1PRNA

Refined structure of porin from rhodopseudomonas blastica and comparison with the porin from rhodobacter capsulatus
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
289
structure length
289
Chain Sequence
EISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYDSEMGYEASSFGDAQSSFFAYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORIN
publication title Refined structure of the porin from Rhodopseudomonas blastica. Comparison with the porin from Rhodobacter capsulatus.
pubmed doi rcsb
source organism Rhodobacter blasticus
molecule tags Integral membrane protein porin
total genus 75
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1994-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13609 Porin_4 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1prnA00
4GCSA 3SZVA 1H6S1 1BH3A 3NSGA 1E54A 1GFOA 4D5UA 1OPFA 2J4UP 4KR4A 3WI5A 3UU2A 2Y0HA 1OSMA 3PRNA 1GFMA 1HXXA 6PRNA 4FOZA 2J1NA 3EMNX 3PORA 2Y0LA 1GFPA 3VZTX 4C69X 1HXTA 2QTKA 4FMSA 2XE3A 3SYBA 2FGRA 2OMFA 3POUA 2ODJA 3SYSA 2XE2A 2XG6A 3VY8X 3JTYA 2O4VA 3SY9A 5DL8A 4RJXA 3K19A 4FSOA 4D64A 2ZLDA 3SY7A 5JDPA 3POQA 3FYXA 2Y2XA 2PORA 3T24A 4KR8A 3T0SA 4FRXA 3VY9X 5DL6A 4LSIA 2K4TA 4KRAA 5PRNA 3VZUX 3POXA 3O0EA 3A2SX 2XE5A 4JFBA 4LSHA 4FRTA 2Y0KA 3SZDA 7PRNA 4LSEA 4FT6A 4D65A 3WI4A 4LSFA 4BUMX 5DL5A 3HWBA 4AUIA 2FGQX 1BT9A 4RJWA 2XE1A 1PHOA 3T20A 4GCPA 1GFNA 4FSPA 5FVNA 3HW9A 3UPGA 1MPFA 1GFQA 5DL7A 3VZWX 8PRNA 2PRNA 1PRNA 1HXUA 4GCQA 2ZFGA
chains in the Genus database with same CATH superfamily
3GP6A 1QJPA 3PGSA 3QRCA 3BS0A 4G76A 4GCSA 4O3XB 3SZVA 1H6S1 1IZNA 1BH3A 4FZNA 3NSGA 4N58A 4C4VA 1IZNB 1ZHZA 1E54A 3DWOX 4O49A 1GFOA 4D5UA 4C4VB 3NJTA 1Q9GA 4N59A 4O4UA 1OPFA 2X27X 4E1TA 2J4UP 4FUVA 2N2MA 3A0BO 3DA4A 4O3WA 4KR4A 1QJ9A 3AAAA 3DZMA 2LFUA 3JCUO 3WI5A 3AAAB 4AFKA 3UU2A 3QRAA 4AYMC 2JMMA 2YNKA 5AFUL 4GHBA 4AYID 3BRYA 2R4OA 2X9KA 1OSMA 2Y0HA 4FESA 4AYNA 3PRNA 5G38A 4O4XA 2IWVA 5ADXL 1GFMA 1HXXA 1YS5A 6PRNA 4XNLA 4FOZA 4GF4A 2MNHA 5EE2A 4Z3TA 2KXPA 2J1NA 3EMNX 3PORA 1ZHWA 1GFPA 2Y0LA 2KXPB 2M06A 3VZTX 1ZHTA 3HOLA 3C5OA 3PQSA 4C69X 1HXTA 4O3YA 4UB8O 2QTKA 5GV0A 1T16A 1S5LO 4PR7A 5KAIO 4AKMA 3AA6A 4FMSA 2XE3A 3SYBA 3VE2A 2FGRA 2OMFA 3AA6B 2ODJA 3POUA 4FQEA 3SYSA 2XE2A 1G90A 3PGRA 2LHFA 2XG6A 5T5FA 3VE1A 1THQA 1BXWA 3LK2A 3VY8X 3JTYA 2M07A 3LK2B 2O4VA 1ORMA 2R4PA 2W80C 4G75A 3SY9A 5DL8A 4RJXA 3UAQA 3K19A 2R8AA 3PGUA 4FSOA 5E79O 4D64A 5AFUK 2KC0A 2ZLDA 3SY7A 5B66O 5JDPA 4XNKA 2R4LA 5G3AA 3POQA 4E1SA 3AA0A 2ERVA 2Y2XA 3FYXA 3KZIO 2XMXA 5ADXK 2PORA 3AA0B 2KDYA 4KR8A 3T24A 3T0SA 3AA7A 2KZ7A 4FRXA 3AA7B 4RLCA 3VY9X 5D5DA 2KZ7B 4U9CA 5DL6A 3DA3A 5G26A 4LSIA 2K4TA 3PF1A 4K3BA 4KRAA 5PRNA 3VZUX 3AA1A 4AKRA 4AYEC 3LK41 3POXA 2R88A 3O0EA 3A2SX 2XE5A 3AA1B 4AKRB 4F4BA 1T1LA 2JQYA 2MHLA 4JFBA 3BRZA 4LSHA 4B61A 5H2FO 3PQUA 4FRTA 2AXTO 5IYUA 5B5EO 2Y0KA 1ZHXA 4N74A 1Q9FA 3SZDA 2F1CX 4LSEA 4AYDC 7PRNA 3LK3A 4IL6O 4FT6A 4D65A 3LK3B 3WI4A 5KAFO 4LSFA 4BUMX 5GTIO 1MM4A 5GTHO 4QQ1A 5DL5A 3HWBA 4RLBA 2WVPA 2FGQX 3WU2O 4AUIA 4CTDA 3DWNA 1BT9A 1QJ8A 4RJWA 3TZGA 5G39A 2IWWA 3V8UA 2XE1A 1PHOA 4RL9A 3T20A 2GE4A 4UB6O 2Y7SA 1GFNA 3A0HO 4FSPA 3HW9A 2WJQA 4GCPA 2WJRA 5FVNA 2F1TA 4N75A 5TISO 2XTQA 3UPGA 4JCHA 1MPFA 4O3ZA 4C00A 1GFQA 5DL7A 1ZHYA 2W81C 3AAEA 4PUXA 2K0LA 3KVDD 3HOEA 4FZMA 3AAEB 3RBHA 3VZWX 8PRNA 2PRNA 2XTRA 4K3CA 1P4TA 2F1VA 1PRNA 1HXUA 2R4NA 1MM5A 4GCQA 2N2LA 4AZLA 2YPVA 4FZLA 4PJ0O 2ZFGA 3G7GA 3LK42 2R89A
chains in the Genus database with same CATH topology
3GP6A 1QJPA 4G76A 3QRCA 4GCSA 4O3XB 3SZVA 1H6S1 1IZNA 1BH3A 4FZNA 3NSGA 4N58A 1IZNB 1ZHZA 1E54A 4O49A 1GFOA 4D5UA 1Q9GA 4N59A 4O4UA 1OPFA 2X27X 4E1TA 2J4UP 4FUVA 2N2MA 3DA4A 4O3WA 4KR4A 1QJ9A 3AAAA 2LFUA 3WI5A 4AFKA 3AAAB 4AYMC 3UU2A 3QRAA 5AFUL 2JMMA 2YNKA 4GHBA 4AYID 2Y0HA 1OSMA 4FESA 4AYNA 3PRNA 4O4XA 5ADXL 1GFMA 1HXXA 1YS5A 6PRNA 4XNLA 4FOZA 4GF4A 2MNHA 5EE2A 4Z3TA 2KXPA 2J1NA 3EMNX 3PORA 1ZHWA 1GFPA 2Y0LA 2KXPB 2M06A 3VZTX 1ZHTA 3HOLA 3C5OA 3PQSA 4C69X 1HXTA 4O3YA 2QTKA 5GV0A 4AKMA 3AA6A 4FMSA 2XE3A 3SYBA 3VE2A 2FGRA 2OMFA 3AA6B 2ODJA 3POUA 3SYSA 1G90A 2XE2A 2LHFA 2XG6A 5T5FA 3VE1A 1THQA 1BXWA 3LK2A 3VY8X 3JTYA 2M07A 3LK2B 2O4VA 1ORMA 2W80C 4G75A 3SY9A 5DL8A 4RJXA 3UAQA 3K19A 4FSOA 4D64A 5AFUK 2KC0A 2ZLDA 3SY7A 5JDPA 4XNKA 3POQA 4E1SA 3AA0A 2ERVA 2Y2XA 3FYXA 5ADXK 2XMXA 2PORA 3AA0B 2KDYA 4KR8A 3T24A 3T0SA 3AA7A 2KZ7A 4FRXA 3AA7B 4RLCA 3VY9X 5D5DA 2KZ7B 4U9CA 5DL6A 3DA3A 5G26A 4LSIA 2K4TA 4KRAA 5PRNA 3VZUX 3AA1A 4AKRA 4AYEC 3LK41 3POXA 3O0EA 3A2SX 2XE5A 3AA1B 4AKRB 4F4BA 2MHLA 4JFBA 4LSHA 4B61A 3PQUA 4FRTA 5IYUA 2Y0KA 1ZHXA 3SZDA 1Q9FA 7PRNA 4AYDC 4LSEA 3LK3A 4FT6A 4D65A 3LK3B 3WI4A 4LSFA 4BUMX 1MM4A 4QQ1A 5DL5A 3HWBA 4RLBA 4AUIA 2FGQX 1BT9A 1QJ8A 4RJWA 3TZGA 3V8UA 2XE1A 1PHOA 4RL9A 3T20A 2GE4A 2Y7SA 1GFNA 4FSPA 4GCPA 3HW9A 5FVNA 3UPGA 2F1TA 2XTQA 4JCHA 1MPFA 4O3ZA 1GFQA 5DL7A 1ZHYA 2W81C 3AAEA 4PUXA 2K0LA 3KVDD 3HOEA 4FZMA 3AAEB 3RBHA 3VZWX 8PRNA 2PRNA 2XTRA 1P4TA 2F1VA 1PRNA 1HXUA 1MM5A 4GCQA 2N2LA 4AZLA 2YPVA 4FZLA 2ZFGA 3G7GA 3LK42
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCS A;  3SZV A;  1H6S 1;  1BH3 A;  3NSG A;  1E54 A;  1GFO A;  4D5U A;  1OPF A;  2J4U P;  4KR4 A;  3WI5 A;  3UU2 A;  2Y0H A;  1OSM A;  3PRN A;  1GFM A;  1HXX A;  6PRN A;  4FOZ A;  2J1N A;  3EMN X;  3POR A;  2Y0L A;  1GFP A;  3VZT X;  4C69 X;  1HXT A;  2QTK A;  4FMS A;  2XE3 A;  3SYB A;  2FGR A;  2OMF A;  3POU A;  2ODJ A;  3SYS A;  2XE2 A;  2XG6 A;  3VY8 X;  3JTY A;  2O4V A;  3SY9 A;  5DL8 A;  4RJX A;  3K19 A;  4FSO A;  4D64 A;  2ZLD A;  3SY7 A;  5JDP A;  3POQ A;  3FYX A;  2Y2X A;  2POR A;  3T24 A;  4KR8 A;  3T0S A;  4FRX A;  3VY9 X;  5DL6 A;  4LSI A;  2K4T A;  4KRA A;  5PRN A;  3VZU X;  3POX A;  3O0E A;  3A2S X;  2XE5 A;  4JFB A;  4LSH A;  4FRT A;  2Y0K A;  3SZD A;  7PRN A;  4LSE A;  4FT6 A;  4D65 A;  3WI4 A;  4LSF A;  4BUM X;  5DL5 A;  3HWB A;  4AUI A;  2FGQ X;  1BT9 A;  4RJW A;  2XE1 A;  1PHO A;  3T20 A;  4GCP A;  1GFN A;  4FSP A;  5FVN A;  3HW9 A;  3UPG A;  1MPF A;  1GFQ A;  5DL7 A;  3VZW X;  8PRN A;  2PRN A;  1PRN A;  1HXU A;  4GCQ A;  2ZFG A; 
#chains in the Genus database with same CATH topology
 3GP6 A;  1QJP A;  3PGS A;  3QRC A;  3BS0 A;  4G76 A;  4GCS A;  4O3X B;  3SZV A;  1H6S 1;  1IZN A;  1BH3 A;  4FZN A;  3NSG A;  4N58 A;  4C4V A;  1IZN B;  1ZHZ A;  1E54 A;  3DWO X;  4O49 A;  1GFO A;  4D5U A;  4C4V B;  3NJT A;  1Q9G A;  4N59 A;  4O4U A;  1OPF A;  2X27 X;  4E1T A;  2J4U P;  4FUV A;  2N2M A;  3A0B O;  3DA4 A;  4O3W A;  4KR4 A;  1QJ9 A;  3AAA A;  3DZM A;  2LFU A;  3JCU O;  3WI5 A;  3AAA B;  4AFK A;  3UU2 A;  3QRA A;  4AYM C;  2JMM A;  2YNK A;  5AFU L;  4GHB A;  4AYI D;  3BRY A;  2R4O A;  2X9K A;  1OSM A;  2Y0H A;  4FES A;  4AYN A;  3PRN A;  5G38 A;  4O4X A;  2IWV A;  5ADX L;  1GFM A;  1HXX A;  1YS5 A;  6PRN A;  4XNL A;  4FOZ A;  4GF4 A;  2MNH A;  5EE2 A;  4Z3T A;  2KXP A;  2J1N A;  3EMN X;  3POR A;  1ZHW A;  1GFP A;  2Y0L A;  2KXP B;  2M06 A;  3VZT X;  1ZHT A;  3HOL A;  3C5O A;  3PQS A;  4C69 X;  1HXT A;  4O3Y A;  4UB8 O;  2QTK A;  5GV0 A;  1T16 A;  1S5L O;  4PR7 A;  5KAI O;  4AKM A;  3AA6 A;  4FMS A;  2XE3 A;  3SYB A;  3VE2 A;  2FGR A;  2OMF A;  3AA6 B;  2ODJ A;  3POU A;  4FQE A;  3SYS A;  2XE2 A;  1G90 A;  3PGR A;  2LHF A;  2XG6 A;  5T5F A;  3VE1 A;  1THQ A;  1BXW A;  3LK2 A;  3VY8 X;  3JTY A;  2M07 A;  3LK2 B;  2O4V A;  1ORM A;  2R4P A;  2W80 C;  4G75 A;  3SY9 A;  5DL8 A;  4RJX A;  3UAQ A;  3K19 A;  2R8A A;  3PGU A;  4FSO A;  5E79 O;  4D64 A;  5AFU K;  2KC0 A;  2ZLD A;  3SY7 A;  5B66 O;  5JDP A;  4XNK A;  2R4L A;  5G3A A;  3POQ A;  4E1S A;  3AA0 A;  2ERV A;  2Y2X A;  3FYX A;  3KZI O;  2XMX A;  5ADX K;  2POR A;  3AA0 B;  2KDY A;  4KR8 A;  3T24 A;  3T0S A;  3AA7 A;  2KZ7 A;  4FRX A;  3AA7 B;  4RLC A;  3VY9 X;  5D5D A;  2KZ7 B;  4U9C A;  5DL6 A;  3DA3 A;  5G26 A;  4LSI A;  2K4T A;  3PF1 A;  4K3B A;  4KRA A;  5PRN A;  3VZU X;  3AA1 A;  4AKR A;  4AYE C;  3LK4 1;  3POX A;  2R88 A;  3O0E A;  3A2S X;  2XE5 A;  3AA1 B;  4AKR B;  4F4B A;  1T1L A;  2JQY A;  2MHL A;  4JFB A;  3BRZ A;  4LSH A;  4B61 A;  5H2F O;  3PQU A;  4FRT A;  2AXT O;  5IYU A;  5B5E O;  2Y0K A;  1ZHX A;  4N74 A;  1Q9F A;  3SZD A;  2F1C X;  4LSE A;  4AYD C;  7PRN A;  3LK3 A;  4IL6 O;  4FT6 A;  4D65 A;  3LK3 B;  3WI4 A;  5KAF O;  4LSF A;  4BUM X;  5GTI O;  1MM4 A;  5GTH O;  4QQ1 A;  5DL5 A;  3HWB A;  4RLB A;  2WVP A;  2FGQ X;  3WU2 O;  4AUI A;  4CTD A;  3DWN A;  1BT9 A;  1QJ8 A;  4RJW A;  3TZG A;  5G39 A;  2IWW A;  3V8U A;  2XE1 A;  1PHO A;  4RL9 A;  3T20 A;  2GE4 A;  4UB6 O;  2Y7S A;  1GFN A;  3A0H O;  4FSP A;  3HW9 A;  2WJQ A;  4GCP A;  2WJR A;  5FVN A;  2F1T A;  4N75 A;  5TIS O;  2XTQ A;  3UPG A;  4JCH A;  1MPF A;  4O3Z A;  4C00 A;  1GFQ A;  5DL7 A;  1ZHY A;  2W81 C;  3AAE A;  4PUX A;  2K0L A;  3KVD D;  3HOE A;  4FZM A;  3AAE B;  3RBH A;  3VZW X;  8PRN A;  2PRN A;  2XTR A;  4K3C A;  1P4T A;  2F1V A;  1PRN A;  1HXU A;  2R4N A;  1MM5 A;  4GCQ A;  2N2L A;  4AZL A;  2YPV A;  4FZL A;  4PJ0 O;  2ZFG A;  3G7G A;  3LK4 2;  2R89 A; 
#chains in the Genus database with same CATH homology
 3GP6 A;  1QJP A;  4G76 A;  3QRC A;  4GCS A;  4O3X B;  3SZV A;  1H6S 1;  1IZN A;  1BH3 A;  4FZN A;  3NSG A;  4N58 A;  1IZN B;  1ZHZ A;  1E54 A;  4O49 A;  1GFO A;  4D5U A;  1Q9G A;  4N59 A;  4O4U A;  1OPF A;  2X27 X;  4E1T A;  2J4U P;  4FUV A;  2N2M A;  3DA4 A;  4O3W A;  4KR4 A;  1QJ9 A;  3AAA A;  2LFU A;  3WI5 A;  4AFK A;  3AAA B;  4AYM C;  3UU2 A;  3QRA A;  5AFU L;  2JMM A;  2YNK A;  4GHB A;  4AYI D;  2Y0H A;  1OSM A;  4FES A;  4AYN A;  3PRN A;  4O4X A;  5ADX L;  1GFM A;  1HXX A;  1YS5 A;  6PRN A;  4XNL A;  4FOZ A;  4GF4 A;  2MNH A;  5EE2 A;  4Z3T A;  2KXP A;  2J1N A;  3EMN X;  3POR A;  1ZHW A;  1GFP A;  2Y0L A;  2KXP B;  2M06 A;  3VZT X;  1ZHT A;  3HOL A;  3C5O A;  3PQS A;  4C69 X;  1HXT A;  4O3Y A;  2QTK A;  5GV0 A;  4AKM A;  3AA6 A;  4FMS A;  2XE3 A;  3SYB A;  3VE2 A;  2FGR A;  2OMF A;  3AA6 B;  2ODJ A;  3POU A;  3SYS A;  1G90 A;  2XE2 A;  2LHF A;  2XG6 A;  5T5F A;  3VE1 A;  1THQ A;  1BXW A;  3LK2 A;  3VY8 X;  3JTY A;  2M07 A;  3LK2 B;  2O4V A;  1ORM A;  2W80 C;  4G75 A;  3SY9 A;  5DL8 A;  4RJX A;  3UAQ A;  3K19 A;  4FSO A;  4D64 A;  5AFU K;  2KC0 A;  2ZLD A;  3SY7 A;  5JDP A;  4XNK A;  3POQ A;  4E1S A;  3AA0 A;  2ERV A;  2Y2X A;  3FYX A;  5ADX K;  2XMX A;  2POR A;  3AA0 B;  2KDY A;  4KR8 A;  3T24 A;  3T0S A;  3AA7 A;  2KZ7 A;  4FRX A;  3AA7 B;  4RLC A;  3VY9 X;  5D5D A;  2KZ7 B;  4U9C A;  5DL6 A;  3DA3 A;  5G26 A;  4LSI A;  2K4T A;  4KRA A;  5PRN A;  3VZU X;  3AA1 A;  4AKR A;  4AYE C;  3LK4 1;  3POX A;  3O0E A;  3A2S X;  2XE5 A;  3AA1 B;  4AKR B;  4F4B A;  2MHL A;  4JFB A;  4LSH A;  4B61 A;  3PQU A;  4FRT A;  5IYU A;  2Y0K A;  1ZHX A;  3SZD A;  1Q9F A;  7PRN A;  4AYD C;  4LSE A;  3LK3 A;  4FT6 A;  4D65 A;  3LK3 B;  3WI4 A;  4LSF A;  4BUM X;  1MM4 A;  4QQ1 A;  5DL5 A;  3HWB A;  4RLB A;  4AUI A;  2FGQ X;  1BT9 A;  1QJ8 A;  4RJW A;  3TZG A;  3V8U A;  2XE1 A;  1PHO A;  4RL9 A;  3T20 A;  2GE4 A;  2Y7S A;  1GFN A;  4FSP A;  4GCP A;  3HW9 A;  5FVN A;  3UPG A;  2F1T A;  2XTQ A;  4JCH A;  1MPF A;  4O3Z A;  1GFQ A;  5DL7 A;  1ZHY A;  2W81 C;  3AAE A;  4PUX A;  2K0L A;  3KVD D;  3HOE A;  4FZM A;  3AAE B;  3RBH A;  3VZW X;  8PRN A;  2PRN A;  2XTR A;  1P4T A;  2F1V A;  1PRN A;  1HXU A;  1MM5 A;  4GCQ A;  2N2L A;  4AZL A;  2YPV A;  4FZL A;  2ZFG A;  3G7G A;  3LK4 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...