1PRNA

Refined structure of porin from rhodopseudomonas blastica and comparison with the porin from rhodobacter capsulatus
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
289
structure length
289
Chain Sequence
EISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYDSEMGYEASSFGDAQSSFFAYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure of the porin from Rhodopseudomonas blastica. Comparison with the porin from Rhodobacter capsulatus.
pubmed doi rcsb
source organism Rhodobacter blasticus
molecule tags Integral membrane protein porin
molecule keywords PORIN
total genus 75
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1994-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13609 Porin_4 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1prnA00
2PORA 3VZWX 3FYXA 5DL6A 1GFPA 4RJWA 1PRNA 5DL7A 4D64A 1OSMA 1GFQA 3SZDA 4KR8A 1E54A 1MPFA 4BUMX 1GFOA 2QTKA 2FGQX 4LSHA 4GCQA 3HW9A 2ZLDA 3T24A 3SYSA 4LSEA 2XG6A 2ODJA 1H6S1 5DL8A 3UPGA 4D65A 4FOZA 4AUIA 8PRNA 1GFMA 4D5UA 3EMNX 2FGRA 3WI5A 2OMFA 5PRNA 3T20A 1BT9A 4C69X 4RJXA 3POUA 3POXA 2Y0LA 4JFBA 2J1NA 2Y0HA 3SZVA 4KRAA 4FRTA 2XE1A 3WI4A 3A2SX 3K19A 4FSOA 4LSIA 4FRXA 1HXUA 5JDPA 3VY8X 5DL5A 2Y2XA 1PHOA 2ZFGA 3PRNA 4FSPA 3HWBA 3JTYA 4GCSA 6PRNA 1OPFA 5FVNA 4LSFA 4KR4A 3SY7A 1GFNA 3SYBA 1HXXA 2XE5A 3PORA 3NSGA 2Y0KA 3VY9X 4FMSA 3VZTX 2J4UP 3UU2A 1HXTA 2PRNA 1BH3A 3O0EA 3SY9A 3VZUX 2K4TA 3T0SA 4FT6A 2XE3A 4GCPA 2XE2A 7PRNA 2O4VA 3POQA
chains in the Genus database with same CATH superfamily
2LHFA 2WJRA 2PORA 3VZWX 1ZHYA 3AA0B 2MHLA 3QRAA 2R8AA 4FZLA 4N58A 4QQ1A 3FYXA 5DL6A 1GFPA 4RJWA 1PRNA 5G26A 2WVPA 2XTQA 3KVDD 4F4BA 1QJ8A 5DL7A 4D64A 1Q9FA 2KC0A 3LK3B 2XTRA 3VE1A 1OSMA 4PJ0O 3AA1A 2M06A 4AFKA 3WU2O 1GFQA 1P4TA 3SZDA 3LK2A 4KR8A 5T5FA 1E54A 4RL9A 1T1LA 1MPFA 1ORMA 2IWVA 2R88A 3PF1A 4G75A 4BUMX 3AAEB 3TZGA 3V8UA 4XNKA 3SYBA 1GFOA 2QTKA 4PUXA 3LK41 2FGQX 4LSHA 4B61A 2JMMA 4AKRB 5B66O 4GCQA 3HW9A 2ZLDA 5KAFO 2R4NA 3PQUA 3T24A 3SYSA 4LSEA 5TISO 4AYEC 4C00A 5AFUK 3KZIO 3LK42 5GTIO 5E79O 4JCHA 1QJ9A 2XG6A 5G39A 2ODJA 1MM4A 1H6S1 3DA3A 5DL8A 3JCUO 3BRZA 5IYUA 3UPGA 4K3CA 4C4VB 2YPVA 4AYNA 2N2MA 3BS0A 4O3YA 4D65A 4FZMA 5EE2A 4AYMC 1Q9GA 4FOZA 4AUIA 4N59A 4AYID 4C4VA 8PRNA 1GFMA 4RLCA 1ZHXA 4FESA 4D5UA 3EMNX 2WJQA 2GE4A 2R4OA 5GV0A 2FGRA 3WI5A 2JQYA 3HOLA 2OMFA 2N2LA 3LK3A 1BT9A 2R4LA 4FUVA 5PRNA 4C69X 3T20A 4RJXA 5AFUL 2KDYA 3POUA 1IZNB 4G76A 1IZNA 3POXA 4FQEA 1T16A 2R4PA 1MM5A 2F1CX 1ZHTA 2X27X 2Y0LA 4JFBA 4Z3TA 4AZLA 2J1NA 5B5EO 2W81C 3A0HO 2Y0HA 2Y7SA 3BRYA 3SZVA 5ADXL 4UB8O 3AA0A 2MNHA 4KRAA 3QRCA 4FRTA 2XE1A 4GHBA 3WI4A 4AKMA 4XNLA 4AYDC 1YS5A 2W80C 3A2SX 3AAAA 3GP6A 3AAAB 2KXPB 3AA7A 2KXPA 3AA7B 3K19A 3PGRA 4FSOA 4FRXA 1HXUA 4LSIA 5JDPA 4O3XB 3AA6B 3VY8X 4N75A 5DL5A 1G90A 4N74A 2KZ7A 5KAIO 2Y2XA 2K0LA 2X9KA 3LK2B 2F1TA 3A0BO 1PHOA 2ZFGA 3PRNA 4E1TA 4FSPA 3C5OA 3HWBA 3JTYA 3AA1B 4UB6O 5G38A 4GCSA 2F1VA 2AXTO 2LFUA 6PRNA 1OPFA 5FVNA 1ZHZA 3DZMA 4KR4A 4LSFA 4O4UA 4U9CA 3SY7A 1GFNA 3VE2A 3UAQA 5ADXK 3DWNA 4RLBA 4FZNA 2YNKA 3PGUA 1HXXA 4O4XA 4O3WA 5D5DA 4K3BA 3DA4A 2XE5A 5G3AA 3PORA 3NSGA 2ERVA 2Y0KA 2R89A 4PR7A 3VY9X 2KZ7B 4FMSA 4E1SA 1THQA 3VZTX 5GTHO 4O49A 3PGSA 3PQSA 3UU2A 2J4UP 1HXTA 4O3ZA 2XMXA 2PRNA 4GF4A 1BH3A 3O0EA 3SY9A 3G7GA 5H2FO 3VZUX 1BXWA 1QJPA 2M07A 2K4TA 3HOEA 3AAEA 3RBHA 4FT6A 3T0SA 4CTDA 3NJTA 1ZHWA 1S5LO 2XE3A 3AA6A 2IWWA 4IL6O 4AKRA 3DWOX 4GCPA 2XE2A 7PRNA 2O4VA 3POQA
chains in the Genus database with same CATH topology
2LHFA 2PORA 3VZWX 1ZHYA 3AA0B 2MHLA 3QRAA 4FZLA 4N58A 4QQ1A 3FYXA 5DL6A 1GFPA 4RJWA 1PRNA 5G26A 4F4BA 2XTQA 3KVDD 1QJ8A 5DL7A 4D64A 1Q9FA 2KC0A 3LK3B 2XTRA 3VE1A 1OSMA 3AA1A 2M06A 4AFKA 1GFQA 1P4TA 3SZDA 3LK2A 4KR8A 5T5FA 1E54A 4RL9A 1MPFA 1ORMA 4BUMX 4G75A 3AAEB 3TZGA 3V8UA 4XNKA 1GFOA 2QTKA 4PUXA 3LK41 2FGQX 4LSHA 4B61A 2JMMA 4AKRB 4GCQA 3HW9A 2ZLDA 3PQUA 3T24A 3SYSA 4LSEA 4AYEC 3LK42 4JCHA 1QJ9A 2XG6A 2ODJA 1MM4A 1H6S1 3DA3A 5DL8A 5IYUA 3UPGA 2YPVA 4AYNA 2N2MA 4O3YA 4D65A 4FZMA 5EE2A 4AYMC 1Q9GA 4FOZA 4AUIA 4N59A 4AYID 8PRNA 1GFMA 4RLCA 1ZHXA 4FESA 4D5UA 3EMNX 2GE4A 5GV0A 2FGRA 3WI5A 3HOLA 2OMFA 2N2LA 3LK3A 1BT9A 4FUVA 5PRNA 4C69X 3T20A 4RJXA 5AFUL 2KDYA 3POUA 1IZNB 4G76A 1IZNA 3POXA 4Z3TA 1MM5A 1ZHTA 2X27X 2Y0LA 4JFBA 4AZLA 2J1NA 2W81C 2Y0HA 2Y7SA 3SZVA 5ADXL 3AA0A 2MNHA 4KRAA 3QRCA 4FRTA 2XE1A 4GHBA 3WI4A 4AKMA 4XNLA 4AYDC 1YS5A 2W80C 3A2SX 3AAAA 3GP6A 3AAAB 2KXPB 3AA7A 2KXPA 3AA7B 3K19A 4FSOA 4LSIA 4FRXA 1HXUA 5JDPA 4O3XB 3AA6B 3VY8X 1G90A 5DL5A 2KZ7A 2Y2XA 2K0LA 3LK2B 2F1TA 5ADXK 1PHOA 2ZFGA 3PRNA 4E1TA 4FSPA 3C5OA 3HWBA 3JTYA 3AA1B 4GCSA 2F1VA 2LFUA 6PRNA 1OPFA 5FVNA 1ZHZA 4KR4A 4LSFA 4O4UA 4U9CA 3SY7A 1GFNA 3VE2A 3UAQA 3SYBA 4RLBA 4FZNA 2YNKA 1HXXA 4O4XA 4O3WA 5D5DA 3DA4A 2XE5A 3PORA 3NSGA 2ERVA 2Y0KA 3VY9X 5AFUK 2KZ7B 4FMSA 4E1SA 1THQA 3VZTX 2J4UP 4O49A 3PQSA 3UU2A 1HXTA 4O3ZA 2XMXA 2PRNA 4GF4A 1BH3A 3O0EA 3SY9A 3G7GA 3VZUX 1BXWA 1QJPA 2M07A 2K4TA 3HOEA 3AAEA 3RBHA 4FT6A 3T0SA 1ZHWA 2XE3A 3AA6A 4AKRA 4GCPA 2XE2A 7PRNA 2O4VA 3POQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2POR A;  3VZW X;  3FYX A;  5DL6 A;  1GFP A;  4RJW A;  1PRN A;  5DL7 A;  4D64 A;  1OSM A;  1GFQ A;  3SZD A;  4KR8 A;  1E54 A;  1MPF A;  4BUM X;  1GFO A;  2QTK A;  2FGQ X;  4LSH A;  4GCQ A;  3HW9 A;  2ZLD A;  3T24 A;  3SYS A;  4LSE A;  2XG6 A;  2ODJ A;  1H6S 1;  5DL8 A;  3UPG A;  4D65 A;  4FOZ A;  4AUI A;  8PRN A;  1GFM A;  4D5U A;  3EMN X;  2FGR A;  3WI5 A;  2OMF A;  5PRN A;  3T20 A;  1BT9 A;  4C69 X;  4RJX A;  3POU A;  3POX A;  2Y0L A;  4JFB A;  2J1N A;  2Y0H A;  3SZV A;  4KRA A;  4FRT A;  2XE1 A;  3WI4 A;  3A2S X;  3K19 A;  4FSO A;  4LSI A;  4FRX A;  1HXU A;  5JDP A;  3VY8 X;  5DL5 A;  2Y2X A;  1PHO A;  2ZFG A;  3PRN A;  4FSP A;  3HWB A;  3JTY A;  4GCS A;  6PRN A;  1OPF A;  5FVN A;  4LSF A;  4KR4 A;  3SY7 A;  1GFN A;  3SYB A;  1HXX A;  2XE5 A;  3POR A;  3NSG A;  2Y0K A;  3VY9 X;  4FMS A;  3VZT X;  2J4U P;  3UU2 A;  1HXT A;  2PRN A;  1BH3 A;  3O0E A;  3SY9 A;  3VZU X;  2K4T A;  3T0S A;  4FT6 A;  2XE3 A;  4GCP A;  2XE2 A;  7PRN A;  2O4V A;  3POQ A; 
#chains in the Genus database with same CATH topology
 2LHF A;  2WJR A;  2POR A;  3VZW X;  1ZHY A;  3AA0 B;  2MHL A;  3QRA A;  2R8A A;  4FZL A;  4N58 A;  4QQ1 A;  3FYX A;  5DL6 A;  1GFP A;  4RJW A;  1PRN A;  5G26 A;  2WVP A;  2XTQ A;  3KVD D;  4F4B A;  1QJ8 A;  5DL7 A;  4D64 A;  1Q9F A;  2KC0 A;  3LK3 B;  2XTR A;  3VE1 A;  1OSM A;  4PJ0 O;  3AA1 A;  2M06 A;  4AFK A;  3WU2 O;  1GFQ A;  1P4T A;  3SZD A;  3LK2 A;  4KR8 A;  5T5F A;  1E54 A;  4RL9 A;  1T1L A;  1MPF A;  1ORM A;  2IWV A;  2R88 A;  3PF1 A;  4G75 A;  4BUM X;  3AAE B;  3TZG A;  3V8U A;  4XNK A;  3SYB A;  1GFO A;  2QTK A;  4PUX A;  3LK4 1;  2FGQ X;  4LSH A;  4B61 A;  2JMM A;  4AKR B;  5B66 O;  4GCQ A;  3HW9 A;  2ZLD A;  5KAF O;  2R4N A;  3PQU A;  3T24 A;  3SYS A;  4LSE A;  5TIS O;  4AYE C;  4C00 A;  5AFU K;  3KZI O;  3LK4 2;  5GTI O;  5E79 O;  4JCH A;  1QJ9 A;  2XG6 A;  5G39 A;  2ODJ A;  1MM4 A;  1H6S 1;  3DA3 A;  5DL8 A;  3JCU O;  3BRZ A;  5IYU A;  3UPG A;  4K3C A;  4C4V B;  2YPV A;  4AYN A;  2N2M A;  3BS0 A;  4O3Y A;  4D65 A;  4FZM A;  5EE2 A;  4AYM C;  1Q9G A;  4FOZ A;  4AUI A;  4N59 A;  4AYI D;  4C4V A;  8PRN A;  1GFM A;  4RLC A;  1ZHX A;  4FES A;  4D5U A;  3EMN X;  2WJQ A;  2GE4 A;  2R4O A;  5GV0 A;  2FGR A;  3WI5 A;  2JQY A;  3HOL A;  2OMF A;  2N2L A;  3LK3 A;  1BT9 A;  2R4L A;  4FUV A;  5PRN A;  4C69 X;  3T20 A;  4RJX A;  5AFU L;  2KDY A;  3POU A;  1IZN B;  4G76 A;  1IZN A;  3POX A;  4FQE A;  1T16 A;  2R4P A;  1MM5 A;  2F1C X;  1ZHT A;  2X27 X;  2Y0L A;  4JFB A;  4Z3T A;  4AZL A;  2J1N A;  5B5E O;  2W81 C;  3A0H O;  2Y0H A;  2Y7S A;  3BRY A;  3SZV A;  5ADX L;  4UB8 O;  3AA0 A;  2MNH A;  4KRA A;  3QRC A;  4FRT A;  2XE1 A;  4GHB A;  3WI4 A;  4AKM A;  4XNL A;  4AYD C;  1YS5 A;  2W80 C;  3A2S X;  3AAA A;  3GP6 A;  3AAA B;  2KXP B;  3AA7 A;  2KXP A;  3AA7 B;  3K19 A;  3PGR A;  4FSO A;  4FRX A;  1HXU A;  4LSI A;  5JDP A;  4O3X B;  3AA6 B;  3VY8 X;  4N75 A;  5DL5 A;  1G90 A;  4N74 A;  2KZ7 A;  5KAI O;  2Y2X A;  2K0L A;  2X9K A;  3LK2 B;  2F1T A;  3A0B O;  1PHO A;  2ZFG A;  3PRN A;  4E1T A;  4FSP A;  3C5O A;  3HWB A;  3JTY A;  3AA1 B;  4UB6 O;  5G38 A;  4GCS A;  2F1V A;  2AXT O;  2LFU A;  6PRN A;  1OPF A;  5FVN A;  1ZHZ A;  3DZM A;  4KR4 A;  4LSF A;  4O4U A;  4U9C A;  3SY7 A;  1GFN A;  3VE2 A;  3UAQ A;  5ADX K;  3DWN A;  4RLB A;  4FZN A;  2YNK A;  3PGU A;  1HXX A;  4O4X A;  4O3W A;  5D5D A;  4K3B A;  3DA4 A;  2XE5 A;  5G3A A;  3POR A;  3NSG A;  2ERV A;  2Y0K A;  2R89 A;  4PR7 A;  3VY9 X;  2KZ7 B;  4FMS A;  4E1S A;  1THQ A;  3VZT X;  5GTH O;  4O49 A;  3PGS A;  3PQS A;  3UU2 A;  2J4U P;  1HXT A;  4O3Z A;  2XMX A;  2PRN A;  4GF4 A;  1BH3 A;  3O0E A;  3SY9 A;  3G7G A;  5H2F O;  3VZU X;  1BXW A;  1QJP A;  2M07 A;  2K4T A;  3HOE A;  3AAE A;  3RBH A;  4FT6 A;  3T0S A;  4CTD A;  3NJT A;  1ZHW A;  1S5L O;  2XE3 A;  3AA6 A;  2IWW A;  4IL6 O;  4AKR A;  3DWO X;  4GCP A;  2XE2 A;  7PRN A;  2O4V A;  3POQ A; 
#chains in the Genus database with same CATH homology
 2LHF A;  2POR A;  3VZW X;  1ZHY A;  3AA0 B;  2MHL A;  3QRA A;  4FZL A;  4N58 A;  4QQ1 A;  3FYX A;  5DL6 A;  1GFP A;  4RJW A;  1PRN A;  5G26 A;  4F4B A;  2XTQ A;  3KVD D;  1QJ8 A;  5DL7 A;  4D64 A;  1Q9F A;  2KC0 A;  3LK3 B;  2XTR A;  3VE1 A;  1OSM A;  3AA1 A;  2M06 A;  4AFK A;  1GFQ A;  1P4T A;  3SZD A;  3LK2 A;  4KR8 A;  5T5F A;  1E54 A;  4RL9 A;  1MPF A;  1ORM A;  4BUM X;  4G75 A;  3AAE B;  3TZG A;  3V8U A;  4XNK A;  1GFO A;  2QTK A;  4PUX A;  3LK4 1;  2FGQ X;  4LSH A;  4B61 A;  2JMM A;  4AKR B;  4GCQ A;  3HW9 A;  2ZLD A;  3PQU A;  3T24 A;  3SYS A;  4LSE A;  4AYE C;  3LK4 2;  4JCH A;  1QJ9 A;  2XG6 A;  2ODJ A;  1MM4 A;  1H6S 1;  3DA3 A;  5DL8 A;  5IYU A;  3UPG A;  2YPV A;  4AYN A;  2N2M A;  4O3Y A;  4D65 A;  4FZM A;  5EE2 A;  4AYM C;  1Q9G A;  4FOZ A;  4AUI A;  4N59 A;  4AYI D;  8PRN A;  1GFM A;  4RLC A;  1ZHX A;  4FES A;  4D5U A;  3EMN X;  2GE4 A;  5GV0 A;  2FGR A;  3WI5 A;  3HOL A;  2OMF A;  2N2L A;  3LK3 A;  1BT9 A;  4FUV A;  5PRN A;  4C69 X;  3T20 A;  4RJX A;  5AFU L;  2KDY A;  3POU A;  1IZN B;  4G76 A;  1IZN A;  3POX A;  4Z3T A;  1MM5 A;  1ZHT A;  2X27 X;  2Y0L A;  4JFB A;  4AZL A;  2J1N A;  2W81 C;  2Y0H A;  2Y7S A;  3SZV A;  5ADX L;  3AA0 A;  2MNH A;  4KRA A;  3QRC A;  4FRT A;  2XE1 A;  4GHB A;  3WI4 A;  4AKM A;  4XNL A;  4AYD C;  1YS5 A;  2W80 C;  3A2S X;  3AAA A;  3GP6 A;  3AAA B;  2KXP B;  3AA7 A;  2KXP A;  3AA7 B;  3K19 A;  4FSO A;  4LSI A;  4FRX A;  1HXU A;  5JDP A;  4O3X B;  3AA6 B;  3VY8 X;  1G90 A;  5DL5 A;  2KZ7 A;  2Y2X A;  2K0L A;  3LK2 B;  2F1T A;  5ADX K;  1PHO A;  2ZFG A;  3PRN A;  4E1T A;  4FSP A;  3C5O A;  3HWB A;  3JTY A;  3AA1 B;  4GCS A;  2F1V A;  2LFU A;  6PRN A;  1OPF A;  5FVN A;  1ZHZ A;  4KR4 A;  4LSF A;  4O4U A;  4U9C A;  3SY7 A;  1GFN A;  3VE2 A;  3UAQ A;  3SYB A;  4RLB A;  4FZN A;  2YNK A;  1HXX A;  4O4X A;  4O3W A;  5D5D A;  3DA4 A;  2XE5 A;  3POR A;  3NSG A;  2ERV A;  2Y0K A;  3VY9 X;  5AFU K;  2KZ7 B;  4FMS A;  4E1S A;  1THQ A;  3VZT X;  2J4U P;  4O49 A;  3PQS A;  3UU2 A;  1HXT A;  4O3Z A;  2XMX A;  2PRN A;  4GF4 A;  1BH3 A;  3O0E A;  3SY9 A;  3G7G A;  3VZU X;  1BXW A;  1QJP A;  2M07 A;  2K4T A;  3HOE A;  3AAE A;  3RBH A;  4FT6 A;  3T0S A;  1ZHW A;  2XE3 A;  3AA6 A;  4AKR A;  4GCP A;  2XE2 A;  7PRN A;  2O4V A;  3POQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...