1PS8A

Crystal structure of the r270k mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
371
structure length
357
Chain Sequence
MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNCTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVKIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of substrate-binding groups in the mechanism of aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
molecule keywords Aspartate semialdehyde dehydrogenase
total genus 110
structure length 357
sequence length 371
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1ps8A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ps8A01
3KVOA 3K31A 1YDEA 2JFGA 3H9UA 1NQOA 3BMCA 2TMDA 2OUIA 3QWIA 3JQGB 1D1TA 2EKQA 2O3RA 4PN3A 1I33A 4MVJD 1KY5A 3LLSA 4RLHA 3VTZA 1Y5MA 1IUKA 1PGPA 3RC2A 1SAYA 4NBWA 1PGNA 5L7YA 4EUFA 4RPLA 2ZJ0A 3KETA 1NQAO 3NV9A 3GF4A 4BMSA 3D5QA 1X7DA 4J9VA 1M67A 2TMGA 1HE4A 5L95A 4IM7A 1PS9A 3RBXA 2V6BA 1GCOA 3H2SA 3EVNA 2W2KA 3DHEA 2UUPA 4N7RA 5A03A 2Z1NA 3OEWA 5FI5A 3VZSA 2J3JA 2E48A 3IP1A 4O6VA 4E2ZA 4DPMA 1YKFA 1SO8A 3ZDFA 2X22A 1KVSA 1ZVMA 1A9ZA 4G2NA 4YQYA 2FPGA 1HL3A 3QWHA 5TJ9A 1I32A 4I8XA 4YJGA 3FD8A 1ID1A 4I08A 5CG2A 4FCCA 4IUYA 1A71A 5TC4A 1UP6A 1SCUA 4BHTA 3E82A 1QP8A 5F5LA 4ZHSA 4IIVA 4TKLA 1E77A 2BH9A 4AFNA 5HBRA 2GDZA 3VPGA 3LT0A 1UDBA 4G65A 4U7WA 1F14A 5GMOA 1PIWA 1Q2XA 2GUGA 1J6UA 3E48A 2W2LA 2IEDA 4BUCA 4BO2A 1R4NB 3GOHA 3G3EA 3VKVA 1D3AA 1P33A 3I6IA 3SXPA 1PZFA 2ZK7A 5EL0A 2X0NA 3PFWO 1Z7BA 4MVJF 4B4VA 4CL8A 1AHHA 4D41A 3S2EA 2B4QA 5JAIA 2J8ZA 2ZB3A 5KCZA 1QYDA 1QR6A 4ZQFA 1PGQA 4CM4B 7MDHA 5L45A 1A4UA 3AUTA 4YAIA 1P3DA 1HYGA 3OA2A 1XA0A 2X5JO 2PKRA 1ZCJA 2HJSA 3DZBA 5M6DA 3I9LA 3KLPX 1HZZA 5T73A 1UZLA 2XXBA 1HDXA 1EUCA 1V8BA 3KB6A 3COSA 1KVUA 1JA9A 1PL6A 4DIOA 4YT4A 3WFJA 4RF5A 4E30A 3EHEA 3PWSA 1SB9A 1T1SA 1ISGA 4N5NA 2DTEA 4A73A 2WMDA 1CETA 1K5HA 3CUKA 1XU9A 1DRWA 4R51A 4ALMA 1U1IA 3DZIA 3F46A 4ZQBA 3LF1A 5F21A 3BMQA 3ZWBA 1BVUA 5KTKA 3HFSA 1BW9B 5MGBA 4YJHA 5EIOA 1O5IA 5BR7A 2J3KA 3TNLA 3GVPA 3TRIA 5TX7A 1F06A 1EUDA 5DZSA 1WPQA 4ZICA 3PJFA 4PG8A 2HJRA 2JJYA 4J0EA 4E12A 1P1RA 1HDOA 3G79A 4PG5A 1H2HA 4MDHA 4CQMB 3GPIA 2WD8A 5DULA 5GZ3A 2VN8A 2NVUB 4BQPA 1HETA 3FPCA 3DMYA 5A3VA 2H1SA 2YQ5A 5AQ1A 4J0FA 1B26A 4QTZA 1PQPA 3KUXA 4M49A 1B2LA 2Q4BA 3JYOA 3JQAA 5DBIA 1UZNA 1Y8RB 2POQX 4FR5A 4PLCA 1PWXA 2YQ4A 2WSBA 4HV4A 1E1MA 1SOWA 2GN4A 3HDQA 4J3FA 5HM8A 1DSSG 1LRJA 2HSDA 3GLQA 4AG3A 5JCJD 1D8AA 1Z82A 3KSZO 3B70A 4IQGA 3LT4A 4ZQEA 3HSKA 4NBVA 1NWCA 4YAGA 4NFSA 4XWYA 5IFLA 5JCJA 4E5NA 4E0BA 1XQ1A 3QVOA 3TOXA 3MOIA 1GZ3A 3H6KA 4CLRA 3GG9A 2G0TA 3HUDA 4F45A 3PXXA 4KTVE 2QHXA 3U4CA 4Y6SA 1G1AA 5IDXA 4U0KA 2DBQA 4ALNA 5JAZA 3NDRA 4E6PA 1EBUA 1HYHA 1O9BA 3JQ8A 3QIVA 4RVSA 4IDDA 1HLDA 4BO9A 3JQ9C 1WLYA 3A28A 4CMEC 5TS3A 4YPOA 3ROQA 4ESOA 1W6UA 3PJEA 3LU1A 5THQA 3EDMA 4GWKA 4B3IA 4TZTA 4HNGA 4B3JA 3VZPA 4F46A 3OM9A 4XIJA 3GZNA 3Q9NA 1XELA 3OP4A 3ETGA 1U2GA 1BMDA 1N7GA 1PJLA 4LVCA 2HRZA 3NT5A 4ND4A 4OQZA 4ALJA 3GRPA 1DIBA 4ALKA 4E2WA 1E1LA 4O59O 2O4CA 3SLGA 2I67A 4OHUA 3L6DA 3X2EA 2QG4A 3FF4A 5CPBA 1HSZA 1GZ4A 2JKVA 1QSGA 1QRRA 4OOEA 1GEEA 1K2WA 4OJNA 1SPXA 1OZAA 4G5HA 3K2BA 3UFXA 3A06A 4LCJA 1PS8A 3RAJA 2BI8A 3FPLA 1F8FA 1PR9A 3BTOA 2Q22A 1ZK0A 1HRDA 1LBEA 1TA4A 1X1EA 4NBRA 1EDOA 3KM0A 5T67A 3ZHYA 4MP6A 3I23A 2B69A 4WOKA 4YBZA 2VUSA 1M75A 2DTXA 1UXGA 2PD3A 3JD4A 4GX5A 4KTTE 1W4ZA 5GZ1A 1LRKA 2NADA 1EUZA 3AI3A 1IE3A 3GGOA 4TROA 2Y1DA 2HK9A 5IZCC 1IYZA 1DB3A 3GN2A 1ZK2A 3E6AA 3WMXA 4WUVA 4WJZA 1AXGA 1UP7A 4CMGA 4CM1A 1E3EA 2Q2QA 1YXMA 1SNYA 2WJPA 2C82A 3TZKA 4BL5A 4J1NA 2NU6A 4LW8A 3QJ5A 1ZMTA 4RZHA 2RHRA 4LISA 1B8UA 1O95A 4GVXA 4CPDA 1R6DA 4PLVA 4QO7A 3TJRA 4BNJA 3TF5A 2IYPA 5BSGA 3WYBA 4C4OA 5TLSA 3PIIA 4J4TA 4QEDA 4RVGA 1RYEA 1NVGA 3RU7A 5T6BA 2BLLA 4L73A 2J3HA 4MVJI 1ENYA 3PJDA 1GYRA 1K6XA 3AK4A 3TZQA 3W1VA 3RBZA 4HWKA 4D0SA 1MFZA 5A04A 2O4UX 4IS2A 2EKPA 4FD3A 3ROPA 1MB4A 5A9SA 4TVOA 4R16A 3LC7O 3ZWYA 5KWEA 1E3IA 2W2LD 3OJFA 1CRWG 5JO9A 2E82A 3L9WA 4BGEA 3KXDA 3NGLA 3T4XA 3U4IA 2CD9A 3KO8A 4RVFA 4BKUA 4CQLB 1VKNA 1LLQA 1ZW1A 2O3SA 1I24A 5HS4A 5EINA 4RORA 3JCZA 4DLBA 4R54A 2J5QA 1X0XA 3LC1O 1JW9B 5COQA 2VHYA 1Q7BA 3JYPA 3OMLA 4B8ZA 1T4DA 4LGVA 4PLHA 4XX0A 1NPTO 4F6CA 3ZCXA 1JAXA 1TT5B 1UDAA 5IN5A 4WLOA 1NR1A 3U62A 3DOJA 4II2A 3RASA 1E1NA 3GRKA 4HXYA 2VWHA 2EEZA 4IPTA 2Z1MA 4TZKA 4OAQA 5CPFA 3H2ZA 2JHGA 2OBYA 4J7UA 3VH4A 3KRTA 2B83A 4L76A 5AVOA 4YB8A 5C7IO 2O7SA 1LUAA 2JD1A 5JYDA 5KKCA 4FW8A 4H15A 4UVIA 3UCFA 2YYYA 3HE3A 1BW9A 1C14A 3DZHA 2VZ8A 3R3SA 3C1TA 5TT0A 1Y5RA 4BNZA 2C54A 2LDBA 1P9LA 3M6IA 5JNLA 3JD2A 2GR9A 5KJEA 1NNUA 3I1JA 4Y8VA 2YHIB 4JQCA 3PRJA 4UUMA 4MIOA 3NKLA 4QECA 1PSDA 4Q3DA 1M6WA 3SC6A 1U28A 3WOHA 1H6BA 2ZIZA 3DMTC 3GDOA 3K73O 1KIFA 3MJVA 4WECA 1Y9AA 1ZEJA 4UREA 5H81A 2ZB4A 2NQ8A 3KSDO 5I7SA 2B5WA 1ZK4A 1DAOA 4CLXA 2FR8A 3RUDA 5DN9A 3V2UA 2UDPA 4BKQA 4WCFA 4YAKA 1YH3A 1J5PA 3GNTA 5F5NA 4J90A 1DLJA 3H5NA 1WP4A 3FSRA 4Q3EA 1LDBA 2BFOA 4F3YA 2ZCVA 3F5SA 1YBVA 1XYGA 3OJEA 3DBLA 4IJUA 4GLOA 3RUEA 3V1TC 1U7HA 3MOGA 4U5QA 1ZSYA 3ZWAA 4LRTB 3OA0A 1PZHA 2OP1A 5FWNA 4E3ZA 3VDQA 4E5YA 2QYSA 1ZMOA 3PPIA 4IZHA 3W8DA 1U3UA 3PHHA 4GH5A 1GV0A 1WZIA 4DA9A 1EQUA 4FS3A 4L4SA 5ICMA 4JNKA 3WBBA 5L9AA 1QXSA 2FSSA 1TB4A 1N2SA 1ZNQO 5IG2A 1O94A 2NQTA 1KC1A 2AMFA 2Y66A 3HDYA 1MG5A 5JYFA 4YQZA 1YVEI 4EJ0A 1WW8A 3C7AA 2ILTA 3MZ0A 1ZBQA 4BO7A 2NLOA 3B20A 3DONA 3PHLA 3S2GA 1UZMA 4NK5A 4QXMA 1JKFA 4FIZA 1GU7A 3PYLA 4MVJM 3HZZA 4DWVA 2VNSA 4GX1A 4CLHA 2Q2VA 4DVJA 4CM9A 3ZU2A 3V1YA 4RDHA 1YJQA 1LLUA 4IY1A 3CH6A 3DWFA 4Y9DA 2AEMA 1UAGA 3BXXA 3IKVA 2E6UX 3F1KA 2WYVA 2HK8A 4NI5A 3PEFA 1GADO 4PG6A 3P2OA 4CQMA 2H6EA 1PJQA 2VZ9A 4ZA2A 1PJTA 1WMBA 1QV7A 3W8EA 1DJQA 1N8KA 2A92A 1M66A 4K28A 3U9LA 5JMWA 2BGKA 4O63O 2WEKA 4CV2A 1A4IA 4BMNA 4DRYA 4HBGA 4ZN6A 4E31A 4FFRA 4PLWA 1IZ9A 3E18A 1H2BA 2I6TA 3JV7A 1YQGA 2C59A 1PZEA 4EITA 3CIFA 4OXNA 3H9GA 3LQFA 2HMTA 1ZFNA 2I3AA 2DBRA 1M6HA 1JKIA 1YL5A 4R3WA 3PQEA 3I9JA 5C37A 1EE9A 1M2WA 1VL6A 2FMUA 3FWNA 1BRMA 4CMJA 1BTOA 3ZU4A 5A9RA 5K0ZA 4ND5A 3ZNNA 3PVZA 2D2IA 4P8RA 2BFAA 4LRSB 3NYWA 5KJ1A 1UXKA 1Z75A 3C7CB 1HDRA 1XU7A 1ZUD1 3O8QB 2GCGA 5C3MA 1ONPA 4UVDA 4GMGA 3ZWPA 1HE2A 2QX7A 3IS3A 3BMQB 3JQ6A 1O6ZA 2VT3A 4CM9D 3IJPA 1E6WA 5JW6A 1OMOA 3S2FA 4L4RA 6ADHA 4PGFA 2OP0A 4BO6A 2X5KO 4TRRA 1C1XA 1RM5A 4RQTA 3U4DA 3TFQA 3WWYA 4EYEA 2CMDA 3Q2IA 1U5CA 4KUHA 1OAAA 4GAEA 4WEQA 4YACA 4GKBA 3DZKA 3EK2A 4ZVVA 1A7AA 1NWHA 1GQ2A 4ZRNA 4BKOA 2D0IA 1GDHA 1V35A 4JXKA 3I4CA 5C5IA 1QG6A 5KVVA 3OIFA 2B37A 1GR0A 4AJ4A 5TT1A 3I5MA 4OXYA 3RIHA 3W6UA 4XRRA 1IHXA 3VH3A 5ILGA 3P7MA 4GWGA 2PGJA 2EP7A 4PZCA 4B7XA 3EYWA 3GVIA 4WLVA 1KYQA 4L0QA 1KETA 3E9MA 1G0OA 4Z9XA 4DC0A 4GL4A 3NTOA 4XEHA 5JY1A 4WCFB 1VPDA 1I2ZA 1E3WA 2C7VA 1I30A 1WVGA 3ZWMA 3GVHA 4XB2A 2P9CA 4W6ZA 4BIIA 1HDCA 4XQCA 1NFRA 2CVOA 2G76A 5HA5A 2PY6A 1XKQA 3F5QA 1X14A 2FOIA 3NJ4A 2IZ1A 1B3RA 4O1MA 1EBFA 4NHEA 1JQBA 3B6ZA 1ENPA 1HDYA 2GGSA 3WIEA 2PH5A 3KSUA 1KVTA 1PEDA 3DBRB 1T2DA 1Q1NA 3ZNPA 3ZW9A 3STHA 1DIAA 3DL2A 4J1SA 2Y0EA 1I2BA 3EZYA 3U4HA 2YDXA 3E9QA 3CXRA 2YDYA 3OQ6A 1YS4A 3VDRA 3GEDA 3KLMX 4L9RA 2EF1A 3FNFA 3JQ7B 4YCAA 4Z9YA 1PGJA 3GT0A 2UYYA 2VWPA 1ML3A 1I3MA 4R3NA 3AY6A 3CZRA 1DRVA 1JDJA 3O4RA 5CP8A 4A26A 2X1HA 1UP4A 4PG7A 1SB8A 1NR7A 3GAFA 3R1IA 1YRLA 2VRCD 1B14A 1LI4A 4FGWA 3PHIA 1HF3A 3TZHA 4CM6A 5B4TA 1LDYA 3PFFA 3PK0A 3V2GA 3DZFA 1HKUA 3ENNA 4B7CA 2BKAA 5I7FA 1DIRA 2VWQA 4YWJA 4R68A 5JC8A 2Q49A 5AYVA 3D3WB 3RC7A 4FFNA 1O8CA 2YZ7A 1CF2O 1V0JA 4CMAA 4IQ8A 1SC6A 2R6JA 3WSVA 3ZZNA 1VRWA 3AM4A 4LCEA 3TPCA 1YO6A 1LRLA 3O9ZA 4FC7A 2DBVO 3WNVA 1MA0A 5A02A 3GMDA 3NEPX 2BF7A 1NM5A 3WB9A 2AQKA 2HMSA 2HO5A 1GTMA 4OMUA 1NBOA 3VKUA 3S8MA 5G0TA 5JC1A 2ET6A 2CSUA 1NPYA 4D0RA 3IQDB 4MKZA 1MFPA 2VCYA 4FFOA 5L3ZA 3UICA 4YDRA 3BTUA 3ADOA 4E21A 5B12A 3IP3A 2GNAA 4JJFA 4BB5A 5FFFA 3H3JA 4XYLA 3ZV3A 3ZV4A 1Q7CA 4FGSA 4Y6PA 1H6CA 1VSVA 1U5AA 2I99A 4OQYA 5AXBA 3TSCA 5A5FA 4YEDA 1LJ8A 2Z5LA 3M2PA 1YQXA 1GQQA 4MIYA 1V9LA 2A35A 1K3TA 1HYEA 2DKNA 2PA3A 2CZCA 1L7EA 4A7PA 1WAMA 1Z74A 4P4GA 1ORRA 4JN6B 5ENVA 4YT8A 5J23A 3O03A 4I5GA 2P2SA 3K6JA 4CODB 3F3SA 1WDLA 2QRKA 3JYQA 3FHLA 2BI7A 1DRUA 4YRAA 4IMRA 3LSYA 1I8TA 3NTQA 1N9GB 4BNXA 5C7LO 5ADHA 2J5RA 3ZHZA 3NT4A 4XZ3A 2GZ3A 4GBJA 5G4KA 4H7PA 3IMFA 3ETDA 5AOVA 1KVRA 1MUUA 2PKQO 4KUEA 2CVQA 4WLUA 1C0KA 1C1XB 3AM5A 4GVLA 4LN1A 5IF3A 3WIDA 4ROSA 4XDZA 2IDZA 2E49A 4K9DA 4J4BA 1IPFA 4KWHA 4YAEA 5U9CA 1JAYA 1MG0A 3IKTA 4I9UA 4XJTA 1UJMA 3Q6IA 3QY9A 4KP7A 3WGYA 2E37A 4DTIA 4W4TA 4AJLA 5I8ZA 2GN6A 1GEGA 4ZJUA 3AW9A 4AJOA 1GZ6A 3FN4A 1N1EA 2H9IA 2VRBA 2DBZA 2XAAA 3AFMA 1YDWA 4NQZA 4IMPA 3JQBC 1KEUA 1YBMA 3DB2A 2FY8A 4R69A 5ITVA 4JJIA 2P4QA 4PRKA 3ZI0A 1CJCA 2YV1A 1U4SA 2A4KA 4HNHA 5A05A 2AG5A 4J2HA 3WGOA 4J2OA 4TRJA 4D7AA 1FDVA 1GUYA 1VC2A 3MCVA 5KJ6A 2Y1GA 3VVBA 4R4JA 5L51A 1U7TA 1P77A 2X0RA 1RM0A 4XD2A 4BO1A 4E5KA 1Y8RA 3QSGA 3BMNB 1SEPA 1I0ZA 1EZ4A 1Y9EA 3DAFA 1NAIA 4XJSA 1PJ2A 4UEOA 4CMBA 5I9MA 1DC6A 1ISJA 4LMPA 1WMAA 2VWGA 2VUTA 3RC1A 4NFYA 1C0IA 1DIHA 4FFLA 3HN2A 1E7RA 4CUKA 1UAYA 3I52A 3INTA 3HFGA 2XF8A 3SBOA 4IDBA 3RI3A 5LDHA 1LLCA 3KEQA 4BO4A 2YY7A 4CMIB 1ZH8A 4Q3CA 2OOSA 1R12A 3HN7A 4RDIA 4BGIA 3RFXA 4XQGA 3P19A 3L4BC 2LDXA 1GUFA 1I3NA 3W6ZA 3MJEA 1B15A 1H5QA 4PFJA 3A1NA 5H83A 4DQUA 3EVTA 4GLLA 2BFMA 1GFSA 1JVSA 2O2SA 3Q2KA 1F8GA 2AW5A 3RUFA 4CLOB 2C2XA 2Y99A 3KV3O 1JWAB 1R0SA 2NM0A 4GSKA 1DC5A 1LEHA 1FMCA 3WQSB 1NXQA 4RPGA 4GX0A 4NH4A 3ZH2A 3DBLB 2EW8A 2PNFA 3GHHA 1XR3A 2CFCA 3KHUA 3AI1A 4ITUA 3TWOA 3OF2A 4BNYA 3WICA 3E5MA 3R3JA 3IAHA 3K2EA 4U0JA 3DTTA 5JS6A 4FN4A 1XSEA 4I5EA 4HADA 4J6FA 2F00A 1BWSA 3GR6A 3L07A 3I9MA 9LDTA 5I9NA 2G82A 1FDTA 3DAPA 4PLGA 1B0AA 3GNQA 2GN8A 3K92A 4JP3A 1U4OA 4QFDA 3H5RA 3HG7A 2P9EA 1R0LA 1U2DA 2AEFA 1R66A 3F4LA 2EERA 1B3BA 3DOCA 4GGOA 4BO3A 5TRTA 1MXHA 3ZWCA 5IAAA 2X7HA 3NAQA 3WTCA 3WGHA 2OO5A 3ICPA 4R41A 3LC2O 2O3JA 2DUWA 1GL3A 2X9VA 5CDGA 3CEAA 3BMOA 4JBIA 3LF2A 1I10A 3H3FA 1U3TA 2NTVA 4NJMB 4ZQGA 1UDCA 4AJIA 1HXHA 5BSEA 2FSVA 4A5OA 4PVCA 1B7GO 4WCFC 1E92A 3EMKA 2DPGA 4MVJE 3FBTA 4HFRA 2P4HX 4GGPA 5DOVA 4XR9A 4R1SA 3I9KA 3ZHBA 1P31A 1NYTA 3D3WA 3H8VA 1KEPA 5IXYA 3TDKA 4QSMA 4XIYA 3SJ7A 3EAGA 3WMWA 2DFDA 1YOVB 4M54A 5A1TA 3Q11A 1ZO8A 4YJHB 1P1JA 2W90A 1DAPA 1NX6A 3TZ6A 4JBHA 2Y67A 2ZQYA 1WDKA 3FR8A 3GVCA 5EMHA 3OICA 4GX2A 3GY0A 2CY0A 2VTDA 3G0OA 1ADGA 1ZK3A 1DIGA 1PGOA 2JAPA 1BG6A 1VL0A 2BFPA 4FDAA 4IGEA 3ANLA 2C0CA 4BO5A 3B1FA 3PHGA 5KOIA 4DQXA 4TMFA 7ADHA 3JQBA 3FBGA 4OOFA 4NJMA 4B8WA 1XHLA 5TNXA 2W4QA 4EW6A 3C3XA 4GMFA 3I4FA 3K5PA 1V3UA 1YQDA 1EVJA 3LLVA 1U3VA 4MVJP 2BD0A 4M1QA 1GPJA 2V6FA 3JYLA 1T2EA 1E1KA 2ZATA 4MP8A 4UUPA 5AXAA 3MJTA 1UXJA 5G4LA 1A7KA 4TVBA 3PWKA 3DQPA 4YVFA 1IPEA 2Y1CA 3VVCA 3GUYA 4ND2A 4WNCA 1TLTA 3AU9A 3PQFA 3E5RA 3ZNQA 2NVBA 3QLJA 5TF4A 1NFQA 4WGGA 5FI3A 5TJHA 2PZJA 4RV9A 1E3SA 4CL3A 2SCUA 5DDIP 2WYWA 4INAA 2YFHA 1GCUA 3BHMA 2GERA 5BNIA 1E7QA 4OM8A 3WJ7A 3WGIA 2O7QA 1KVQA 4RPKA 1FDSA 1E7MA 4WKGA 2P5UA 4HX5A 4YT2A 2YV2A 4AJPA 3TOZA 4ILKA 2ZYAA 4TSKA 1DHTA 2I5PO 4ALIA 3QA9A 1OOEA 3CINA 4AVYA 4RF3A 5HWSA 1ADCA 4DPLA 3O26A 2VYVA 4QFCA 3QWBA 2PD6A 1LQTA 4Z6KA 1CDOA 3OQ1A 5ER9A 1SMKA 4EUHA 5IDYA 5T8KC 1DHRA 4BS9A 3IDSA 2P9GA 1RWBA 2D1YA 1CQIA 2FR1A 3P2YA 3ABIA 3HB5X 1LSJA 5I9LA 1J49A 3H9QA 4MKRA 5BSHA 2AHRA 3MTGA 4R9RA 2GO1A 5ILOA 4YAJA 2X6TA 4Q3AA 3QV1A 3N7UA 1W73A 3R6DA 4NFHA 3S1LA 4F6LA 3AOGA 2HDHA 3MJCA 4BVAA 5A3JA 2NTJA 2OZPA 3GZNB 3LVFO 2BMAA 3UHAA 3P5SA 2EHDA 2G17A 4Z0HO 1JKJA 4KDEA 2GPTA 4JJGA 4XGKA 2Q1UA 3KTDA 2FR0A 3JQ8B 4Q3NA 4ONEA 1NQ5A 3IOYA 3WSWA 2A9FA 1BXGA 3H7AA 4XYBA 2PGLA 2CNBA 4BNMA 2IODA 3L6EA 1RM4A 2EGGA 3FNEA 3UF0A 1KERA 3CE6A 1PR3A 4FB5A 3BZUA 2AQHA 1YL6A 2DC1A 4GQAA 3UOGA 1M76A 4BO8A 3DOOA 1HDGO 2VTEA 3ZU3A 1XCBA 3I9NA 4U8GA 3GUCA 4NZ9A 3ONEA 3OFSA 3AWDA 4U6QA 1UR5A 1U8FO 2YHUA 1MX3A 4BOYA 2HLPA 2VNAA 1T1RA 2FP4A 3RVDA 3JSAA 3L0DA 5CDYA 2GN9A 5L4NA 4E5MA 2VOJA 4DUPA 4NDNE 2P5YA 4CR8A 4XB1A 4IQ0A 1DOHA 4HUJA 3HNPA 2UUOA 2ZB8A 3VHRA 1GAEO 4L74A 4OKNA 4D44A 4PLFA 1GY8A 4PZEA 4YJGB 3ROKA 2JAHA 4PLTA 3F4BA 1E0DA 4B3HA 4D46A 4OIMA 3CPSA 2O2YA 3KYDA 1AUPA 1PS0A 5KVSA 1F0YA 2FN7A 2JFFA 1Z7EA 2X86A 3CMMA 4W7IA 4BO0A 1IZ0A 1NHWA 5L4SA 1N5DA 3PDJA 4W9NC 5CEEA 4I5DA 1L1FA 3ORFA 1ZK1A 4PCVA 4NG5A 1H0KA 2X5OA 4ND3A 1NFFA 3OEYA 5A9SB 4QX6A 4IZIA 4CJXA 1HEUA 4B4WA 1K6JA 3W4IA 1DO8A 1A27A 1NHGA 2CDCA 2O48X 1B8PA 4BNVA 1IY8A 4TQGA 4A2CA 3OETA 3AOEC 9LDBA 2Y68A 1P45A 4BNUA 3NT2A 1VL8A 1PQWA 3QP9A 4QT0A 2Y0DA 2EJVA 1X7GA 2JHFA 5F1KA 1YBAA 3JQFC 2HMUA 3BMOB 3U5TA 3RROA 2VRCA 5IN4A 3C1AA 4KUGA 3KEOA 1XDWA 5EERA 3HDHA 4UVEA 4WCDA 4CM4A 3ZV5A 4FPXA 2VOEA 1Y8QA 3A14A 1FF9A 4MPDA 4DREA 1Z73A 1XGKA 1Q7GA 3TQHA 2AQ8A 2FHSA 2H5LA 3G1UA 4WASA 1VJ1A 4YA6A 5B4VA 1H94A 4DLLA 3VZRA 4J1QA 4PG4A 2I65A 4EI2A 4IJWA 5MDHA 4WPGA 1FDWA 1ZKMA 1LDGA 1AXEA 4N5MA 2X9NA 5JLAA 3T4EA 4BB6A 4UVGA 5A5EA 1LDEA 1UXHA 5CHEA 3VAZA 3RBVA 2HAEA 4AJKA 2RBEA 2ZTUA 3FNHA 4BNKA 1R37A 4DGSA 2BELA 3G1TA 4OL9A 5T64A 2AEJA 2EP5A 1F17A 1F12A 2O3UA 4R01A 1LC3A 3GEGA 4PLYA 3PZBA 1CYDA 4A0SA 4ZGWA 5JDIC 1V3VA 4NBUA 1KY4A 5IJZA 3INGA 1RKXA 3LT2A 4WLNA 4Z3KA 1GYQA 1IB6A 2O50A 2OHXA 3ON5A 1H6DA 4J43A 3FI9A 1T25A 1JU9A 1TT5A 3AY7A 3BA1A 5T57A 1P1IA 3D4NA 3QWAA 1DC4A 3HHPA 3BTSA 1ULUA 3C85A 3ASUA 2B35A 3WYEA 3GEMA 1E6UA 4RQUA 1OFGA 4GPD1 4MP3A 1VJ0A 1X15A 4HP8A 1J4AA 4WNIA 3QW2A 4AJJA 2Y05A 3G17A 2WYUA 4YJFA 3CKYA 4BGUA 1AE1A 1DFHA 1D1SA 2CF5A 4WLFA 3ZW8A 1AGNA 3PWZA 5H82A 4C7JA 5JSFA 3RKRA 3RUCA 2P91A 4FJ1A 4CUZA 2IXBA 1LTHR 3FRJA 3UW3A 4R1NA 4HFJA 5DCUA 3Q0EA 4E32A 1U8XX 3I83A 2J6IA 2DU8A 2B4RO 4E5PA 4P4LA 1VLLA 2PWZA 4O0LA 1Q0QA 5A9TA 3C24A 4NBTA 1LSOA 2AA3A 2CUKA 3ZWWA 4H3VA 5AXDA 4NJOA 4KOAA 1R0KA 5EN4A 3SX2A 2R2GA 4ID9A 3TFOA 2DPHA 3I3OA 4FFPA 1P0CA 2WE7A 3GFBA 5CFZA 3LK7A 4WLEA 4CV3A 3JQ9A 1TEHA 2WDZA 5FYDA 3O38A 1ENOA 2VYVD 1TT7A 3MJ4A 4TRNA 4WE3A 5G0SA 4CUJA 2QZ9A 3FWZA 3GC6A 5HTOA 3DHNA 1DC3A 3F47A 3VPFA 3GMSA 3QQPA 4OGWA 3ZGYA 4YXFA 3I9OA 3WQQA 4O5OA 3GGPA 1S7CA 3HWRA 1MLDA 5JDCA 2FZEA 3K9QO 1E5LA 1NPDA 1OC4A 3OJLA 3UXYA 3WGTA 2DM6A 3MTJA 3DHYA 2Q46A 2EW2A 1AN9A 4JX8A 1DEHA 3NDJA 3IJRA 3W8FA 5K6AA 5JXWA 1VI2A 3RKUA 1EVYA 2PKQP 1Z6ZA 3CTMA 2G1UA 3KYCB 3AI2A 2A94A 3JD3A 2C7GA 3LT1A 1FK8A 2EGHA 3S55A 4M86A 1OBFO 3AJRA 4HFNA 5T5QA 1PJCA 1KC3A 4Q3BA 2C5AA 4IINA 4DMMA 2BRUA 2X0IA 3D64A 4EEXA 4CMCA 4HY3A 1YJ8A 1Q0HA 2Q2WA 4MOWA 3MWEB 3E9NA 2W8ZA 5G0WA 3EUWA 2RH4A 3JTMA 4ALLA 1MV8A 2HMWA 3LDHA 4DBVO 4JGBA 1PX0A 1W0CA 3BHJA 4JK3A 4BV9A 3ONFA 4Z9FA 1HDZA 3HQ4O 2AE1A 2DAPA 5A4DA 3TL2A 5KVCA 4D42A 2R00C 8LDHA 1BSVA 4AJHA 2H63A 1X7HA 3WFIA 5F1PA 2VT2A 2V65A 5JO0A 3OQBA 3PLNA 4P22A 1W8DA 1DPGA 3V2HA 1V6AA 1E7WA 1ZEMA 2EG9A 4P4NA 2X58A 3EW7A 5HRUA 1Y8QB 1BGVA 4N18A 1UH5A 1T2AA 1ZSNA 3TL3A 3T7EA 1HT0A 1DJNA 2QW8A 3MEQA 4XGNA 3ZWVA 1YWGO 1ADFA 1KEWA 3OH8A 5JE8A 3DBRA 2I9PA 5CDTA 4FJ0A 4TKMA 3JQAD 4JLWA 2ZB7A 1BXKA 1RYDA 1I01A 3ENKA 4LSWA 4NIMA 3U49A 4AJ1A 3GDFA 4B79A 5JDIA 3L6OO 1DFGA 1LSUA 1Z45A 2B5VA 4TWRA 4UEKA 5EJ2A 3DR3A 4UUOA 3RU9A 3D7LA 4KMSA 4KDFA 1CERA 3GHYA 4EBFA 2O3TA 1DLIA 2Z95A 3WDSA 3DBHB 4B4UA 1G6KA 2NVUA 5TSDA 4DC1A 3SC4A 3PDUA 4IDCA 2C29D 2JCVA 4IS3A 1NVTA 4Z0PA 4I9HA 1PQUA 4DPKA 3LYLA 2NVWA 2DUUA 2RIRA 2VHWA 4BNWA 3HDJA 1ZIDA 4GSLA 2HCTA 3BMNA 1ISFA 2W2KB 4CMHA 4Q9NA 1TXGA 2ZTMA 4D45A 2AG8A 3VOSA 4ZQHA 2VHVA 4LK3A 3JQGA 4N54A 2I3GA 1T24A 3KBOA 3SEFA 3NJ8A 3VH2A 3QVSA 1A5ZA 4P38A 4BGVA 2GYYA 4J4HA 4M87A 2NV6A 5BNTA 3GK3A 1JTVA 5IXSA 3JYNA 3RUAA 1E3JA 5IZ4A 1WNTA 2I76A 4IIUA 1QLHA 4YJFB 5COAA 5B1YA 1XLTA 4IJVA 1YGYA 3IL2A 1PJ4A 2Q99A 1H9BA 3UN1A 3M2TA 2UV8A 4YYZA 4CM8B 4EEZA 5AXCA 2FWMX 4A27A 2QRJA 3GNSA 2HQ1A 3ZN2A 3AM3A 2R00A 2YV3A 4DIBA 2NU8A 2RCYA 5DP1A 3G49A 1SOVA 1YB4A 4JCOA 4RF2A 3U0BA 3IUPA 3UCXA 4FOSA 3WGZA 1EMDA 3A9WA 5TGDA 5CEFA 1QMGA 1DXYA 4S1VA 1I3KA 1P44A 5CG1A 3BIOA 3WBFA 3PI7A 2BGMA 1N9GA 2AQIA 3ETEA 4K6FA 1N92A 4R5HA 4PLZA 3U3XA 5DBGA 2C07A 2GF2A 1VM6A 2QQ5A 1CQJA 5EPOA 5G4KB 3RC9A 2NACA 3OSUA 4K26A 1LSSA 1E7YA 4RL6A 1X13A 3PGXA 4II3A 1P74A 4BMVA 1K6IA 4ZRMA 1QORA 2EIHA 2JCYA 4M55A 3ZV6A 5KVQA 3MJSA 1X0VA 5L7TA 5BNFA 3ZU5A 4CR7A 3AUUA 1U9JA 1R4NA 1HSOA 4ND1A 4OSPA 4YR9A 1XWFA 3HADA 4MVJG 4ZD6A 4NMHA 2Q1WA 4IDAA 3MWDB 3DFUA 4EJMA 3H9EO 4MINA 4LMRA 1ISMA 5JCXA 2V6GA 3EC7A 2CVZA 4K6CA 5LC1A 1ZJZA 1B8VA 1K89A 4BNIA 3DFZA 4J1TA 1PU2A 2WE8A 4Q39A 3RFTA 5I8WA 3VZQA 3WNQA 4BNHA 2IYOA 1Y1PA 1DDOA 1ZSVA 5ER6A 1C0PA 4CM7A 4DMLA 1HZJA 1NQTA 3AUSA 3UVEA 4EGFA 4CQLA 2Q1TA 1WDMA 2DT5A 4RVUA 3ZWXA 2HU2A 2D4AA 4AJNA 2W98A 1YL7A 5JYEA 2NU9A 4NR0A 3TZCA 3WTBA 3VPXA 1P1KA 4J7CA 5U4QA 2D5AA 3C8MA 5I7VA 2X4GA 1AHIA 4R1UA 1ULSA 5FEUA 2NU7A 1MXFA 5ENDA 3DO5A 4XA8A 1IL0A 2CDBA 2Y1FA 3PYXA 2IRWA 2V6MA 4H16A 1LLDA 3UGKA 3GQVA 5L4LA 1LXCA 2PK3A 3HB4X 5GZ6A 2WD7B 2FPIA 4WOJA 3ULKA 3K96A 3DBHA 2PLAA 1L7DA 1HWYA 1Y7TA 3UKOA 3AFNA 3WWZA 3RUHA 1ONOA 4L4XA 4EUEA 1P1FA 4UAGA 5ICSA 1T26A 3C1OA 3QRWA 2OXIA 2XXJA 3JQFA 4D3SA 1X1TA 2JL1A 3OBBA 5FF9A 4HFMA 2VYNA 2NWQA 4B4OA 2PFGA 3N58A 5I7EA 3RWBA 3JD1A 5G2OA 3ROMA 2IZ0A 5JAMA 3EY4A 4JROA 1KOLA 1IOLA 3RSHA 5DBFA 4BNGA 3NUGA 3KYBA 2Y1EA 3OJ0A 1DFIA 4OXKA 1BHSA 3GFGA 4RLSA 3D4PA 3ITKA 1RPNA 2G5CA 2X9GA 2BHLA 2DFVA 2F1KA 5DF1A 2EJWA 5EQDA 1GPDG 1GQYA 4CMIA 1LC0A 3GA0A 4CMKA 5L53A 5JMPA 1QYWA 1BVRA 4IDGA 3CZMA 1R4MB 4CLEA 2WWRA 2V7PA 1H9AA 3KZVA 4DBZA 1GUZA 4X54A 3DMTA 3RCBA 1LA2A 1PJBA 4U6SA 1Y6JA 5CDUA 3GVXA 3ASVA 4XCVA 2QZZA 3QWFA 3BTVA 2PZMA 1ZXBA 1EE2A 4FC6A 2NNLD 3DZGA 4L75A 2XPCA 2PD4A 4R5MA 4XR4A 2EXXA 2FZWA 4Y67A 3V5NA 1PJ3A 3IUSA 1RM3A 1ENZA 5U1PA 2OORA 3BYZA 3FTPA 1MC5A 1SZJG 4FBGA 4XQ9A 3KYCA 4MVJA 1J0XO 5BSFA 4XGIA 1I2CA 5ITWA 3F6YA 3A4VA 2ZTVA 2PTGA 1ONNA 3DDNA 2VZ0A 3H65A 3IC5A 1NASA 4IBOA 3V8BA 5K9ZA 4DIFA 3SVTA 1E5QA 2JD0A 4A10A 4EDFA 3LZ6A 4CM8A 2VUUA 2Y93A 3VTFA 3QVWA 1E3LA 4LSMA 4B7UA 4IGFA 4RVDA 1EVIA 4MVJH 3ITDA 4KQXA 2GSDA 4AL4A 3OIDA 3QVXA 4NU5A 2YHIA 5KNLA 1GD1O 5JY6A 3V1UA 2NSDA 3QVTA 3RJ9A 1XQ6A 4CV1A 3NGXA 4RVHA 1PTJA 4Y6RA 3C7DB 1O0SA 4I5FA 2WM3A 4EJ6A 2ZTLA 2PZLA 2JD2A 2RH8A 4CR6A 1E7SA 1T2CA 4OYRA 5TIIA 4HKTA 3L77A 1Q0LA 4N5LA 1EK6A 4CQMD 3U09A 2JFHA 4EZBA 3JQ7A 4UULA 2Q50A 3AU8A 5C7OO 1IULA 5LDGA 1PL7A 3N74A 5EQFA 4E4YA 1PZGA 3PGJA 3RQSA 2PGDA 1WZEA 3UCEA 4J49A 1O89A 2Q45A 4XYGA 3PJGA 4W99A 2PR2A 1GYPA 4WK6A 5F1OA 1YB5A 2D5CA 1RJWA 3Q3CA 3TN7A 2IZZA 3KYDB 4GI2A 1CWUA 4Y98A 4MIEA 1ARZA 2OBNA 3QE3A 4QO8A 1VSUA 5COBA 2X8LA 4PIVA 4NK4A 4E33A 3JD0A 3L4BA 2DTDA 1YB1A 5KIAA 1YOVA 3H4VA 1G0NA 4E2XA 4CM5A 2YUTA 1HLPA 4PRLA 3VH1A 1ZZEA 3E03A 4XRGA 5K6AC 3ZWNA 5GY7A 1JVBA 3DEYX 1QYXA 3RFVA 3M1AA 3ST7A 2IEBA 2QRLA 3GG2A 3OJOA 1LX6A 4E2YA 2PH3A 2BGLA 4JIGA 1QYCA 2XOXA 4AICA 3RJ5A 3DZJA 2OMEA 3GN1A 2GD1O 4L8VA 4OO3A 2D59A 5L40A 3AY3A 3D3EA 5JBIA 4FFMA 1HE3A 3W4KA 1LNQA 3W4JA 2ZQZA 2FPPA 3NRCA 1XIVA 3OHSX 3NDIA 4WEOA 5THKA 2IXAA 4AJ2A 4UVHA 1QLJA 3X2FA 1P0FA 2DLDA 1ZJYA 4YRBA 4RO0A 5CDSA 1H6AA 1LU9A 4DL9A 4RGBA 4CLDA 4FQ8A 4J9UE 4JBGA 4BQRA 1MGOA 3GH3A 1I36A 3VC7A 3S2IA 3VPHA 4FOOA 1PL8A 4E13A 1C1DB 2C20A 3AOEA 4NNJA 2EV9A 4DLAA 6LDHA 3WJAA 4D79A 1I3LA 1WXDA 2D3TA 3T7CA 4BV8A 3QHAA 4CV0A 2HK7A 2ZYDA 4A03A 3RD5A 2HKIA 1WWKA 3O8QA 1ISIA 3GPDG 4DYDA 8ADHA 1I5RA 5G0VA 3B1JA 2B36A 5JYAA 3CSDA 1R16A 1NTOA 4W7HA 4CMEA 3CMCO 3EGOA 1B16A 1N7HA 5G0UA 4DYVA 1UXIA 4J7XA 1FXSA 3UUWA 1D4FA 1H93A 1LDNA 1U3WA 1TI7A 4AJEA 1FDUA 4BKPA 2NUAA 3FTNA 4BNLA 3L9XA 4RPJA 5TQVA 3WGQA 1UUFA 3D0OA 3FR7A 3BAZA 4BKRA 1YONA 2P68A 1LDMA 3HJAA 1A9YA 1EK5A 2C2YA 3E1KA 2Y1OA 3INRA 1C1DA 4Z3DA 4OKIA 2J5KA 5IDWA 3Q1LA 5A06A 2ZYGA 4OH1A 3PP8A 3PLRA 5BT9A 2ZKLA 2X0JA 3SJUA 4UUNA 1SBYA 3OECA 4IXTA 4RZIA 2JCXA 4W9NA 1MC4A 1NP3A 5DT9A 1T4BA 3BMCB 3SLKA 5J9GA 2ZJ1A 4BNTA 4I1IA 4TRMA 3H9JA 4ZU3A 2OL4A 4DQVA 5CAEA 4I9NA 1C3VA 4MJLA 1ISHA 1NAHA 2FRDA 3I6QA 2Q1SA 4IDFA 5KJFA 2QYTA 3K30A 1EFKA 2VHXA 5JDCC 3ANMA 1C0LA 4GKVA 5JAQA 1BXGB 3WLFA 1ADBA 1E6EA 4XKJA 3GZ4A 3PQDA 1JN0A 4IJKA 3JQAB 1R4MA 3BHIA 3DTYA 3ONDA 3PHJA 4FJ2A 5LCXA 4OSOA 4KWIA 2YW9A 4RF4A 4YRDA 4YT5A 1JLLA 1FJHA 2GRAA 2UAGA 3D1LA 3F9IA 2PV7A 3UH1A 1R15A 1HE5A 2O3QA 4JP2A 3NX4A 5ES3A 3ADPA 4CLOA 3WYCA 2B4TO 4PLPA 2CDAA 1CIVA 4YTEA 5B4UA 4S3MA 5JFOA 4MKXA 1EEHA 2B0JA 2RAFA 2WD7A 3FNGA 1NVMB 1VKOA 1IHYA 3DC2A 3B1KA 3JQDA 1EDZA 2QIOA 3PIDA 3UAGA 1ZXLA 2X23A 4BNNA 1YE3A 3D5TA 3ICCA 5KKAA 2YJZA 4URFA 1QV6A 5JPIA 3D4OA 5DP2A 3VPSA 1D7OA 4XDYA 3WLEA 5L7WA 2I66A 2HRBA 2GZ1A 3GAZA 4LVUA 3DAGA 5DCWA 4D3FA 1QKIA 4NPCA 3E8XA 3DBVO 1LQUA 2VQ3A 5DNAA 1DBVO 1V3TA 2DQ4A 3NTRA 4W82A 1GV1A 4PVDA 4CM3A 4QUKA 4XYMA 1BDBA 1CEQA 1VE9A 3IIEA 3WQRA 3H5AA 5HS6A 4C7KA 4QQRA 5F3RA 2GASA 1PWZA 4G81A 1E3WB 2VYND 5EESA 2WTBA 2AXQA 4XQEA 2UVDA 3ZNOA 1OI7A 1P1HA 3WGGA 1EFLA 4MO2A 4RCVA 2NTNA 1TVEA 1OC2A 3AUAA 3WXBA 4RJTA 2YFQA 4KQWA 4M8SA 4D43A 3RUIA 2O23A 2Y0CA 5DOZA 2HMVA 3EZLA 4KZPA 4BNFA 4UEJA 3F1LA 2D8AA 1XEAA 4IXWA 3ZWOA 5B37A 1KEVA 2IE0A 2OGUA 1VJTA 1Y81A 4R9SA 4CLRB 3PYMA 4D3DA 3WX0A 3L4SO 1S6YA 4IDEA 1SEVA 2HUNA 1KBZA 5IDQA 2Q4EA 1XG5A 3JQEA 3M1LA 4XYEA 4R1TA 2EWMA 1JWBB 1MP0A 2GZ2A 1QYVA 5DCYA 3KOUA 1EVZA 4DXHA 5CEJA 3ZHXA 1N1GA 5T8KA 1K0UA 4M89A 2GLXA 3WR5A 2VHZA 4J16A 1BDMA 2E4AA 2J3IA 2C5EA 3PTZA 2CF6A 3ANNA 4NU6A 2EKLA 3WG9A 1HTBA 3GGGA 4J91A 3K8ZA 4FSHA 1BXZA 3JQCA 1KS9A 4YJDA 3R0IA 3GDGA 1A72A 1PJSA 2Q3EA 4PZDA 1EQ2A 2DVMA 3PZRA 3FCOA 3OIGA 3DXFA 2ZCUA 5BQFA 5IZCA 2PZKA 4RPHA 4Z0TA 4K1LA 3Q9UA 3WS7A 1T2FA 5KJCA 2OFPA 2AE2A 2RHCA
chains in the Genus database with same CATH superfamily
1ZGBA 3EDOA 3KVOA 3MGBA 2PKCA 2JFGA 2OY0A 3E3LA 5CA1F 1BC5A 1NQOA 1BE6A 1MTZA 3QWIA 5BYAA 1A96A 2V6JA 4PZZA 2O3RA 2WOOA 1AGRA 3TW6A 1L5MA 3IO5A 4ATNA 4KR7A 4RVOA 3OX3A 3EPKA 2X8BA 3OLQA 1Y5MA 2ZYUX 1PGPA 3CRNA 4A0GA 1EJ0A 3B36A 3S99A 3ZU6A 1QFXA 4KV7A 4NBWA 5LBTA 5ALGA 2Q6TA 3KETA 4RPLA 5JWOA 2ZWVA 4BMSA 1X7DA 2O0HA 5L95A 3MAAC 4TKVA 4M88A 5KC8A 2J3EA 1T3LA 1VMAA 3CVVA 1NJFA 1NL3A 2V6BA 3HMQA 1R10A 3DO6A 3H2SA 3MQFA 4D80A 1E62A 1K4YA 3DHEA 4C5BA 5KYKA 4CHTA 4H4EA 4KE6A 5A03A 2IEIA 4TXJA 2YVQA 5B1IA 2E48A 4O6VA 2OCPA 4G24A 3EGIA 5CYFA 3V1KA 2Z30A 4QRIA 4FZRA 2H08A 2FPGA 4KIUA 1N6LA 4RELA 4K6KA 4I8XA 3D7MA 1CQPA 4LNAA 1LFDB 1YUNA 4YJGA 5IM5A 3ZJXA 2WA2A 4I08A 1XEFA 4EMBA 4WKNA 4MHTA 2QBYA 4FCCA 3L8FA 4RJKA 3SF8A 1A71A 5TC4A 1UP6A 1SCUA 3S81A 3M7IA 3E82A 3PNYA 4P7FA 3RYTC 5KPDA 2VIIA 3PDIB 3TZEA 1O0CA 3SEQA 1A9XA 4Z4EA 2PQMA 1DAMA 5DRTA 4NCIA 3OQNA 3OQJA 4FMPA 5SZIA 1JMVA 3RRXA 5AR1A 3VPGA 2AOWA 2B6HA 3WE7A 2PXXA 4JKYA 4OP2A 1POXA 2N3ZA 1QZXA 3B2QA 5ALPA 1GPWB 1USGA 2V8BA 4FYYA 1Q2XA 2GUGA 3A4IA 5CH5A 2JPDA 3LYUA 2QTGA 5BY2A 1LK0A 2H1VA 1XC7A 2IEDA 3A9TA 4ZOBA 1ZM3A 4B85A 1S01A 3AF5A 1OB2A 1R8JA 2KBFA 3B3QA 3G85A 3I6IA 4EBBA 2XE4A 3T3IA 2JVJA 4JELA 3PFWO 5EL0A 1Z7BA 1XNRB 1FNSA 4RC9A 5EWJB 2LKDA 4B4VA 3AF0A 1CP3A 1RI3A 1E4VA 3WBJA 3BICA 3LC0A 1CS4C 5EXXA 5KCZA 2JLCA 2OLKA 2R6AA 2Y4NA 2RHOA 2WIAA 1UT5A 3EASA 5L45A 4EPWA 4DB2A 1P3DA 2RHLA 5F7OA 3OA2A 2VNHA 4I4CA 4UDYX 1VIDA 3UC9A 3G13A 1Z26A 2BFCA 1Z5UA 2OT3B 2QTCA 2ZRPA 3FZQA 4NOMA 3N0XA 1OX4A 1I1HA 3AIOA 4ZODA 3W5HA 3JRXA 3QBEA 1BOOA 4FE3A 5IC4A 4JEHA 5T73A 5H3HA 4YCCA 1HDXA 1EUCA 3W3AD 2ZSIA 3FPHA 3WKDA 3KB6A 1U0BB 3COSA 4HI0E 1NIPA 1US8A 1PL6A 3D8NA 4NPHA 3V34A 2WF6A 2CHGA 4BN5A 4GPAA 1SB9A 2MDTA 2P2LA 4N5NA 2AK3A 4WNAA 5CXSA 1W1WA 3KDSE 4AMVA 1X39A 5M3BA 2H06A 3REQA 4QGGA 1XU9A 3E9RA 4H08A 4LPSA 1QYIA 4MUBA 2A5YB 1CVLA 3F46A 4R0VA 3P71T 2C4VA 4ZQBA 2C4TA 3RJMA 1NDQA 1WZCA 3D6UA 5KTKA 1WZ2A 1BW9B 3RSZA 5EIOA 3A3PA 1W48A 1TIBA 3GUVA 2WK1A 5F1YA 1GDTA 4JU9A 2ZJ2A 121PA 2CUTA 2JRLA 4RKRA 4B9EA 4C0BA 4FMDB 2QSUA 4M1SA 1JLSA 2J3KA 3GVPA 1VB3A 3T3DA 1KRWA 3KWFA 2P1ZA 2ECPA 4RNCA 5DZSA 1AV7A 1OIWA 1WPQA 5B30A 3E9CA 3UFBA 4KAAA 1QFSA 2JEOA 2JJYA 1OUMA 1TIKA 1NOKA 5BRNA 2QTVA 1PW7A 2B6NA 4PGHA 3IR7A 4ZO8A 4E12A 1P1RA 1HDOA 3G79A 2PX0A 1MORA 1Q3KA 1H2HA 2QRQA 3QITA 2PL3A 3GPIA 2FE1A 2W6CX 3Q88A 4KAXA 4MIKA 4NOJA 4E1AA 5CJPA 2WD8A 4D5EA 3V8EA 1SRRA 4UTZA 4PR0A 5GZ3A 3RS5A 4MTLA 4BQPA 3MRXA 1HETA 1N77A 3FPCA 2OHGA 5A3VA 2BP7B 2YQ5A 5AQ1A 3TRJA 1IDOA 3RTDA 4RY8A 2IUUA 1PLJA 1UBKS 5DXFA 3K4HA 5ALJA 1MIHA 3AF6A 2XE6A 1RLOA 1UPAA 3GGSA 4EAAA 3KUXA 5BQOA 3MVEA 5CLGA 4F3RA 1NSFA 3JQAA 1UZNA 4FR2A 3RW9A 4YLYA 3NMUF 2POQX 3ZHOA 1OH6A 5DTIA 2YQ4A 3NAZA 4WBNA 4BQOA 1DJPA 1EHYA 2QTWB 3K53A 1BEUB 5K0JA 1SOWA 4N12A 1DSSG 1NJ5A 4O29A 4AG3A 4D6XA 5YASA 1FPMA 1MZVA 4HJXA 1ESNA 1D8AA 1Z82A 3KSZO 3BCRA 5GGYA 4C01A 1C9KA 1YQEA 3W90A 3T5TA 1YJXA 3A9RA 5JCJA 4UE3S 2IYXA 2V3CC 3ZJVA 4GYKA 4ZOLF 4KXQA 3TOXA 1GZ3A 3H6KA 2NXJA 2O1XA 4CLRA 1TEZA 3JWPA 2JW5A 1OKKA 5CB4B 2HC9A 3PXXA 4C0JA 1P9OA 5A4IS 3AT1A 3OCXA 4Y6SA 3DKVA 1G1AA 5IDXA 1UL1X 4S35A 3SYKA 3RYIB 4C0QC 3NDRA 1UJNA 3P9IA 4E6PA 1UPCA 3M6LA 3JQ8A 3QIVA 4IHKA 2IE8A 1JFTA 1HLDA 2EFYA 3JQ9C 4KFCA 4F4CA 5ECDA 4N3NA 5TS3A 3G2LA 2LGJA 5J5CA 5KQSA 3O90A 3VFDA 1KFBB 4L9AA 2E89A 3ZE6A 2C00A 3EDMA 1H3FA 3DLIA 4YAUA 4B3IA 2IOHA 5ALVA 3H8SA 4HNGA 1E4OA 4GZ5A 4BJHB 4K05A 3CEPB 4F46A 5GVRA 1CPYA 5KO2A 3CNEA 2VJOA 4FFBA 4BLOA 1U2GA 2QJFA 3DL7A 2FQQA 2PVCA 2PCLA 4RM3A 2HRZA 2B1JA 1RFLA 2JI8A 3N2GB 4IFBA 4ND8B 4OQZA 4MV7A 3THSA 1IVYA 4PQEA 4ZPXA 5A6SB 4DCCA 3N1UA 3IWDB 2I67A 3D3QA 1QRDA 3LZDA 3N2KB 3OKAA 2VHUA 4G0PA 2QG4A 2YMPA 4OHUA 1FPQA 4PO9A 3M6XA 1HSZA 3WKEA 4DV7B 3GCXA 1GZ4A 1PJ8A 2XUOA 4LZJA 1D6NA 2OA0A 4OOEA 1E3TA 3RLFA 4XVRA 3BM5A 1SPXA 3F8WA 1OZAA 3EWSA 3W8RA 3WLRA 4PHHA 2RGCA 4LRXA 4GDFA 1YZQA 5KX5A 5M29A 1EFVA 4QDOA 4TXMA 5CIQA 3L6RA 1ZOPA 2RHHA 1B6TA 1E1QA 1LB1B 1NU8A 2KLBA 3AEKB 4DV6B 2F7SA 4Z4QA 3KR1A 1HNZB 1PR9A 4GI5A 2Q22A 4FINA 3SVZA 1NW7A 4NBRA 1EDOA 5LMZA 4KB5A 3SBEA 4FZ5A 2HXYA 4WOKA 4YBZA 2Q6OA 2WWGA 2CNWA 1ORIA 4EECA 4CKWA 1QVWA 1WNFA 2QRVB 4CNQA 2DTXA 4Y2VA 4KQ6A 3SF8B 1ABFA 2WU0A 2R1UA 2PD3A 2XYQA 3FMVA 3JD4A 5A0FA 3VKGA 4KTTE 1S7GA 5AHWA 3LBNA 2NADA 5CT4A 3D8BA 2DLCX 2Q3BA 1KI4A 3KOYA 3OFVA 4UQPA 4ZIRA 5IZCC 4KPGA 4P54A 2JAUA 4CIDA 4Y6GB 3JRWA 1QWSA 2RI0A 4WUVA 3WMXA 4EA6A 3TG2A 2JLUA 1AXGA 1E1CB 1T2NA 4CM1A 1Q44A 4NENB 2J67A 1Y7IA 4MR9A 4RPCA 5CB6A 5ICEA 2WJPA 2Q4TA 4S0ZA 3UMMA 2BMEA 3KQOA 4Z7NB 1IHUA 3WHLA 4YRGA 4LW8A 1DE0A 3CRZA 4MUXA 2DR2A 5A7FA 2ORWA 3HJGA 4RZHA 4LISA 1IN6A 3GFQA 4DNOA 5FH9A 2JI6A 3U3JA 4QNMA 1OVGA 3TJRA 3BRWA 3A3OA 1AKVA 4WZAA 3DLHA 3WYBA 4C4OA 1H5UA 2OQRA 2YY6A 5C32A 4EJ2A 5MN5A 2FMTA 2DH6A 3MCUA 3ZDCA 2M32A 4OCZA 2Y27A 3BRWD 3TVTA 4E14A 3GJ4A 1FLNA 4TQAA 3O91A 1V4BA 4JLOA 3PJDA 2L0XA 2YZ2A 1ORDA 2Z2IA 5BURA 1QGED 1D2MA 2FMXA 3OOEA 5HR5A 1W29A 3GPBA 5AOAA 1FUEA 4D8WA 4JT2A 1GU0A 1MFZA 2G6TA 3FOWA 4F5EA 2EKPA 4FD3A 1LPOA 2BEWA 3ROPA 2PDAA 4TVOA 4PX2A 3ETCA 2CNNA 1Z3IX 4IIJB 2G36A 2NV0A 4O4HA 1CRWG 1QDEA 5JO9A 1IMJA 2NPOA 3ZK8A 3PB3A 4BGEA 2CD9A 2D00A 2X14A 5DGDA 3K0CC 3GJYA 4M1YA 3H75A 1LLQA 1O95D 1P73A 3STYA 1GAWA 1UM9A 2C77A 4DLBA 2D06A 1QF6A 6Q21A 3L7KA 1T9DA 2VHYA 3LP5A 3V4ZA 3OMLA 5EZSA 1T4DA 1TTHA 1UM8A 1TUEA 3LBYA 1NPTO 5DTQA 3W4IA 4DA0A 1KMHA 5C4MA 3ZCXA 1JAXA 2YIJA 1PR6A 5JARA 3W5CA 1D5CA 4D8TA 1HE8B 2WW8A 1NVUQ 2C7QA 1KU6A 1EGAA 3CZAA 1XZGA 4HXYA 3ORYA 3O8BA 3A10A 1OX6A 4ZCTA 1Y48E 2PMFA 2VSNA 1RWOA 2Z1MA 3BGSA 4RNDB 4YMUA 4J7UA 2PSSA 4EO9A 5IXJA 1E58A 2YXNA 4YC7A 2B83A 2BTEA 4YB8A 5C7IO 2O7SA 3OPVA 3IIIA 1V1MA 4JX9A 1TJ5A 3EWNA 4FW8A 3MBKA 3T3PB 1GFWA 1YQWA 3EYAA 3QVUA 4O33A 2YYYA 3U61B 1PVVA 4KO4S 3FGPA 1CJBA 1SKYB 1TRKA 4IH4A 4RY9A 2DT8A 4UQOA 4RJIA 2PWBA 5TT0A 4I4TA 4W5RA 4E07A 1R5JA 3G2JA 2LDBA 1P9LA 5BYKA 1V47A 1XFDA 1HO3A 1O5TA 3ZHCA 2XQJA 5JH7B 2CFIA 1HRKA 2YHIB 4HNTA 5AMXA 3DDOA 1HORA 3SC6A 4EFDA 3QXSA 4HDSA 4B76A 2NTEA 8GPBA 5JQWA 1VIMA 4CZ2A 3S2SA 3NEJA 3MJVA 4OF4A 3U1BA 1Y9AA 1ZEJA 4GC5A 4WNYA 5H81A 1I6MA 3MTQA 2WV9A 1T9GS 5JXGA 4NBNA 4XX0B 1ZK4A 1AKQA 2B3TA 4PQRA 3L05A 5DN9A 2VAMA 3A6FA 5E4YA 4BKQA 3VU9B 3UOAB 1YH3A 1X7YB 5EIBC 1J5PA 2A30A 4RMJA 1VSQA 4Y6LA 2AXNA 3MCAA 2WVGA 5KMGA 2C4WA 1DLJA 4UTXA 1WP4A 5HKKA 2BFOA 1C7EA 1EK2A 3G89A 4CI0B 5KS2A 1T1EA 3LM8A 4BLRA 4M1OA 3T99A 4LZAA 1SG9A 1ODLA 5FBHA 3AIKA 4RM2A 2IXDA 4K0KB 1EEXB 4QNRA 3GWZA 3LDAA 2P4SA 5BN4B 3OO0A 2R2AA 4PCLA 3ZLBA 4WXMA 4RTQA 2R6R1 4NDZA 1SD2A 1YHYA 1MMFB 2G07A 3DSRA 2UUAB 5A6SA 2EX4A 1OA1A 1WZIA 4DA9A 4FS3A 4ENVA 2XHZA 2ZTHA 1U04A 3O95A 3WIUA 1YDHA 1TB4A 2FSSA 3IQEA 2ZBQA 3PFKA 4HPXB 2BGJA 2GBFA 1KC1A 2AMFA 2OSVA 4Y2RA 4OXQA 4FXPA 4YQZA 5J4KA 1E79A 1QAMA 1BZYA 1WU7A 4ZVRA 4UOZA 5CD9A 5HBGA 3P9PA 2X77A 3B20A 4ND8A 4QQNA 1YCFA 4YGYA 4DJJA 4NK5A 5B6IA 4L57A 2ZRJA 1GU7A 2A9PA 4HGRA 4ER6A 4TXHA 2VNSA 1IZ8A 4DVJA 1MAUA 3ZU2A 1IJBA 3DMRA 1LLUA 4K2AA 4PO1A 1SJ9A 1VPLA 2B4YA 2H0RA 3IP7A 2JFNA 1KOFA 4L3WA 4X7PA 5HSGA 3SHFA 2WYVA 3ZE9A 4AUKA 4NI5A 4F97A 1PWYE 1MHPA 3TMYA 2H92A 3P2OA 1PJQA 4Y1GA 3T94A 4KQCA 4M9ZA 3SQWA 1CZRA 3GBVA 1CX9B 4NP6A 1N8KA 2A92A 2Z04A 4K28A 2NU7B 4AUMA 1T9ZA 1SG0A 4JVOA 4PS1A 4CV2A 4YLGA 2CLIB 3LKDA 2BFNA 3TR5A 4HBGA 2CXTA 5CTAA 4CQNA 3VX4A 4FFRA 3E18A 3PS9A 1DKMA 3CNOA 4PQFA 2PU7A 3CX8A 2H2WA 4E6EA 4I6EA 1H2BA 4PHFA 4N76A 2ZWAA 3HY6A 5TY0A 5LBIA 2PQ0A 4EITA 1AUQA 4LGYA 3CIFA 4RCZA 4ABYA 1J8DA 3FYCA 4AMYA 1CULC 5EJ8A 4K3UA 1ZH2A 3LQFA 2QT1A 5DMXA 1KHHA 3JQRA 3AX6A 1GLVA 1JSCA 1JKIA 4NEGA 3PQEA 1USVA 3I9JA 2XW6A 3FYUB 3TKLA 3GP8A 4EQ6A 4MZXA 2YYSA 1SGWA 4IUDS 4ZCRA 1H2WA 1YZYA 3IIKA 4HRYA 3AR9A 5A9RA 4MSUA 3AH8A 4IUBS 3IHKA 2GPJA 3JWEA 4ND5A 1YR8A 1G8GA 1T3SA 3LG2A 2BFAA 4GS5A 4LX8A 1H9CA 5HKBA 3ZLTA 2AUTA 1E9AA 1Z75A 2GD6A 2FF5A 3UJBA 2PBZA 1ZUD1 2ZSHA 4DIKA 1QIMA 1C9NA 2HDNB 2V7GA 2VP6A 2QX7A 2G88A 1R5BA 2C97A 1RWXA 2VT3A 3D0QA 4KIJA 1E6WA 4IIHA 5JW6A 2UZ0A 2HFJA 1TM4E 5K0BA 2X9QA 2AXPA 3AR3A 4I1OA 2V7WA 3NM5A 2OZKA 4ODIA 3VDMA 3QX8A 1U2SA 3GGJA 4YMHA 2VDLB 1YASA 2PUVA 5DM70 3WWYA 2DHRA 1RXEA 4EYEA 1ODCA 5F7ZA 1U5CA 2Z98A 2Z8YA 4GAEA 4WEQA 3NI2A 4TTTS 3QX3A 3M5DA 1GLGA 1N7IA 2QOEA 3OZCA 2GNPA 2N75A 3HBAA 4UD2A 4ZVVA 1OXTA 1NWHA 5J43A 1J97A 3NOOA 1QVZA 3T5AA 3ZGNA 1V35A 4JXKA 5FFMA 2B37A 3FWHA 1YC2A 3I5MA 4TL8A 3HVRA 2V54A 4JLSA 2VSQA 3BK7A 1FIUA 2OD7A 3P7MA 5G3YA 5IWAB 2J7PA 1AKMA 2RAUA 2TSYB 1Y3CE 4LHEA 4WLVA 5ESXA 5K0NA 1R5OA 1EGVB 4QUGA 4XEHA 4BVHA 4S0XA 2OHOA 4PC7A 5DU2A 4K6MA 3ZOZA 1FLVA 4PYJA 2NXCA 2I91A 1MPXA 1VP3A 2C9MA 5IBCA 3GVHA 2XT9A 2COKA 5BV1A 4XB2A 4KODA 5LQMA 1FXWF 4FONA 4KDCA 1CS0B 3WYFA 4XGQA 3FMOB 2IU3A 4FD2A 2CVOA 1IK4A 2WAAA 3AINA 4RANA 1T6XA 4KQ9A 5DSTA 1T4CA 2IZ1A 4O1MA 1EBFA 1JQBA 2JGDA 1OWNA 1U02A 3B2EA 1FBTA 1NMSA 1ENPA 1HDYA 3JVIA 3MELA 2NNWB 3PNBA 3H83A 2GGSA 4TXNA 5HF5A 2PH5A 4I55B 4L22A 3KSUA 1AGYA 3ELDA 4YI3A 1KVTA 4V03A 5IT0A 5EY5B 3FHJA 3NHPA 3B3AA 1R2QA 4O89A 3STHA 4JYZA 2CJWB 3A32A 5EKSA 2VJPA 3V8MA 1BKDR 1I2BA 4TKVB 2ATCA 4FM9A 2DG2A 2ZBPA 3VNBA 2YDXA 3TW8B 2IH5A 4C06A 5TMPA 4PYQA 1ZIOA 3OQ6A 1AMUA 1YS4A 3TI9A 3PHBE 2QF7A 4L9RA 1TQHA 2EF1A 2ORIA 2XR1A 3FPEA 3PL1A 4G5YA 1RKUA 1G4AE 2JJQA 1JENB 2OFXA 2ORYA 2UYYA 3A58B 5DLDA 2XQVA 3CZRA 1WCV1 1DRVA 4OUDB 1QS0A 2L42A 2W2TA 5CP8A 1VYHA 3U3RA 4OQXA 1QOQB 4PG7A 4EVSA 4LX0A 4X8HA 1T36B 1DV1A 1FP4A 2DSTA 4JASB 3DP7A 1YRLA 4E08A 1B14A 1JHPA 1OYVA 4TMKA 4R2XA 1DZ3A 3HBMA 1EFDN 4Y7CA 4D97A 1T5OA 4CM6A 3U6KA 1L7NA 3B2NA 4C04A 3EGVA 4GNRA 4A82A 2C8LA 3T1VA 3ZKWA 4TLLB 2Y4OA 2HO4A 4IRMA 1GTL1 3T6KA 5DXJA 3H87A 3WDLA 3C41J 1QIFA 2P7HA 4L50A 1M7BA 3C8UA 4YWJA 3N8HA 2Q49A 1W0JA 5AYVA 1G59A 4ZV9A 3RC7A 4AKSA 4D26A 1N6RA 2AFVA 1CF2O 1V0JA 3B7GA 3FFBA 4IQ8A 4CMAA 3TPCA 3RS0A 3JZIA 1K97A 1ACMA 5JWRA 1WXIA 3W3AH 1NURA 5A02A 1RBZA 1KH1A 1U8CB 3WB9A 3OE7A 2HO5A 2ZRAA 5IC5A 3ZDZB 4IIJF 4JLPA 2ECKA 3VKUA 1C8LA 5H5JA 5IU6A 3QBTA 3M8KA 4I1UA 5LQJA 5G0TA 4WTOA 5DPMA 3OTOB 2ET6A 3CCFA 4D0RA 3IQDB 1XJWA 4ZI7F 4MKZA 1OSNA 2GCPA 2P8SA 3PUYA 1V8ZA 4FFOA 3BTUA 2VDPB 3BRQA 4OK3A 5C1IA 3IP3A 2V74B 3NBUA 4NOKA 1ESEA 1LVGA 2GAFA 2QDKA 4RA6B 5ALIA 3ZV3A 2H2DA 4QJ4A 4AECA 4Y6PA 2I99A 5EJ6A 3VR6D 4UTNA 5HUJA 4TN1A 1Q3HA 1M8KA 1LJ8A 1WKVA 2Z5LA 2JBWA 4PINA 1EK1A 2Q7XA 3HB1A 1P0MA 2N1MA 2X1MA 1JJAA 2YQZA 1XTJA 4CCSA 2G5TA 2DKNA 2X6QA 4QG7A 4A7PA 1PQ4A 1Z74A 2J0UB 5ENVA 3CLVA 5EP2A 1XEXA 1C29B 4CF4A 2PUFA 2P2SA 3K6JA 1KZYC 4NEHB 4X62B 1X7WB 2AI2A 1KZ7B 2JLAA 4B09A 4D9KA 2Z2KA 2VHTA 5GAJA 4BZXA 5KQMA 2AF3C 2BKUA 4IMRA 3SZMA 1T6ZA 3NTQA 1N9GB 1T8YA 2O7RA 3PPVA 1G8AA 2KMLA 1UIRA 4FOLA 5E0OA 5ADHA 1N6PA 4LHXA 1H0HA 1LQ2A 2GZ3A 2WR8A 1BFKA 4GBJA 4XZ3A 4H7PA 1ZA2A 1JEQB 2AYXA 1HL7A 2CW5A 2R1TB 1IK6A 3BE5A 3ETDA 4OAOA 5GM1A 4ZHQF 5M2QA 1T15A 4LECA 5JT1A 4EZIA 1EJBA 1JJ7A 1T8UA 1N9ZA 1Y5NA 4ZKEA 5IF3A 5FLXA 4XDZA 2OCIA 4Q4CA 4WT7A 2YZMA 4F4UA 2HQOA 2ID9A 4NXNB 2ECOA 1K9SA 2DH5A 2F9MA 4J4BA 4OHKA 1NP7A 2Q3JA 1O57A 4REMA 2D1QA 2DCMA 5CURA 2IYNA 3OIYA 1LH0A 5ALOA 3RBAA 1MG0A 2FZLA 3EXFA 4Q4JA 4AQDA 3THYA 2X6RA 3WGYA 2FWNA 2ZLBA 3P9NA 1A76A 3HEAA 3AHEA 2PSEA 3DDZX 2Z6UA 1VFNA 5HVNA 3EEQA 3EP7B 1SCIA 1NZFA 1ULZA 2GN6A 2GM9A 3BQMB 5KDOA 3J81k 4ZAVA 5ECWA 2GEVA 3FN4A 5CNIA 4QLOA 1DG3A 3DOIA 1NJGA 1UBOS 4C7VA 3RYCA 1PLLA 1SU7A 1KEUA 4RZQA 2P35A 4G41A 1V1MB 2YJNA 4U7PB 3IERA 4PRKA 1SHKA 2INGX 2RFLA 5DRYA 3ZI0A 2A4KA 1JQEA 3RF6A 1TL7C 2JFZA 4J2HA 1XZNA 1U1DA 1GUYA 1KRHA 1J24A 2G7ZA 4XE5A 4ZVKA 4BXOA 3IUJA 4JH0A 1QYRA 2W8BA 1MO3A 1ACJA 1DAEA 2X7XA 4QT4A 3SDZA 4BWVA 1I0ZA 3ID6C 1NAIA 3MAGA 1PJ2A 3K0CA 3UWPA 4FIDA 1P2UA 4CMBA 3GO4A 1R8XA 1E5XA 1ISJA 1Y3AA 3RKSA 1APBA 4LTDA 3VPCA 3ETNA 2CZQA 2PUEA 4NFYA 5IM4A 2GWRA 3JWIA 3RSCA 3GP5A 4KLNA 4CUKA 2FZKA 2XD4A 4AM8A 1UAYA 1NUPA 3INTA 1BIFA 3VV3A 1W76A 3ZBPA 4XOUA 3SBOA 5GGXA 5LDHA 1DAGA 3E7WA 2LKCA 2JFQA 1RQRA 1H2RS 2OWDA 1T34A 2QRHA 4Q3CA 2OOSA 1R12A 5DNEA 1N1DA 4BGIA 1NP6A 1NLMA 4JVNA 1EAYA 1BEZA 1NA5A 3W5JA 2TECE 1HV8A 2W6ID 3GEEA 2I9KA 5FORA 1N1MA 2HTFA 2K2WA 4Y18A 3KTFA 1HX7A 3KDAA 1B15A 1H5QA 2R5NA 3MJEA 4O4HF 4TTIA 2XF2A 4PFJA 3VPBA 4GW3A 4AZ3B 4FYXA 2CV2A 5JAOA 5HIIA 3TQCA 5HHTA 1UMCA 4CLOB 3KK0A 2YASA 1VYUA 2WU8A 1JWAB 2JHAA 2QX4A 3BIJA 2OWEA 3I5XA 4U2KA 4R2KA 1J42A 2GM3A 5FBZA 5BR4A 2R62A 4QLAA 3GT3A 2EW8A 3FZNA 1RMYA 2XCIA 3JAKA 3BD7A 2HV8A 3ZIUA 3GYBA 2CFCA 1JKJB 2O19A 4HGPA 1L7QA 2I4TA 4PZAA 4PYNA 2XTAA 4R2MA 3TLGA 1U0EA 3OZEA 4RHFA 2CFOA 1UBNA 1UEJA 1VE6A 3PUWA 5CVTA 3GCGA 2XTJA 1KYWA 3R3JA 2ZXEA 4L4YA 1ZUWA 4L51A 3RAPR 5AW5A 5LZ8A 2BFEA 1FS4A 4UU0A 3HJUA 4I5EA 3TLEA 4HADA 3PNLA 2H3EA 2OCLA 3L41A 2A9RA 4H17A 3GR6A 1THGA 3U4QA 1M6VB 2I54A 4YJ2B 5K03A 3D8UA 4MW7A 1CP2A 2G82A 1FJ2A 3DAPA 3NVAA 1B0AA 3GNQA 1DMSA 1KQOA 2H3HA 2J4CA 3K92A 4JQOA 1CJSA 4BMDA 4E46A 5I6DA 4L8WB 3VZBA 4QFDA 5J3JA 2YRFA 5LXTB 2OG2A 5CT6A 3ENQA 5IKXA 1JQLB 1N2XA 1FW6A 3F4LA 4D9BA 1TUBA 4MDFA 4BO3A 3DOCA 3EP3B 3M6FA 3TXYA 2QZJA 2X7HA 3MS7A 1CY8A 5TMDA 2I7DA 1R6UA 3ICPA 2AUMA 3IHWA 1AQJA 1TVKB 2XKJE 4X65B 1MDBA 1AU9A 1UT8A 1BS9A 2QP3A 4OGKA 4A15A 4JMLA 1VJGA 2P2GA 5JCZA 3G0HA 3H3FA 1O95C 1U3TA 2WF5A 3OZTA 5K51A 2O0JA 3S8YA 4ZAYA 4NJMB 3SKYA 5B7QA 1PJAA 4C05A 4BQNA 5IRCD 4MV4A 1JFFA 4WCFC 1E92A 3WP1B 2C3MA 1JDNA 4XARA 4F1KA 4GGPA 5DOVA 3A6JA 3B7WA 1E69A 1GU1A 2OECA 5CHYA 2WB2A 2ETVA 2DFNA 5MF6A 2JVKA 3OZFA 1SC4A 1R6AA 1RAHA 3C6BA 1W5AA 3WMWA 2DQSA 2HA3A 3WNBA 4M54A 4BYMA 5A1TA 4HB2A 3PVSA 3Q11A 1TO6A 4KWCA 4LDPA 4RK5A 3OZRA 4RIFA 3ZIAA 4CFZA 3N3AC 5DW3A 4X90A 1P1JA 3RVSA 6AT1A 4P31A 1MNQA 3BN3A 5CYGA 1NX6A 2V6IA 5KTYA 1N25A 4JBHA 3H04A 3L1VA 1WDKA 2XCTB 2HJWA 4GX2A 4P3OA 2NZUG 2X19A 3GY0A 3G0OA 1K7YA 2OXFA 4Z1MA 1DIGA 2PL9A 2XZDA 3IWBB 3X44A 1H2AS 1M1NB 3TO5A 4D4IA 4ENTA 4J0IA 4JC8A 4FCTA 3SSAA 3RVBA 2CFTA 5DI9A 1QLWA 5CIYA 1GSHA 1BCSB 2E9SA 3L7IA 5JZVA 4UCWA 1G5TA 1DEOA 1YFZA 1JUDA 4OOFA 3OPYA 4JY7A 1XHLA 1B6SA 3UK0A 1NC1A 3DKKA 1NI4B 4W1PA 1QBKC 3FNIA 3PE4A 3A05A 1EVJA 2X4IA 4NMXB 3Q7TA 1OGIA 2YMLA 3BVPA 2MSCB 2Q62A 2ZITA 4ZOLA 5B57C 3G9XA 5LWHA 3H1TA 2ZATA 5L3QA 4MP8A 4P7JA 4UUPA 2PVPA 3IKLA 4YRIA 1UXJA 3QLEA 1WQ4A 1A7KA 4TVBA 5G4LA 1Y42X 3TB4A 2ZE8A 4YVFA 4W9RA 1VMIA 3W0LB 5L3VA 5LVAA 3MPOA 1RC8A 4NQRA 1WSAA 2JGMA 1T9KA 2FSFA 4JT4A 4ND2A 3VVCA 2QTAA 1GT6A 3PQFA 1A4RA 2XRYA 3JR3A 1NYQA 5ELMA 4AU1A 3ZNQA 1GPAA 1YU9A 2I8CA 3ZI4A 5AVQA 2NVBA 3LD9A 5HK8A 3G5LA 3AF2A 3Q3GE 4AYWA 4IOJA 4HH4A 2JGDB 4WGGA 3QE9Y 1GNQA 5TJHA 3S27A 2PZJA 3Q3VA 1OXVA 4XB6B 1J2UA 1FTSA 1UQTA 1P17A 1TYCA 2SCUA 2WYWA 5DYGA 4N40A 2XGGA 5EYPA 3WI7A 3LCJA 4DWOA 5BNIA 3EFBA 2W71A 2O7QA 1KVQA 1Q7RA 4AWAA 1ZS9A 3CEHA 4QQFA 4AP9A 3TBKA 4CKCA 4L85A 3EIXA 3SAJA 5JD4A 1L5OA 2P5UA 3M4ZA 5TEWA 1Z88A 4X1KB 3E2MA 4AJPA 3L40A 3TOZA 3VR2A 2ZYAA 4TSKA 1NUSA 5ALNA 2VPXA 4U8HA 4RF3A 5HWSA 1PKXA 2WWIA 2FRVA 3CW2A 5AESA 1KOGA 3O21A 4J29A 5AKZA 4PR3A 2BZ1A 1TGVA 1XZQA 4EYQA 5AVXA 1KJJA 2VHCA 3BOSA 1G16A 3T35A 3PV0A 1CQIA 2FR1A 3IPYA 4G3XA 4KLAA 3K6SA 1YR1A 4F5WA 1CY7A 1OWOA 1GCIA 3KR9A 1SVNA 5I9LA 1X7YA 1GZDA 2BEKA 1ZL2A 2ERYA 1ZCZA 2P9JA 4K03A 5BSHA 4X7MA 3W05A 1N2BA 1JQDA 1UK7A 4U00A 5HX7A 2BAGA 1UMCB 2ZSFA 1Y1TA 4CKXA 1W73A 2HCRA 1TQ6A 3AL2A 3WNCA 1Z7WA 2ZT7A 3S1LA 1USUA 5KYGA 4X6LA 1IRIA 4G89A 5REQA 3E53A 4P2GA 1NXWA 5SV2A 4W5QA 2PT5A 2X15A 1T0PA 2EHJA 5LD2C 4RMNA 2Q4RA 3P5SA 4XLZA 5BSRA 1JKJA 2EKDA 3FOZA 3KTDA 3TLGB 2GARA 4M9RA 4CVNA 3OTIA 4MRAA 5J5VA 4ZC8A 1X86B 1NQ5A 4CEIA 5LL6P 2CNDA 2A9KA 2UVPA 4CG0A 1U6KA 4FFVA 3IOYA 4KK4A 4PYMA 1RKVA 2R47A 3ADBA 1KFCB 2G63A 2VQFB 2A9FA 4MS4A 5J59A 2Z6QA 3DZ3B 3AVTA 4BNMA 1FFSA 3I1FA 2IODA 4YBRA 1Z38A 1W4LA 5BT8A 3TGPA 5F2EA 4RTKA 3AFIA 1P5ZB 1JHYA 2PSHA 3N75A 4MQ6A 3RFUA 3R44A 3UF0A 4YHHB 1D9XA 3BZUA 1TE2A 4YJ3B 2HF8A 3U4GA 5ALRA 2ZRFA 1JSZA 4R84A 1V37A 4EOGA 4FNMA 3DPSA 3IUNA 3GX1A 5FNVF 1GAXA 3AP2A 3HACA 1O96B 2R751 4WJKB 3RH0A 3QZUA 2VTEA 3RS3A 3TW0A 2WSLA 3ZU3A 4MMYB 3GUCA 2RGWA 4QPZA 3SCZA 2BONA 2YHUA 3C6YA 3U7QA 2Y1KA 4BOYA 1V1JA 2GQ0A 2HLPA 1QANA 1AKWA 2VNAA 1T1RA 4ZI3A 4CDNA 3RVDA 1ITZA 3C5WP 2V7VA 3OHPA 1WETA 5L4NA 1EZZA 1FU7A 3GPCA 4DG5A 4DUPA 2FFJA 3V8VA 1LD3A 1OH7A 4D4KA 4LFAB 4XB1A 1TVMA 2P77A 2VFAA 4IQ0A 1FUIA 1XQXA 3CPHA 3HNPA 2ZB8A 4O4HB 1GAEO 4L74A 3ABZA 3VHRA 2V4UA 4DUGA 1AXRA 3M5CA 2FRDC 1VZ3A 4P36A 3QA3E 4B3HA 4D46A 3KJEA 1DAFA 2BE9A 4NJEB 3F5FA 3E2PA 2BTQA 1AUPA 2IFTA 5KVSA 1F0YA 4B3BA 4BO0A 4E11A 2XXAB 5BP7A 1IZ0A 4I1RA 3DE5X 4W9MC 1BQEA 1Y63A 3LY5A 3MRVA 3QKTA 1L1FA 5CLQA 4CKBB 4PCVA 5BPFA 2I55A 1ID8A 1C9EA 2BGNA 2WT8A 3AZQA 1FU8A 2X5OA 2XCUA 1DU4A 1NW8A 2R48A 4NG5A 3F5MA 1OJLA 4QX6A 4E51A 4LWQA 4M98A 5K4HA 4G1VA 2P3LA 1K6JA 2IKSA 1DO8A 1A27A 1NHGA 1V2HE 2CDCA 3C6XA 3MWDA 3CV3A 3P4YA 5EJAA 2O48X 5IUJC 1E9EA 4KRYA 1L5YA 4C29A 3INYA 3NG1A 4QKQA 3QKUA 1V11B 4PHCA 4TQGA 3Q72A 4A2CA 3K9GA 4Y2HA 3VNUA 4DLNA 1U8ZA 1EG7A 4BNUA 3NT2A 4JVLA 3D02A 5E7MA 2X0KA 4QT0A 2R25B 4H4DA 5EZYB 3HUUA 2V7QA 1ZD9A 5FB3A 4A6DA 2W0SA 4REQB 5K8VA 4FILA 4GHWA 3T5BA 1QH0A 4L6IA 3DBOB 1VBKA 3CUYA 4GI7A 3V4VB 3UGJA 4ZT5A 4Q4JB 3THYB 5LYJB 1NKVA 1X8JA 4K9NA 3UATA 2P9BA 3C1AA 1SKAA 4KUGA 1AVTA 4D57A 1MQ8B 1DBIA 1E99A 1T1IA 4KYTA 4DCPA 4DSNA 5CA1A 4WCDA 4EM6A 4BWFB 2GM4A 2GCNA 5FPQA 4TMXA 2XUQA 2ISCA 4RYDA 2AQ8A 5IVHA 1J99A 3G1UA 1QHYA 4B46A 3BDIA 3R6WA 1RU3A 1UZUA 1A5AB 1B43A 3FE2A 4WPGA 1ZKMA 5IH3A 2R84A 2X9NA 1FUYB 4FEGA 5CHEA 3RYIA 4ARAA 2CJYA 3S1AA 4WQMA 3NHWA 1ULTA 3P96A 3CVUA 2R66A 3GCZA 4X9XA 4AJKA 3KQLA 3BGVA 5HYVA 5E9WA 4XQ0A 1E2LA 1K8QA 4LDNA 4DS3A 4HWSA 4KEAA 1R3DA 3DTVB 3X1KA 2XECA 2UZ3A 3TQSA 3C45A 5I7RA 4GMKA 1URPA 4UEQA 3TYXA 1YZTA 1Z8HA 2EP5A 1EHCA 1NQXA 1LFAA 1F12A 4KH1A 4Q3KA 3TQIA 4ZRDA 4EEZA 5LKRA 1CYDA 1YNSA 1Y3DE 4NH0A 4A0SA 4ZGWA 2W4IA 3UANA 1V3VA 5F76A 5C2JB 5JDIC 4C1NA 1KY4A 1QQ6A 4RJ2A 3INGA 4TLMB 5AJVB 4FDVA 5JVDB 3LT2A 1VHTA 5B7GA 4EW2A 4I4TB 2ZAIA 1U2RA 1IB6A 3AESA 3GGCA 2OHXA 4J43A 4QXRA 4M9XA 3DCNA 4WFQA 5HFNA 4HMQA 1TT5A 4NYJQ 3AY7A 5BWBA 3AB8A 5DW0A 4EX7A 1ODIA 5T57A 4BX0A 3BE6A 3H5VA 1P7CA 2XLBA 3C85A 2BOVA 3QLVA 4EEKA 4UTOA 4NCBA 3VQTA 1AJEA 1B2RA 2SCUB 3GEMA 2FUG1 2BFFB 3KCQA 4UAUA 4RQUA 3WYEA 3K0FA 4G37A 1GQOA 1X15A 2Z2ZA 3C3WA 3DPIA 1G7RA 3QW2A 4MLDA 3G17A 2WJ4A 2A59A 3RIMA 1X2EA 5JI2E 4QYXA 5AKYA 2AJCA 4ZZ2A 4WW0A 4WLFA 2IUTA 1TRHA 2W2QA 2ZDHA 3TR6A 3EQ7A 3GW8A 2FUNB 3VM6A 4UOEA 1UK6A 1HT3A 2VRWA 3EUFA 3L79A 4MV3A 5HF8A 5LZ5A 1E5TA 4QTUB 3RUCA 1P7PA 5BR1A 1K98A 2ZRQA 1QGAA 2FPIB 1E2QA 2O06A 4FE4A 4QWMA 4XUEA 4TS4A 3ZHSA 4Z49A 1ECJA 2PH1A 3CNHA 2QX8A 2YN2A 3I83A 2BJHA 1L4KA 3MB5A 1GNVA 2DU8A 3HI4A 3K0HA 3LKZA 4RL4A 1A69A 1XU4A 1OJ7A 5AP9A 2GN1A 3VSBA 2QQGA 1BMFA 2GKOA 3IPXA 4YMIA 2IOFK 2OK8A 2VH2A 1Z8NA 2I29A 4GT1A 1TCUA 3OU6A 3FNRA 3ZWWA 3BERA 3A37A 4JQSA 1W36C 3MTEA 1P5JA 1Z15A 2D2EA 3D6HA 2PJUA 1TCBA 2VXOA 4U4AA 5LOVB 2QRZA 2J87A 2DPHA 4BZZA 4FFPA 2E4WA 2AV6A 3NS7A 3O4FA 4RJLA 3TTVA 2WE7A 3GFBA 1UIMA 1SKYE 1NZDA 1U5BB 4CV3A 1TNDA 3JQ9A 4YJ3F 5K7SA 1CJTC 4UZSA 2WDZA 2PL5A 1ORHA 3O38A 3HA7A 1ENOA 1LBTA 3Q0TA 1KGDA 2BC9A 4JLAA 3TE6A 4JUFA 1JT2A 1CYEA 4WE3A 1IBRA 4MI1A 2JJ1D 1N5OX 5TQ2B 2EP8A 1DWUA 1HFEL 2QZ9A 3UWDA 1QZZA 1DUIA 4UNNA 1IEQA 1OU4