1PRLC

Two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
b'TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-SRC TYROSINE KINASE SH3 DOMAIN
publication title Two binding orientations for peptides to the Src SH3 domain: development of a general model for SH3-ligand interactions.
pubmed rcsb
source organism Gallus gallus
molecule tags Complex (signal transduction/peptide)
total genus 4
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1prlC00
3EG1A 1NYFA 1YWPA 1IO6A 3NHNA 1UG1A 2LQWA 1WFWA 2O2OA 1AD5A 2ROTA 2MOXA 1RUWA 3REAB 3TSWA 2FPFA 5IHNA 1OPLA 1M27C 3EG3A 2XMFA 1KSWA 4F14A 3UF4A 2CT4A 2EGAA 1UECA 1OV3A 3H0FA 1YP5A 3VS1A 3O5ZA 2F2XA 2V1QA 2HBWA 2KE9A 2V1RA 2KEAA 4EIKA 4F16A 2O9VA 4HVWA 2CUBA 1X27A 2JXBA 3M0TA 4HVUA 2A37A 1GBRA 1OEBA 1GFCA 1A0NB 2J6OA 2AK5A 1GBQA 5FWBA 1WLPB 1ZBJA 2QDLA 4RTZA 1GCQC 1E6HA 1WDXA 1X69A 4AFUC 3UA6A 2PTKA 2JT4A 1GFDA 2CT3A 2NUZA 1B07A 3EG2A 1M3BA 1UJ0A 2KROA 2HDAA 1TUDA 3ULRB 3VS4A 3SHWA 1W70A 3M0RA 4R0KA 4AFQC 4AG1C 4DEYA 4LNPA 2EYXA 2YT6A 2D8JA 2RPNA 1N5ZA 3VRYA 2OAWA 4GBQA 3UA7A 4RTWA 4Z8AA 1PWTA 3REBB 3NGPA 4E6RA 2AZSA 2JS0A 2GTJA 2SRCA 2RMOA 2D8HA 1UDLA 2EPDA 2K6DA 2RQTA 1CKBA 1YNZA 1YN8A 5L23A 2EKHA 1E7OA 1Y57A 2CH4W 2M0YA 3LH5A 2LNHB 5IXBA 3I9QA 3CQTA 1SRLA 1FMKA 2DNUA 1AWOA 2W0ZA 1AWXA 2A08A 2MCNA 1BB9A 1WXUA 1AVZC 2DA9A 3A98A 2LJ1A 3EHQA 1I07A 3TSZA 2PNIA 4J9BA 1VYVA 3M0QA 2OJ2A 2IIMA 1AWJA 2JTEA 1U5SA 2A36A 1UTIA 4AFZC 1Y0MA 3I5RA 3EHRA 1NEGA 1M3CA 1NM7A 4WCIA 1ZUYA 3C0CA 4HCKA 1PKSA 2G6FX 2YUNA 4OMMA 2EGCA 1W6XA 1JXOA 1S1NA 1M8MA 1ZUUA 1WA7A 2HSPA 2DX1A 2DILA 2J6KA 1K1ZA 3PVQA 2NWMA 1XOVA 2K79A 1RLQC 2C0OA 4K11A 1QWEA 5FW9A 1H92A 2JS2A 1T3LA 4ORZA 3U23A 4D8KA 2GBQA 2VWFA 2K7AA 4ESRA 2RQRA 1UGVA 2CSIA 2KT1A 3VS3A 1M30A 5IXFA 2KR3A 1T0HA 1I0CA 2E5KA 3RBBB 2DF6A 1X6GA 1NG2A 3VS5A 2RNAA 3H41A 2ESWA 1G2BA 1GL5A 4RTVA 2CREA 4RTUA 2DL5A 2FRWA 2LMJA 2JMCA 2K9GA 2YSQA 3EGUA 4A63B 5ECAA 2LJ3A 1WYXA 1HSQA 1I1JA 2ROLA 2ENMA 2FO0A 1KJWA 2LQNA 4OMOA 3I35A 4IIOA 1HJDA 1NEBA 1ABQA 2I0NA 1G83A 2LZ6B 2K2MA 4RUGA 4Z89A 1T0JA 1MV3A 4LUEA 4Y92A 1SSHA 1SRMA 1JU5C 1YCSB 1LCKA 5GJVB 2BTTA 3H0IA 4LE9A 2AKKA 4J9DA 1SEMA 2DM1A 5IHIA 1AZGB 4JJDA 4OMNA 1AZEA 2J6FA 1SPKA 4QT7A 2CSQA 1KFZA 2EBPA 2DRMA 2A28A 4CC3A 2DE0X 1VA7A 1V1CA 1QKXA 1PKTA 2DVJA 2FPEA 1OPKA 3VRZA 1UFFA 2GNCA 2J06A 4J9EA 1Z9QA 2C0TA 2H8HA 1ZLMA 3VS0A 4JZ4A 2VKNA 1QCFA 1JO8A 4J9HA 4D8DA 2DJQA 1B3QA 2GTOA 2RN8A 2EVRA 4DEXA 2EQIA 1ZUKA 2W10A 1AWWA 1WI7A 4FSSA 2DYBA 5GJWB 2DBKA 2EGEA 2O31A 2LX7A 1SHGA 2RF0A 3H0HA 1PHTA 1GCQA 1UE9A 2HCKA 2X3XD 2YUQA 2OI3A 2FEIA 1MV0B 4JJCA 4CC2A 1WX6A 3THKA 2KBTA 1AEYA 3PVLA 3JV3A 2DMOA 1QKWA 3FJ5A 2DL7A 2BZYA 1Z9ZA 2FG0A 2FRYA 1M3AA 2KRSA 4OMLA 1JEGA 1JQQA 2J05A 4ZNXA 4RTXA 2K3BA 2ED0A 1X43A 2LP5A 3VS2A 4CC4B 1RLPC 3VS6A 1NYGA 1UHCA 2CUDA 3M0UA 4Z88A 2EYYA 1AOJA 2DBMA 4J9IA 4LN2A 1UHFA 3KFVA 1KIKA 1YWOA 3R6NA 2JMAA 2D0NA 4JPBW 5FWCA 2KXDA 2RQVA 1BK2A 2L3SA 2DRKA 2KRNA 2ED1A 3QWYA 1H3HA 4M4ZA 3PE0A 2LCSA 2HEQA 5IHKA 2D1XA 1U06A 1VYTA 1WXTA 4OMQA 5I11A 1TUCA 1BU1A 2PZ1A 2SEMA 4HXJA 3QWXX 3M0PA 1EFNA 2CDTA 2KXCA 3SEMA 1CSKA 1K0XA 1U3OA 2KYMA 1ZSGA 2O88A 5HCKA 4CC7A 4GLMA 2DL4A 1SHFA 2LJ0A 2F2VA 2AKLA 1QWFA 2KNBB 4RTTA 1K9AA 2GGRA 4RTYA 1X2QA 1WIEA 2DL8A 1JXMA 1FYNA 5I22A 2RQUA 2EW3A 4F17A 4J9GA 4J9CA 4JJBA 1CKAA 1T3SA 3ZL7C 1PRLC 3M0SA 3VS7A 1H8KA 2JM9A 2EYWA 2BZXA 2FPDA 2J7IA 2L0AA 1UJYA 3I5SA 1J3TA 5IH2A 2JW4A 4X1VA 3RNJA 2F2WA 1NLPC 1ZX6A 4J9FA 2X3WD 3GBQA 1QLYA 1MUZA 2CH4A 2P4RA 3NPFA 2L3PA 4KRTA 3NMZC 1K0SA 2DLPA 2VVKA 3IQLA 1TG0A 1RI9A 1E6GA 2KGTA 1PNJA 2KYBA 4OMPA 2YDLA 1OOTA 2MIOA 4AFSC 4AG2C 2BZ8A 4JZ3A 2O9SA 2ECZA 1PRMC 2ABLA 3EG0A 2GQIA 2KRMA 2L3QA 2L2PA 5EC7A 1UUEA 1WXBA 2M51A 2YUOA 1GCPA 1HD3A 2KT8A 4LUDA 1K4US 2B86A 1GRIA 4HVVA 3UATA 1VYUA 1X6BA 2C0IA 4IIMA 2RQWA 2YUPA 2EYZA 2DL3A 1ABOA 1ARKA 1W1FA 2AZVA 1X2KA 3TVTA 1BBZA 1K76A 2JM8A 1NLOC
chains in the Genus database with same CATH superfamily
3OYGA 1QW1A 3HPWA 4FYYB 4NL3A 1UG1A 2LQWA 3BDLA 1D1AA 4M7AC 4M7AG 5I2MA 4DOWA 2MOXA 3EG9A 1RUWA 4PKCC 1YJWQ 1OPLA 5LJ5j 1VQPT 3I55T 1KSWA 3A8GB 3TQ7P 3G4ST 4M7AE 4N0AC 1RAIB 3CCRQ 1YHQA 3CMEQ 2EGAA 1YJ9Q 3H0FA 1TXQA 2FHDA 2RJCA 2HQHA 2V1RA 2JVVA 3C12A 4E7JA 4HVWA 3CCUT 2ZPBB 1X27A 2JXBA 4ZN3A 2NUPB 1WGSA 4FL6A 3QYHB 1K8AR 1E6HA 5GAMd 1WDXA 8AT1B 4C0DC 3META 2A0FB 2PTKA 2R5AA 1QVFS 3CCQT 1VQ4Q 2XDBA 1NZ9A 1XTDA 2D0QB 4PJOA 3PMTA 2KROA 1JJ2S 2HAXA 3MEUA 3VS4A 3CCSQ 4DEYA 2D8JA 5GMKe 3VRYA 1TOVA 2OAWA 2LQKA 2YRVA 3M9QA 4Z8AA 2DETA 1VQOQ 3V7RA 4B9XA 3CMAA 1M2VA 1UDLA 3EH1A 2EKOA 1Y57A 1LNXA 1B34A 4ELYC 4B9WA 1ZSZC 4X34A 4YTLA 3CCLQ 1MMNA 4A54A 4M7AA 4ME7A 3MJXA 1OU8A 3BDUA 2BE7D 2JTFA 2JNGA 1I5LA 1VYVA 2DTOA 3M0QA 2E65A 5CKHA 1AWJA 1VQ7T 4Y28E 5FU7B 1IHWA 5CCAA 2P0KA 3LGFA 3SD4A 2DVEA 1Y0MA 3I5RA 4JLIA 3EHRA 1Y96B 2B8AA 3QSUA 3HRUA 3CC7A 3CPWS 2RA2A 4HCKA 2YUNA 1W6XA 2XDPA 3CC2T 4OB0B 2GFAA 4M7DD 1S72Q 1S1NA 4UC4A 3EG9B 1K1ZA 3PVQA 1NPRA 3V7SA 3M5AA 2DIGA 4M77E 1KQSA 1KQ2A 2GBQA 2K7AA 1WHHA 4LD6A 1M30A 1Q81U 5FRMA 2P4TA 4QQGA 3FC3A 4NOYA 5FU6C 1X6GA 5KYNA 1UGSB 1VQ9A 5HK0A 2X35A 5IAYA 2RNAA 1G2BA 2Y4YA 1VQ6Q 4RTVA 2VXEA 5GAN5 2MPXC 3TU4K 3G7ZA 4A63B 4PJOB 2CP2A 2MWPA 1WYXA 1KQSP 2VGMA 2QG9B 3VUZA 3VYGA 1HJDA 1IREB 2RHIA 1NEBA 3CCVA 4C5IA 4Z89A 1MV3A 5J26A 2LRQA 1M2VB 2JOYA 1TWBA 4FW2A 3L2QA 3P8BB 1MGQA 2KQWA 5KYXA 1YCSB 2E41A 2BTTA 3QZ9B 3QG1A 1Q81C 3H0IA 1VQMA 1B34B 1UGRB 2WSFE 3A8OB 3CMAT 2COZA 3OB9A 4M7AB 2YLBA 1SPKA 1KFZA 2E3IA 2EBPA 4M77A 2A28A 1V1CA 4L5GA 4A4HA 3UWNA 1QKXA 1H641 5A0DA 1PKTA 3CC4Q 4KH0B 3MEWA 1YJ9A 2XG8D 2IPOB 2J06A 3OYLA 1Z9QA 2KI7A 2C0TA 1RADB 1JO8A 2DJQA 3OQ5A 2XI9A 4PLLA 1B3QA 2GTOA 2RN8A 3OS2A 2EVRA 3JCMQ 3ME9A 3OSVA 1OU9A 2H3EB 1IGQA 2W10A 4E2FB 1WI7A 2F69A 2PVOB 5HKCA 1VQ4A 1SHGA 4C0DB 3CC7T 4XU3A 1BCOA 5GANj 2HCKA 2VB6A 4C5GA 4MZPA 3A8LB 5AT1B 1WX6A 3PVLA 3CCJA 2C06A 3JV3A 5LJ5e 1VQOA 3L2ZA 3DB4A 1M3AA 4E7IA 2J05A 1Q95G 2HSEB 1RACB 4E7KA 1RAHB 4CC4B 1VUBA 4C92C 4C92G 1NYGA 2CUDA 4Z88A 2R58A 2EQJA 4OB3B 3JCMJ 1KIKA 1ZSZB 3OYDA 1VQ9T 4JPBW 4C92E 2WACA 2KAFA 2RQVA 1M90U 4V2SA 2L5QA 3QWYA 2PVGB 3OSSC 1EIFA 2LCSA 4C0ZA 2VASA 2D1XA 1U06A 2DD5A 4MDWA 1VYTA 4OMQA 2PZ1A 4HXJA 3M0PA 1JRIA 2X4XA 1K0XA 1ZSGA 1PC0A 5HCKA 2KY9A 4GLMA 3VJPA 2DL4A 4WF2A 3X20B 3CBOA 2AKLA 3D7SB 2KNBB 4RTTA 4LDYA 3ASKA 3WVEB 5LJ3j 4RTYA 5KE3A 2AT1B 1WIEA 4BI8B 1WZOA 3G6EQ 3GP8A 2M0OA 2OTJQ 3E2UA 3MEVA 2M9UA 2BIVA 4F17A 4J6WA 4JRIA 5KYUA 2RM4A 4JJBA 1CKAA 4KT0E 1VQMT 4RG8A 4FSXA 3ZL7C 4M78F 2EJFA 3VS7A 1H8KA 2CP5A 3OYAA 2EYWA 5HK3A 5A0GA 2BZXA 1M90C 1D3BA 3I5SA 2MI6A 4O6JA 5GMKj 4A53A 2F2WA 1BIAA 4J9FA 3GBQA 1QVFA 2CH4A 5FU6B 3PIPA 2P4RA 1K0SA 2DLPA 1JJ2A 2VVKA 4DBHA 4RKUE 1RI9A 1E6GA 4C92A 1G8XA 5GAMg 3GF5A 2MIOA 4KUIA 2OX7A 2CP3A 3CBPA 4AG2C 3FIFA 4HCCA 3OBYA 3QHSA 1QQJA 5FLXE 2ABLA 3I56T 3EG0A 2QA4A 3OYHA 3MO8A 1P92A 2L2PA 1VQ4T 3EFOB 1VQ8Q 3PIOA 3KBGA 1HD3A 4J6XA 4KUDK 1C0MA 1GRIA 4HVVA 3CCJT 3L2VA 1VQOT 2MF2A 4N4HA 1JJ2P 1FWZA 4F7UA 1HYOA 1X2KA 3QKJA 1K73R 2LNVA 4Q5WA 2CKKA 1DJ7B 1NYFA 1YWPA 2O2OA 4PJNA 3EFSA 3L2WA 2EQKA 3TSWA 2FPFA 5IHNA 3CPWA 3RERA 3OMCA 1YI2A 1Q86U 2LDMA 1M4ZA 4F14A 2CT4A 2ZZDA 1UECA 3O5ZA 2F2XA 1PM3A 3LLRA 2OTLA 2HBWA 2KE9A 1XNIA 1Q7YR 4E7SA 5CR2A 1RL2A 2CUBA 4JS5A 2A37A 1GBRA 4BDYA 3JCMe 2AK5A 3CCMT 1GCQC 5KYUB 2LQ8A 2KK4A 4IUPA 3HHTB 1X69A 4AFUC 4BE0A 3UA6A 3LWHA 1GFDA 1M1KR 2BKDN 1D3BB 3ULRB 3OMGA 3SHWA 1W70A 1X01A 4AFQC 3C4SA 2RPNA 1WNLA 3RKXA 1Q86C 2GF7A 2AZSA 2GTJA 2MAMA 2XK0A 2SRCA 2RMOA 4RCCA 4C92B 2EPDA 1WPYA 4ELZC 4M78C 2EKHA 1UEBA 4M78G 4DOVA 2D6FA 4M7DC 1FXXA 2M0YA 3LH5A 4M7DG 4J7IA 4HCZA 3I9QA 2CP7A 1M8VA 1G3SA 2W0ZA 1AWXA 3R6OA 4M78E 2A08A 1K9MR 4M7DE 1BB9A 1WXUA 3EHQA 3O8VA 3MP8A 5GANe 2PNIA 4BDZA 2RB6A 2M16A 1VQNQ 4AMCA 2OJ2A 3QUIA 2IIMA 2QA4T 2CZ0B 2JTEA 2K57A 4E7LA 3QYGB 3RR6A 5M9OA 3M4GA 3FJPA 2ATCB 2EJGA 3G6EA 4WCIA 2DFUA 1YIJA 1ZUYA 3C0CA 2AIRB 3ZFJA 5D6XA 3ZBDA 1QVGS 2K5FA 1Y96A 2NLUA 3G71Q 2DILA 5D7UA 3S6WA 2NWMA 4KH1B 1XOVA 5CQXA 1WQWA 1RLQC 2V26A 2C0OA 3X24B 3F70A 4WTOB 5L8RE 1ACMB 2DIQA 2Y4XA 3U23A 5C0MA 2CZ6B 1N8RR 2HL3A 4C5HA 3FEOA 1ZBXA 1UGVA 2M02A 2DKGA 2KT1A 5IXFA 1YI2T 1T0HA 3BFMA 1I0CA 2E5KA 2DF6A 4X9CA 1QP2A 2DERA 2OTLT 2CZ1B 4BE2A 2ESWA 2ZAEA 5KYYA 1RAFB 4FW1A 4BD3A 2CREA 3CD6Q 2DL5A 2FRWA 5LJ3e 4M7DA 3GLXA 2K5LA 3HKSA 2YSQA 3EGUA 4JUVA 1VOMA 1VQ8A 3EFRA 5CKEA 1R8OB 3H9NA 1KJWA 3I35A 4IIOA 1ABQA 3SDZA 1VQLT 1G83A 3PNWC 5CQYA 4Y92A 1SRMA 2FZKB 2X51A 2DTIA 1JU5C 2HQEA 1TUGB 2LC4A 4KBMB 3V8JA 2RI5A 4M75F 2P0PA 4J9DA 1SEMA 4HT8A 3OYCA 1AZGB 5GAN8 2J6FA 2MK5A 3HTRA 2CSQA 3HRTA 4CI0C 2DE0X 1VA7A 4II1A 3VYHB 2QTVA 1JBMA 2DVJA 2VXFA 5HY6A 4IUVA 3SFMA 1PD0A 4HA8A 1UFFA 2GNCA 5GAOr 2BUDA 3EAEA 1M5Q1 1KG1A 3WXMB 4N0AA 2E4HA 3DLLA 4J9HA 4D8DA 5GMKm 3EGDA 2LT1A 1RAGB 4LDXA 2KDSA 2LT4A 5GAOq 4OP0A 2HD0A 4XU2A 1AWWA 2QAZA 4FSSA 2DXCA 2DBKA 1IRXA 3G6ET 4M78D 1YIJT 2RF0A 3H0HA 1EX4A 2CGHA 1NBEB 4JJCA 5AYFA 4C8QF 1AEYA 1PCXA 2BZYA 3S3OA 2FG0A 2FRYA 1JQQA 1SF9A 4XTXA 4ZNXA 2K3BA 1I5OB 1M1GA 1K8AU 2EFIA 4M78B 3MEAA 1YHQT 5KYYB 1AT1B 2EYYA 1AOJA 2YHTA 4M7DB 4LN2A 3KFVA 2FB7A 1WHKA 2JMAA 3JRZA 5FWCA 1EZZB 4XTYA 1BK2A 2L3SA 2YXYA 3X26B 2KRNA 2ZPGB 1NJIR 1PSFA 4NL2A 1MMDA 1ZSZA 4QQ6A 3L1AA 3FLGA 5IHKA 1X75C 1TUCA 1VIEA 3QWXX 3MCAB 1VQ8T 1EFNA 3C94A 3V8KA 5GAOl 3SEMA 2KYMA 4FT2A 4LXCA 4CC7A 3ER0A 2R5MA 1C6VX 1YJNQ 2FZCB 2LJ0A 3HP9A 1D0XA 1M1FA 3S3MA 2K3YA 3GOXA 2OAUA 1N27A 3M57A 3OY9A 1QCOA 4FU6A 5GAN2 1WHMA 2GGRA 3M53A 4N4GA 4JRQA 7AT1B 4R56A 3A8HB 1K8AC 5I22A 2E5QA 1BI3A 2ZPHB 3A8MB 3X25B 3OYNA 3AHUA 1YJWA 2RD1A 3DLMA 3CCRA 3CMEA 1J3TA 4X1VA 3EGDB 3RNJA 1D1CA 1OULA 2X3WD 1QLYA 1MUZA 3QDRB 1O9SA 3PMIA 2L3PA 5LJ3f 1OYXA 3IQLA 2QYZA 2JJ9A 3INZA 4E7HA 1PNJA 5LL6S 3RMSA 3M59A 1IB8A 5IN1A 3H8ZA 3PGGA 3BE3A 3I55Q 2X4JA 4JZ3A 3G4SQ 2ECZA 1PRMC 4QVCA 2RI2A 5EC7A 2YUOA 3CCSA 4LUDA 5FROA 1G3YA 2F5KA 2K4YA 5J3BA 3EFOA 2O4XB 2RQWA 2DL3A 1Y7XA 1QMCA 2AZVA 4OB2B 3AT1B 2COYA 3TVTA 1K76A 4PFOA 4XQ3A 3J7AF 2F5TX 3EG1A 3CCQQ 2YLCA 4C8QC 5GAN6 1BYMA 2XIDA 4C8QG 3OYIA 1WHLA 3CCLA 2RHYA 1WFWA 3JB9F 1R77A 2KMTA 1AD5A 2X4WA 4XTVA 4J83A 2X4YA 3REAB 3E9FA 1M27C 2XMFA 4KGXB 2R57A 1ZHIA 1QVGA 4ZGDB 5DM7R 4XU0A 4PLIA 4CRIA 1OV3A 1YP5A 2G3RA 3VS1A 1KD1R 3RKYA 2V1QA 3OYMA 2YRCA 1M2OA 5CO7A 4F16A 8ATCB 3JAME 1BCMA 2Z0WA 2DXUA 3M0TA 2P0QA 4LDVA 3TEEA 2QEXQ 5LJ3h 2HZYA 1GBQA 2CYZB 4A4GA 3CCVT 1ZBJA 4OB1B 2QDLA 4RTZA 1UGPB 1F1BB 1S72A 1OZ2A 1W4SA 1LPLA 2EYQA 5KE2A 5J39A 1VQKQ 1BI2A 2PUOB 1LJOA 2K5IA 1VQ7Q 2EJ9A 1B07A 3P8HA 4DBRA 4BACA 1UJ0A 2IVWA 4BUGA 3OYEA 1H3ZA 3M0RA 4R0KA 4LNPA 2EYXA 2YT6A 1N5ZA 5GMKh 2DPPB 1YJWT 3UA7A 4IURA 3MP1A 2QASA 1PWTA 3CCRT 2QQRA 3MKDA 2JS0A 3CMET 1YJ9T 3CC2Q 2GFUA 3JB9I 2K6DA 2RQTA 1CKBA 4XTZA 4KGVB 2HKQB 4JRPA 1E7OA 1UGQB 2CH4W 4EMKC 5GMKl 3OYBA 1VQ6A 3NFCA 3QIIA 2LNHB 1TS9A 1Q82R 1B7TA 3HSBA 1FMKA 2E6ZA 3OS1A 5GAMj 3A98A 1I07A 3TSZA 1O75A 3JCMc 4FCYA 3SWNC 1WJQA 4PJOF 2COWA 2E6NA 2GCXA 2A36A 1UTIA 3CCST 1TU0B 5GMKi 2QQBA 1WJRA 5KCOA 2RH2A 4GY5A 4M75D 3CBMA 3OYKA 2XU8A 1QVFP 1KQSS 1KC8R 1NM7A 3HFNA 4J6YA 4BI4A 1PKSA 2G6FX 4OMMA 3LWIA 3UT1A 1KHIA 5CKDA 4PFPA 1ZUUA 2HSPA 4DBFA 2J6KA 3OYJA 4IKFA 2QQSA 2ZPFB 3CC4A 1D09B 4K11A 4M7AF 1QWEA 2MWOA 3CCLT 3EGXB 1T3LA 3E9GA 4HCBA 4D8KA 1RABB 2VWFA 2RQRA 2VV5A 2DXTA 2PUKB 2EAYA 2CSIA 3NTKA 9ATCB 2DEUA 1BKBA 1IGUA 1X6OA 3QJ6A 1PD1A 2E10A 2QGGA 2FZGB 3CCEQ 2XDDA 3BW1A 2GQVA 4D6WA 4MZTA 4IUUA 3LH0A 4EMKA 4RTUA 2LMJA 5KH6A 3LX7A 2JMCA 2K9GA 3KUFA 1OI1A 1WHGA 4C8QD 1IZ6A 1S72T 1QVPA 2LJ3A 5GAOm 5LJ5f 2ROLA 3SWNA 4OMOA 3CPWP 4XK8E 2NYSA 2LZ6B 2K2MA 4RUGA 4MMKA 2L89A 3JCMP 1LCKA 5GJVB 2F1LA 3CCQA 2VGNA 1YFNA 3SB2A 3CC7Q 4LD9K 1D0ZA 4Z02A 2AKKA 4OMNA 4OGCA 2XICA 2QI2A 4QT7A 3JB9H 4IUTA 2E70A 1G3TA 4N4IA 2DZ9A 5CIUA 1VQ6T 1OPKA 3VRZA 5GAN3 4J9EA 4EMGA 3HFOA 2H8HA 4QW2A 3VS0A 4QVDA 2FVUA 2VKNA 1QCFA 1K73U 1UB4A 3HRSA 2QEXA 3KXTA 3GNFB 2QXFA 4DEXA 1RI0A 4ATOA 1TTHB 4E47A 1HXDA 2OTJA 2O31A 3OYFA 1VQKA 4LDWA 1I81A 1LOJA 4JS4A 1PHTA 4PJOC 1R0BG 1GCQA 4PJOG 1XQHA 3NTHA 1MNEA 4M77F 1MV0B 3QDFA 2DMOA 5LJ5h 3X28B 3G1JA 1QKWA 1Q7YU 2DTHA 4AT1B 3CC4T 2DL7A 4PJJA 4OVAA 3CC2A 2KRSA 4FIBA 4BE1A 2XD0A 2D9TA 4RTXA 2XHCA 1X43A 4FM4B 3VS2A 4EMKB 1UHCA 1K73C 3A5ZB 4XTUA 2JZ2A 1VQMQ 2DBMA 4J9IA 5LJ5g 1YWOA 3R6NA 4PK4A 2DJZA 2KXDA 4M78A 3JCMX 1M1KU 3RKWA 4PL6A 1LVKA 2DRKA 3M56A 5D6WA 2ED1A 1H3HA 2VUBA 4M4ZA 2RHUA 3SWNB 4Y91A 3QPHA 5I11A 1W2BS 1JB0E 3S3NA 1G5VA 2RJDA 1SG5A 1U3OA 4FYXB 2LTOA 1D0YA 1SHFA 2F2VA 2DYIA 1Q7YC 1FMVA 5DLOA 1K9AA 1Q81R 2AHJB 3GPLA 3Q1JA 1ZA2B 2DL8A 3I56Q 4L6V5 3JB9D 2QQ9A 3OS5A 2VC8A 1K9MU 1FYNA 3QXEB 4J9GA 3CXCS 2CP6A 2YWWA 4OF1A 5GAOp 3M0SA 4B6MA 1M1KC 1U8RA 2QDYB 5GAMe 2FPDA 3CCJQ 4TVRA 5IH2A 2JW4A 3CCEA 3M4YA 3OYYA 4KRTA 3NMZC 3JCMf 3MPUB 3A1PA 4OMPA 1YITQ 2YDLA 4X9DA 2E1HA 2QEXT 3RESA 3MHXA 1K9MC 1N8RU 4ZGEB 2OTJT 1VQKT 2KRMA 2M51A 1RAAB 2DO3A 3UATA 2DAQA 4ZTJA 2LVMA 3M54A 3OBWA 2C0IA 4IIMA 3CCMQ 2QK0A 5DLQE 1W1FA 2WSEE 4BY6C 1BBZA 2PU9B 4XTWA 2O4XA 4M77C 3PT9A 2RHXA 4M77G 4C92F 1VQ5Q 1IO6A 2K2VA 3NHNA 4C0FA 5A0LA 4EPCA 3RUXA 1FMWA 2ROTA 3RMQA 5D6YA 1YBYA 5GANf 4KGZB 4PJOD 3EG3A 2DEQA 2Y90A 1HK9A 1VQNA 3UF4A 1Y07A 1N8RC 3DB3A 1U1SA 2A7YA 4XU1A 2QQAA 2E64A 3FRNA 1BI0A 2KEAA 2V8IA 4EIKA 2O9VA 2EQMA 3J81E 4HVUA 1OEBA 1GFCA 1A0NB 2J6OA 3JCMh 5A2QE 5FWBA 1WLPB 3C95A 4F7UF 1WQ7A 4PFZA 5IT9E 6AT1B 1G3WA 3G71A 4M7AD 4EMHA 2JN0A 3OW2S 1N6AA 2JT4A 3N5BB 2QA4Q 2CT3A 2NUZA 5GAN7 3EG2A 1M90R 3MP6A 1M3BA 1PG5B 5DY9A 3JCMg 2HDAA 1TUDA 4AG1C 3DKMA 2QGFB 3OA6A 3VU3C 4GBQA 4RTWA 2O01E 5CKBA 3REBB 3NGPA 4E6RA 2I2LA 4E7ZA 4M75C 4M75G 2D8HA 3GIBA 4PJLA 2JTMA 3CEYA 1YNZA 3CCET 1YN8A 1IXDA 5L23A 1SKUB 4M75E 4LDUA 3CD6A 1OX9A 2QTXA 5IXBA 3CQTA 1SRLA 2DNUA 1Y71A 1AWOA 1VQPQ 2MCNA 1ZA1B 1I8FA 2ZCFB 2CS7A 1AVZC 2DA9A 5LJ5d 2LJ1A 2E3HA 5GANh 4C5EA 1YI2Q 3URGA 4J9BA 3VUBA 1MMGA 3BY7A 1U5SA 4A4EA 3UPUA 2OTLQ 3CCUQ 4AFZC 1NEGA 1M3CA 3I56A 4J8OA 3VKIA 5GANg 5EG2A 3QZ5B 2DD4A 4PNOA 2LX9A 3L2RA 2EGCA 3P8DA 1NJIU 1JXOA 1M8MA 1WA7A 2FYKA 5GAMf 2DX1A 2A3LA 4DA4A 2IG0A 2K79A 1VQLQ 3GNGA 5FW9A 2RJFA 1H92A 2JS2A 4FYVB 4ORZA 2NUTA 4C8QE 4ZN1A 1QP3A 1MNDA 4ESRA 1I4K1 4MZMA 2DXBA 4QVZA 2P84A 3EGXA 3VS3A 1VQNT 2KR3A 3RBBB 1YITA 4M75A 1NG2A 3VS5A 4BI3A 4RMOA 2PVDB 3H41A 2RK1A 1GL5A 3LGLA 2K3XA 4J5YA 1MMAA 4JDSA 2RHZA 4M77D 3V7CA 1OZ3A 5CVIA 5ECAA 1NJIC 1D1BA 2YRDA 3G71T 1HSQA 1I1JA 2WSCE 2ENMA 2FO0A 5KYWA 2LQNA 3FB9A 2HMAA 5KYXB 2I0NA 1QCNA 5CAIA 5LJ3g 1QVGP 3CCMA 1T0JA 4LUEA 1SSHA 1Q86R 4F7UG 2LCCA 5CK9A 4BY6B 4MMLA 1W2BA 4F7UE 1YIJQ 1VQ5A 4M77B 4LE9A 3JCMb 4HT9A 2DM1A 5IHIA 4JJDA 1KK7A 1AZEA 2DRMA 4CC3A 4M7DF 4C8QA 5GAMh 3CD6T 2FPEA 1TSFA 4VUBA 3JB9J 3VV0A 1YCYA 2MYSA 5GAOn 2E12A 2ZGWA 1OX8A 1ZLMA 2RO0A 3CXCA 4JZ4A 4QKUA 2HL5C 1YHQQ 1NPPA 1IHVA 1YJNA 2L8DA 2DZCA 3EH2A 4F04B 1V29B 1VIFA 2EQUA 3PFSA 4KULA 1W2BP 5KCHA 2EQIA 1ZUKA 1ZQ1A 2DYBA 5GJWB 3T9NA 2EGEA 2LX7A 4PJMA 2FL7A 2M1HA 1UE9A 2X3XD 5FRNA 2YUQA 4J7FA 4FT4A 2OI3A 3ZEHA 2FEIA 2NUTB 4MDXA 4CC2A 3THKA 2KBTA 3JCMV 1AHJB 1KD1U 4P5NA 2CZ7B 4NS5A 1N9SA 3FJ5A 3CXCP 1Z9ZA 3QJYA 4RCBA 4JJNK 4OMLA 5CKFA 2HQXA 4M75B 1JEGA 1WJSA 3JCMd 2HKNA 1FX7A 1NE8A 2ED0A 2ZPEB 4DQ2A 4OGEA 2LP5A 1RLPC 4HKEA 3VS6A 1TH7A 3M0UA 1RAEB 3CMAQ 3QBYA 3J80E 3RDVA 3JB9G 1YITT 1UHFA 2X9HA 1VQPA 3JCMW 4A4FA 2D0NA 3I55A 1XJWB 3G4SA 1U1TA 3L42A 3L2UA 3HL8A 2BE9B 3PE0A 2RI3A 5KYWB 2HEQA 2H3JA 2RJEA 3NTIA 1BIBA 2KSSA 1WXTA 4R55A 4RG2A 1BU1A 2SEMA 1M9SA 2CDTA 2KXCA 5I21A 3CCUA 1CSKA 3M55A 2O88A 1R0CB 1MHNA 1KD1C 4QQDA 5FU7C 4OMFB 1C1AA 2XKOC 1QWFA 4L59A 4O5VA 4C92D 1Q82U 1X2QA 2MMPA 2NUPA 4DBQA 1JXMA 1VQLA 2RQUA 2EW3A 4BB7A 4C8QB 4J9CA 1VQ5T 4IUQA 1T3SA 2CP0A 3PTAA 3LW5E 5GANd 4JRKA 1PRLC 1KHCA 5C6SA 3JSCA 2EWNA 3QO3A 2JM9A 4A4KA 2JUFA 2PQWA 2J7IA 2L0AA 1UJYA 5GAN4 1NLPC 1ZX6A 1OQKA 2EIFA 2ZPIB 4GLKA 3TREA 4ZGJB 3OS0A 3OW2A 1KC8U 4ANJA 3NPFA 4EDUA 3CPFA 4ZTFA 3V8LA 1TG0A 1WHJA 2KGTA 4C0GA 2KYBA 1YJNT 3WVDB 1OOTA 2HBPA 3UDCA 4AFSC 1VQ9Q 2BZ8A 3RIRA 2DK3A 2RK2A 2O9SA 1Q82C 3FDRA 2LCLA 5I2SA 4JLGA 2GQIA 1VQ7A 2L3RA 2L3QA 1UUEA 1WXBA 2HNIA 3H6ZA 1GCPA 3M58A 2KT8A 2VYTA 1N9RA 2V8JA 1K4US 2B86A 1BI1A 2KVQG 4F7UB 1PSEA 4PJOE 3TCJA 3OW2P 2V8KA 1VYUA 3CCVQ 1V76A 1KQ1A 1X6BA 2YUPA 3LYIA 4FYWB 2EYZA 1ABOA 1ARKA 3E1SA 1GXIE 3E19A 4XAXB 1KC8C 1SSFA 5LJ3d 2JM8A 1NLOC
chains in the Genus database with same CATH topology
3EG1A 1NYFA 1YWPA 1IO6A 3NHNA 1UG1A 2LQWA 1WFWA 2O2OA 1AD5A 2ROTA 2MOXA 1RUWA 3REAB 3TSWA 2FPFA 5IHNA 1OPLA 1M27C 3EG3A 2XMFA 1KSWA 4F14A 3UF4A 2CT4A 2EGAA 1UECA 1OV3A 3H0FA 1YP5A 3VS1A 3O5ZA 2F2XA 2V1QA 2HBWA 2KE9A 2V1RA 2KEAA 4EIKA 4F16A 2O9VA 4HVWA 2CUBA 1X27A 2JXBA 3M0TA 4HVUA 2A37A 1GBRA 1OEBA 1GFCA 1A0NB 2J6OA 2AK5A 1GBQA 5FWBA 1WLPB 1ZBJA 2QDLA 4RTZA 1GCQC 1E6HA 1WDXA 1X69A 4AFUC 3UA6A 2PTKA 2JT4A 1GFDA 2CT3A 2NUZA 1B07A 3EG2A 1M3BA 1UJ0A 2KROA 2HDAA 1TUDA 3ULRB 3VS4A 3SHWA 1W70A 3M0RA 4R0KA 4AFQC 4AG1C 4DEYA 4LNPA 2EYXA 2YT6A 2D8JA 2RPNA 1N5ZA 3VRYA 2OAWA 4GBQA 3UA7A 4RTWA 4Z8AA 1PWTA 3REBB 3NGPA 4E6RA 2AZSA 2JS0A 2GTJA 2SRCA 2RMOA 2D8HA 1UDLA 2EPDA 2K6DA 2RQTA 1CKBA 1YNZA 1YN8A 5L23A 2EKHA 1E7OA 1Y57A 2CH4W 2M0YA 3LH5A 2LNHB 5IXBA 3I9QA 3CQTA 1SRLA 1FMKA 2DNUA 1AWOA 2W0ZA 1AWXA 2A08A 2MCNA 1BB9A 1WXUA 1AVZC 2DA9A 3A98A 2LJ1A 3EHQA 1I07A 3TSZA 2PNIA 4J9BA 1VYVA 3M0QA 2OJ2A 2IIMA 1AWJA 2JTEA 1U5SA 2A36A 1UTIA 4AFZC 1Y0MA 3I5RA 3EHRA 1NEGA 1M3CA 1NM7A 4WCIA 1ZUYA 3C0CA 4HCKA 1PKSA 2G6FX 2YUNA 4OMMA 2EGCA 1W6XA 1JXOA 1S1NA 1M8MA 1ZUUA 1WA7A 2HSPA 2DX1A 2DILA 2J6KA 1K1ZA 3PVQA 2NWMA 1XOVA 2K79A 1RLQC 2C0OA 4K11A 1QWEA 5FW9A 1H92A 2JS2A 1T3LA 4ORZA 3U23A 4D8KA 2GBQA 2VWFA 2K7AA 4ESRA 2RQRA 1UGVA 2CSIA 2KT1A 3VS3A 1M30A 5IXFA 2KR3A 1T0HA 1I0CA 2E5KA 3RBBB 2DF6A 1X6GA 1NG2A 3VS5A 2RNAA 3H41A 2ESWA 1G2BA 1GL5A 4RTVA 2CREA 4RTUA 2DL5A 2FRWA 2LMJA 2JMCA 2K9GA 2YSQA 3EGUA 4A63B 5ECAA 2LJ3A 1WYXA 1HSQA 1I1JA 2ROLA 2ENMA 2FO0A 1KJWA 2LQNA 4OMOA 3I35A 4IIOA 1HJDA 1NEBA 1ABQA 2I0NA 1G83A 2LZ6B 2K2MA 4RUGA 4Z89A 1T0JA 1MV3A 4LUEA 4Y92A 1SSHA 1SRMA 1JU5C 1YCSB 1LCKA 5GJVB 2BTTA 3H0IA 4LE9A 2AKKA 4J9DA 1SEMA 2DM1A 5IHIA 1AZGB 4JJDA 4OMNA 1AZEA 2J6FA 1SPKA 4QT7A 2CSQA 1KFZA 2EBPA 2DRMA 2A28A 4CC3A 2DE0X 1VA7A 1V1CA 1QKXA 1PKTA 2DVJA 2FPEA 1OPKA 3VRZA 1UFFA 2GNCA 2J06A 4J9EA 1Z9QA 2C0TA 2H8HA 1ZLMA 3VS0A 4JZ4A 2VKNA 1QCFA 1JO8A 4J9HA 4D8DA 2DJQA 1B3QA 2GTOA 2RN8A 2EVRA 4DEXA 2EQIA 1ZUKA 2W10A 1AWWA 1WI7A 4FSSA 2DYBA 5GJWB 2DBKA 2EGEA 2O31A 2LX7A 1SHGA 2RF0A 3H0HA 1PHTA 1GCQA 1UE9A 2HCKA 2X3XD 2YUQA 2OI3A 2FEIA 1MV0B 4JJCA 4CC2A 1WX6A 3THKA 2KBTA 1AEYA 3PVLA 3JV3A 2DMOA 1QKWA 3FJ5A 2DL7A 2BZYA 1Z9ZA 2FG0A 2FRYA 1M3AA 2KRSA 4OMLA 1JEGA 1JQQA 2J05A 4ZNXA 4RTXA 2K3BA 2ED0A 1X43A 2LP5A 3VS2A 4CC4B 1RLPC 3VS6A 1NYGA 1UHCA 2CUDA 3M0UA 4Z88A 2EYYA 1AOJA 2DBMA 4J9IA 4LN2A 1UHFA 3KFVA 1KIKA 1YWOA 3R6NA 2JMAA 2D0NA 4JPBW 5FWCA 2KXDA 2RQVA 1BK2A 2L3SA 2DRKA 2KRNA 2ED1A 3QWYA 1H3HA 4M4ZA 3PE0A 2LCSA 2HEQA 5IHKA 2D1XA 1U06A 1VYTA 1WXTA 4OMQA 5I11A 1TUCA 1BU1A 2PZ1A 2SEMA 4HXJA 3QWXX 3M0PA 1EFNA 2CDTA 2KXCA 3SEMA 1CSKA 1K0XA 1U3OA 2KYMA 1ZSGA 2O88A 5HCKA 4CC7A 4GLMA 2DL4A 1SHFA 2LJ0A 2F2VA 2AKLA 1QWFA 2KNBB 4RTTA 1K9AA 2GGRA 4RTYA 1X2QA 1WIEA 2DL8A 1JXMA 1FYNA 5I22A 2RQUA 2EW3A 4F17A 4J9GA 4J9CA 4JJBA 1CKAA 1T3SA 3ZL7C 1PRLC 3M0SA 3VS7A 1H8KA 2JM9A 2EYWA 2BZXA 2FPDA 2J7IA 2L0AA 1UJYA 3I5SA 1J3TA 5IH2A 2JW4A 4X1VA 3RNJA 2F2WA 1NLPC 1ZX6A 4J9FA 2X3WD 3GBQA 1QLYA 1MUZA 2CH4A 2P4RA 3NPFA 2L3PA 4KRTA 3NMZC 1K0SA 2DLPA 2VVKA 3IQLA 1TG0A 1RI9A 1E6GA 2KGTA 1PNJA 2KYBA 4OMPA 2YDLA 1OOTA 2MIOA 4AFSC 4AG2C 2BZ8A 4JZ3A 2O9SA 2ECZA 1PRMC 2ABLA 3EG0A 2GQIA 2KRMA 2L3QA 2L2PA 5EC7A 1UUEA 1WXBA 2M51A 2YUOA 1GCPA 1HD3A 2KT8A 4LUDA 1K4US 2B86A 1GRIA 4HVVA 3UATA 1VYUA 1X6BA 2C0IA 4IIMA 2RQWA 2YUPA 2EYZA 2DL3A 1ABOA 1ARKA 1W1FA 2AZVA 1X2KA 3TVTA 1BBZA 1K76A 2JM8A 1NLOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EG1 A;  1NYF A;  1YWP A;  1IO6 A;  3NHN A;  1UG1 A;  2LQW A;  1WFW A;  2O2O A;  1AD5 A;  2ROT A;  2MOX A;  1RUW A;  3REA B;  3TSW A;  2FPF A;  5IHN A;  1OPL A;  1M27 C;  3EG3 A;  2XMF A;  1KSW A;  4F14 A;  3UF4 A;  2CT4 A;  2EGA A;  1UEC A;  1OV3 A;  3H0F A;  1YP5 A;  3VS1 A;  3O5Z A;  2F2X A;  2V1Q A;  2HBW A;  2KE9 A;  2V1R A;  2KEA A;  4EIK A;  4F16 A;  2O9V A;  4HVW A;  2CUB A;  1X27 A;  2JXB A;  3M0T A;  4HVU A;  2A37 A;  1GBR A;  1OEB A;  1GFC A;  1A0N B;  2J6O A;  2AK5 A;  1GBQ A;  5FWB A;  1WLP B;  1ZBJ A;  2QDL A;  4RTZ A;  1GCQ C;  1E6H A;  1WDX A;  1X69 A;  4AFU C;  3UA6 A;  2PTK A;  2JT4 A;  1GFD A;  2CT3 A;  2NUZ A;  1B07 A;  3EG2 A;  1M3B A;  1UJ0 A;  2KRO A;  2HDA A;  1TUD A;  3ULR B;  3VS4 A;  3SHW A;  1W70 A;  3M0R A;  4R0K A;  4AFQ C;  4AG1 C;  4DEY A;  4LNP A;  2EYX A;  2YT6 A;  2D8J A;  2RPN A;  1N5Z A;  3VRY A;  2OAW A;  4GBQ A;  3UA7 A;  4RTW A;  4Z8A A;  1PWT A;  3REB B;  3NGP A;  4E6R A;  2AZS A;  2JS0 A;  2GTJ A;  2SRC A;  2RMO A;  2D8H A;  1UDL A;  2EPD A;  2K6D A;  2RQT A;  1CKB A;  1YNZ A;  1YN8 A;  5L23 A;  2EKH A;  1E7O A;  1Y57 A;  2CH4 W;  2M0Y A;  3LH5 A;  2LNH B;  5IXB A;  3I9Q A;  3CQT A;  1SRL A;  1FMK A;  2DNU A;  1AWO A;  2W0Z A;  1AWX A;  2A08 A;  2MCN A;  1BB9 A;  1WXU A;  1AVZ C;  2DA9 A;  3A98 A;  2LJ1 A;  3EHQ A;  1I07 A;  3TSZ A;  2PNI A;  4J9B A;  1VYV A;  3M0Q A;  2OJ2 A;  2IIM A;  1AWJ A;  2JTE A;  1U5S A;  2A36 A;  1UTI A;  4AFZ C;  1Y0M A;  3I5R A;  3EHR A;  1NEG A;  1M3C A;  1NM7 A;  4WCI A;  1ZUY A;  3C0C A;  4HCK A;  1PKS A;  2G6F X;  2YUN A;  4OMM A;  2EGC A;  1W6X A;  1JXO A;  1S1N A;  1M8M A;  1ZUU A;  1WA7 A;  2HSP A;  2DX1 A;  2DIL A;  2J6K A;  1K1Z A;  3PVQ A;  2NWM A;  1XOV A;  2K79 A;  1RLQ C;  2C0O A;  4K11 A;  1QWE A;  5FW9 A;  1H92 A;  2JS2 A;  1T3L A;  4ORZ A;  3U23 A;  4D8K A;  2GBQ A;  2VWF A;  2K7A A;  4ESR A;  2RQR A;  1UGV A;  2CSI A;  2KT1 A;  3VS3 A;  1M30 A;  5IXF A;  2KR3 A;  1T0H A;  1I0C A;  2E5K A;  3RBB B;  2DF6 A;  1X6G A;  1NG2 A;  3VS5 A;  2RNA A;  3H41 A;  2ESW A;  1G2B A;  1GL5 A;  4RTV A;  2CRE A;  4RTU A;  2DL5 A;  2FRW A;  2LMJ A;  2JMC A;  2K9G A;  2YSQ A;  3EGU A;  4A63 B;  5ECA A;  2LJ3 A;  1WYX A;  1HSQ A;  1I1J A;  2ROL A;  2ENM A;  2FO0 A;  1KJW A;  2LQN A;  4OMO A;  3I35 A;  4IIO A;  1HJD A;  1NEB A;  1ABQ A;  2I0N A;  1G83 A;  2LZ6 B;  2K2M A;  4RUG A;  4Z89 A;  1T0J A;  1MV3 A;  4LUE A;  4Y92 A;  1SSH A;  1SRM A;  1JU5 C;  1YCS B;  1LCK A;  5GJV B;  2BTT A;  3H0I A;  4LE9 A;  2AKK A;  4J9D A;  1SEM A;  2DM1 A;  5IHI A;  1AZG B;  4JJD A;  4OMN A;  1AZE A;  2J6F A;  1SPK A;  4QT7 A;  2CSQ A;  1KFZ A;  2EBP A;  2DRM A;  2A28 A;  4CC3 A;  2DE0 X;  1VA7 A;  1V1C A;  1QKX A;  1PKT A;  2DVJ A;  2FPE A;  1OPK A;  3VRZ A;  1UFF A;  2GNC A;  2J06 A;  4J9E A;  1Z9Q A;  2C0T A;  2H8H A;  1ZLM A;  3VS0 A;  4JZ4 A;  2VKN A;  1QCF A;  1JO8 A;  4J9H A;  4D8D A;  2DJQ A;  1B3Q A;  2GTO A;  2RN8 A;  2EVR A;  4DEX A;  2EQI A;  1ZUK A;  2W10 A;  1AWW A;  1WI7 A;  4FSS A;  2DYB A;  5GJW B;  2DBK A;  2EGE A;  2O31 A;  2LX7 A;  1SHG A;  2RF0 A;  3H0H A;  1PHT A;  1GCQ A;  1UE9 A;  2HCK A;  2X3X D;  2YUQ A;  2OI3 A;  2FEI A;  1MV0 B;  4JJC A;  4CC2 A;  1WX6 A;  3THK A;  2KBT A;  1AEY A;  3PVL A;  3JV3 A;  2DMO A;  1QKW A;  3FJ5 A;  2DL7 A;  2BZY A;  1Z9Z A;  2FG0 A;  2FRY A;  1M3A A;  2KRS A;  4OML A;  1JEG A;  1JQQ A;  2J05 A;  4ZNX A;  4RTX A;  2K3B A;  2ED0 A;  1X43 A;  2LP5 A;  3VS2 A;  4CC4 B;  1RLP C;  3VS6 A;  1NYG A;  1UHC A;  2CUD A;  3M0U A;  4Z88 A;  2EYY A;  1AOJ A;  2DBM A;  4J9I A;  4LN2 A;  1UHF A;  3KFV A;  1KIK A;  1YWO A;  3R6N A;  2JMA A;  2D0N A;  4JPB W;  5FWC A;  2KXD A;  2RQV A;  1BK2 A;  2L3S A;  2DRK A;  2KRN A;  2ED1 A;  3QWY A;  1H3H A;  4M4Z A;  3PE0 A;  2LCS A;  2HEQ A;  5IHK A;  2D1X A;  1U06 A;  1VYT A;  1WXT A;  4OMQ A;  5I11 A;  1TUC A;  1BU1 A;  2PZ1 A;  2SEM A;  4HXJ A;  3QWX X;  3M0P A;  1EFN A;  2CDT A;  2KXC A;  3SEM A;  1CSK A;  1K0X A;  1U3O A;  2KYM A;  1ZSG A;  2O88 A;  5HCK A;  4CC7 A;  4GLM A;  2DL4 A;  1SHF A;  2LJ0 A;  2F2V A;  2AKL A;  1QWF A;  2KNB B;  4RTT A;  1K9A A;  2GGR A;  4RTY A;  1X2Q A;  1WIE A;  2DL8 A;  1JXM A;  1FYN A;  5I22 A;  2RQU A;  2EW3 A;  4F17 A;  4J9G A;  4J9C A;  4JJB A;  1CKA A;  1T3S A;  3ZL7 C;  1PRL C;  3M0S A;  3VS7 A;  1H8K A;  2JM9 A;  2EYW A;  2BZX A;  2FPD A;  2J7I A;  2L0A A;  1UJY A;  3I5S A;  1J3T A;  5IH2 A;  2JW4 A;  4X1V A;  3RNJ A;  2F2W A;  1NLP C;  1ZX6 A;  4J9F A;  2X3W D;  3GBQ A;  1QLY A;  1MUZ A;  2CH4 A;  2P4R A;  3NPF A;  2L3P A;  4KRT A;  3NMZ C;  1K0S A;  2DLP A;  2VVK A;  3IQL A;  1TG0 A;  1RI9 A;  1E6G A;  2KGT A;  1PNJ A;  2KYB A;  4OMP A;  2YDL A;  1OOT A;  2MIO A;  4AFS C;  4AG2 C;  2BZ8 A;  4JZ3 A;  2O9S A;  2ECZ A;  1PRM C;  2ABL A;  3EG0 A;  2GQI A;  2KRM A;  2L3Q A;  2L2P A;  5EC7 A;  1UUE A;  1WXB A;  2M51 A;  2YUO A;  1GCP A;  1HD3 A;  2KT8 A;  4LUD A;  1K4U S;  2B86 A;  1GRI A;  4HVV A;  3UAT A;  1VYU A;  1X6B A;  2C0I A;  4IIM A;  2RQW A;  2YUP A;  2EYZ A;  2DL3 A;  1ABO A;  1ARK A;  1W1F A;  2AZV A;  1X2K A;  3TVT A;  1BBZ A;  1K76 A;  2JM8 A;  1NLO C; 
#chains in the Genus database with same CATH topology
 3OYG A;  1QW1 A;  3HPW A;  4FYY B;  4NL3 A;  1UG1 A;  2LQW A;  3BDL A;  1D1A A;  4M7A C;  4M7A G;  5I2M A;  4DOW A;  2MOX A;  3EG9 A;  1RUW A;  4PKC C;  1YJW Q;  1OPL A;  5LJ5 j;  1VQP T;  3I55 T;  1KSW A;  3A8G B;  3TQ7 P;  3G4S T;  4M7A E;  4N0A C;  1RAI B;  3CCR Q;  1YHQ A;  3CME Q;  2EGA A;  1YJ9 Q;  3H0F A;  1TXQ A;  2FHD A;  2RJC A;  2HQH A;  2V1R A;  2JVV A;  3C12 A;  4E7J A;  4HVW A;  3CCU T;  2ZPB B;  1X27 A;  2JXB A;  4ZN3 A;  2NUP B;  1WGS A;  4FL6 A;  3QYH B;  1K8A R;  1E6H A;  5GAM d;  1WDX A;  8AT1 B;  4C0D C;  3MET A;  2A0F B;  2PTK A;  2R5A A;  1QVF S;  3CCQ T;  1VQ4 Q;  2XDB A;  1NZ9 A;  1XTD A;  2D0Q B;  4PJO A;  3PMT A;  2KRO A;  1JJ2 S;  2HAX A;  3MEU A;  3VS4 A;  3CCS Q;  4DEY A;  2D8J A;  5GMK e;  3VRY A;  1TOV A;  2OAW A;  2LQK A;  2YRV A;  3M9Q A;  4Z8A A;  2DET A;  1VQO Q;  3V7R A;  4B9X A;  3CMA A;  1M2V A;  1UDL A;  3EH1 A;  2EKO A;  1Y57 A;  1LNX A;  1B34 A;  4ELY C;  4B9W A;  1ZSZ C;  4X34 A;  4YTL A;  3CCL Q;  1MMN A;  4A54 A;  4M7A A;  4ME7 A;  3MJX A;  1OU8 A;  3BDU A;  2BE7 D;  2JTF A;  2JNG A;  1I5L A;  1VYV A;  2DTO A;  3M0Q A;  2E65 A;  5CKH A;  1AWJ A;  1VQ7 T;  4Y28 E;  5FU7 B;  1IHW A;  5CCA A;  2P0K A;  3LGF A;  3SD4 A;  2DVE A;  1Y0M A;  3I5R A;  4JLI A;  3EHR A;  1Y96 B;  2B8A A;  3QSU A;  3HRU A;  3CC7 A;  3CPW S;  2RA2 A;  4HCK A;  2YUN A;  1W6X A;  2XDP A;  3CC2 T;  4OB0 B;  2GFA A;  4M7D D;  1S72 Q;  1S1N A;  4UC4 A;  3EG9 B;  1K1Z A;  3PVQ A;  1NPR A;  3V7S A;  3M5A A;  2DIG A;  4M77 E;  1KQS A;  1KQ2 A;  2GBQ A;  2K7A A;  1WHH A;  4LD6 A;  1M30 A;  1Q81 U;  5FRM A;  2P4T A;  4QQG A;  3FC3 A;  4NOY A;  5FU6 C;  1X6G A;  5KYN A;  1UGS B;  1VQ9 A;  5HK0 A;  2X35 A;  5IAY A;  2RNA A;  1G2B A;  2Y4Y A;  1VQ6 Q;  4RTV A;  2VXE A;  5GAN 5;  2MPX C;  3TU4 K;  3G7Z A;  4A63 B;  4PJO B;  2CP2 A;  2MWP A;  1WYX A;  1KQS P;  2VGM A;  2QG9 B;  3VUZ A;  3VYG A;  1HJD A;  1IRE B;  2RHI A;  1NEB A;  3CCV A;  4C5I A;  4Z89 A;  1MV3 A;  5J26 A;  2LRQ A;  1M2V B;  2JOY A;  1TWB A;  4FW2 A;  3L2Q A;  3P8B B;  1MGQ A;  2KQW A;  5KYX A;  1YCS B;  2E41 A;  2BTT A;  3QZ9 B;  3QG1 A;  1Q81 C;  3H0I A;  1VQM A;  1B34 B;  1UGR B;  2WSF E;  3A8O B;  3CMA T;  2COZ A;  3OB9 A;  4M7A B;  2YLB A;  1SPK A;  1KFZ A;  2E3I A;  2EBP A;  4M77 A;  2A28 A;  1V1C A;  4L5G A;  4A4H A;  3UWN A;  1QKX A;  1H64 1;  5A0D A;  1PKT A;  3CC4 Q;  4KH0 B;  3MEW A;  1YJ9 A;  2XG8 D;  2IPO B;  2J06 A;  3OYL A;  1Z9Q A;  2KI7 A;  2C0T A;  1RAD B;  1JO8 A;  2DJQ A;  3OQ5 A;  2XI9 A;  4PLL A;  1B3Q A;  2GTO A;  2RN8 A;  3OS2 A;  2EVR A;  3JCM Q;  3ME9 A;  3OSV A;  1OU9 A;  2H3E B;  1IGQ A;  2W10 A;  4E2F B;  1WI7 A;  2F69 A;  2PVO B;  5HKC A;  1VQ4 A;  1SHG A;  4C0D B;  3CC7 T;  4XU3 A;  1BCO A;  5GAN j;  2HCK A;  2VB6 A;  4C5G A;  4MZP A;  3A8L B;  5AT1 B;  1WX6 A;  3PVL A;  3CCJ A;  2C06 A;  3JV3 A;  5LJ5 e;  1VQO A;  3L2Z A;  3DB4 A;  1M3A A;  4E7I A;  2J05 A;  1Q95 G;  2HSE B;  1RAC B;  4E7K A;  1RAH B;  4CC4 B;  1VUB A;  4C92 C;  4C92 G;  1NYG A;  2CUD A;  4Z88 A;  2R58 A;  2EQJ A;  4OB3 B;  3JCM J;  1KIK A;  1ZSZ B;  3OYD A;  1VQ9 T;  4JPB W;  4C92 E;  2WAC A;  2KAF A;  2RQV A;  1M90 U;  4V2S A;  2L5Q A;  3QWY A;  2PVG B;  3OSS C;  1EIF A;  2LCS A;  4C0Z A;  2VAS A;  2D1X A;  1U06 A;  2DD5 A;  4MDW A;  1VYT A;  4OMQ A;  2PZ1 A;  4HXJ A;  3M0P A;  1JRI A;  2X4X A;  1K0X A;  1ZSG A;  1PC0 A;  5HCK A;  2KY9 A;  4GLM A;  3VJP A;  2DL4 A;  4WF2 A;  3X20 B;  3CBO A;  2AKL A;  3D7S B;  2KNB B;  4RTT A;  4LDY A;  3ASK A;  3WVE B;  5LJ3 j;  4RTY A;  5KE3 A;  2AT1 B;  1WIE A;  4BI8 B;  1WZO A;  3G6E Q;  3GP8 A;  2M0O A;  2OTJ Q;  3E2U A;  3MEV A;  2M9U A;  2BIV A;  4F17 A;  4J6W A;  4JRI A;  5KYU A;  2RM4 A;  4JJB A;  1CKA A;  4KT0 E;  1VQM T;  4RG8 A;  4FSX A;  3ZL7 C;  4M78 F;  2EJF A;  3VS7 A;  1H8K A;  2CP5 A;  3OYA A;  2EYW A;  5HK3 A;  5A0G A;  2BZX A;  1M90 C;  1D3B A;  3I5S A;  2MI6 A;  4O6J A;  5GMK j;  4A53 A;  2F2W A;  1BIA A;  4J9F A;  3GBQ A;  1QVF A;  2CH4 A;  5FU6 B;  3PIP A;  2P4R A;  1K0S A;  2DLP A;  1JJ2 A;  2VVK A;  4DBH A;  4RKU E;  1RI9 A;  1E6G A;  4C92 A;  1G8X A;  5GAM g;  3GF5 A;  2MIO A;  4KUI A;  2OX7 A;  2CP3 A;  3CBP A;  4AG2 C;  3FIF A;  4HCC A;  3OBY A;  3QHS A;  1QQJ A;  5FLX E;  2ABL A;  3I56 T;  3EG0 A;  2QA4 A;  3OYH A;  3MO8 A;  1P92 A;  2L2P A;  1VQ4 T;  3EFO B;  1VQ8 Q;  3PIO A;  3KBG A;  1HD3 A;  4J6X A;  4KUD K;  1C0M A;  1GRI A;  4HVV A;  3CCJ T;  3L2V A;  1VQO T;  2MF2 A;  4N4H A;  1JJ2 P;  1FWZ A;  4F7U A;  1HYO A;  1X2K A;  3QKJ A;  1K73 R;  2LNV A;  4Q5W A;  2CKK A;  1DJ7 B;  1NYF A;  1YWP A;  2O2O A;  4PJN A;  3EFS A;  3L2W A;  2EQK A;  3TSW A;  2FPF A;  5IHN A;  3CPW A;  3RER A;  3OMC A;  1YI2 A;  1Q86 U;  2LDM A;  1M4Z A;  4F14 A;  2CT4 A;  2ZZD A;  1UEC A;  3O5Z A;  2F2X A;  1PM3 A;  3LLR A;  2OTL A;  2HBW A;  2KE9 A;  1XNI A;  1Q7Y R;  4E7S A;  5CR2 A;  1RL2 A;  2CUB A;  4JS5 A;  2A37 A;  1GBR A;  4BDY A;  3JCM e;  2AK5 A;  3CCM T;  1GCQ C;  5KYU B;  2LQ8 A;  2KK4 A;  4IUP A;  3HHT B;  1X69 A;  4AFU C;  4BE0 A;  3UA6 A;  3LWH A;  1GFD A;  1M1K R;  2BKD N;  1D3B B;  3ULR B;  3OMG A;  3SHW A;  1W70 A;  1X01 A;  4AFQ C;  3C4S A;  2RPN A;  1WNL A;  3RKX A;  1Q86 C;  2GF7 A;  2AZS A;  2GTJ A;  2MAM A;  2XK0 A;  2SRC A;  2RMO A;  4RCC A;  4C92 B;  2EPD A;  1WPY A;  4ELZ C;  4M78 C;  2EKH A;  1UEB A;  4M78 G;  4DOV A;  2D6F A;  4M7D C;  1FXX A;  2M0Y A;  3LH5 A;  4M7D G;  4J7I A;  4HCZ A;  3I9Q A;  2CP7 A;  1M8V A;  1G3S A;  2W0Z A;  1AWX A;  3R6O A;  4M78 E;  2A08 A;  1K9M R;  4M7D E;  1BB9 A;  1WXU A;  3EHQ A;  3O8V A;  3MP8 A;  5GAN e;  2PNI A;  4BDZ A;  2RB6 A;  2M16 A;  1VQN Q;  4AMC A;  2OJ2 A;  3QUI A;  2IIM A;  2QA4 T;  2CZ0 B;  2JTE A;  2K57 A;  4E7L A;  3QYG B;  3RR6 A;  5M9O A;  3M4G A;  3FJP A;  2ATC B;  2EJG A;  3G6E A;  4WCI A;  2DFU A;  1YIJ A;  1ZUY A;  3C0C A;  2AIR B;  3ZFJ A;  5D6X A;  3ZBD A;  1QVG S;  2K5F A;  1Y96 A;  2NLU A;  3G71 Q;  2DIL A;  5D7U A;  3S6W A;  2NWM A;  4KH1 B;  1XOV A;  5CQX A;  1WQW A;  1RLQ C;  2V26 A;  2C0O A;  3X24 B;  3F70 A;  4WTO B;  5L8R E;  1ACM B;  2DIQ A;  2Y4X A;  3U23 A;  5C0M A;  2CZ6 B;  1N8R R;  2HL3 A;  4C5H A;  3FEO A;  1ZBX A;  1UGV A;  2M02 A;  2DKG A;  2KT1 A;  5IXF A;  1YI2 T;  1T0H A;  3BFM A;  1I0C A;  2E5K A;  2DF6 A;  4X9C A;  1QP2 A;  2DER A;  2OTL T;  2CZ1 B;  4BE2 A;  2ESW A;  2ZAE A;  5KYY A;  1RAF B;  4FW1 A;  4BD3 A;  2CRE A;  3CD6 Q;  2DL5 A;  2FRW A;  5LJ3 e;  4M7D A;  3GLX A;  2K5L A;  3HKS A;  2YSQ A;  3EGU A;  4JUV A;  1VOM A;  1VQ8 A;  3EFR A;  5CKE A;  1R8O B;  3H9N A;  1KJW A;  3I35 A;  4IIO A;  1ABQ A;  3SDZ A;  1VQL T;  1G83 A;  3PNW C;  5CQY A;  4Y92 A;  1SRM A;  2FZK B;  2X51 A;  2DTI A;  1JU5 C;  2HQE A;  1TUG B;  2LC4 A;  4KBM B;  3V8J A;  2RI5 A;  4M75 F;  2P0P A;  4J9D A;  1SEM A;  4HT8 A;  3OYC A;  1AZG B;  5GAN 8;  2J6F A;  2MK5 A;  3HTR A;  2CSQ A;  3HRT A;  4CI0 C;  2DE0 X;  1VA7 A;  4II1 A;  3VYH B;  2QTV A;  1JBM A;  2DVJ A;  2VXF A;  5HY6 A;  4IUV A;  3SFM A;  1PD0 A;  4HA8 A;  1UFF A;  2GNC A;  5GAO r;  2BUD A;  3EAE A;  1M5Q 1;  1KG1 A;  3WXM B;  4N0A A;  2E4H A;  3DLL A;  4J9H A;  4D8D A;  5GMK m;  3EGD A;  2LT1 A;  1RAG B;  4LDX A;  2KDS A;  2LT4 A;  5GAO q;  4OP0 A;  2HD0 A;  4XU2 A;  1AWW A;  2QAZ A;  4FSS A;  2DXC A;  2DBK A;  1IRX A;  3G6E T;  4M78 D;  1YIJ T;  2RF0 A;  3H0H A;  1EX4 A;  2CGH A;  1NBE B;  4JJC A;  5AYF A;  4C8Q F;  1AEY A;  1PCX A;  2BZY A;  3S3O A;  2FG0 A;  2FRY A;  1JQQ A;  1SF9 A;  4XTX A;  4ZNX A;  2K3B A;  1I5O B;  1M1G A;  1K8A U;  2EFI A;  4M78 B;  3MEA A;  1YHQ T;  5KYY B;  1AT1 B;  2EYY A;  1AOJ A;  2YHT A;  4M7D B;  4LN2 A;  3KFV A;  2FB7 A;  1WHK A;  2JMA A;  3JRZ A;  5FWC A;  1EZZ B;  4XTY A;  1BK2 A;  2L3S A;  2YXY A;  3X26 B;  2KRN A;  2ZPG B;  1NJI R;  1PSF A;  4NL2 A;  1MMD A;  1ZSZ A;  4QQ6 A;  3L1A A;  3FLG A;  5IHK A;  1X75 C;  1TUC A;  1VIE A;  3QWX X;  3MCA B;  1VQ8 T;  1EFN A;  3C94 A;  3V8K A;  5GAO l;  3SEM A;  2KYM A;  4FT2 A;  4LXC A;  4CC7 A;  3ER0 A;  2R5M A;  1C6V X;  1YJN Q;  2FZC B;  2LJ0 A;  3HP9 A;  1D0X A;  1M1F A;  3S3M A;  2K3Y A;  3GOX A;  2OAU A;  1N27 A;  3M57 A;  3OY9 A;  1QCO A;  4FU6 A;  5GAN 2;  1WHM A;  2GGR A;  3M53 A;  4N4G A;  4JRQ A;  7AT1 B;  4R56 A;  3A8H B;  1K8A C;  5I22 A;  2E5Q A;  1BI3 A;  2ZPH B;  3A8M B;  3X25 B;  3OYN A;  3AHU A;  1YJW A;  2RD1 A;  3DLM A;  3CCR A;  3CME A;  1J3T A;  4X1V A;  3EGD B;  3RNJ A;  1D1C A;  1OUL A;  2X3W D;  1QLY A;  1MUZ A;  3QDR B;  1O9S A;  3PMI A;  2L3P A;  5LJ3 f;  1OYX A;  3IQL A;  2QYZ A;  2JJ9 A;  3INZ A;  4E7H A;  1PNJ A;  5LL6 S;  3RMS A;  3M59 A;  1IB8 A;  5IN1 A;  3H8Z A;  3PGG A;  3BE3 A;  3I55 Q;  2X4J A;  4JZ3 A;  3G4S Q;  2ECZ A;  1PRM C;  4QVC A;  2RI2 A;  5EC7 A;  2YUO A;  3CCS A;  4LUD A;  5FRO A;  1G3Y A;  2F5K A;  2K4Y A;  5J3B A;  3EFO A;  2O4X B;  2RQW A;  2DL3 A;  1Y7X A;  1QMC A;  2AZV A;  4OB2 B;  3AT1 B;  2COY A;  3TVT A;  1K76 A;  4PFO A;  4XQ3 A;  3J7A F;  2F5T X;  3EG1 A;  3CCQ Q;  2YLC A;  4C8Q C;  5GAN 6;  1BYM A;  2XID A;  4C8Q G;  3OYI A;  1WHL A;  3CCL A;  2RHY A;  1WFW A;  3JB9 F;  1R77 A;  2KMT A;  1AD5 A;  2X4W A;  4XTV A;  4J83 A;  2X4Y A;  3REA B;  3E9F A;  1M27 C;  2XMF A;  4KGX B;  2R57 A;  1ZHI A;  1QVG A;  4ZGD B;  5DM7 R;  4XU0 A;  4PLI A;  4CRI A;  1OV3 A;  1YP5 A;  2G3R A;  3VS1 A;  1KD1 R;  3RKY A;  2V1Q A;  3OYM A;  2YRC A;  1M2O A;  5CO7 A;  4F16 A;  8ATC B;  3JAM E;  1BCM A;  2Z0W A;  2DXU A;  3M0T A;  2P0Q A;  4LDV A;  3TEE A;  2QEX Q;  5LJ3 h;  2HZY A;  1GBQ A;  2CYZ B;  4A4G A;  3CCV T;  1ZBJ A;  4OB1 B;  2QDL A;  4RTZ A;  1UGP B;  1F1B B;  1S72 A;  1OZ2 A;  1W4S A;  1LPL A;  2EYQ A;  5KE2 A;  5J39 A;  1VQK Q;  1BI2 A;  2PUO B;  1LJO A;  2K5I A;  1VQ7 Q;  2EJ9 A;  1B07 A;  3P8H A;  4DBR A;  4BAC A;  1UJ0 A;  2IVW A;  4BUG A;  3OYE A;  1H3Z A;  3M0R A;  4R0K A;  4LNP A;  2EYX A;  2YT6 A;  1N5Z A;  5GMK h;  2DPP B;  1YJW T;  3UA7 A;  4IUR A;  3MP1 A;  2QAS A;  1PWT A;  3CCR T;  2QQR A;  3MKD A;  2JS0 A;  3CME T;  1YJ9 T;  3CC2 Q;  2GFU A;  3JB9 I;  2K6D A;  2RQT A;  1CKB A;  4XTZ A;  4KGV B;  2HKQ B;  4JRP A;  1E7O A;  1UGQ B;  2CH4 W;  4EMK C;  5GMK l;  3OYB A;  1VQ6 A;  3NFC A;  3QII A;  2LNH B;  1TS9 A;  1Q82 R;  1B7T A;  3HSB A;  1FMK A;  2E6Z A;  3OS1 A;  5GAM j;  3A98 A;  1I07 A;  3TSZ A;  1O75 A;  3JCM c;  4FCY A;  3SWN C;  1WJQ A;  4PJO F;  2COW A;  2E6N A;  2GCX A;  2A36 A;  1UTI A;  3CCS T;  1TU0 B;  5GMK i;  2QQB A;  1WJR A;  5KCO A;  2RH2 A;  4GY5 A;  4M75 D;  3CBM A;  3OYK A;  2XU8 A;  1QVF P;  1KQS S;  1KC8 R;  1NM7 A;  3HFN A;  4J6Y A;  4BI4 A;  1PKS A;  2G6F X;  4OMM A;  3LWI A;  3UT1 A;  1KHI A;  5CKD A;  4PFP A;  1ZUU A;  2HSP A;  4DBF A;  2J6K A;  3OYJ A;  4IKF A;  2QQS A;  2ZPF B;  3CC4 A;  1D09 B;  4K11 A;  4M7A F;  1QWE A;  2MWO A;  3CCL T;  3EGX B;  1T3L A;  3E9G A;  4HCB A;  4D8K A;  1RAB B;  2VWF A;  2RQR A;  2VV5 A;  2DXT A;  2PUK B;  2EAY A;  2CSI A;  3NTK A;  9ATC B;  2DEU A;  1BKB A;  1IGU A;  1X6O A;  3QJ6 A;  1PD1 A;  2E10 A;  2QGG A;  2FZG B;  3CCE Q;  2XDD A;  3BW1 A;  2GQV A;  4D6W A;  4MZT A;  4IUU A;  3LH0 A;  4EMK A;  4RTU A;  2LMJ A;  5KH6 A;  3LX7 A;  2JMC A;  2K9G A;  3KUF A;  1OI1 A;  1WHG A;  4C8Q D;  1IZ6 A;  1S72 T;  1QVP A;  2LJ3 A;  5GAO m;  5LJ5 f;  2ROL A;  3SWN A;  4OMO A;  3CPW P;  4XK8 E;  2NYS A;  2LZ6 B;  2K2M A;  4RUG A;  4MMK A;  2L89 A;  3JCM P;  1LCK A;  5GJV B;  2F1L A;  3CCQ A;  2VGN A;  1YFN A;  3SB2 A;  3CC7 Q;  4LD9 K;  1D0Z A;  4Z02 A;  2AKK A;  4OMN A;  4OGC A;  2XIC A;  2QI2 A;  4QT7 A;  3JB9 H;  4IUT A;  2E70 A;  1G3T A;  4N4I A;  2DZ9 A;  5CIU A;  1VQ6 T;  1OPK A;  3VRZ A;  5GAN 3;  4J9E A;  4EMG A;  3HFO A;  2H8H A;  4QW2 A;  3VS0 A;  4QVD A;  2FVU A;  2VKN A;  1QCF A;  1K73 U;  1UB4 A;  3HRS A;  2QEX A;  3KXT A;  3GNF B;  2QXF A;  4DEX A;  1RI0 A;  4ATO A;  1TTH B;  4E47 A;  1HXD A;  2OTJ A;  2O31 A;  3OYF A;  1VQK A;  4LDW A;  1I81 A;  1LOJ A;  4JS4 A;  1PHT A;  4PJO C;  1R0B G;  1GCQ A;  4PJO G;  1XQH A;  3NTH A;  1MNE A;  4M77 F;  1MV0 B;  3QDF A;  2DMO A;  5LJ5 h;  3X28 B;  3G1J A;  1QKW A;  1Q7Y U;  2DTH A;  4AT1 B;  3CC4 T;  2DL7 A;  4PJJ A;  4OVA A;  3CC2 A;  2KRS A;  4FIB A;  4BE1 A;  2XD0 A;  2D9T A;  4RTX A;  2XHC A;  1X43 A;  4FM4 B;  3VS2 A;  4EMK B;  1UHC A;  1K73 C;  3A5Z B;  4XTU A;  2JZ2 A;  1VQM Q;  2DBM A;  4J9I A;  5LJ5 g;  1YWO A;  3R6N A;  4PK4 A;  2DJZ A;  2KXD A;  4M78 A;  3JCM X;  1M1K U;  3RKW A;  4PL6 A;  1LVK A;  2DRK A;  3M56 A;  5D6W A;  2ED1 A;  1H3H A;  2VUB A;  4M4Z A;  2RHU A;  3SWN B;  4Y91 A;  3QPH A;  5I11 A;  1W2B S;  1JB0 E;  3S3N A;  1G5V A;  2RJD A;  1SG5 A;  1U3O A;  4FYX B;  2LTO A;  1D0Y A;  1SHF A;  2F2V A;  2DYI A;  1Q7Y C;  1FMV A;  5DLO A;  1K9A A;  1Q81 R;  2AHJ B;  3GPL A;  3Q1J A;  1ZA2 B;  2DL8 A;  3I56 Q;  4L6V 5;  3JB9 D;  2QQ9 A;  3OS5 A;  2VC8 A;  1K9M U;  1FYN A;  3QXE B;  4J9G A;  3CXC S;  2CP6 A;  2YWW A;  4OF1 A;  5GAO p;  3M0S A;  4B6M A;  1M1K C;  1U8R A;  2QDY B;  5GAM e;  2FPD A;  3CCJ Q;  4TVR A;  5IH2 A;  2JW4 A;  3CCE A;  3M4Y A;  3OYY A;  4KRT A;  3NMZ C;  3JCM f;  3MPU B;  3A1P A;  4OMP A;  1YIT Q;  2YDL A;  4X9D A;  2E1H A;  2QEX T;  3RES A;  3MHX A;  1K9M C;  1N8R U;  4ZGE B;  2OTJ T;  1VQK T;  2KRM A;  2M51 A;  1RAA B;  2DO3 A;  3UAT A;  2DAQ A;  4ZTJ A;  2LVM A;  3M54 A;  3OBW A;  2C0I A;  4IIM A;  3CCM Q;  2QK0 A;  5DLQ E;  1W1F A;  2WSE E;  4BY6 C;  1BBZ A;  2PU9 B;  4XTW A;  2O4X A;  4M77 C;  3PT9 A;  2RHX A;  4M77 G;  4C92 F;  1VQ5 Q;  1IO6 A;  2K2V A;  3NHN A;  4C0F A;  5A0L A;  4EPC A;  3RUX A;  1FMW A;  2ROT A;  3RMQ A;  5D6Y A;  1YBY A;  5GAN f;  4KGZ B;  4PJO D;  3EG3 A;  2DEQ A;  2Y90 A;  1HK9 A;  1VQN A;  3UF4 A;  1Y07 A;  1N8R C;  3DB3 A;  1U1S A;  2A7Y A;  4XU1 A;  2QQA A;  2E64 A;  3FRN A;  1BI0 A;  2KEA A;  2V8I A;  4EIK A;  2O9V A;  2EQM A;  3J81 E;  4HVU A;  1OEB A;  1GFC A;  1A0N B;  2J6O A;  3JCM h;  5A2Q E;  5FWB A;  1WLP B;  3C95 A;  4F7U F;  1WQ7 A;  4PFZ A;  5IT9 E;  6AT1 B;  1G3W A;  3G71 A;  4M7A D;  4EMH A;  2JN0 A;  3OW2 S;  1N6A A;  2JT4 A;  3N5B B;  2QA4 Q;  2CT3 A;  2NUZ A;  5GAN 7;  3EG2 A;  1M90 R;  3MP6 A;  1M3B A;  1PG5 B;  5DY9 A;  3JCM g;  2HDA A;  1TUD A;  4AG1 C;  3DKM A;  2QGF B;  3OA6 A;  3VU3 C;  4GBQ A;  4RTW A;  2O01 E;  5CKB A;  3REB B;  3NGP A;  4E6R A;  2I2L A;  4E7Z A;  4M75 C;  4M75 G;  2D8H A;  3GIB A;  4PJL A;  2JTM A;  3CEY A;  1YNZ A;  3CCE T;  1YN8 A;  1IXD A;  5L23 A;  1SKU B;  4M75 E;  4LDU A;  3CD6 A;  1OX9 A;  2QTX A;  5IXB A;  3CQT A;  1SRL A;  2DNU A;  1Y71 A;  1AWO A;  1VQP Q;  2MCN A;  1ZA1 B;  1I8F A;  2ZCF B;  2CS7 A;  1AVZ C;  2DA9 A;  5LJ5 d;  2LJ1 A;  2E3H A;  5GAN h;  4C5E A;  1YI2 Q;  3URG A;  4J9B A;  3VUB A;  1MMG A;  3BY7 A;  1U5S A;  4A4E A;  3UPU A;  2OTL Q;  3CCU Q;  4AFZ C;  1NEG A;  1M3C A;  3I56 A;  4J8O A;  3VKI A;  5GAN g;  5EG2 A;  3QZ5 B;  2DD4 A;  4PNO A;  2LX9 A;  3L2R A;  2EGC A;  3P8D A;  1NJI U;  1JXO A;  1M8M A;  1WA7 A;  2FYK A;  5GAM f;  2DX1 A;  2A3L A;  4DA4 A;  2IG0 A;  2K79 A;  1VQL Q;  3GNG A;  5FW9 A;  2RJF A;  1H92 A;  2JS2 A;  4FYV B;  4ORZ A;  2NUT A;  4C8Q E;  4ZN1 A;  1QP3 A;  1MND A;  4ESR A;  1I4K 1;  4MZM A;  2DXB A;  4QVZ A;  2P84 A;  3EGX A;  3VS3 A;  1VQN T;  2KR3 A;  3RBB B;  1YIT A;  4M75 A;  1NG2 A;  3VS5 A;  4BI3 A;  4RMO A;  2PVD B;  3H41 A;  2RK1 A;  1GL5 A;  3LGL A;  2K3X A;  4J5Y A;  1MMA A;  4JDS A;  2RHZ A;  4M77 D;  3V7C A;  1OZ3 A;  5CVI A;  5ECA A;  1NJI C;  1D1B A;  2YRD A;  3G71 T;  1HSQ A;  1I1J A;  2WSC E;  2ENM A;  2FO0 A;  5KYW A;  2LQN A;  3FB9 A;  2HMA A;  5KYX B;  2I0N A;  1QCN A;  5CAI A;  5LJ3 g;  1QVG P;  3CCM A;  1T0J A;  4LUE A;  1SSH A;  1Q86 R;  4F7U G;  2LCC A;  5CK9 A;  4BY6 B;  4MML A;  1W2B A;  4F7U E;  1YIJ Q;  1VQ5 A;  4M77 B;  4LE9 A;  3JCM b;  4HT9 A;  2DM1 A;  5IHI A;  4JJD A;  1KK7 A;  1AZE A;  2DRM A;  4CC3 A;  4M7D F;  4C8Q A;  5GAM h;  3CD6 T;  2FPE A;  1TSF A;  4VUB A;  3JB9 J;  3VV0 A;  1YCY A;  2MYS A;  5GAO n;  2E12 A;  2ZGW A;  1OX8 A;  1ZLM A;  2RO0 A;  3CXC A;  4JZ4 A;  4QKU A;  2HL5 C;  1YHQ Q;  1NPP A;  1IHV A;  1YJN A;  2L8D A;  2DZC A;  3EH2 A;  4F04 B;  1V29 B;  1VIF A;  2EQU A;  3PFS A;  4KUL A;  1W2B P;  5KCH A;  2EQI A;  1ZUK A;  1ZQ1 A;  2DYB A;  5GJW B;  3T9N A;  2EGE A;  2LX7 A;  4PJM A;  2FL7 A;  2M1H A;  1UE9 A;  2X3X D;  5FRN A;  2YUQ A;  4J7F A;  4FT4 A;  2OI3 A;  3ZEH A;  2FEI A;  2NUT B;  4MDX A;  4CC2 A;  3THK A;  2KBT A;  3JCM V;  1AHJ B;  1KD1 U;  4P5N A;  2CZ7 B;  4NS5 A;  1N9S A;  3FJ5 A;  3CXC P;  1Z9Z A;  3QJY A;  4RCB A;  4JJN K;  4OML A;  5CKF A;  2HQX A;  4M75 B;  1JEG A;  1WJS A;  3JCM d;  2HKN A;  1FX7 A;  1NE8 A;  2ED0 A;  2ZPE B;  4DQ2 A;  4OGE A;  2LP5 A;  1RLP C;  4HKE A;  3VS6 A;  1TH7 A;  3M0U A;  1RAE B;  3CMA Q;  3QBY A;  3J80 E;  3RDV A;  3JB9 G;  1YIT T;  1UHF A;  2X9H A;  1VQP A;  3JCM W;  4A4F A;  2D0N A;  3I55 A;  1XJW B;  3G4S A;  1U1T A;  3L42 A;  3L2U A;  3HL8 A;  2BE9 B;  3PE0 A;  2RI3 A;  5KYW B;  2HEQ A;  2H3J A;  2RJE A;  3NTI A;  1BIB A;  2KSS A;  1WXT A;  4R55 A;  4RG2 A;  1BU1 A;  2SEM A;  1M9S A;  2CDT A;  2KXC A;  5I21 A;  3CCU A;  1CSK A;  3M55 A;  2O88 A;  1R0C B;  1MHN A;  1KD1 C;  4QQD A;  5FU7 C;  4OMF B;  1C1A A;  2XKO C;  1QWF A;  4L59 A;  4O5V A;  4C92 D;  1Q82 U;  1X2Q A;  2MMP A;  2NUP A;  4DBQ A;  1JXM A;  1VQL A;  2RQU A;  2EW3 A;  4BB7 A;  4C8Q B;  4J9C A;  1VQ5 T;  4IUQ A;  1T3S A;  2CP0 A;  3PTA A;  3LW5 E;  5GAN d;  4JRK A;  1PRL C;  1KHC A;  5C6S A;  3JSC A;  2EWN A;  3QO3 A;  2JM9 A;  4A4K A;  2JUF A;  2PQW A;  2J7I A;  2L0A A;  1UJY A;  5GAN 4;  1NLP C;  1ZX6 A;  1OQK A;  2EIF A;  2ZPI B;  4GLK A;  3TRE A;  4ZGJ B;  3OS0 A;  3OW2 A;  1KC8 U;  4ANJ A;  3NPF A;  4EDU A;  3CPF A;  4ZTF A;  3V8L A;  1TG0 A;  1WHJ A;  2KGT A;  4C0G A;  2KYB A;  1YJN T;  3WVD B;  1OOT A;  2HBP A;  3UDC A;  4AFS C;  1VQ9 Q;  2BZ8 A;  3RIR A;  2DK3 A;  2RK2 A;  2O9S A;  1Q82 C;  3FDR A;  2LCL A;  5I2S A;  4JLG A;  2GQI A;  1VQ7 A;  2L3R A;  2L3Q A;  1UUE A;  1WXB A;  2HNI A;  3H6Z A;  1GCP A;  3M58 A;  2KT8 A;  2VYT A;  1N9R A;  2V8J A;  1K4U S;  2B86 A;  1BI1 A;  2KVQ G;  4F7U B;  1PSE A;  4PJO E;  3TCJ A;  3OW2 P;  2V8K A;  1VYU A;  3CCV Q;  1V76 A;  1KQ1 A;  1X6B A;  2YUP A;  3LYI A;  4FYW B;  2EYZ A;  1ABO A;  1ARK A;  3E1S A;  1GXI E;  3E19 A;  4XAX B;  1KC8 C;  1SSF A;  5LJ3 d;  2JM8 A;  1NLO C; 
#chains in the Genus database with same CATH homology
 3EG1 A;  1NYF A;  1YWP A;  1IO6 A;  3NHN A;  1UG1 A;  2LQW A;  1WFW A;  2O2O A;  1AD5 A;  2ROT A;  2MOX A;  1RUW A;  3REA B;  3TSW A;  2FPF A;  5IHN A;  1OPL A;  1M27 C;  3EG3 A;  2XMF A;  1KSW A;  4F14 A;  3UF4 A;  2CT4 A;  2EGA A;  1UEC A;  1OV3 A;  3H0F A;  1YP5 A;  3VS1 A;  3O5Z A;  2F2X A;  2V1Q A;  2HBW A;  2KE9 A;  2V1R A;  2KEA A;  4EIK A;  4F16 A;  2O9V A;  4HVW A;  2CUB A;  1X27 A;  2JXB A;  3M0T A;  4HVU A;  2A37 A;  1GBR A;  1OEB A;  1GFC A;  1A0N B;  2J6O A;  2AK5 A;  1GBQ A;  5FWB A;  1WLP B;  1ZBJ A;  2QDL A;  4RTZ A;  1GCQ C;  1E6H A;  1WDX A;  1X69 A;  4AFU C;  3UA6 A;  2PTK A;  2JT4 A;  1GFD A;  2CT3 A;  2NUZ A;  1B07 A;  3EG2 A;  1M3B A;  1UJ0 A;  2KRO A;  2HDA A;  1TUD A;  3ULR B;  3VS4 A;  3SHW A;  1W70 A;  3M0R A;  4R0K A;  4AFQ C;  4AG1 C;  4DEY A;  4LNP A;  2EYX A;  2YT6 A;  2D8J A;  2RPN A;  1N5Z A;  3VRY A;  2OAW A;  4GBQ A;  3UA7 A;  4RTW A;  4Z8A A;  1PWT A;  3REB B;  3NGP A;  4E6R A;  2AZS A;  2JS0 A;  2GTJ A;  2SRC A;  2RMO A;  2D8H A;  1UDL A;  2EPD A;  2K6D A;  2RQT A;  1CKB A;  1YNZ A;  1YN8 A;  5L23 A;  2EKH A;  1E7O A;  1Y57 A;  2CH4 W;  2M0Y A;  3LH5 A;  2LNH B;  5IXB A;  3I9Q A;  3CQT A;  1SRL A;  1FMK A;  2DNU A;  1AWO A;  2W0Z A;  1AWX A;  2A08 A;  2MCN A;  1BB9 A;  1WXU A;  1AVZ C;  2DA9 A;  3A98 A;  2LJ1 A;  3EHQ A;  1I07 A;  3TSZ A;  2PNI A;  4J9B A;  1VYV A;  3M0Q A;  2OJ2 A;  2IIM A;  1AWJ A;  2JTE A;  1U5S A;  2A36 A;  1UTI A;  4AFZ C;  1Y0M A;  3I5R A;  3EHR A;  1NEG A;  1M3C A;  1NM7 A;  4WCI A;  1ZUY A;  3C0C A;  4HCK A;  1PKS A;  2G6F X;  2YUN A;  4OMM A;  2EGC A;  1W6X A;  1JXO A;  1S1N A;  1M8M A;  1ZUU A;  1WA7 A;  2HSP A;  2DX1 A;  2DIL A;  2J6K A;  1K1Z A;  3PVQ A;  2NWM A;  1XOV A;  2K79 A;  1RLQ C;  2C0O A;  4K11 A;  1QWE A;  5FW9 A;  1H92 A;  2JS2 A;  1T3L A;  4ORZ A;  3U23 A;  4D8K A;  2GBQ A;  2VWF A;  2K7A A;  4ESR A;  2RQR A;  1UGV A;  2CSI A;  2KT1 A;  3VS3 A;  1M30 A;  5IXF A;  2KR3 A;  1T0H A;  1I0C A;  2E5K A;  3RBB B;  2DF6 A;  1X6G A;  1NG2 A;  3VS5 A;  2RNA A;  3H41 A;  2ESW A;  1G2B A;  1GL5 A;  4RTV A;  2CRE A;  4RTU A;  2DL5 A;  2FRW A;  2LMJ A;  2JMC A;  2K9G A;  2YSQ A;  3EGU A;  4A63 B;  5ECA A;  2LJ3 A;  1WYX A;  1HSQ A;  1I1J A;  2ROL A;  2ENM A;  2FO0 A;  1KJW A;  2LQN A;  4OMO A;  3I35 A;  4IIO A;  1HJD A;  1NEB A;  1ABQ A;  2I0N A;  1G83 A;  2LZ6 B;  2K2M A;  4RUG A;  4Z89 A;  1T0J A;  1MV3 A;  4LUE A;  4Y92 A;  1SSH A;  1SRM A;  1JU5 C;  1YCS B;  1LCK A;  5GJV B;  2BTT A;  3H0I A;  4LE9 A;  2AKK A;  4J9D A;  1SEM A;  2DM1 A;  5IHI A;  1AZG B;  4JJD A;  4OMN A;  1AZE A;  2J6F A;  1SPK A;  4QT7 A;  2CSQ A;  1KFZ A;  2EBP A;  2DRM A;  2A28 A;  4CC3 A;  2DE0 X;  1VA7 A;  1V1C A;  1QKX A;  1PKT A;  2DVJ A;  2FPE A;  1OPK A;  3VRZ A;  1UFF A;  2GNC A;  2J06 A;  4J9E A;  1Z9Q A;  2C0T A;  2H8H A;  1ZLM A;  3VS0 A;  4JZ4 A;  2VKN A;  1QCF A;  1JO8 A;  4J9H A;  4D8D A;  2DJQ A;  1B3Q A;  2GTO A;  2RN8 A;  2EVR A;  4DEX A;  2EQI A;  1ZUK A;  2W10 A;  1AWW A;  1WI7 A;  4FSS A;  2DYB A;  5GJW B;  2DBK A;  2EGE A;  2O31 A;  2LX7 A;  1SHG A;  2RF0 A;  3H0H A;  1PHT A;  1GCQ A;  1UE9 A;  2HCK A;  2X3X D;  2YUQ A;  2OI3 A;  2FEI A;  1MV0 B;  4JJC A;  4CC2 A;  1WX6 A;  3THK A;  2KBT A;  1AEY A;  3PVL A;  3JV3 A;  2DMO A;  1QKW A;  3FJ5 A;  2DL7 A;  2BZY A;  1Z9Z A;  2FG0 A;  2FRY A;  1M3A A;  2KRS A;  4OML A;  1JEG A;  1JQQ A;  2J05 A;  4ZNX A;  4RTX A;  2K3B A;  2ED0 A;  1X43 A;  2LP5 A;  3VS2 A;  4CC4 B;  1RLP C;  3VS6 A;  1NYG A;  1UHC A;  2CUD A;  3M0U A;  4Z88 A;  2EYY A;  1AOJ A;  2DBM A;  4J9I A;  4LN2 A;  1UHF A;  3KFV A;  1KIK A;  1YWO A;  3R6N A;  2JMA A;  2D0N A;  4JPB W;  5FWC A;  2KXD A;  2RQV A;  1BK2 A;  2L3S A;  2DRK A;  2KRN A;  2ED1 A;  3QWY A;  1H3H A;  4M4Z A;  3PE0 A;  2LCS A;  2HEQ A;  5IHK A;  2D1X A;  1U06 A;  1VYT A;  1WXT A;  4OMQ A;  5I11 A;  1TUC A;  1BU1 A;  2PZ1 A;  2SEM A;  4HXJ A;  3QWX X;  3M0P A;  1EFN A;  2CDT A;  2KXC A;  3SEM A;  1CSK A;  1K0X A;  1U3O A;  2KYM A;  1ZSG A;  2O88 A;  5HCK A;  4CC7 A;  4GLM A;  2DL4 A;  1SHF A;  2LJ0 A;  2F2V A;  2AKL A;  1QWF A;  2KNB B;  4RTT A;  1K9A A;  2GGR A;  4RTY A;  1X2Q A;  1WIE A;  2DL8 A;  1JXM A;  1FYN A;  5I22 A;  2RQU A;  2EW3 A;  4F17 A;  4J9G A;  4J9C A;  4JJB A;  1CKA A;  1T3S A;  3ZL7 C;  1PRL C;  3M0S A;  3VS7 A;  1H8K A;  2JM9 A;  2EYW A;  2BZX A;  2FPD A;  2J7I A;  2L0A A;  1UJY A;  3I5S A;  1J3T A;  5IH2 A;  2JW4 A;  4X1V A;  3RNJ A;  2F2W A;  1NLP C;  1ZX6 A;  4J9F A;  2X3W D;  3GBQ A;  1QLY A;  1MUZ A;  2CH4 A;  2P4R A;  3NPF A;  2L3P A;  4KRT A;  3NMZ C;  1K0S A;  2DLP A;  2VVK A;  3IQL A;  1TG0 A;  1RI9 A;  1E6G A;  2KGT A;  1PNJ A;  2KYB A;  4OMP A;  2YDL A;  1OOT A;  2MIO A;  4AFS C;  4AG2 C;  2BZ8 A;  4JZ3 A;  2O9S A;  2ECZ A;  1PRM C;  2ABL A;  3EG0 A;  2GQI A;  2KRM A;  2L3Q A;  2L2P A;  5EC7 A;  1UUE A;  1WXB A;  2M51 A;  2YUO A;  1GCP A;  1HD3 A;  2KT8 A;  4LUD A;  1K4U S;  2B86 A;  1GRI A;  4HVV A;  3UAT A;  1VYU A;  1X6B A;  2C0I A;  4IIM A;  2RQW A;  2YUP A;  2EYZ A;  2DL3 A;  1ABO A;  1ARK A;  1W1F A;  2AZV A;  1X2K A;  3TVT A;  1BBZ A;  1K76 A;  2JM8 A;  1NLO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...