1PRUA

Purine repressor dna-binding domain dna binding
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of the free and DNA-bound forms of the purine repressor DNA-binding domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords PURINE REPRESSOR
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1995-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1pruA00
4J1XA 1ZAYA 3OQNA 2PUFA 2LYJA 1GT0C 4JCXA 1PRAA 2R1JL 1WETA 2L8NA 3TRBA 4Z59A 1WH6A 4Z5HA 1OSLA 1QPZA 1VPWA 2PUDA 4X4FA 2D5VA 4PU3C 2XCJA 5K98B 2LYSA 1LCDA 1JFTA 4YG4A 3BDNA 2MEZA 2CROA 3FYMA 2H8RA 3FMYA 4OB4A 3U3WA 2BNNA 2IVGA 3F6WA 4YARA 2LYKA 3UFDA 2BNOA 3KXAA 1BDIA 1ZPQA 3L1PA 2ICPA 1QP7A 4PU4C 3CROL 3OMTA 1QP0A 2HSGA 2XIUA 2KEKA 2PUCA 1CJGA 1UXCA 2PUEA 1NERA 3F51A 4MCXA 3FYAA 3SCHA 4GHJA 2PE5A 4PU7A 1JFSA 1OCTC 3GBFA 1ZZ8A 2PUGA 3OQMA 1ADRA 1RIOA 3CLCA 4YG7B 1B0NA 1LCCA 3RZZA 1YSEA 4IWRA 3QQ6A 3IVPA 3HZIB 2BNMA 1DW9A 2AXUA 3KJXA 1EFAA 1X2LA 4Z5CA 2XSDC 2PPXA 3OQOA 2XJ3A 4PU8A 1AU7A 4X4HA 3ZHMA 4I6RA 2LYRA 1POUA 3D1NI 3BD1A 1RZRA 2LYPA 4O8BA 2AXVA 3LFPA 1LLIA 3KZ3A 1CQTA 2AW6A 1UXDA 1RZSA 1WH8A 1PRVA 1PRUA 4YG1A 4I6UA 3JXCL 3MLFA 1WIZA 1ZUGA 2KEIA 1O4XA 4I8TA 4F8DA 1UTXA 2B5AA 2IVBA 2BJCA 1L1MA 1ZZCA 2AXZA 2R63A 1ZS4A 3QWGA 2O49A 3G5GA 2OR1L 2WIUB 2FJRA 1Y7YA 4X4CA 1QP4A 2LYQA 3F52A 2JCGA 4YBAA 1JWLA 4Y42A 1S7EA 2A6CA 2AUWA 2XI8A 4IVZA 1ZVVA 3PXPA 1ZZBA 4FN3A 3BS3A 4Z5DA 2O38A 1NEQA 3LISA 1IC8A 2HINA 1LQCA 3GN5A 3SCGA 4Z58A 2IV1A 3QF3A 1PNRA 4IA8A 2KZ8A 3JXDL 2ICTA 2LYLA 2KEJA 4GQMA 3GN5B 2L49A 4NDWA 1BDHA 1LMB3 2WUSR 4X4IA 3EUSA 2GRMA 1ZZ9A 3DNVB 1Y9QA 1E3OC 4JCYA 2KPJA 3B7HA 1XWRA 3H5TA 4J1WA 2MQKA 3CECA 1HF0A 2OFYA 3OP9A 5A7LA 2IU7A 3S8QA 4MCTA 3VK0A 4JQDA 2LCVA 4X4DA 1ZZ7A 2JVLA 3QYXA 3ZKCA 1RZRD 1ZZ6A 2EBYA 4X4BA 1JH9A 1PERL 2GZUA 2PUAA 2CSFA 2EF8A 2PUBA 1X57A 2AWIA 1QQAA 1R69A 3JXBC 4X4GA 2IVQA 2O4AA 4FBIA 1RPEL 2IUOA 2GRLA 3O9XA 1DWKA 1R63A 1SQ8A 3G7DA 2EWTA 4X4EA 3R1FA 3SCFA 3ZHIA 4I6TA 2PIJA 1QQBA
chains in the Genus database with same CATH superfamily
4J1XA 3OQNA 1GT0C 1PRAA 1VPWA 5JUWA 4Z5HA 2PUDA 1LCDA 2MEZA 2LLVA 4ER7A 3F6WA 3KXAA 1BDIA 1ZPQA 1QP0A 2PUCA 2KEKA 1CJGA 1UXCA 2PUEA 3TELA 1ZZ8A 3DM5A 1RIOA 4IWRA 1YSEA 3QQ6A 1X2LA 2PPXA 2AXVA 2AW6A 1RZSA 1WH8A 4I6UA 2KEIA 3MLFA 1WIZA 1ZUGA 3UWPA 1O4XA 1UTXA 3SX0A 2O49A 2OR1L 2FJRA 1DULA 4EK9A 2AUWA 3NZLA 2ODRD 4Z5DA 1IC8A 2J7UA 2IV1A 4ER0A 2KEJA 1NW3A 3GN5B 2L49A 4NDWA 1LMB3 1ZZ9A 4JCYA 2KPJA 3B7HA 1XWRA 3H5TA 3OP9A 2PXLA 4OBMA 4X4DA 1RZRD 5DSXA 1PERL 3QOWA 3QFIA 2EF8A 2PXKA 1QB2A 3O9XA 1R63A 1SQ8A 2V3CC 3GZDC 2PXPA 4I6TA 1QQBA 2J7WA 2PUFA 1WETA 2D5VA 5K98B 2LYSA 2PXUA 4YG4A 3BDNA 2CROA 3U3WA 1QZXA 2IVGA 3L1PA 1QP7A 2HSGA 1NERA 3QOXA 3CLCA 1B0NA 1LCCA 4ER3A 2PXQA 5DRTA 3GUUA 4PU8A 4X4HA 4I6RA 2LYRA 3D1NI 3BD1A 1RZRA 1CQTA 1PRVA 4YG1A 4I8TA 1L1MA 1ZZCA 1ZS4A 3QWGA 1Y7YA 2XXPA 1QP4A 2A6CA 3PE5A 3PXPA 4FN3A 1U2ZA 2O38A 1NEQA 4DE8A 3SCGA 2PXBA 3QF3A 1PNRA 3NDBB 4IA8A 2KZ8A 3JXDL 2XXAA 1BDHA 3DNVB 2MQKA 3CECA 1HF0A 5A7LA 3GZDA 2LCVA 1ZZ7A 3ZKCA 4X4BA 2EBYA 2CSFA 1QQAA 2O4AA 3KL4A 3LQXA 3M9LA 2PIJA 1ZAYA 2LYJA 2R1JL 4WVLA 1QPZA 1OSLA 4X4FA 2XCJA 1JFTA 3FYMA 2H8RA 2BNNA 3MEJA 4YARA 2BNOA 4PU4C 3CROL 3F51A 4MCXA 3FYAA 3A9ZA 4GHJA 2PE5A 4PU7A 1OCTC 3OQMA 5DRYA 3IVPA 2XJ3A 2LYPA 1LLIA 3LFPA 3KZ3A 1UXDA 3JXCL 5DTRA 2IVBA 2BJCA 2AXZA 2FFHA 3F52A 3TFLA 4YBAA 1JWLA 2XI8A 2PXDA 1ZVVA 3NXHA 1ZZBA 3BS3A 3LISA 2HINA 2LLWA 2YBDA 2ICTA 5GAHi 3EUSA 2GRMA 5GAGi 3SR4A 2IU7A 4Q2JA 3VK0A 2JVLA 3QYXA 4HRAA 1JH9A 2GZUA 3VWSA 1HQ1A 3TEPA 2AWIA 3GZCA 1R69A 3JXBC 4FBIA 2XXQA 3G7DA 3R1FA 3ME5A 4JCXA 3G0TA 2L8NA 3TRBA 4Z59A 1WH6A 4PU3C 4ER6A 2VEOA 2JQEA 3FMYA 4OB4A 2LNMA 2LYKA 3UFDA 4EKGA 2L1PA 4EZIA 2ICPA 3OMTA 2XIUA 3SCHA 1JFSA 3GBFA 2M4HA 2PUGA 1ADRA 4ER5A 4YG7B 3RZZA 3HZIB 5DTQA 2BNMA 1DW9A 2AXUA 3KJXA 1EFAA 4Z5CA 2XSDC 3OQOA 1AU7A 3ZHMA 2PXEA 1POUA 4O8BA 1PRUA 3OKZA 5DTMA 4F8DA 2HCSA 2B5AA 2PXVA 2MXDA 2R63A 3G5GA 2WIUB 4X4CA 2LYQA 2JCGA 3NROA 4Y42A 1S7EA 2PXTA 4IVZA 3A9XA 2HFZA 1LQCA 3GN5A 4Z58A 2LYLA 3OWQA 4GQMA 2WUSR 3A9YA 4X4IA 4EKIA 1Y9QA 1E3OC 2HCNA 3ZPXA 4J1WA 2OFYA 3S8QA 4MCTA 2PXFA 4JQDA 1ZZ6A 2PUAA 2PUBA 4EQZA 1X57A 4DE9A 4X4GA 2IVQA 1MFQC 1RPEL 2IUOA 2GRLA 3R09A 1DWKA 4X4EA 2EWTA 3SCFA 5DT2A 3ZHIA
chains in the Genus database with same CATH topology
4J1XA 1ZAYA 3OQNA 2PUFA 2LYJA 1GT0C 4JCXA 1PRAA 2R1JL 1WETA 2L8NA 3TRBA 4Z59A 1WH6A 4Z5HA 1OSLA 1QPZA 1VPWA 2PUDA 4X4FA 2D5VA 4PU3C 2XCJA 5K98B 2LYSA 1LCDA 1JFTA 4YG4A 3BDNA 2MEZA 2CROA 3FYMA 2H8RA 3FMYA 4OB4A 3U3WA 2BNNA 2IVGA 3F6WA 4YARA 2LYKA 3UFDA 2BNOA 3KXAA 1BDIA 1ZPQA 3L1PA 2ICPA 1QP7A 4PU4C 3CROL 3OMTA 1QP0A 2HSGA 2XIUA 2KEKA 2PUCA 1CJGA 1UXCA 2PUEA 1NERA 3F51A 4MCXA 3FYAA 3SCHA 4GHJA 2PE5A 4PU7A 1JFSA 1OCTC 3GBFA 1ZZ8A 2PUGA 3OQMA 1ADRA 1RIOA 3CLCA 4YG7B 1B0NA 1LCCA 3RZZA 1YSEA 4IWRA 3QQ6A 3IVPA 3HZIB 2BNMA 1DW9A 2AXUA 3KJXA 1EFAA 1X2LA 4Z5CA 2XSDC 2PPXA 3OQOA 2XJ3A 4PU8A 1AU7A 4X4HA 3ZHMA 4I6RA 2LYRA 1POUA 3D1NI 3BD1A 1RZRA 2LYPA 4O8BA 2AXVA 3LFPA 1LLIA 3KZ3A 1CQTA 2AW6A 1UXDA 1RZSA 1WH8A 1PRVA 1PRUA 4YG1A 4I6UA 3JXCL 3MLFA 1WIZA 1ZUGA 2KEIA 1O4XA 4I8TA 4F8DA 1UTXA 2B5AA 2IVBA 2BJCA 1L1MA 1ZZCA 2AXZA 2R63A 1ZS4A 3QWGA 2O49A 3G5GA 2OR1L 2WIUB 2FJRA 1Y7YA 4X4CA 1QP4A 2LYQA 3F52A 2JCGA 4YBAA 1JWLA 4Y42A 1S7EA 2A6CA 2AUWA 2XI8A 4IVZA 1ZVVA 3PXPA 1ZZBA 4FN3A 3BS3A 4Z5DA 2O38A 1NEQA 3LISA 1IC8A 2HINA 1LQCA 3GN5A 3SCGA 4Z58A 2IV1A 3QF3A 1PNRA 4IA8A 2KZ8A 3JXDL 2ICTA 2LYLA 2KEJA 4GQMA 3GN5B 2L49A 4NDWA 1BDHA 1LMB3 2WUSR 4X4IA 3EUSA 2GRMA 1ZZ9A 3DNVB 1Y9QA 1E3OC 4JCYA 2KPJA 3B7HA 1XWRA 3H5TA 4J1WA 2MQKA 3CECA 1HF0A 2OFYA 3OP9A 5A7LA 2IU7A 3S8QA 4MCTA 3VK0A 4JQDA 2LCVA 4X4DA 1ZZ7A 2JVLA 3QYXA 3ZKCA 1RZRD 1ZZ6A 2EBYA 4X4BA 1JH9A 1PERL 2GZUA 2PUAA 2CSFA 2EF8A 2PUBA 1X57A 2AWIA 1QQAA 1R69A 3JXBC 4X4GA 2IVQA 2O4AA 4FBIA 1RPEL 2IUOA 2GRLA 3O9XA 1DWKA 1R63A 1SQ8A 3G7DA 2EWTA 4X4EA 3R1FA 3SCFA 3ZHIA 4I6TA 2PIJA 1QQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J1X A;  1ZAY A;  3OQN A;  2PUF A;  2LYJ A;  1GT0 C;  4JCX A;  1PRA A;  2R1J L;  1WET A;  2L8N A;  3TRB A;  4Z59 A;  1WH6 A;  4Z5H A;  1OSL A;  1QPZ A;  1VPW A;  2PUD A;  4X4F A;  2D5V A;  4PU3 C;  2XCJ A;  5K98 B;  2LYS A;  1LCD A;  1JFT A;  4YG4 A;  3BDN A;  2MEZ A;  2CRO A;  3FYM A;  2H8R A;  3FMY A;  4OB4 A;  3U3W A;  2BNN A;  2IVG A;  3F6W A;  4YAR A;  2LYK A;  3UFD A;  2BNO A;  3KXA A;  1BDI A;  1ZPQ A;  3L1P A;  2ICP A;  1QP7 A;  4PU4 C;  3CRO L;  3OMT A;  1QP0 A;  2HSG A;  2XIU A;  2KEK A;  2PUC A;  1CJG A;  1UXC A;  2PUE A;  1NER A;  3F51 A;  4MCX A;  3FYA A;  3SCH A;  4GHJ A;  2PE5 A;  4PU7 A;  1JFS A;  1OCT C;  3GBF A;  1ZZ8 A;  2PUG A;  3OQM A;  1ADR A;  1RIO A;  3CLC A;  4YG7 B;  1B0N A;  1LCC A;  3RZZ A;  1YSE A;  4IWR A;  3QQ6 A;  3IVP A;  3HZI B;  2BNM A;  1DW9 A;  2AXU A;  3KJX A;  1EFA A;  1X2L A;  4Z5C A;  2XSD C;  2PPX A;  3OQO A;  2XJ3 A;  4PU8 A;  1AU7 A;  4X4H A;  3ZHM A;  4I6R A;  2LYR A;  1POU A;  3D1N I;  3BD1 A;  1RZR A;  2LYP A;  4O8B A;  2AXV A;  3LFP A;  1LLI A;  3KZ3 A;  1CQT A;  2AW6 A;  1UXD A;  1RZS A;  1WH8 A;  1PRV A;  1PRU A;  4YG1 A;  4I6U A;  3JXC L;  3MLF A;  1WIZ A;  1ZUG A;  2KEI A;  1O4X A;  4I8T A;  4F8D A;  1UTX A;  2B5A A;  2IVB A;  2BJC A;  1L1M A;  1ZZC A;  2AXZ A;  2R63 A;  1ZS4 A;  3QWG A;  2O49 A;  3G5G A;  2OR1 L;  2WIU B;  2FJR A;  1Y7Y A;  4X4C A;  1QP4 A;  2LYQ A;  3F52 A;  2JCG A;  4YBA A;  1JWL A;  4Y42 A;  1S7E A;  2A6C A;  2AUW A;  2XI8 A;  4IVZ A;  1ZVV A;  3PXP A;  1ZZB A;  4FN3 A;  3BS3 A;  4Z5D A;  2O38 A;  1NEQ A;  3LIS A;  1IC8 A;  2HIN A;  1LQC A;  3GN5 A;  3SCG A;  4Z58 A;  2IV1 A;  3QF3 A;  1PNR A;  4IA8 A;  2KZ8 A;  3JXD L;  2ICT A;  2LYL A;  2KEJ A;  4GQM A;  3GN5 B;  2L49 A;  4NDW A;  1BDH A;  1LMB 3;  2WUS R;  4X4I A;  3EUS A;  2GRM A;  1ZZ9 A;  3DNV B;  1Y9Q A;  1E3O C;  4JCY A;  2KPJ A;  3B7H A;  1XWR A;  3H5T A;  4J1W A;  2MQK A;  3CEC A;  1HF0 A;  2OFY A;  3OP9 A;  5A7L A;  2IU7 A;  3S8Q A;  4MCT A;  3VK0 A;  4JQD A;  2LCV A;  4X4D A;  1ZZ7 A;  2JVL A;  3QYX A;  3ZKC A;  1RZR D;  1ZZ6 A;  2EBY A;  4X4B A;  1JH9 A;  1PER L;  2GZU A;  2PUA A;  2CSF A;  2EF8 A;  2PUB A;  1X57 A;  2AWI A;  1QQA A;  1R69 A;  3JXB C;  4X4G A;  2IVQ A;  2O4A A;  4FBI A;  1RPE L;  2IUO A;  2GRL A;  3O9X A;  1DWK A;  1R63 A;  1SQ8 A;  3G7D A;  2EWT A;  4X4E A;  3R1F A;  3SCF A;  3ZHI A;  4I6T A;  2PIJ A;  1QQB A; 
#chains in the Genus database with same CATH topology
 4J1X A;  3OQN A;  1GT0 C;  1PRA A;  1VPW A;  5JUW A;  4Z5H A;  2PUD A;  1LCD A;  2MEZ A;  2LLV A;  4ER7 A;  3F6W A;  3KXA A;  1BDI A;  1ZPQ A;  1QP0 A;  2PUC A;  2KEK A;  1CJG A;  1UXC A;  2PUE A;  3TEL A;  1ZZ8 A;  3DM5 A;  1RIO A;  4IWR A;  1YSE A;  3QQ6 A;  1X2L A;  2PPX A;  2AXV A;  2AW6 A;  1RZS A;  1WH8 A;  4I6U A;  2KEI A;  3MLF A;  1WIZ A;  1ZUG A;  3UWP A;  1O4X A;  1UTX A;  3SX0 A;  2O49 A;  2OR1 L;  2FJR A;  1DUL A;  4EK9 A;  2AUW A;  3NZL A;  2ODR D;  4Z5D A;  1IC8 A;  2J7U A;  2IV1 A;  4ER0 A;  2KEJ A;  1NW3 A;  3GN5 B;  2L49 A;  4NDW A;  1LMB 3;  1ZZ9 A;  4JCY A;  2KPJ A;  3B7H A;  1XWR A;  3H5T A;  3OP9 A;  2PXL A;  4OBM A;  4X4D A;  1RZR D;  5DSX A;  1PER L;  3QOW A;  3QFI A;  2EF8 A;  2PXK A;  1QB2 A;  3O9X A;  1R63 A;  1SQ8 A;  2V3C C;  3GZD C;  2PXP A;  4I6T A;  1QQB A;  2J7W A;  2PUF A;  1WET A;  2D5V A;  5K98 B;  2LYS A;  2PXU A;  4YG4 A;  3BDN A;  2CRO A;  3U3W A;  1QZX A;  2IVG A;  3L1P A;  1QP7 A;  2HSG A;  1NER A;  3QOX A;  3CLC A;  1B0N A;  1LCC A;  4ER3 A;  2PXQ A;  5DRT A;  3GUU A;  4PU8 A;  4X4H A;  4I6R A;  2LYR A;  3D1N I;  3BD1 A;  1RZR A;  1CQT A;  1PRV A;  4YG1 A;  4I8T A;  1L1M A;  1ZZC A;  1ZS4 A;  3QWG A;  1Y7Y A;  2XXP A;  1QP4 A;  2A6C A;  3PE5 A;  3PXP A;  4FN3 A;  1U2Z A;  2O38 A;  1NEQ A;  4DE8 A;  3SCG A;  2PXB A;  3QF3 A;  1PNR A;  3NDB B;  4IA8 A;  2KZ8 A;  3JXD L;  2XXA A;  1BDH A;  3DNV B;  2MQK A;  3CEC A;  1HF0 A;  5A7L A;  3GZD A;  2LCV A;  1ZZ7 A;  3ZKC A;  4X4B A;  2EBY A;  2CSF A;  1QQA A;  2O4A A;  3KL4 A;  3LQX A;  3M9L A;  2PIJ A;  1ZAY A;  2LYJ A;  2R1J L;  4WVL A;  1QPZ A;  1OSL A;  4X4F A;  2XCJ A;  1JFT A;  3FYM A;  2H8R A;  2BNN A;  3MEJ A;  4YAR A;  2BNO A;  4PU4 C;  3CRO L;  3F51 A;  4MCX A;  3FYA A;  3A9Z A;  4GHJ A;  2PE5 A;  4PU7 A;  1OCT C;  3OQM A;  5DRY A;  3IVP A;  2XJ3 A;  2LYP A;  1LLI A;  3LFP A;  3KZ3 A;  1UXD A;  3JXC L;  5DTR A;  2IVB A;  2BJC A;  2AXZ A;  2FFH A;  3F52 A;  3TFL A;  4YBA A;  1JWL A;  2XI8 A;  2PXD A;  1ZVV A;  3NXH A;  1ZZB A;  3BS3 A;  3LIS A;  2HIN A;  2LLW A;  2YBD A;  2ICT A;  5GAH i;  3EUS A;  2GRM A;  5GAG i;  3SR4 A;  2IU7 A;  4Q2J A;  3VK0 A;  2JVL A;  3QYX A;  4HRA A;  1JH9 A;  2GZU A;  3VWS A;  1HQ1 A;  3TEP A;  2AWI A;  3GZC A;  1R69 A;  3JXB C;  4FBI A;  2XXQ A;  3G7D A;  3R1F A;  3ME5 A;  4JCX A;  3G0T A;  2L8N A;  3TRB A;  4Z59 A;  1WH6 A;  4PU3 C;  4ER6 A;  2VEO A;  2JQE A;  3FMY A;  4OB4 A;  2LNM A;  2LYK A;  3UFD A;  4EKG A;  2L1P A;  4EZI A;  2ICP A;  3OMT A;  2XIU A;  3SCH A;  1JFS A;  3GBF A;  2M4H A;  2PUG A;  1ADR A;  4ER5 A;  4YG7 B;  3RZZ A;  3HZI B;  5DTQ A;  2BNM A;  1DW9 A;  2AXU A;  3KJX A;  1EFA A;  4Z5C A;  2XSD C;  3OQO A;  1AU7 A;  3ZHM A;  2PXE A;  1POU A;  4O8B A;  1PRU A;  3OKZ A;  5DTM A;  4F8D A;  2HCS A;  2B5A A;  2PXV A;  2MXD A;  2R63 A;  3G5G A;  2WIU B;  4X4C A;  2LYQ A;  2JCG A;  3NRO A;  4Y42 A;  1S7E A;  2PXT A;  4IVZ A;  3A9X A;  2HFZ A;  1LQC A;  3GN5 A;  4Z58 A;  2LYL A;  3OWQ A;  4GQM A;  2WUS R;  3A9Y A;  4X4I A;  4EKI A;  1Y9Q A;  1E3O C;  2HCN A;  3ZPX A;  4J1W A;  2OFY A;  3S8Q A;  4MCT A;  2PXF A;  4JQD A;  1ZZ6 A;  2PUA A;  2PUB A;  4EQZ A;  1X57 A;  4DE9 A;  4X4G A;  2IVQ A;  1MFQ C;  1RPE L;  2IUO A;  2GRL A;  3R09 A;  1DWK A;  4X4E A;  2EWT A;  3SCF A;  5DT2 A;  3ZHI A; 
#chains in the Genus database with same CATH homology
 4J1X A;  1ZAY A;  3OQN A;  2PUF A;  2LYJ A;  1GT0 C;  4JCX A;  1PRA A;  2R1J L;  1WET A;  2L8N A;  3TRB A;  4Z59 A;  1WH6 A;  4Z5H A;  1OSL A;  1QPZ A;  1VPW A;  2PUD A;  4X4F A;  2D5V A;  4PU3 C;  2XCJ A;  5K98 B;  2LYS A;  1LCD A;  1JFT A;  4YG4 A;  3BDN A;  2MEZ A;  2CRO A;  3FYM A;  2H8R A;  3FMY A;  4OB4 A;  3U3W A;  2BNN A;  2IVG A;  3F6W A;  4YAR A;  2LYK A;  3UFD A;  2BNO A;  3KXA A;  1BDI A;  1ZPQ A;  3L1P A;  2ICP A;  1QP7 A;  4PU4 C;  3CRO L;  3OMT A;  1QP0 A;  2HSG A;  2XIU A;  2KEK A;  2PUC A;  1CJG A;  1UXC A;  2PUE A;  1NER A;  3F51 A;  4MCX A;  3FYA A;  3SCH A;  4GHJ A;  2PE5 A;  4PU7 A;  1JFS A;  1OCT C;  3GBF A;  1ZZ8 A;  2PUG A;  3OQM A;  1ADR A;  1RIO A;  3CLC A;  4YG7 B;  1B0N A;  1LCC A;  3RZZ A;  1YSE A;  4IWR A;  3QQ6 A;  3IVP A;  3HZI B;  2BNM A;  1DW9 A;  2AXU A;  3KJX A;  1EFA A;  1X2L A;  4Z5C A;  2XSD C;  2PPX A;  3OQO A;  2XJ3 A;  4PU8 A;  1AU7 A;  4X4H A;  3ZHM A;  4I6R A;  2LYR A;  1POU A;  3D1N I;  3BD1 A;  1RZR A;  2LYP A;  4O8B A;  2AXV A;  3LFP A;  1LLI A;  3KZ3 A;  1CQT A;  2AW6 A;  1UXD A;  1RZS A;  1WH8 A;  1PRV A;  1PRU A;  4YG1 A;  4I6U A;  3JXC L;  3MLF A;  1WIZ A;  1ZUG A;  2KEI A;  1O4X A;  4I8T A;  4F8D A;  1UTX A;  2B5A A;  2IVB A;  2BJC A;  1L1M A;  1ZZC A;  2AXZ A;  2R63 A;  1ZS4 A;  3QWG A;  2O49 A;  3G5G A;  2OR1 L;  2WIU B;  2FJR A;  1Y7Y A;  4X4C A;  1QP4 A;  2LYQ A;  3F52 A;  2JCG A;  4YBA A;  1JWL A;  4Y42 A;  1S7E A;  2A6C A;  2AUW A;  2XI8 A;  4IVZ A;  1ZVV A;  3PXP A;  1ZZB A;  4FN3 A;  3BS3 A;  4Z5D A;  2O38 A;  1NEQ A;  3LIS A;  1IC8 A;  2HIN A;  1LQC A;  3GN5 A;  3SCG A;  4Z58 A;  2IV1 A;  3QF3 A;  1PNR A;  4IA8 A;  2KZ8 A;  3JXD L;  2ICT A;  2LYL A;  2KEJ A;  4GQM A;  3GN5 B;  2L49 A;  4NDW A;  1BDH A;  1LMB 3;  2WUS R;  4X4I A;  3EUS A;  2GRM A;  1ZZ9 A;  3DNV B;  1Y9Q A;  1E3O C;  4JCY A;  2KPJ A;  3B7H A;  1XWR A;  3H5T A;  4J1W A;  2MQK A;  3CEC A;  1HF0 A;  2OFY A;  3OP9 A;  5A7L A;  2IU7 A;  3S8Q A;  4MCT A;  3VK0 A;  4JQD A;  2LCV A;  4X4D A;  1ZZ7 A;  2JVL A;  3QYX A;  3ZKC A;  1RZR D;  1ZZ6 A;  2EBY A;  4X4B A;  1JH9 A;  1PER L;  2GZU A;  2PUA A;  2CSF A;  2EF8 A;  2PUB A;  1X57 A;  2AWI A;  1QQA A;  1R69 A;  3JXB C;  4X4G A;  2IVQ A;  2O4A A;  4FBI A;  1RPE L;  2IUO A;  2GRL A;  3O9X A;  1DWK A;  1R63 A;  1SQ8 A;  3G7D A;  2EWT A;  4X4E A;  3R1F A;  3SCF A;  3ZHI A;  4I6T A;  2PIJ A;  1QQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...