2RQT A;  1I0C A;  4ESR A;  1J3T A;  1T3S A;  1UJ0 A;  4EIK A;  1K0X A;  2KRS A;  2YUN A;  4HXJ A;  2J7I A;  2J6F A;  3C0C A;  1RI9 A;  4GBQ A;  1MV3 A;  1X27 A;  2GTJ A;  2LNH B;  1PRL C;  2GNC A;  2JM8 A;  3TSW A;  1X43 A;  1NEB A;  1RLQ C;  4RTZ A;  4J9G A;  1VYU A;  1BB9 A;  1B3Q A;  1H92 A;  1SHG A;  1ZX6 A;  1NLO C;  1YWO A;  1SEM A;  1WFW A;  1WI7 A;  5GJV B;  2DL5 A;  1T3L A;  1BK2 A;  3PVL A;  1OPL A;  1S1N A;  5GJW B;  1RUW A;  3VS4 A;  1WXU A;  1U3O A;  2K9G A;  2JMC A;  1X2Q A;  5EC7 A;  4J9F A;  4J9E A;  1AVZ C;  2M0Y A;  2SEM A;  2A28 A;  4OMP A;  2HEQ A;  2V1R A;  1Y57 A;  4HCK A;  1JXM A;  2VWF A;  2DRK A;  2DBK A;  1W70 A;  1UJY A;  4DEY A;  2RQR A;  1XOV A;  1W1F A;  1NG2 A;  1I1J A;  2JM9 A;  2DM1 A;  2CH4 A;  1JU5 C;  1UHF A;  3LH5 A;  1PKT A;  2L3Q A;  1AWX A;  3EG2 A;  3VS7 A;  2BZY A;  2AKK A;  4AG2 C;  1Z9Q A;  2KYB A;  1UHC A;  2DVJ A;  4J9D A;  1YNZ A;  1E7O A;  2CDT A;  3H0H A;  1U06 A;  1M3B A;  1GFC A;  2CT3 A;  2HBW A;  1WLP B;  1ABO A;  1OEB A;  1T0H A;  2K3B A;  4CC3 A;  2F2X A;  1SSH A;  1E6G A;  2L0A A;  1GBR A;  1PNJ A;  2LQN A;  2YT6 A;  2P4R A;  2EYY A;  3EG3 A;  1ARK A;  1I07 A;  4CC7 A;  3THK A;  4LNP A;  2JXB A;  1AEY A;  1FMK A;  1WXB A;  1B07 A;  2RQW A;  2EW3 A;  3REA B;  4E6R A;  2KYM A;  1YN8 A;  2KRM A;  5I11 A;  2EVR A;  4J9H A;  3EHR A;  3JV3 A;  4RTY A;  3PE0 A;  2KGT A;  2ABL A;  4RTT A;  1QKW A;  3QWY A;  2DNU A;  1HJD A;  5IHK A;  1AZG B;  1GCQ A;  1UG1 A;  2HSP A;  2YUO A;  3H0I A;  4JPB W;  4F17 A;  1AWJ A;  2DA9 A;  3I5S A;  3ZL7 C;  1ZUY A;  2EGC A;  3EHQ A;  1QWF A;  4D8D A;  3QWX X;  1SRL A;  3SHW A;  3KFV A;  2J6O A;  2L3S A;  1LCK A;  1YP5 A;  4J9C A;  3VS2 A;  2LX7 A;  1M3A A;  2JT4 A;  4OMO A;  3M0R A;  2LJ1 A;  2DL8 A;  2CSI A;  4JZ4 A;  1HSQ A;  3M0Q A;  1X69 A;  2L2P A;  2HDA A;  2KT1 A;  1CSK A;  1K4U S;  1NYF A;  1Y0M A;  2KBT A;  2KRN A;  3I9Q A;  3VRY A;  1AWO A;  1EFN A;  5L23 A;  1BU1 A;  4HVW A;  4CC2 A;  4LUD A;  2AZV A;  1GBQ A;  3ULR B;  1M3C A;  1NLP C;  3I35 A;  1JXO A;  4J9B A;  1WDX A;  2OI3 A;  3M0U A;  2FPD A;  1N5Z A;  3A98 A;  2MCN A;  2C0I A;  4F14 A;  4OMN A;  1YWP A;  2LQW A;  1E6H A;  2CUD A;  2GTO A;  1WIE A;  1MUZ A;  2RQU A;  1WXT A;  1Z9Z A;  2CUB A;  2DYB A;  2AZS A;  2DE0 X;  1KFZ A;  2D1X A;  3H0F A;  1VYT A;  2J05 A;  1OOT A;  2XMF A;  4GLM A;  3R6N A;  2JW4 A;  2RN8 A;  2A08 A;  2DMO A;  3M0S A;  2KT8 A;  2DLP A;  1A0N B;  1PKS A;  2VKN A;  2DX1 A;  2O9V A;  2NWM A;  3VS3 A;  3VS5 A;  2RF0 A;  3IQL A;  1AOJ A;  1PRM C;  2FEI A;  2K6D A;  4CC4 B;  2L3P A;  2BZX A;  2I0N A;  2RNA A;  3UA7 A;  4Z89 A;  4RTX A;  2O88 A;  2EQI A;  1AWW A;  1KIK A;  1UE9 A;  1UTI A;  4OML A;  2FPE A;  1GFD A;  4LE9 A;  1WYX A;  4JZ3 A;  2KNB B;  2YDL A;  1GCQ C;  1KSW A;  1NEG A;  2ED1 A;  3RBB B;  2LJ3 A;  1H3H A;  5IXF A;  4Z88 A;  1SHF A;  4A63 B;  1WA7 A;  2BZ8 A;  2D8H A;  4WCI A;  1NYG A;  2LMJ A;  1X6B A;  1V1C A;  2BTT A;  1T0J A;  2DL7 A;  2FO0 A;  2X3W D;  2PZ1 A;  1K76 A;  1RLP C;  2DIL A;  2KR3 A;  4JJC A;  2C0T A;  3VS6 A;  3VS1 A;  2KXC A;  2MIO A;  1QLY A;  1AD5 A;  2EBP A;  2EYW A;  2VVK A;  1WX6 A;  5I22 A;  1CKB A;  4RTV A;  2RPN A;  1ZBJ A;  2W0Z A;  1YCS B;  3UF4 A;  2JMA A;  2K7A A;  2OJ2 A;  2FG0 A;  1OV3 A;  2ROL A;  2EKH A;  4HVU A;  2V1Q A;  4KRT A;  1GL5 A;  2PNI A;  2EPD A;  4LN2 A;  1QWE A;  2ED0 A;  1AZE A;  5IH2 A;  3FJ5 A;  2EYX A;  1UDL A;  4AFQ C;  1VYV A;  3NGP A;  4JJB A;  2G6F X;  3NMZ C;  2H8H A;  1K1Z A;  2RQV A;  2O9S A;  1ZUK A;  4X1V A;  4K11 A;  2LCS A;  1W6X A;  2IIM A;  3O5Z A;  4Y92 A;  3VRZ A;  2FRY A;  1K9A A;  4Z8A A;  3TSZ A;  2MOX A;  4HVV A;  1G83 A;  4ORZ A;  2CSQ A;  4AFZ C;  2E5K A;  2AKL A;  4LUE A;  4FSS A;  1JEG A;  2GQI A;  2FPF A;  1JO8 A;  4OMM A;  1HD3 A;  1M8M A;  2ROT A;  2AK5 A;  1SRM A;  3VS0 A;  1ZSG A;  2QDL A;  2RMO A;  5FW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...