1PSEA

The three-dimensional solution structure of psae from the cyanobacterium synechococcus sp. strain pcc 7002: a photosystem i protein that shows structural homology with sh3 domains
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
b'AIERGSKVKILRKESYWYGDVGTVASIDKSGIIYPVIVRFNKVNYNGFSGSAGGLNTNNFAEHELEVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM I ACCESSORY PROTEIN E
publication title Three-dimensional solution structure of PsaE from the cyanobacterium Synechococcus sp. strain PCC 7002, a photosystem I protein that shows structural homology with SH3 domains.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Photosystem i
total genus 7
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1994-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1pseA00
2WSEE 2CZ0B 3HHTB 4Y28E 1UGSB 3X20B 2CZ7B 2DPPB 2PVGB 4ZGEB 1UGQB 2O01E 2ZPEB 2CYZB 3A8HB 3A8OB 2DXCA 4OB3B 4L6V5 2ZZDA 2ZPGB 1PSFA 3X25B 3QYGB 3VYHB 2DD4A 3QZ9B 1UGPB 1AHJB 3LW5E 1UGRB 2PUKB 2D0QB 3X26B 2AHJB 3X28B 2QDYB 1QP2A 2WSCE 4OB1B 4ZGJB 1QP3A 2ZPIB 4OB0B 2PUOB 4KT0E 3WVEB 3QXEB 1GXIE 2PVDB 2CZ1B 5L8RE 3A8MB 3A8LB 1V29B 3QZ5B 3QYHB 1JB0E 3VYGA 1IREB 2DXBA 2WSFE 3WVDB 2ZPHB 3A8GB 4OB2B 1DJ7B 2CZ6B 4XK8E 3X24B 2DD5A 1PSEA 4RKUE 2ZPBB 2PVOB 4FM4B 2ZCFB 2ZPFB 4ZGDB 2PU9B
chains in the Genus database with same CATH superfamily
1N27A 2LC4A 3QKJA 2YSQA 2EQUA 1WI7A 2E4HA 1WLPB 5LJ5d 2VKNA 4C92E 3G6EA 3SFMA 3X20B 5J39A 2RI2A 1YN8A 1RAIB 4J9HA 1IRXA 3CC2A 1NEBA 2CZ7B 2K3XA 1QKXA 1AVZC 4N4IA 4ZGEB 3CQTA 1UGQB 1VQLT 1OI1A 4PJOF 1NE8A 2K6DA 2ROTA 5IH2A 3D7SB 3CC7Q 3A8OB 3KBGA 3L2ZA 5LJ3d 3FDRA 3UPUA 3EHQA 4RG8A 2J06A 3F70A 1H8KA 4OGCA 5HY6A 3CCJA 3NPFA 1WQ7A 2RM4A 1Y96A 2MYSA 8ATCB 5KYNA 2BUDA 1Q86U 2XI9A 1RL2A 4HA8A 2V1QA 2F2XA 2DZ9A 2PQWA 3VRZA 3PT9A 2M1HA 3MP8A 1K9AA 2JMCA 1M8MA 4M77D 2DTHA 4J7IA 2RHXA 2ENMA 1EIFA 4BUGA 1ACMB 3T9NA 4RTVA 3L2UA 2BIVA 4Z88A 2EKHA 2Y4YA 2DTIA 1GRIA 1HD3A 2JTFA 3MEWA 4XTWA 1FXXA 4M7DB 1M3BA 3CCRQ 2GTJA 2EPDA 4BY6C 2FO0A 1I1JA 1ZBXA 3CCSQ 3TREA 3EGXB 1DJ7B 1D3BA 3RESA 2DE0X 4XU3A 4OMFB 1YBYA 1VQ9A 1RAGB 2GFAA 2ED1A 3JAME 2QGGA 3PTAA 1BI1A 2JS2A 1W1FA 1D1CA 4LDYA 2RK2A 3MJXA 2GTOA 1X27A 3ZL7C 2LNVA 3L42A 4BI3A 4KGVB 3M4GA 5KYUB 5GANg 4FW2A 1VQLQ 3JCMb 3M59A 2MI6A 4BDZA 1P92A 4L5GA 2ABLA 2MWPA 3U23A 1FMKA 2M51A 3VS0A 3EFOA 1WHMA 2KR3A 2XDBA 1BCMA 1SG5A 2RHZA 2E3HA 1VQ8A 4LD9K 3A8HB 4CC3A 2KK4A 2JTMA 3URGA 1RUWA 1QVGP 4L59A 3JB9F 5I2MA 2LCLA 3SWNB 1K9MR 1HXDA 4OGEA 2KYBA 4FYYB 4M7AG 1GCQA 5I22A 1AHJB 2DIQA 2HZYA 3MEVA 4A53A 2LQNA 2RHIA 1OPLA 2XG8D 1Q82C 4OMOA 1RACB 4WTOB 1X2QA 2QQSA 3AHUA 5AT1B 1VQMQ 4M75C 1Q81U 2KRNA 4M77E 2EQJA 4QKUA 1K9MC 3EG2A 3OYJA 5C6SA 3R6OA 3TSZA 4OMMA 1PRLC 3MPUB 2DKGA 4GLKA 1K1ZA 3C94A 1D1AA 2CSIA 4E7ZA 3I35A 4IURA 1VQ5Q 1M90R 4C5GA 1TU0B 3JB9H 2EFIA 2L89A 3CCEA 2DFUA 3OSVA 1BU1A 2LP5A 4KH0B 1VQNA 1FMVA 1VYVA 3E2UA 3G4SA 5CKHA 1WZOA 3VS2A 3VUZA 2E12A 3CCQT 2JVVA 2HD0A 1TUCA 1M3AA 1YJWA 5GANe 1LCKA 4FT2A 1UG1A 3PIPA 2F2WA 1M90C 3MKDA 2IVWA 1YITQ 3VV0A 2VWFA 3TCJA 4ME7A 3KXTA 2R5AA 2HSPA 3L2VA 2NUPA 3I56Q 2HBPA 3UT1A 4JRQA 1YHQQ 3CMAA 1JXMA 3PIOA 2QA4A 4AFSC 4JJDA 4CI0C 2FRWA 4J6WA 2KDSA 1TUDA 3CC2T 2LDMA 3S3OA 1Y96B 5J3BA 4C8QC 2X3XD 2RNAA 2E41A 5GAN2 1VQPA 1SKUB 2EIFA 3OMGA 4D8KA 3OYKA 4M7AC 2LJ3A 2G3RA 4DEXA 1RI0A 4LUEA 1LPLA 4OB1B 4HCZA 2P84A 1ZLMA 4PK4A 3CCJT 3J80E 2E70A 1QWFA 3CCVA 4PFPA 4C92C 1MMAA 4BE2A 1IO6A 1HSQA 1PM3A 1QVPA 2HKNA 4QQDA 4R56A 3M58A 1RAEB 2OX7A 3E1SA 3OMCA 1MGQA 2WSFE 3EH1A 3PFSA 1O9SA 1T0HA 4JJNK 4LUDA 3EG1A 4IUQA 4C5HA 5GAOq 2KQWA 2CS7A 2VASA 1VQ6A 4RKUE 1CKAA 3EGUA 2QK0A 4E7LA 2R5MA 3META 1ZBJA 5AYFA 2LQWA 1G3WA 2X4WA 3WXMB 4LDWA 2X4XA 3V7CA 1WJRA 2K57A 1N8RR 2OTJA 1VQ9T 2QAZA 3I55A 2JS0A 3RKYA 3LWHA 3G6EQ 4QVCA 3FRNA 2KXDA 3RMSA 4ZN1A 2L3PA 3OYDA 4EIKA 1KHIA 2PVGB 5D6YA 4A4FA 2RPNA 4FIBA 2E3IA 2RD1A 5M9OA 1N8RC 2E5KA 2DEQA 2QQRA 5KYWA 1SSHA 3E9GA 1VQ8T 2DYBA 3RNJA 2EW3A 4M78A 1YCYA 3QZ9B 3VYHB 2KSSA 2FHDA 2P0QA 2FPEA 4JPBW 1UDLA 1Y0MA 3VKIA 2DXTA 4DBFA 2EBPA 4EMKB 2E64A 2FB7A 3LGLA 3CCMA 2LVMA 3H9NA 1GL5A 2LRQA 4C0DB 2ATCB 4ZGJB 1EX4A 3UATA 2DZCA 5D6WA 3VS6A 3V8JA 2RQVA 1YJ9A 1M5Q1 2X4YA 4FYWB 1SRMA 2HDAA 1OQKA 5CQYA 3QDFA 2O4XB 4X1VA 4P5NA 3A8MB 4M7DD 3RKXA 1YFNA 2YHTA 1WDXA 4RTXA 1WIEA 2QGFB 1JO8A 1FWZA 3O8VA 4HCKA 1VQ4A 1VQ9Q 2MIOA 2DMOA 1LOJA 4M78E 2CT4A 1PSEA 1IGQA 3CD6Q 3JSCA 2XDPA 4RCCA 3CCET 3JV3A 1KSWA 4E7JA 2H3JA 1MHNA 2SEMA 2LNHB 2W0ZA 1H3HA 1VQNT 3JB9I 3G4ST 4JUVA 5GAOm 3H0FA 5GANd 4M77C 2CP5A 2KMTA 2EQKA 1U1SA 2GCXA 5LJ5f 5KE2A 4HT8A 4D6WA 2ESWA 1N5ZA 1WGSA 4CC7A 4PFZA 1VQ8Q 1M4ZA 1YJWT 4OF1A 2JXBA 2C0OA 4LDUA 2X9HA 3GLXA 1OU8A 3JCMP 4ATOA 2JMAA 2LMJA 4PNOA 4PLIA 2GBQA 2HNIA 2LT1A 2HCKA 4PKCC 1M9SA 5CO7A 4BE1A 3MO8A 5LJ3f 1M27C 2M0OA 4YTLA 3QWXX 2DAQA 3OYEA 2OI3A 1GFDA 2DL8A 4E7HA 2P4TA 1WHJA 3CC4Q 4PJOB 1PSFA 5I2SA 1NPRA 1ZA1B 2L3RA 1GCQC 2FEIA 3QJ6A 1JXOA 5IHKA 3TSWA 1I4K1 2X51A 1OPKA 3OYGA 3CMAT 1PG5B 2D9TA 1ABQA 3HPWA 2QA4T 1TXQA 2V26A 4LN2A 1UGRB 3JCMf 1B3QA 2KAFA 1KC8R 1ZX6A 4XTZA 4GLMA 5FROA 2IG0A 1PC0A 3ER0A 1R77A 4C0ZA 4JRIA 5IHNA 1VQPT 3P8BB 4BDYA 5EC7A 2EWNA 5A2QE 1KG1A 5DM7R 1AD5A 5GAMj 4OP0A 2YT6A 2A28A 3INZA 4C8QA 3UWNA 4M7DE 3LYIA 1IREB 4KGZB 1KC8C 2DVEA 1G3YA 4M7AA 2VXFA 5GMKh 5A0LA 2QQBA 4VUBA 3TVTA 2DD5A 2CKKA 1NJIR 5IXBA 1KJWA 5CVIA 1WHLA 2H3EB 2DILA 3EGDA 1G3SA 1WPYA 1IXDA 4BY6B 1AEYA 1VQ6T 2XICA 2P0PA 3VRYA 1YCSB 2A37A 1QWEA 2O88A 4A63B 1KQ1A 2DJQA 2CP2A 5C0MA 1NJIC 3L1AA 2EQMA 2FPDA 2OTJT 1VUBA 3I55T 1T0JA 2D8HA 1U5SA 5GAMh 4E47A 3VS7A 3PVLA 4J7FA 1SHGA 2EJGA 1YP5A 3PVQA 3OQ5A 1UECA 1VQPQ 1KQSA 4RTUA 3NTIA 1Y07A 4QVZA 3GPLA 5GAOp 2VXEA 3M4YA 5FLXE 3CCVQ 1VA7A 3QG1A 4BE0A 1NEGA 2VVKA 2NLUA 4Q5WA 1M1KU 2HMAA 2KNBB 3MP1A 4N0AA 1VQOA 2DL4A 3QJYA 3CCMT 3FLGA 2F5KA 4ZTJA 5GMKi 4PLLA 4J9BA 2RQRA 4NS5A 5KCOA 4F16A 1YJ9T 2HKQB 3WVDB 1RAHB 1H3ZA 4PL6A 4M75B 2NUZA 3EG9A 3CXCA 1UGVA 3E19A 2LCSA 2NUTA 5GAMd 1ZHIA 4DQ2A 6AT1B 3IQLA 3MP6A 1TTHB 4MMLA 4J8OA 5EG2A 1C1AA 3M5AA 4IUTA 1Q86R 1Y57A 1VQ4T 2OTJQ 3E9FA 3FIFA 1W70A 4OMPA 4B6MA 1PNJA 5GJWB 2RJCA 1YNZA 5GAOr 4II1A 2KRMA 2VUBA 3P8HA 2EGAA 5KH6A 2K2VA 4O5VA 1PKTA 4M7DG 3H6ZA 2QEXA 3OBWA 1KQSS 4XU1A 4HT9A 4RCBA 4F7UB 4XTXA 1K8AU 1Q86C 2COZA 1JRIA 2DXUA 4XTVA 3OYMA 4DA4A 4M77A 4M78C 4HCBA 2COYA 4XTYA 2CP6A 3CMEA 2A3LA 2ZAEA 1XTDA 2DA9A 2MWOA 4A54A 2RHUA 1AWOA 2M16A 2PUKB 3OW2A 3MEUA 2VGNA 2E6NA 4CC4B 4ANJA 5KYYB 2GF7A 5GMKm 1H92A 2CH4A 2HSEB 3CXCS 2PUOB 3OB9A 4FT4A 2YUOA 4B9XA 1M1GA 4BD3A 4IIMA 2DEUA 5L8RE 4C8QB 1X6GA 2IIMA 1VQ7A 4OMLA 1BI3A 2DXBA 2YXYA 3QBYA 1VQ4Q 1FMWA 4AFUC 2A7YA 2K9GA 2JW4A 2R58A 2ZPHB 4HXJA 1QCNA 2CREA 4C92B 4KH1B 3EAEA 1PKSA 4A4GA 1WQWA 2CUDA 1BBZA 2KROA 3M0UA 3EH2A 3FEOA 2MF2A 4XU0A 2RF0A 4M75F 1BIAA 2LCCA 3EGDB 4OMQA 1UFFA 4E7IA 2VGMA 4FCYA 4Z89A 5I21A 4DOVA 3OYYA 2PNIA 3OY9A 3NFCA 4NOYA 2O9SA 2EYWA 4FSXA 4LNPA 4NL2A 1Q81R 5IT9E 3QO3A 4FU6A 5GAOn 3GP8A 2DPPB 3EG3A 3FJPA 1B7TA 1S1NA 1I0CA 3OW2S 3V7RA 3VS3A 2O01E 2J7IA 1X75C 3UF4A 2QG9B 4PJOD 1VOMA 3HKSA 2Y4XA 1M2VA 1X6BA 4Y92A 1VIEA 4F7UF 1AWXA 1FX7A 4RUGA 3CCUT 1Q81C 1J3TA 3P8DA 2DF6A 2QQAA 2K5FA 3TQ7P 3EFRA 4KUIA 3L2RA 4Z8AA 1D1BA 1WXUA 3X28B 1NPPA 5D7UA 2E1HA 4WCIA 4E7KA 3A1PA 2EJFA 5GAN8 1WHGA 2VB6A 1KQSP 4CRIA 3WVEB 2GGRA 3UDCA 2RQUA 4J9CA 2PVDB 2CZ1B 3LLRA 1JJ2A 2AZSA 4RG2A 4PJNA 2LZ6B 3M56A 1ZSZA 2B8AA 4BB7A 4C0GA 5CR2A 3AT1B 3QYHB 2GFUA 2LX9A 4CC2A 1NYGA 1VQOT 2DJZA 2X3WD 2RJDA 5D6XA 4C8QF 2FRYA 2Y90A 1WX6A 2DBKA 2JOYA 2VC8A 5GJVB 4M7AF 1JU5C 1NM7A 2LJ1A 1E6GA 2L3QA 1N6AA 2K79A 3CCQQ 4DEYA 1KHCA 2BE7D 3CXCP 3FB9A 1ARKA 1HK9A 4ZGDB 1M1FA 2KE9A 5GANf 4C92F 2O2OA 2L8DA 3CPFA 2L5QA 1D3BB 3JCMc 2OAUA 5GAMg 4LDVA 2XD0A 1SRLA 2NYSA 5KCHA 1OULA 2K3BA 4X34A 1BB9A 1TG0A 3OYFA 3UA6A 4PJJA 1YWOA 3G7ZA 1PCXA 4M77B 2EGEA 4PJOE 2QEXT 3HTRA 3JB9D 2RI3A 3EFOB 2JT4A 1B07A 3CC2Q 1NLOC 4FYXB 3BY7A 3LW5E 1JJ2S 2XU8A 4E6RA 1H641 2YDLA 2YLCA 2D0QB 1ABOA 3M0QA 2KI7A 1YI2A 4DOWA 2WSCE 2EYXA 2IPOB 3CMET 1BI2A 4KBMB 3CCSA 1VQOQ 3O5ZA 3CCJQ 4N0AC 5GMKe 4J6YA 4J9EA 3OW2P 4LD6A 1XQHA 3OYHA 1UEBA 1K76A 2EGCA 2RQWA 1B34A 2VV5A 4N4HA 4BI8B 3OSSC 2HQXA 3HL8A 3M0PA 3BDLA 2JTEA 1HJDA 3NHNA 2QDLA 4OMNA 1VQ7T 1GCPA 3JB9J 1VIFA 3ZFJA 4PJMA 2D1XA 2DK3A 2FL7A 5KYXA 4AMCA 3L2QA 3MEAA 3VS1A 2GNCA 1VYUA 1KD1U 3CEYA 3QSUA 2AK5A 3JCMW 5GAMe 2RJEA 3ULRB 3H0HA 2F1LA 2V8IA 2KRSA 4J9DA 2RMOA 5CKFA 3M53A 1W2BA 1UE9A 4C5EA 4XQ3A 4QVDA 2OTLA 2QTXA 3BDUA 4MDWA 4R55A 1U3OA 4DBRA 2J6FA 5KE3A 1OV3A 4MZPA 1BKBA 4GBQA 2K2MA 3JRZA 4B9WA 1M2VB 1VQMA 3HFNA 3OYNA 1VYTA 4JRPA 3ZEHA 2V8JA 1K73U 2DBMA 4XU2A 4BACA 4A4EA 2NUPB 3BE3A 2F69A 3EHRA 1OX9A 5CKEA 4M77F 4M7DA 3VJPA 2RB6A 5FU6C 1AWJA 4UC4A 1UHCA 2J6OA 1VQ5A 2K4YA 4OB0B 1UJ0A 4KT0E 2YUNA 5LJ5j 1WJSA 4C0FA 1K73R 2R57A 1GXIE 2OJ2A 2DX1A 1JBMA 3QZ5B 2DTOA 1GBRA 3DB4A 1TH7A 2RN8A 4PJOG 1JB0E 2QQ9A 1SEMA 1CKBA 5KYUA 2FYKA 2CGHA 1KK7A 5LJ3j 1JJ2P 4RTWA 2CZ6B 2RA2A 1YITA 5LL6S 2D8JA 1SSFA 2XKOC 2D0NA 4MZTA 3PMTA 2EYYA 4JS5A 2K5LA 1W2BS 2DL5A 3C0CA 1Q7YU 3V8LA 2CT3A 1S72A 2PVOB 3I56A 3CCEQ 4FYVB 2PU9B 1YJNA 1YHQA 2HEQA 3BFMA 2HQEA 2DL7A 1VQNQ 2KGTA 3G4SQ 4QW2A 1QMCA 3OS2A 1RAAB 1OOTA 2X35A 1QLYA 5DLQE 3GBQA 4ESRA 1NYFA 2EKOA 1YJWQ 2RK1A 2AKKA 3NTKA 1UTIA 5LJ5h 4A4HA 4F17A 2I0NA 3JCMQ 2CYZB 3ME9A 4EPCA 2V8KA 1I8FA 3UA7A 3Q1JA 1MMGA 2RHYA 4KULA 2MMPA 5CQXA 1OZ3A 2L2PA 3QYGB 3REAB 5LJ3h 3PNWC 1ZSGA 1IB8A 3FC3A 2QYZA 3CMAQ 3SB2A 2DO3A 3M55A 2QA4Q 3CCUA 2AHJB 1E7OA 1EFNA 1YIJA 4Z02A 5KYWB 2A0FB 3M0TA 4MDXA 4M78B 3JCMh 1PRMC 1B34B 1YI2T 1ZSZC 4BI4A 5CAIA 1V29B 1KQ2A 2KBTA 2J05A 4AG2C 5GAN3 3CCST 2K7AA 2ED0A 2W10A 5HKCA 3N5BB 1NBEB 3FJ5A 3GNGA 4AG1C 4PJOC 3A8GB 3JB9G 4JJCA 2G6FX 2M02A 2DIGA 3NTHA 3SEMA 3LWIA 1M8VA 3CBOA 1SPKA 2A08A 3DB3A 4ELZC 5KYXB 1MMNA 3HFOA 4J9FA 3ZBDA 2ZCFB 3I5RA 1JEGA 2FPFA 1PD0A 1W4SA 1BK2A 1WHKA 1Y71A 2QI2A 1QVFA 2MPXC 2KEAA 2DRMA 1K4US 2CP7A 3HHTB 2HBWA 4Y28E 2JM9A 4HVWA 4E7SA 4JLGA 1UGSB 1VQ6Q 2LT4A 2E6ZA 1M1KR 2F2VA 2GQVA 4M75G 2P4RA 2EYQA 2E10A 3JCMd 2ECZA 4OVAA 2ZPEB 2E5QA 4LXCA 3I55Q 5A0DA 1V76A 4L6V5 5ECAA 1G8XA 2QXFA 1R0BG 2VYTA 1F1BB 3TU4K 1W2BP 1GFCA 3DKMA 5DY9A 1UHFA 1FYNA 3V7SA 2L3SA 2OTLT 5GAOl 5IAYA 4IUVA 1R8OB 1N9RA 2FZKB 1M1KC 1BCOA 5IXFA 4V2SA 5HK3A 1VQMT 1YI2Q 4ZNXA 4QQGA 1D0XA 5FU7C 3EG0A 2HL3A 1D0YA 2JZ2A 5FW9A 3RR6A 3VS4A 1T3LA 4F7UG 1Q82U 3H0IA 1PHTA 3QXEB 3QPHA 3MCAB 3CD6A 1I5LA 1OZ2A 2ZGWA 1VQ5T 2XK0A 3V8KA 2BZXA 2BZYA 4J6XA 2AIRB 3OYAA 3CCMQ 3CCLA 4IIOA 2PZ1A 1K9MU 1K8AR 4M78F 1QVFS 4J9IA 1MV0B 3A98A 1YJ9Q 1PWTA 4XK8E 2DETA 1IZ6A 3OYCA 2KT8A 3OYLA 1WJQA 1Q82R 1QW1A 2MOXA 4J83A 1D09B 2O9VA 3RBBB 1TOVA 2DERA 1GBQA 4M7AB 1YITT 1N9SA 5FRNA 2CZ0B 1K8AC 1ZQ1A 2K3YA 2KY9A 2QTVA 4J9GA 4C8QG 1AT1B 2M9UA 3CC4A 1Y7XA 2YUQA 4EMHA 3LX7A 1S72T 3I56T 2OTLQ 2FVUA 4D8DA 1EZZB 3NMZC 3DLLA 1YHQT 1YJNT 4LDXA 1M90U 4FL6A 3QIIA 4ZN3A 5A0GA 2HAXA 1U8RA 4JZ4A 4EMKA 4C92G 4K11A 2DXCA 4OB3B 3KUFA 2ZZDA 1LJOA 3OBYA 1Z9QA 1QKWA 1G3TA 1ZUKA 2CP3A 1ZUUA 5CK9A 1WXTA 2O4XA 2KYMA 1NZ9A 3VS5A 3BW1A 4M7DC 1V1CA 1IGUA 5GAN6 1VQKA 2DL3A 3SD4A 1G5VA 2K5IA 4R0KA 4WF2A 1X6OA 4ORZA 4M7DF 1C6VX 1T3SA 1YIJT 3C4SA 4KRTA 2HQHA 4JJBA 2EJ9A 3JCMJ 1W6XA 1Q95G 2FZGB 3QHSA 1XOVA 1O75A 1E6HA 2AKLA 5DLOA 1OYXA 1KIKA 1OX8A 2BTTA 3X24B 1U06A 1WYXA 1RABB 1S72Q 3G71A 3KFVA 2ZPBB 3OS5A 1YJNQ 1MUZA 5J26A 4MZMA 3PGGA 3G6ET 2LX7A 1X2KA 1WXBA 3EG9B 5LJ5g 3SWNC 4IUPA 4PJOA 2COWA 1UUEA 2C0TA 2NUTB 5CKBA 3J81E 2ROLA 3HP9A 4NL3A 3I9QA 2DVJA 1X69A 1QVFP 2P0KA 1HYOA 3TEEA 3A5ZB 5LJ3g 5FWCA 2KT1A 7AT1B 4MMKA 2LQKA 3OS0A 3CC7A 4F04B 4IUUA 1X43A 3RERA 4O6JA 3X25B 2EQIA 1BIBA 1RI9A 2DD4A 4TVRA 4XAXB 4ELYC 2C06A 2EVRA 3CCUQ 1N8RU 3JCMg 1YIJQ 2RO0A 1RLQC 1TS9A 2YWWA 1QP3A 4HVVA 2RQTA 4M78D 2XHCA 2DYIA 5GANj 3HRUA 1TWBA 2J6KA 2WACA 2CH4W 1I81A 4DBQA 3CPWA 1AOJA 4DBHA 4HKEA 3QWYA 1NLPC 3A8LB 5IHIA 4M77G 2MK5A 2GQIA 2LQ8A 2XMFA 1U1TA 1MV3A 2LJ0A 3CCRA 1LNXA 5FU6B 1CSKA 4N4GA 2V1RA 3CD6T 1MNDA 3LGFA 5GMKl 3CCLT 5CKDA 2RI5A 2YRVA 1G2BA 1TUGB 2QASA 4ZTFA 2Z0WA 1MNEA 4RTYA 3M0RA 3CBMA 2BZ8A 5FWBA 3OYIA 4M75D 4RTTA 1M3CA 3L2WA 1QQJA 3M9QA 3PE0A 3QUIA 5LJ5e 4JDSA 3CBPA 1VQLA 4HCCA 2JN0A 1RLPC 2FZCB 8AT1B 3OYBA 4GY5A 3OS1A 2E65A 5GANh 5CCAA 2D6FA 3S3MA 4HVUA 3C12A 1PD1A 2HL5C 2I2LA 2JM8A 5LJ3e 1K0SA 4M4ZA 3M54A 3C95A 2JNGA 3CC4T 3HSBA 2YRCA 5CIUA 9ATCB 2F5TX 1UJYA 3CPWS 2QEXQ 1WA7A 1LVKA 4J5YA 1JQQA 3H8ZA 3JCMe 1I5OB 2CUBA 5FRMA 2A36A 1OU9A 2DRKA 1K0XA 2MCNA 1MMDA 1QP2A 2YUPA 2M0YA 1R0CB 4M75A 1KD1R 1NG2A 2EAYA 1M2OA 3CMEQ 5IN1A 1BI0A 2PTKA 5GAN7 1VQKT 3DLMA 1C0MA 3CCLQ 2DNUA 5L23A 2XIDA 3S6WA 2H8HA 3VYGA 1WNLA 4QT7A 4FW1A 3J7AF 3SHWA 4KGXB 4F14A 3SDZA 2YRDA 3RUXA 1YWPA 1KD1C 4E2FB 3EGXA 2AT1B 4C8QD 4PJLA 4LE9A 3PMIA 3M57A 1KC8U 2RJFA 5GMKj 2CSQA 1VQ7Q 2O31A 3REBB 3GF5A 2B86A 4M7AD 3M0SA 1ZSZB 4FM4B 3RKWA 4F7UA 3MHXA 3GIBA 1AZGB 4Y91A 4JRKA 1ZA2B 3HRTA 1M30A 4FSSA 2WSEE 4RTZA 4X9CA 3RMQA 1SF9A 4M75E 4C92D 5GAN5 4A4KA 3G71T 3THKA 1OEBA 5GAMf 3RDVA 3QDRB 3JCMX 4JLIA 1WFWA 3VUBA 1QVGA 4X9DA 5GAN4 3OA6A 4KUDK 2XDDA 2YLBA 1K73C 1IHVA 2KVQG 4IKFA 4EMKC 3ASKA 3R6NA 1D0ZA 4AFZC 2LTOA 4C0DC 1UB4A 4PFOA 2CP0A 4JZ3A 5KYYA 3VU3C 2ZPGB 1SHFA 1IHWA 1TSFA 1XJWB 1NJIU 4QQ6A 3NGPA 3SWNA 2RH2A 3I5SA 1UGPB 1RAFB 2BKDN 1VQKQ 1RADB 4F7UE 1WHHA 3CCVT 3CC7T 5HCKA 3X26B 4AFQC 1Q7YR 2JJ9A 2QDYB 1X01A 2ZPIB 2CDTA 1BYMA 4C92A 2BE9B 3RIRA 2DM1A 1A0NB 2DLPA 2JUFA 3EFSA 1ZUYA 1G83A 2KXCA 4AT1B 4JS4A 1QCFA 4RMOA 1AWWA 1I07A 2SRCA 3LH0A 2NWMA 3CCQA 5HK0A 5FU7B 1Q7YC 3CPWP 4EDUA 3S3NA 2AZVA 3H41A 4OB2B 4EMGA 2MAMA 1AZEA 2FG0A 1QCOA 3G71Q 5I11A 1Z9ZA 4XTUA 3HRSA 1QVGS 2C0IA 2L0AA 2OAWA 3GNFB 1XNIA 4C8QE 3GOXA 2EYZA 3CCRT 2X4JA 3JCMV 4C5IA 2ZPFB 1KFZA 4M7AE 3LH5A 3G1JA 4M78G
chains in the Genus database with same CATH topology
4C92F 4JUVA 5GAOm 1N27A 2CZ0B 2L8DA 2LC4A 2KMTA 3CPFA 4M77C 2EQKA 2L5QA 5GANd 1K8AC 1U1SA 1ZQ1A 2K3YA 2KY9A 2EQUA 2GCXA 3QKJA 5KE2A 4C8QG 5LJ5f 1D3BB 3JCMc 2OAUA 2M9UA 5LJ5d 4HT8A 4D6WA 5GAMg 4C92E 3G6EA 3CC4A 1Y7XA 1WGSA 4LDVA 4EMHA 3LX7A 1S72T 2XD0A 3SFMA 3X20B 1M4ZA 1YJWT 5J39A 2RI2A 3I56T 4OF1A 2FVUA 5KCHA 3DLLA 4LDUA 3GLXA 1YHQT 1YJNT 3CC2A 4LDXA 3JCMP 2CZ7B 2K3XA 1M90U 4FL6A 4ATOA 3QIIA 4PNOA 4ZN3A 4N4IA 4ZGEB 4PLIA 5A0GA 1UGQB 1VQLT 1OI1A 2HNIA 2LT1A 4PKCC 1M9SA 4X34A 1NE8A 5CO7A 3MO8A 5LJ3f 4C92G 4EMKA 3OYFA 1U8RA 3A8OB 2DXCA 3KBGA 3L2ZA 3KUFA 4OB3B 3FDRA 5LJ3d 3OYEA 2M0OA 4YTLA 2ZZDA 2DAQA 3G7ZA 3UPUA 1LJOA 3OBYA 4RG8A 4M77B 4PJOE 4E7HA 2P4TA 2QEXT 4PJOB 1PSFA 3F70A 5I2SA 3JB9D 1G3TA 1NPRA 2RI3A 4OGCA 5HY6A 2L3RA 3CCJA 3QJ6A 1WQ7A 2RM4A 1I4K1 1Y96A 3OYGA 3CMAT 2BUDA 1Q86U 2XI9A 3BY7A 5CK9A 2O4XA 2D9TA 3LW5E 1JJ2S 1RL2A 2XU8A 3HPWA 1NZ9A 4HA8A 2QA4T 1H641 1UGRB 2YLCA 3BW1A 2DZ9A 2PQWA 4M7DC 3JCMf 2D0QB 3PT9A 5GAN6 2KAFA 2M1HA 3MP8A 1YI2A 4DOWA 1VQKA 4XTZA 3SD4A 1G5VA 4M77D 2WSCE 2DTHA 5FROA 3CMET 1BI2A 2IG0A 4J7IA 4KBMB 2K5IA 3CCSA 4C0ZA 3ER0A 2RHXA 4JRIA 1VQPT 4WF2A 4PJOF 4N0AC 5GMKe 4J6YA 3P8BB 1X6OA 1EIFA 4BUGA 4LD6A 4BDYA 1XQHA 2EWNA 5A2QE 3T9NA 4M7DF 3OYHA 1KG1A 1UEBA 5DM7R 3L2UA 2BIVA 5GAMj 1B34A 4OP0A 1YIJT 2VV5A 4N4HA 3INZA 2Y4YA 3C4SA 4C8QA 2DTIA 2JTFA 3MEWA 4XTWA 3UWNA 1FXXA 2EJ9A 3LYIA 4BI8B 4M7DB 1IREB 4M7DE 3JCMJ 1KC8C 2DVEA 1G3YA 3OSSC 2HQXA 4BY6C 3HL8A 2VXFA 4M7AA 5GMKh 1ZBXA 3BDLA 3TREA 5A0LA 3QHSA 1XOVA 1O75A 1DJ7B 1D3BA 3RESA 1OYXA 4XU3A 5DLOA 4OMFB 1YBYA 1VQ7T 2QQBA 3X24B 1VQ9A 2GFAA 4VUBA 3JAME 2DD5A 3JB9J 1VIFA 3ZFJA 3PTAA 1BI1A 2CKKA 2DK3A 2FL7A 4LDYA 2RK2A 5CVIA 3G71A 2ZPBB 3MEAA 3OS5A 2LNVA 3L42A 4BI3A 1KD1U 5J26A 4MZMA 3M4GA 3PGGA 5GANg 3CEYA 3G6ET 1G3SA 1WPYA 3M59A 3JCMb 3QSUA 2MI6A 4BY6B 4BDZA 1P92A 4L5GA 5LJ5g 2XICA 2MWPA 3SWNC 3JCMW 2P0PA 4IUPA 1VQ6T 5GAMe 4PJOA 2RJEA 2V8IA 5CKBA 3J81E 3HP9A 5CKFA 2XDBA 3M53A 2RHZA 4NL3A 1KQ1A 1W2BA 1VQ8A 5C0MA 1NJIC 3L1AA 2EQMA 4LD9K 2OTJT 4C5EA 1VUBA 4XQ3A 4QVDA 2OTLA 2P0KA 3I55T 3TEEA 2QTXA 3BDUA 4MDWA 4R55A 3A5ZB 5KE3A 5LJ3g 4MZPA 3A8HB 1BKBA 5GAMh 2KK4A 2JTMA 3JRZA 4MMKA 4B9WA 4E47A 3URGA 1VQMA 3HFNA 3OYNA 2LQKA 4J7FA 3OS0A 4L59A 3CC7A 3JB9F 4JRPA 3ZEHA 2V8JA 2EJGA 4IUUA 5I2MA 1K73U 2LCLA 3OQ5A 3SWNB 1HXDA 3RERA 4O6JA 4OGEA 3X25B 1BIBA 2DD4A 4XU2A 4M7AG 4TVRA 4XAXB 4BACA 4ELYC 2C06A 1AHJB 2DIQA 4A4EA 1KQSA 3MEVA 4A53A 3NTIA 1Y07A 2RHIA 4QVZA 1N8RU 2XG8D 3JCMg 1Q82C 2F69A 3GPLA 5CKEA 4M77F 2QQSA 5GAOp 4M7DA 2RO0A 3VJPA 3AHUA 2VXEA 3M4YA 2RB6A 5FLXE 5FU6C 4UC4A 4M75C 1VQ5A 3QG1A 4BE0A 1QP3A 2K4YA 2NLUA 4Q5WA 4OB0B 1Q81U 4M78D 4M77E 2XHCA 1M1KU 2EQJA 5GANj 3HRUA 4KT0E 2WACA 1I81A 3MP1A 1K9MC 4N0AA 3CPWA 1VQOA 5LJ5j 3OYJA 5C6SA 3R6OA 1WJSA 4C0FA 2R57A 1GXIE 3QJYA 4HKEA 3CCMT 3FLGA 2F5KA 3A8LB 4ZTJA 2DKGA 4GLKA 1JBMA 5GMKi 3C94A 2DTOA 3QZ5B 3DB4A 1TH7A 4M77G 4PLLA 4PJOG 1JB0E 2QQ9A 4IURA 4NS5A 5KCOA 4C5GA 1YJ9T 2FYKA 2LQ8A 3WVDB 3JB9H 1H3ZA 1U1TA 2EFIA 2CGHA 2L89A 3CCEA 3CCRA 1LNXA 4PL6A 5FU6B 4M75B 3OSVA 5LJ3j 4N4GA 3CXCA 3E19A 3CD6T 2CZ6B 2RA2A 1YITA 1VQNA 5LL6S 3G4SA 1SSFA 2XKOC 3LGFA 5CKHA 5GAMd 1ZHIA 4MZTA 3VUZA 3PMTA 4DQ2A 2E12A 3MP6A 4MMLA 5GMKl 5FRNA 4J8OA 5EG2A 3CCLT 3CCQT 4JS5A 2K5LA 5CKDA 2RI5A 1W2BS 2YRVA 3M5AA 1Q7YU 2JVVA 3V8LA 4IUTA 4ZTFA 2HD0A 1S72A 2PVOB 1YJWA 3I56A 1VQ4T 3E9FA 3FIFA 5GANe 3CBMA 3OYIA 2PU9B 4M75D 1YJNA 4FT2A 1YHQA 3PIPA 3L2WA 3M9QA 1M90C 3BFMA 3QUIA 2HQEA 2RJCA 4JDSA 5LJ5e 2IVWA 3CBPA 5GAOr 1VQLA 4II1A 2VUBA 3P8HA 4QW2A 4HCCA 5KH6A 2K2VA 3OS2A 1VQNT 4O5VA 2JN0A 3VV0A 2X35A 5DLQE 3TCJA 4M7DG 4ME7A 3KXTA 2R5AA 3H6ZA 3OYBA 2QEXA 4GY5A 3OS1A 2E65A 3OBWA 5GANh 3L2VA 5CCAA 4XU1A 3S3MA 2EKOA 1KQSS 2D6FA 2RK1A 3C12A 4HT9A 2HBPA 4RCBA 4F7UB 2I2LA 3NTKA 4XTXA 3UT1A 4JRQA 4BE1A 1K8AU 5LJ5h 5LJ3e 4A4HA 3CMAA 3JCMQ 2CYZB 3ME9A 1Q86C 1JRIA 3M54A 2DXUA 3PIOA 3C95A 2QA4A 2JNGA 4EPCA 3CC4T 2V8KA 1I8FA 4XTVA 3OYMA 4CI0C 4DA4A 3Q1JA 3HSBA 4J6WA 2KDSA 2RHYA 4M77A 3CC2T 4KULA 2MMPA 2LDMA 4M78C 5CIUA 1OZ3A 5CQXA 3S3OA 4HCBA 2F5TX 4XTYA 1Y96B 5J3BA 3QYGB 3CMEA 2A3LA 3CPWS 4C8QC 2E41A 5GAN2 5LJ3h 1XTDA 2MWOA 3PNWC 1VQPA 2EIFA 4J5YA 4A54A 3FC3A 2RHUA 3H8ZA 3JCMe 3OMGA 2M16A 2PUKB 3OYKA 5FRMA 3SB2A 3OW2A 4M7AC 2G3RA 2DO3A 3M55A 2VGNA 3MEUA 3CCUA 1RI0A 2AHJB 1YIJA 2E6NA 4Z02A 1QP2A 4HCZA 4OB1B 3CCJT 2GF7A 3J80E 2E70A 5GMKm 4M75A 3CCVA 3CXCS 4C92C 2PUOB 3OB9A 2EAYA 4BE2A 4FT4A 5IN1A 4B9XA 1QVPA 4MDXA 1BI0A 4M78B 3JCMh 1M1GA 4QQDA 4R56A 4BD3A 1B34B 5GAN7 1YI2T 3DLMA 3M58A 1VQKT 5L8RE 4C8QB 4BI4A 5CAIA 1V29B 1VQ7A 1KQ2A 2XIDA 3E1SA 3OMCA 3CCST 5GAN3 1MGQA 3S6WA 1BI3A 3VYGA 1WNLA 2DXBA 3J7AF 5HKCA 2WSFE 3QBYA 3N5BB 2A7YA 3GNGA 4PJOC 2R58A 2ZPHB 3A8GB 3PFSA 3JB9G 1O9SA 3SDZA 4JJNK 3RUXA 2DIGA 3NTHA 1KD1C 4IUQA 3LWIA 4C92B 4C5HA 5GAOq 1M8VA 3CBOA 3EAEA 4A4GA 1WQWA 4C8QD 2KQWA 2CS7A 3DB3A 3PMIA 1VQ6A 4ELZC 4RKUE 3M57A 1KC8U 2RJFA 3FEOA 5GMKj 4E7LA 2R5MA 3META 3HFOA 2MF2A 5AYFA 3GF5A 4M7AD 1G3WA 2X4WA 4XU0A 3WXMB 4FM4B 3RKWA 4M75F 3ZBDA 3MHXA 4F7UA 3GIBA 1BIAA 2ZCFB 4LDWA 2LCCA 4Y91A 4JRKA 3HRTA 4E7IA 2VGMA 2X4XA 3V7CA 1WJRA 2K57A 1W4SA 2OTJA 4X9CA 2WSEE 1Y71A 2QI2A 1VQ9T 3RMQA 5I21A 3I55A 1QVFA 3RKYA 4M75E 4DOVA 3LWHA 3OYYA 4C92D 4QVCA 5GAN5 3OY9A 3HHTB 3NFCA 4Y28E 3FRNA 4NOYA 4A4KA 4JLGA 3G71T 4FSXA 1UGSB 5GAMf 4NL2A 3QDRB 3JCMX 2LT4A 4JLIA 3RMSA 5IT9E 2E6ZA 3VUBA 4ZN1A 4X9DA 3QO3A 4FU6A 1QVGA 5GAN4 3OYDA 3OA6A 5GAOn 4KUDK 2XDDA 3GP8A 2YLBA 2DPPB 2GQVA 1K73C 3FJPA 1KHIA 4M75G 2KVQG 4IKFA 3OW2S 4EMKC 2PVGB 3ASKA 2EYQA 2E10A 5D6YA 3V7RA 2O01E 3JCMd 4OVAA 1X75C 4A4FA 2ZPEB 2LTOA 4FIBA 4C0DC 2E5QA 1UB4A 2RD1A 5M9OA 4PJOD 5A0DA 4L6V5 1N8RC 2DEQA 3VU3C 2QQRA 2Y4XA 2ZPGB 3HKSA 2QXFA 2VYTA 3TU4K 3E9GA 1VQ8T 3DKMA 5DY9A 1NJIU 4QQ6A 1VIEA 3V7SA 2OTLT 3SWNA 5GAOl 5IAYA 4M78A 4IUVA 4F7UF 1R8OB 1FX7A 1YCYA 2RH2A 3QZ9B 1N9RA 1UGPB 2KSSA 2FHDA 3VYHB 3CCUT 1Q81C 1M1KC 2BKDN 2P0QA 3P8DA 4V2SA 2QQAA 3VKIA 5HK3A 2K5FA 1VQMT 2DXTA 4F7UE 3EFRA 3CCVT 4QQGA 3CC7T 5FU7C 4KUIA 3X26B 3L2RA 4EMKB 2E64A 2FB7A 3LGLA 3CCMA 2LVMA 2JZ2A 3X28B 2QDYB 2LRQA 1NPPA 4C0DB 2E1HA 4ZGJB 4E7KA 1X01A 2EJFA 2ZPIB 5GAN8 2DZCA 5D6WA 3V8JA 1BYMA 4CRIA 1YJ9A 1M5Q1 3WVEB 4F7UG 4C92A 2X4YA 3RIRA 3UDCA 1Q82U 5CQYA 3QXEB 2JUFA 2O4XB 3EFSA 3QPHA 2PVDB 2CZ1B 3LLRA 3MCAB 4P5NA 1JJ2A 3A8MB 3CD6A 1I5LA 4RG2A 1OZ2A 3RKXA 4JS4A 4M7DD 2ZGWA 1VQ5T 2YHTA 4RMOA 2XK0A 3V8KA 3M56A 4J6XA 3OYAA 2B8AA 3LH0A 4BB7A 4C0GA 3QYHB 5CR2A 3CCLA 3CCQA 5HK0A 2GFUA 5FU7B 2LX9A 1Q7YC 1FWZA 1K9MU 3O8VA 1VQOT 2DJZA 4M78F 4EDUA 1QVFS 3S3NA 1VQ4A 4OB2B 2RJDA 5D6XA 4C8QF 4XK8E 2MAMA 4EMGA 1LOJA 2Y90A 1IZ6A 4M78E 3OYCA 1PSEA 2JOYA 2VC8A 4XTUA 3HRSA 1QVGS 3JSCA 2XDPA 3OYLA 4M7AF 1WJQA 3GNFB 1XNIA 4RCCA 4C8QE 3GOXA 1N6AA 3CCET 1QW1A 3CCRT 4J83A 2X4JA 1KHCA 4E7JA 2H3JA 1MHNA 3FB9A 1HK9A 2ZPFB 3JCMV 4C5IA 1M1FA 4ZGDB 2HAXA 4M7AE 4M7AB 3L2QA 1YITT 5GANf 3JB9I 1N9SA 3G4ST 4M78G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSE E;  2CZ0 B;  3HHT B;  4Y28 E;  1UGS B;  3X20 B;  2CZ7 B;  2DPP B;  2PVG B;  4ZGE B;  1UGQ B;  2O01 E;  2ZPE B;  2CYZ B;  3A8H B;  3A8O B;  2DXC A;  4OB3 B;  4L6V 5;  2ZZD A;  2ZPG B;  1PSF A;  3X25 B;  3QYG B;  3VYH B;  2DD4 A;  3QZ9 B;  1UGP B;  1AHJ B;  3LW5 E;  1UGR B;  2PUK B;  2D0Q B;  3X26 B;  2AHJ B;  3X28 B;  2QDY B;  1QP2 A;  2WSC E;  4OB1 B;  4ZGJ B;  1QP3 A;  2ZPI B;  4OB0 B;  2PUO B;  4KT0 E;  3WVE B;  3QXE B;  1GXI E;  2PVD B;  2CZ1 B;  5L8R E;  3A8M B;  3A8L B;  1V29 B;  3QZ5 B;  3QYH B;  1JB0 E;  3VYG A;  1IRE B;  2DXB A;  2WSF E;  3WVD B;  2ZPH B;  3A8G B;  4OB2 B;  1DJ7 B;  2CZ6 B;  4XK8 E;  3X24 B;  2DD5 A;  1PSE A;  4RKU E;  2ZPB B;  2PVO B;  4FM4 B;  2ZCF B;  2ZPF B;  4ZGD B;  2PU9 B; 
#chains in the Genus database with same CATH topology
 1N27 A;  2LC4 A;  3QKJ A;  2YSQ A;  2EQU A;  1WI7 A;  2E4H A;  1WLP B;  5LJ5 d;  2VKN A;  4C92 E;  3G6E A;  3SFM A;  3X20 B;  5J39 A;  2RI2 A;  1YN8 A;  1RAI B;  4J9H A;  1IRX A;  3CC2 A;  1NEB A;  2CZ7 B;  2K3X A;  1QKX A;  1AVZ C;  4N4I A;  4ZGE B;  3CQT A;  1UGQ B;  1VQL T;  1OI1 A;  4PJO F;  1NE8 A;  2K6D A;  2ROT A;  5IH2 A;  3D7S B;  3CC7 Q;  3A8O B;  3KBG A;  3L2Z A;  5LJ3 d;  3FDR A;  3UPU A;  3EHQ A;  4RG8 A;  2J06 A;  3F70 A;  1H8K A;  4OGC A;  5HY6 A;  3CCJ A;  3NPF A;  1WQ7 A;  2RM4 A;  1Y96 A;  2MYS A;  8ATC B;  5KYN A;  2BUD A;  1Q86 U;  2XI9 A;  1RL2 A;  4HA8 A;  2V1Q A;  2F2X A;  2DZ9 A;  2PQW A;  3VRZ A;  3PT9 A;  2M1H A;  3MP8 A;  1K9A A;  2JMC A;  1M8M A;  4M77 D;  2DTH A;  4J7I A;  2RHX A;  2ENM A;  1EIF A;  4BUG A;  1ACM B;  3T9N A;  4RTV A;  3L2U A;  2BIV A;  4Z88 A;  2EKH A;  2Y4Y A;  2DTI A;  1GRI A;  1HD3 A;  2JTF A;  3MEW A;  4XTW A;  1FXX A;  4M7D B;  1M3B A;  3CCR Q;  2GTJ A;  2EPD A;  4BY6 C;  2FO0 A;  1I1J A;  1ZBX A;  3CCS Q;  3TRE A;  3EGX B;  1DJ7 B;  1D3B A;  3RES A;  2DE0 X;  4XU3 A;  4OMF B;  1YBY A;  1VQ9 A;  1RAG B;  2GFA A;  2ED1 A;  3JAM E;  2QGG A;  3PTA A;  1BI1 A;  2JS2 A;  1W1F A;  1D1C A;  4LDY A;  2RK2 A;  3MJX A;  2GTO A;  1X27 A;  3ZL7 C;  2LNV A;  3L42 A;  4BI3 A;  4KGV B;  3M4G A;  5KYU B;  5GAN g;  4FW2 A;  1VQL Q;  3JCM b;  3M59 A;  2MI6 A;  4BDZ A;  1P92 A;  4L5G A;  2ABL A;  2MWP A;  3U23 A;  1FMK A;  2M51 A;  3VS0 A;  3EFO A;  1WHM A;  2KR3 A;  2XDB A;  1BCM A;  1SG5 A;  2RHZ A;  2E3H A;  1VQ8 A;  4LD9 K;  3A8H B;  4CC3 A;  2KK4 A;  2JTM A;  3URG A;  1RUW A;  1QVG P;  4L59 A;  3JB9 F;  5I2M A;  2LCL A;  3SWN B;  1K9M R;  1HXD A;  4OGE A;  2KYB A;  4FYY B;  4M7A G;  1GCQ A;  5I22 A;  1AHJ B;  2DIQ A;  2HZY A;  3MEV A;  4A53 A;  2LQN A;  2RHI A;  1OPL A;  2XG8 D;  1Q82 C;  4OMO A;  1RAC B;  4WTO B;  1X2Q A;  2QQS A;  3AHU A;  5AT1 B;  1VQM Q;  4M75 C;  1Q81 U;  2KRN A;  4M77 E;  2EQJ A;  4QKU A;  1K9M C;  3EG2 A;  3OYJ A;  5C6S A;  3R6O A;  3TSZ A;  4OMM A;  1PRL C;  3MPU B;  2DKG A;  4GLK A;  1K1Z A;  3C94 A;  1D1A A;  2CSI A;  4E7Z A;  3I35 A;  4IUR A;  1VQ5 Q;  1M90 R;  4C5G A;  1TU0 B;  3JB9 H;  2EFI A;  2L89 A;  3CCE A;  2DFU A;  3OSV A;  1BU1 A;  2LP5 A;  4KH0 B;  1VQN A;  1FMV A;  1VYV A;  3E2U A;  3G4S A;  5CKH A;  1WZO A;  3VS2 A;  3VUZ A;  2E12 A;  3CCQ T;  2JVV A;  2HD0 A;  1TUC A;  1M3A A;  1YJW A;  5GAN e;  1LCK A;  4FT2 A;  1UG1 A;  3PIP A;  2F2W A;  1M90 C;  3MKD A;  2IVW A;  1YIT Q;  3VV0 A;  2VWF A;  3TCJ A;  4ME7 A;  3KXT A;  2R5A A;  2HSP A;  3L2V A;  2NUP A;  3I56 Q;  2HBP A;  3UT1 A;  4JRQ A;  1YHQ Q;  3CMA A;  1JXM A;  3PIO A;  2QA4 A;  4AFS C;  4JJD A;  4CI0 C;  2FRW A;  4J6W A;  2KDS A;  1TUD A;  3CC2 T;  2LDM A;  3S3O A;  1Y96 B;  5J3B A;  4C8Q C;  2X3X D;  2RNA A;  2E41 A;  5GAN 2;  1VQP A;  1SKU B;  2EIF A;  3OMG A;  4D8K A;  3OYK A;  4M7A C;  2LJ3 A;  2G3R A;  4DEX A;  1RI0 A;  4LUE A;  1LPL A;  4OB1 B;  4HCZ A;  2P84 A;  1ZLM A;  4PK4 A;  3CCJ T;  3J80 E;  2E70 A;  1QWF A;  3CCV A;  4PFP A;  4C92 C;  1MMA A;  4BE2 A;  1IO6 A;  1HSQ A;  1PM3 A;  1QVP A;  2HKN A;  4QQD A;  4R56 A;  3M58 A;  1RAE B;  2OX7 A;  3E1S A;  3OMC A;  1MGQ A;  2WSF E;  3EH1 A;  3PFS A;  1O9S A;  1T0H A;  4JJN K;  4LUD A;  3EG1 A;  4IUQ A;  4C5H A;  5GAO q;  2KQW A;  2CS7 A;  2VAS A;  1VQ6 A;  4RKU E;  1CKA A;  3EGU A;  2QK0 A;  4E7L A;  2R5M A;  3MET A;  1ZBJ A;  5AYF A;  2LQW A;  1G3W A;  2X4W A;  3WXM B;  4LDW A;  2X4X A;  3V7C A;  1WJR A;  2K57 A;  1N8R R;  2OTJ A;  1VQ9 T;  2QAZ A;  3I55 A;  2JS0 A;  3RKY A;  3LWH A;  3G6E Q;  4QVC A;  3FRN A;  2KXD A;  3RMS A;  4ZN1 A;  2L3P A;  3OYD A;  4EIK A;  1KHI A;  2PVG B;  5D6Y A;  4A4F A;  2RPN A;  4FIB A;  2E3I A;  2RD1 A;  5M9O A;  1N8R C;  2E5K A;  2DEQ A;  2QQR A;  5KYW A;  1SSH A;  3E9G A;  1VQ8 T;  2DYB A;  3RNJ A;  2EW3 A;  4M78 A;  1YCY A;  3QZ9 B;  3VYH B;  2KSS A;  2FHD A;  2P0Q A;  2FPE A;  4JPB W;  1UDL A;  1Y0M A;  3VKI A;  2DXT A;  4DBF A;  2EBP A;  4EMK B;  2E64 A;  2FB7 A;  3LGL A;  3CCM A;  2LVM A;  3H9N A;  1GL5 A;  2LRQ A;  4C0D B;  2ATC B;  4ZGJ B;  1EX4 A;  3UAT A;  2DZC A;  5D6W A;  3VS6 A;  3V8J A;  2RQV A;  1YJ9 A;  1M5Q 1;  2X4Y A;  4FYW B;  1SRM A;  2HDA A;  1OQK A;  5CQY A;  3QDF A;  2O4X B;  4X1V A;  4P5N A;  3A8M B;  4M7D D;  3RKX A;  1YFN A;  2YHT A;  1WDX A;  4RTX A;  1WIE A;  2QGF B;  1JO8 A;  1FWZ A;  3O8V A;  4HCK A;  1VQ4 A;  1VQ9 Q;  2MIO A;  2DMO A;  1LOJ A;  4M78 E;  2CT4 A;  1PSE A;  1IGQ A;  3CD6 Q;  3JSC A;  2XDP A;  4RCC A;  3CCE T;  3JV3 A;  1KSW A;  4E7J A;  2H3J A;  1MHN A;  2SEM A;  2LNH B;  2W0Z A;  1H3H A;  1VQN T;  3JB9 I;  3G4S T;  4JUV A;  5GAO m;  3H0F A;  5GAN d;  4M77 C;  2CP5 A;  2KMT A;  2EQK A;  1U1S A;  2GCX A;  5LJ5 f;  5KE2 A;  4HT8 A;  4D6W A;  2ESW A;  1N5Z A;  1WGS A;  4CC7 A;  4PFZ A;  1VQ8 Q;  1M4Z A;  1YJW T;  4OF1 A;  2JXB A;  2C0O A;  4LDU A;  2X9H A;  3GLX A;  1OU8 A;  3JCM P;  4ATO A;  2JMA A;  2LMJ A;  4PNO A;  4PLI A;  2GBQ A;  2HNI A;  2LT1 A;  2HCK A;  4PKC C;  1M9S A;  5CO7 A;  4BE1 A;  3MO8 A;  5LJ3 f;  1M27 C;  2M0O A;  4YTL A;  3QWX X;  2DAQ A;  3OYE A;  2OI3 A;  1GFD A;  2DL8 A;  4E7H A;  2P4T A;  1WHJ A;  3CC4 Q;  4PJO B;  1PSF A;  5I2S A;  1NPR A;  1ZA1 B;  2L3R A;  1GCQ C;  2FEI A;  3QJ6 A;  1JXO A;  5IHK A;  3TSW A;  1I4K 1;  2X51 A;  1OPK A;  3OYG A;  3CMA T;  1PG5 B;  2D9T A;  1ABQ A;  3HPW A;  2QA4 T;  1TXQ A;  2V26 A;  4LN2 A;  1UGR B;  3JCM f;  1B3Q A;  2KAF A;  1KC8 R;  1ZX6 A;  4XTZ A;  4GLM A;  5FRO A;  2IG0 A;  1PC0 A;  3ER0 A;  1R77 A;  4C0Z A;  4JRI A;  5IHN A;  1VQP T;  3P8B B;  4BDY A;  5EC7 A;  2EWN A;  5A2Q E;  1KG1 A;  5DM7 R;  1AD5 A;  5GAM j;  4OP0 A;  2YT6 A;  2A28 A;  3INZ A;  4C8Q A;  3UWN A;  4M7D E;  3LYI A;  1IRE B;  4KGZ B;  1KC8 C;  2DVE A;  1G3Y A;  4M7A A;  2VXF A;  5GMK h;  5A0L A;  2QQB A;  4VUB A;  3TVT A;  2DD5 A;  2CKK A;  1NJI R;  5IXB A;  1KJW A;  5CVI A;  1WHL A;  2H3E B;  2DIL A;  3EGD A;  1G3S A;  1WPY A;  1IXD A;  4BY6 B;  1AEY A;  1VQ6 T;  2XIC A;  2P0P A;  3VRY A;  1YCS B;  2A37 A;  1QWE A;  2O88 A;  4A63 B;  1KQ1 A;  2DJQ A;  2CP2 A;  5C0M A;  1NJI C;  3L1A A;  2EQM A;  2FPD A;  2OTJ T;  1VUB A;  3I55 T;  1T0J A;  2D8H A;  1U5S A;  5GAM h;  4E47 A;  3VS7 A;  3PVL A;  4J7F A;  1SHG A;  2EJG A;  1YP5 A;  3PVQ A;  3OQ5 A;  1UEC A;  1VQP Q;  1KQS A;  4RTU A;  3NTI A;  1Y07 A;  4QVZ A;  3GPL A;  5GAO p;  2VXE A;  3M4Y A;  5FLX E;  3CCV Q;  1VA7 A;  3QG1 A;  4BE0 A;  1NEG A;  2VVK A;  2NLU A;  4Q5W A;  1M1K U;  2HMA A;  2KNB B;  3MP1 A;  4N0A A;  1VQO A;  2DL4 A;  3QJY A;  3CCM T;  3FLG A;  2F5K A;  4ZTJ A;  5GMK i;  4PLL A;  4J9B A;  2RQR A;  4NS5 A;  5KCO A;  4F16 A;  1YJ9 T;  2HKQ B;  3WVD B;  1RAH B;  1H3Z A;  4PL6 A;  4M75 B;  2NUZ A;  3EG9 A;  3CXC A;  1UGV A;  3E19 A;  2LCS A;  2NUT A;  5GAM d;  1ZHI A;  4DQ2 A;  6AT1 B;  3IQL A;  3MP6 A;  1TTH B;  4MML A;  4J8O A;  5EG2 A;  1C1A A;  3M5A A;  4IUT A;  1Q86 R;  1Y57 A;  1VQ4 T;  2OTJ Q;  3E9F A;  3FIF A;  1W70 A;  4OMP A;  4B6M A;  1PNJ A;  5GJW B;  2RJC A;  1YNZ A;  5GAO r;  4II1 A;  2KRM A;  2VUB A;  3P8H A;  2EGA A;  5KH6 A;  2K2V A;  4O5V A;  1PKT A;  4M7D G;  3H6Z A;  2QEX A;  3OBW A;  1KQS S;  4XU1 A;  4HT9 A;  4RCB A;  4F7U B;  4XTX A;  1K8A U;  1Q86 C;  2COZ A;  1JRI A;  2DXU A;  4XTV A;  3OYM A;  4DA4 A;  4M77 A;  4M78 C;  4HCB A;  2COY A;  4XTY A;  2CP6 A;  3CME A;  2A3L A;  2ZAE A;  1XTD A;  2DA9 A;  2MWO A;  4A54 A;  2RHU A;  1AWO A;  2M16 A;  2PUK B;  3OW2 A;  3MEU A;  2VGN A;  2E6N A;  4CC4 B;  4ANJ A;  5KYY B;  2GF7 A;  5GMK m;  1H92 A;  2CH4 A;  2HSE B;  3CXC S;  2PUO B;  3OB9 A;  4FT4 A;  2YUO A;  4B9X A;  1M1G A;  4BD3 A;  4IIM A;  2DEU A;  5L8R E;  4C8Q B;  1X6G A;  2IIM A;  1VQ7 A;  4OML A;  1BI3 A;  2DXB A;  2YXY A;  3QBY A;  1VQ4 Q;  1FMW A;  4AFU C;  2A7Y A;  2K9G A;  2JW4 A;  2R58 A;  2ZPH B;  4HXJ A;  1QCN A;  2CRE A;  4C92 B;  4KH1 B;  3EAE A;  1PKS A;  4A4G A;  1WQW A;  2CUD A;  1BBZ A;  2KRO A;  3M0U A;  3EH2 A;  3FEO A;  2MF2 A;  4XU0 A;  2RF0 A;  4M75 F;  1BIA A;  2LCC A;  3EGD B;  4OMQ A;  1UFF A;  4E7I A;  2VGM A;  4FCY A;  4Z89 A;  5I21 A;  4DOV A;  3OYY A;  2PNI A;  3OY9 A;  3NFC A;  4NOY A;  2O9S A;  2EYW A;  4FSX A;  4LNP A;  4NL2 A;  1Q81 R;  5IT9 E;  3QO3 A;  4FU6 A;  5GAO n;  3GP8 A;  2DPP B;  3EG3 A;  3FJP A;  1B7T A;  1S1N A;  1I0C A;  3OW2 S;  3V7R A;  3VS3 A;  2O01 E;  2J7I A;  1X75 C;  3UF4 A;  2QG9 B;  4PJO D;  1VOM A;  3HKS A;  2Y4X A;  1M2V A;  1X6B A;  4Y92 A;  1VIE A;  4F7U F;  1AWX A;  1FX7 A;  4RUG A;  3CCU T;  1Q81 C;  1J3T A;  3P8D A;  2DF6 A;  2QQA A;  2K5F A;  3TQ7 P;  3EFR A;  4KUI A;  3L2R A;  4Z8A A;  1D1B A;  1WXU A;  3X28 B;  1NPP A;  5D7U A;  2E1H A;  4WCI A;  4E7K A;  3A1P A;  2EJF A;  5GAN 8;  1WHG A;  2VB6 A;  1KQS P;  4CRI A;  3WVE B;  2GGR A;  3UDC A;  2RQU A;  4J9C A;  2PVD B;  2CZ1 B;  3LLR A;  1JJ2 A;  2AZS A;  4RG2 A;  4PJN A;  2LZ6 B;  3M56 A;  1ZSZ A;  2B8A A;  4BB7 A;  4C0G A;  5CR2 A;  3AT1 B;  3QYH B;  2GFU A;  2LX9 A;  4CC2 A;  1NYG A;  1VQO T;  2DJZ A;  2X3W D;  2RJD A;  5D6X A;  4C8Q F;  2FRY A;  2Y90 A;  1WX6 A;  2DBK A;  2JOY A;  2VC8 A;  5GJV B;  4M7A F;  1JU5 C;  1NM7 A;  2LJ1 A;  1E6G A;  2L3Q A;  1N6A A;  2K79 A;  3CCQ Q;  4DEY A;  1KHC A;  2BE7 D;  3CXC P;  3FB9 A;  1ARK A;  1HK9 A;  4ZGD B;  1M1F A;  2KE9 A;  5GAN f;  4C92 F;  2O2O A;  2L8D A;  3CPF A;  2L5Q A;  1D3B B;  3JCM c;  2OAU A;  5GAM g;  4LDV A;  2XD0 A;  1SRL A;  2NYS A;  5KCH A;  1OUL A;  2K3B A;  4X34 A;  1BB9 A;  1TG0 A;  3OYF A;  3UA6 A;  4PJJ A;  1YWO A;  3G7Z A;  1PCX A;  4M77 B;  2EGE A;  4PJO E;  2QEX T;  3HTR A;  3JB9 D;  2RI3 A;  3EFO B;  2JT4 A;  1B07 A;  3CC2 Q;  1NLO C;  4FYX B;  3BY7 A;  3LW5 E;  1JJ2 S;  2XU8 A;  4E6R A;  1H64 1;  2YDL A;  2YLC A;  2D0Q B;  1ABO A;  3M0Q A;  2KI7 A;  1YI2 A;  4DOW A;  2WSC E;  2EYX A;  2IPO B;  3CME T;  1BI2 A;  4KBM B;  3CCS A;  1VQO Q;  3O5Z A;  3CCJ Q;  4N0A C;  5GMK e;  4J6Y A;  4J9E A;  3OW2 P;  4LD6 A;  1XQH A;  3OYH A;  1UEB A;  1K76 A;  2EGC A;  2RQW A;  1B34 A;  2VV5 A;  4N4H A;  4BI8 B;  3OSS C;  2HQX A;  3HL8 A;  3M0P A;  3BDL A;  2JTE A;  1HJD A;  3NHN A;  2QDL A;  4OMN A;  1VQ7 T;  1GCP A;  3JB9 J;  1VIF A;  3ZFJ A;  4PJM A;  2D1X A;  2DK3 A;  2FL7 A;  5KYX A;  4AMC A;  3L2Q A;  3MEA A;  3VS1 A;  2GNC A;  1VYU A;  1KD1 U;  3CEY A;  3QSU A;  2AK5 A;  3JCM W;  5GAM e;  2RJE A;  3ULR B;  3H0H A;  2F1L A;  2V8I A;  2KRS A;  4J9D A;  2RMO A;  5CKF A;  3M53 A;  1W2B A;  1UE9 A;  4C5E A;  4XQ3 A;  4QVD A;  2OTL A;  2QTX A;  3BDU A;  4MDW A;  4R55 A;  1U3O A;  4DBR A;  2J6F A;  5KE3 A;  1OV3 A;  4MZP A;  1BKB A;  4GBQ A;  2K2M A;  3JRZ A;  4B9W A;  1M2V B;  1VQM A;  3HFN A;  3OYN A;  1VYT A;  4JRP A;  3ZEH A;  2V8J A;  1K73 U;  2DBM A;  4XU2 A;  4BAC A;  4A4E A;  2NUP B;  3BE3 A;  2F69 A;  3EHR A;  1OX9 A;  5CKE A;  4M77 F;  4M7D A;  3VJP A;  2RB6 A;  5FU6 C;  1AWJ A;  4UC4 A;  1UHC A;  2J6O A;  1VQ5 A;  2K4Y A;  4OB0 B;  1UJ0 A;  4KT0 E;  2YUN A;  5LJ5 j;  1WJS A;  4C0F A;  1K73 R;  2R57 A;  1GXI E;  2OJ2 A;  2DX1 A;  1JBM A;  3QZ5 B;  2DTO A;  1GBR A;  3DB4 A;  1TH7 A;  2RN8 A;  4PJO G;  1JB0 E;  2QQ9 A;  1SEM A;  1CKB A;  5KYU A;  2FYK A;  2CGH A;  1KK7 A;  5LJ3 j;  1JJ2 P;  4RTW A;  2CZ6 B;  2RA2 A;  1YIT A;  5LL6 S;  2D8J A;  1SSF A;  2XKO C;  2D0N A;  4MZT A;  3PMT A;  2EYY A;  4JS5 A;  2K5L A;  1W2B S;  2DL5 A;  3C0C A;  1Q7Y U;  3V8L A;  2CT3 A;  1S72 A;  2PVO B;  3I56 A;  3CCE Q;  4FYV B;  2PU9 B;  1YJN A;  1YHQ A;  2HEQ A;  3BFM A;  2HQE A;  2DL7 A;  1VQN Q;  2KGT A;  3G4S Q;  4QW2 A;  1QMC A;  3OS2 A;  1RAA B;  1OOT A;  2X35 A;  1QLY A;  5DLQ E;  3GBQ A;  4ESR A;  1NYF A;  2EKO A;  1YJW Q;  2RK1 A;  2AKK A;  3NTK A;  1UTI A;  5LJ5 h;  4A4H A;  4F17 A;  2I0N A;  3JCM Q;  2CYZ B;  3ME9 A;  4EPC A;  2V8K A;  1I8F A;  3UA7 A;  3Q1J A;  1MMG A;  2RHY A;  4KUL A;  2MMP A;  5CQX A;  1OZ3 A;  2L2P A;  3QYG B;  3REA B;  5LJ3 h;  3PNW C;  1ZSG A;  1IB8 A;  3FC3 A;  2QYZ A;  3CMA Q;  3SB2 A;  2DO3 A;  3M55 A;  2QA4 Q;  3CCU A;  2AHJ B;  1E7O A;  1EFN A;  1YIJ A;  4Z02 A;  5KYW B;  2A0F B;  3M0T A;  4MDX A;  4M78 B;  3JCM h;  1PRM C;  1B34 B;  1YI2 T;  1ZSZ C;  4BI4 A;  5CAI A;  1V29 B;  1KQ2 A;  2KBT A;  2J05 A;  4AG2 C;  5GAN 3;  3CCS T;  2K7A A;  2ED0 A;  2W10 A;  5HKC A;  3N5B B;  1NBE B;  3FJ5 A;  3GNG A;  4AG1 C;  4PJO C;  3A8G B;  3JB9 G;  4JJC A;  2G6F X;  2M02 A;  2DIG A;  3NTH A;  3SEM A;  3LWI A;  1M8V A;  3CBO A;  1SPK A;  2A08 A;  3DB3 A;  4ELZ C;  5KYX B;  1MMN A;  3HFO A;  4J9F A;  3ZBD A;  2ZCF B;  3I5R A;  1JEG A;  2FPF A;  1PD0 A;  1W4S A;  1BK2 A;  1WHK A;  1Y71 A;  2QI2 A;  1QVF A;  2MPX C;  2KEA A;  2DRM A;  1K4U S;  2CP7 A;  3HHT B;  2HBW A;  4Y28 E;  2JM9 A;  4HVW A;  4E7S A;  4JLG A;  1UGS B;  1VQ6 Q;  2LT4 A;  2E6Z A;  1M1K R;  2F2V A;  2GQV A;  4M75 G;  2P4R A;  2EYQ A;  2E10 A;  3JCM d;  2ECZ A;  4OVA A;  2ZPE B;  2E5Q A;  4LXC A;  3I55 Q;  5A0D A;  1V76 A;  4L6V 5;  5ECA A;  1G8X A;  2QXF A;  1R0B G;  2VYT A;  1F1B B;  3TU4 K;  1W2B P;  1GFC A;  3DKM A;  5DY9 A;  1UHF A;  1FYN A;  3V7S A;  2L3S A;  2OTL T;  5GAO l;  5IAY A;  4IUV A;  1R8O B;  1N9R A;  2FZK B;  1M1K C;  1BCO A;  5IXF A;  4V2S A;  5HK3 A;  1VQM T;  1YI2 Q;  4ZNX A;  4QQG A;  1D0X A;  5FU7 C;  3EG0 A;  2HL3 A;  1D0Y A;  2JZ2 A;  5FW9 A;  3RR6 A;  3VS4 A;  1T3L A;  4F7U G;  1Q82 U;  3H0I A;  1PHT A;  3QXE B;  3QPH A;  3MCA B;  3CD6 A;  1I5L A;  1OZ2 A;  2ZGW A;  1VQ5 T;  2XK0 A;  3V8K A;  2BZX A;  2BZY A;  4J6X A;  2AIR B;  3OYA A;  3CCM Q;  3CCL A;  4IIO A;  2PZ1 A;  1K9M U;  1K8A R;  4M78 F;  1QVF S;  4J9I A;  1MV0 B;  3A98 A;  1YJ9 Q;  1PWT A;  4XK8 E;  2DET A;  1IZ6 A;  3OYC A;  2KT8 A;  3OYL A;  1WJQ A;  1Q82 R;  1QW1 A;  2MOX A;  4J83 A;  1D09 B;  2O9V A;  3RBB B;  1TOV A;  2DER A;  1GBQ A;  4M7A B;  1YIT T;  1N9S A;  5FRN A;  2CZ0 B;  1K8A C;  1ZQ1 A;  2K3Y A;  2KY9 A;  2QTV A;  4J9G A;  4C8Q G;  1AT1 B;  2M9U A;  3CC4 A;  1Y7X A;  2YUQ A;  4EMH A;  3LX7 A;  1S72 T;  3I56 T;  2OTL Q;  2FVU A;  4D8D A;  1EZZ B;  3NMZ C;  3DLL A;  1YHQ T;  1YJN T;  4LDX A;  1M90 U;  4FL6 A;  3QII A;  4ZN3 A;  5A0G A;  2HAX A;  1U8R A;  4JZ4 A;  4EMK A;  4C92 G;  4K11 A;  2DXC A;  4OB3 B;  3KUF A;  2ZZD A;  1LJO A;  3OBY A;  1Z9Q A;  1QKW A;  1G3T A;  1ZUK A;  2CP3 A;  1ZUU A;  5CK9 A;  1WXT A;  2O4X A;  2KYM A;  1NZ9 A;  3VS5 A;  3BW1 A;  4M7D C;  1V1C A;  1IGU A;  5GAN 6;  1VQK A;  2DL3 A;  3SD4 A;  1G5V A;  2K5I A;  4R0K A;  4WF2 A;  1X6O A;  4ORZ A;  4M7D F;  1C6V X;  1T3S A;  1YIJ T;  3C4S A;  4KRT A;  2HQH A;  4JJB A;  2EJ9 A;  3JCM J;  1W6X A;  1Q95 G;  2FZG B;  3QHS A;  1XOV A;  1O75 A;  1E6H A;  2AKL A;  5DLO A;  1OYX A;  1KIK A;  1OX8 A;  2BTT A;  3X24 B;  1U06 A;  1WYX A;  1RAB B;  1S72 Q;  3G71 A;  3KFV A;  2ZPB B;  3OS5 A;  1YJN Q;  1MUZ A;  5J26 A;  4MZM A;  3PGG A;  3G6E T;  2LX7 A;  1X2K A;  1WXB A;  3EG9 B;  5LJ5 g;  3SWN C;  4IUP A;  4PJO A;  2COW A;  1UUE A;  2C0T A;  2NUT B;  5CKB A;  3J81 E;  2ROL A;  3HP9 A;  4NL3 A;  3I9Q A;  2DVJ A;  1X69 A;  1QVF P;  2P0K A;  1HYO A;  3TEE A;  3A5Z B;  5LJ3 g;  5FWC A;  2KT1 A;  7AT1 B;  4MMK A;  2LQK A;  3OS0 A;  3CC7 A;  4F04 B;  4IUU A;  1X43 A;  3RER A;  4O6J A;  3X25 B;  2EQI A;  1BIB A;  1RI9 A;  2DD4 A;  4TVR A;  4XAX B;  4ELY C;  2C06 A;  2EVR A;  3CCU Q;  1N8R U;  3JCM g;  1YIJ Q;  2RO0 A;  1RLQ C;  1TS9 A;  2YWW A;  1QP3 A;  4HVV A;  2RQT A;  4M78 D;  2XHC A;  2DYI A;  5GAN j;  3HRU A;  1TWB A;  2J6K A;  2WAC A;  2CH4 W;  1I81 A;  4DBQ A;  3CPW A;  1AOJ A;  4DBH A;  4HKE A;  3QWY A;  1NLP C;  3A8L B;  5IHI A;  4M77 G;  2MK5 A;  2GQI A;  2LQ8 A;  2XMF A;  1U1T A;  1MV3 A;  2LJ0 A;  3CCR A;  1LNX A;  5FU6 B;  1CSK A;  4N4G A;  2V1R A;  3CD6 T;  1MND A;  3LGF A;  5GMK l;  3CCL T;  5CKD A;  2RI5 A;  2YRV A;  1G2B A;  1TUG B;  2QAS A;  4ZTF A;  2Z0W A;  1MNE A;  4RTY A;  3M0R A;  3CBM A;  2BZ8 A;  5FWB A;  3OYI A;  4M75 D;  4RTT A;  1M3C A;  3L2W A;  1QQJ A;  3M9Q A;  3PE0 A;  3QUI A;  5LJ5 e;  4JDS A;  3CBP A;  1VQL A;  4HCC A;  2JN0 A;  1RLP C;  2FZC B;  8AT1 B;  3OYB A;  4GY5 A;  3OS1 A;  2E65 A;  5GAN h;  5CCA A;  2D6F A;  3S3M A;  4HVU A;  3C12 A;  1PD1 A;  2HL5 C;  2I2L A;  2JM8 A;  5LJ3 e;  1K0S A;  4M4Z A;  3M54 A;  3C95 A;  2JNG A;  3CC4 T;  3HSB A;  2YRC A;  5CIU A;  9ATC B;  2F5T X;  1UJY A;  3CPW S;  2QEX Q;  1WA7 A;  1LVK A;  4J5Y A;  1JQQ A;  3H8Z A;  3JCM e;  1I5O B;  2CUB A;  5FRM A;  2A36 A;  1OU9 A;  2DRK A;  1K0X A;  2MCN A;  1MMD A;  1QP2 A;  2YUP A;  2M0Y A;  1R0C B;  4M75 A;  1KD1 R;  1NG2 A;  2EAY A;  1M2O A;  3CME Q;  5IN1 A;  1BI0 A;  2PTK A;  5GAN 7;  1VQK T;  3DLM A;  1C0M A;  3CCL Q;  2DNU A;  5L23 A;  2XID A;  3S6W A;  2H8H A;  3VYG A;  1WNL A;  4QT7 A;  4FW1 A;  3J7A F;  3SHW A;  4KGX B;  4F14 A;  3SDZ A;  2YRD A;  3RUX A;  1YWP A;  1KD1 C;  4E2F B;  3EGX A;  2AT1 B;  4C8Q D;  4PJL A;  4LE9 A;  3PMI A;  3M57 A;  1KC8 U;  2RJF A;  5GMK j;  2CSQ A;  1VQ7 Q;  2O31 A;  3REB B;  3GF5 A;  2B86 A;  4M7A D;  3M0S A;  1ZSZ B;  4FM4 B;  3RKW A;  4F7U A;  3MHX A;  3GIB A;  1AZG B;  4Y91 A;  4JRK A;  1ZA2 B;  3HRT A;  1M30 A;  4FSS A;  2WSE E;  4RTZ A;  4X9C A;  3RMQ A;  1SF9 A;  4M75 E;  4C92 D;  5GAN 5;  4A4K A;  3G71 T;  3THK A;  1OEB A;  5GAM f;  3RDV A;  3QDR B;  3JCM X;  4JLI A;  1WFW A;  3VUB A;  1QVG A;  4X9D A;  5GAN 4;  3OA6 A;  4KUD K;  2XDD A;  2YLB A;  1K73 C;  1IHV A;  2KVQ G;  4IKF A;  4EMK C;  3ASK A;  3R6N A;  1D0Z A;  4AFZ C;  2LTO A;  4C0D C;  1UB4 A;  4PFO A;  2CP0 A;  4JZ3 A;  5KYY A;  3VU3 C;  2ZPG B;  1SHF A;  1IHW A;  1TSF A;  1XJW B;  1NJI U;  4QQ6 A;  3NGP A;  3SWN A;  2RH2 A;  3I5S A;  1UGP B;  1RAF B;  2BKD N;  1VQK Q;  1RAD B;  4F7U E;  1WHH A;  3CCV T;  3CC7 T;  5HCK A;  3X26 B;  4AFQ C;  1Q7Y R;  2JJ9 A;  2QDY B;  1X01 A;  2ZPI B;  2CDT A;  1BYM A;  4C92 A;  2BE9 B;  3RIR A;  2DM1 A;  1A0N B;  2DLP A;  2JUF A;  3EFS A;  1ZUY A;  1G83 A;  2KXC A;  4AT1 B;  4JS4 A;  1QCF A;  4RMO A;  1AWW A;  1I07 A;  2SRC A;  3LH0 A;  2NWM A;  3CCQ A;  5HK0 A;  5FU7 B;  1Q7Y C;  3CPW P;  4EDU A;  3S3N A;  2AZV A;  3H41 A;  4OB2 B;  4EMG A;  2MAM A;  1AZE A;  2FG0 A;  1QCO A;  3G71 Q;  5I11 A;  1Z9Z A;  4XTU A;  3HRS A;  1QVG S;  2C0I A;  2L0A A;  2OAW A;  3GNF B;  1XNI A;  4C8Q E;  3GOX A;  2EYZ A;  3CCR T;  2X4J A;  3JCM V;  4C5I A;  2ZPF B;  1KFZ A;  4M7A E;  3LH5 A;  3G1J A;  4M78 G; 
#chains in the Genus database with same CATH homology
 4C92 F;  4JUV A;  5GAO m;  1N27 A;  2CZ0 B;  2L8D A;  2LC4 A;  2KMT A;  3CPF A;  4M77 C;  2EQK A;  2L5Q A;  5GAN d;  1K8A C;  1U1S A;  1ZQ1 A;  2K3Y A;  2KY9 A;  2EQU A;  2GCX A;  3QKJ A;  5KE2 A;  4C8Q G;  5LJ5 f;  1D3B B;  3JCM c;  2OAU A;  2M9U A;  5LJ5 d;  4HT8 A;  4D6W A;  5GAM g;  4C92 E;  3G6E A;  3CC4 A;  1Y7X A;  1WGS A;  4LDV A;  4EMH A;  3LX7 A;  1S72 T;  2XD0 A;  3SFM A;  3X20 B;  1M4Z A;  1YJW T;  5J39 A;  2RI2 A;  3I56 T;  4OF1 A;  2FVU A;  5KCH A;  3DLL A;  4LDU A;  3GLX A;  1YHQ T;  1YJN T;  3CC2 A;  4LDX A;  3JCM P;  2CZ7 B;  2K3X A;  1M90 U;  4FL6 A;  4ATO A;  3QII A;  4PNO A;  4ZN3 A;  4N4I A;  4ZGE B;  4PLI A;  5A0G A;  1UGQ B;  1VQL T;  1OI1 A;  2HNI A;  2LT1 A;  4PKC C;  1M9S A;  4X34 A;  1NE8 A;  5CO7 A;  3MO8 A;  5LJ3 f;  4C92 G;  4EMK A;  3OYF A;  1U8R A;  3A8O B;  2DXC A;  3KBG A;  3L2Z A;  3KUF A;  4OB3 B;  3FDR A;  5LJ3 d;  3OYE A;  2M0O A;  4YTL A;  2ZZD A;  2DAQ A;  3G7Z A;  3UPU A;  1LJO A;  3OBY A;  4RG8 A;  4M77 B;  4PJO E;  4E7H A;  2P4T A;  2QEX T;  4PJO B;  1PSF A;  3F70 A;  5I2S A;  3JB9 D;  1G3T A;  1NPR A;  2RI3 A;  4OGC A;  5HY6 A;  2L3R A;  3CCJ A;  3QJ6 A;  1WQ7 A;  2RM4 A;  1I4K 1;  1Y96 A;  3OYG A;  3CMA T;  2BUD A;  1Q86 U;  2XI9 A;  3BY7 A;  5CK9 A;  2O4X A;  2D9T A;  3LW5 E;  1JJ2 S;  1RL2 A;  2XU8 A;  3HPW A;  1NZ9 A;  4HA8 A;  2QA4 T;  1H64 1;  1UGR B;  2YLC A;  3BW1 A;  2DZ9 A;  2PQW A;  4M7D C;  3JCM f;  2D0Q B;  3PT9 A;  5GAN 6;  2KAF A;  2M1H A;  3MP8 A;  1YI2 A;  4DOW A;  1VQK A;  4XTZ A;  3SD4 A;  1G5V A;  4M77 D;  2WSC E;  2DTH A;  5FRO A;  3CME T;  1BI2 A;  2IG0 A;  4J7I A;  4KBM B;  2K5I A;  3CCS A;  4C0Z A;  3ER0 A;  2RHX A;  4JRI A;  1VQP T;  4WF2 A;  4PJO F;  4N0A C;  5GMK e;  4J6Y A;  3P8B B;  1X6O A;  1EIF A;  4BUG A;  4LD6 A;  4BDY A;  1XQH A;  2EWN A;  5A2Q E;  3T9N A;  4M7D F;  3OYH A;  1KG1 A;  1UEB A;  5DM7 R;  3L2U A;  2BIV A;  5GAM j;  1B34 A;  4OP0 A;  1YIJ T;  2VV5 A;  4N4H A;  3INZ A;  2Y4Y A;  3C4S A;  4C8Q A;  2DTI A;  2JTF A;  3MEW A;  4XTW A;  3UWN A;  1FXX A;  2EJ9 A;  3LYI A;  4BI8 B;  4M7D B;  1IRE B;  4M7D E;  3JCM J;  1KC8 C;  2DVE A;  1G3Y A;  3OSS C;  2HQX A;  4BY6 C;  3HL8 A;  2VXF A;  4M7A A;  5GMK h;  1ZBX A;  3BDL A;  3TRE A;  5A0L A;  3QHS A;  1XOV A;  1O75 A;  1DJ7 B;  1D3B A;  3RES A;  1OYX A;  4XU3 A;  5DLO A;  4OMF B;  1YBY A;  1VQ7 T;  2QQB A;  3X24 B;  1VQ9 A;  2GFA A;  4VUB A;  3JAM E;  2DD5 A;  3JB9 J;  1VIF A;  3ZFJ A;  3PTA A;  1BI1 A;  2CKK A;  2DK3 A;  2FL7 A;  4LDY A;  2RK2 A;  5CVI A;  3G71 A;  2ZPB B;  3MEA A;  3OS5 A;  2LNV A;  3L42 A;  4BI3 A;  1KD1 U;  5J26 A;  4MZM A;  3M4G A;  3PGG A;  5GAN g;  3CEY A;  3G6E T;  1G3S A;  1WPY A;  3M59 A;  3JCM b;  3QSU A;  2MI6 A;  4BY6 B;  4BDZ A;  1P92 A;  4L5G A;  5LJ5 g;  2XIC A;  2MWP A;  3SWN C;  3JCM W;  2P0P A;  4IUP A;  1VQ6 T;  5GAM e;  4PJO A;  2RJE A;  2V8I A;  5CKB A;  3J81 E;  3HP9 A;  5CKF A;  2XDB A;  3M53 A;  2RHZ A;  4NL3 A;  1KQ1 A;  1W2B A;  1VQ8 A;  5C0M A;  1NJI C;  3L1A A;  2EQM A;  4LD9 K;  2OTJ T;  4C5E A;  1VUB A;  4XQ3 A;  4QVD A;  2OTL A;  2P0K A;  3I55 T;  3TEE A;  2QTX A;  3BDU A;  4MDW A;  4R55 A;  3A5Z B;  5KE3 A;  5LJ3 g;  4MZP A;  3A8H B;  1BKB A;  5GAM h;  2KK4 A;  2JTM A;  3JRZ A;  4MMK A;  4B9W A;  4E47 A;  3URG A;  1VQM A;  3HFN A;  3OYN A;  2LQK A;  4J7F A;  3OS0 A;  4L59 A;  3CC7 A;  3JB9 F;  4JRP A;  3ZEH A;  2V8J A;  2EJG A;  4IUU A;  5I2M A;  1K73 U;  2LCL A;  3OQ5 A;  3SWN B;  1HXD A;  3RER A;  4O6J A;  4OGE A;  3X25 B;  1BIB A;  2DD4 A;  4XU2 A;  4M7A G;  4TVR A;  4XAX B;  4BAC A;  4ELY C;  2C06 A;  1AHJ B;  2DIQ A;  4A4E A;  1KQS A;  3MEV A;  4A53 A;  3NTI A;  1Y07 A;  2RHI A;  4QVZ A;  1N8R U;  2XG8 D;  3JCM g;  1Q82 C;  2F69 A;  3GPL A;  5CKE A;  4M77 F;  2QQS A;  5GAO p;  4M7D A;  2RO0 A;  3VJP A;  3AHU A;  2VXE A;  3M4Y A;  2RB6 A;  5FLX E;  5FU6 C;  4UC4 A;  4M75 C;  1VQ5 A;  3QG1 A;  4BE0 A;  1QP3 A;  2K4Y A;  2NLU A;  4Q5W A;  4OB0 B;  1Q81 U;  4M78 D;  4M77 E;  2XHC A;  1M1K U;  2EQJ A;  5GAN j;  3HRU A;  4KT0 E;  2WAC A;  1I81 A;  3MP1 A;  1K9M C;  4N0A A;  3CPW A;  1VQO A;  5LJ5 j;  3OYJ A;  5C6S A;  3R6O A;  1WJS A;  4C0F A;  2R57 A;  1GXI E;  3QJY A;  4HKE A;  3CCM T;  3FLG A;  2F5K A;  3A8L B;  4ZTJ A;  2DKG A;  4GLK A;  1JBM A;  5GMK i;  3C94 A;  2DTO A;  3QZ5 B;  3DB4 A;  1TH7 A;  4M77 G;  4PLL A;  4PJO G;  1JB0 E;  2QQ9 A;  4IUR A;  4NS5 A;  5KCO A;  4C5G A;  1YJ9 T;  2FYK A;  2LQ8 A;  3WVD B;  3JB9 H;  1H3Z A;  1U1T A;  2EFI A;  2CGH A;  2L89 A;  3CCE A;  3CCR A;  1LNX A;  4PL6 A;  5FU6 B;  4M75 B;  3OSV A;  5LJ3 j;  4N4G A;  3CXC A;  3E19 A;  3CD6 T;  2CZ6 B;  2RA2 A;  1YIT A;  1VQN A;  5LL6 S;  3G4S A;  1SSF A;  2XKO C;  3LGF A;  5CKH A;  5GAM d;  1ZHI A;  4MZT A;  3VUZ A;  3PMT A;  4DQ2 A;  2E12 A;  3MP6 A;  4MML A;  5GMK l;  5FRN A;  4J8O A;  5EG2 A;  3CCL T;  3CCQ T;  4JS5 A;  2K5L A;  5CKD A;  2RI5 A;  1W2B S;  2YRV A;  3M5A A;  1Q7Y U;  2JVV A;  3V8L A;  4IUT A;  4ZTF A;  2HD0 A;  1S72 A;  2PVO B;  1YJW A;  3I56 A;  1VQ4 T;  3E9F A;  3FIF A;  5GAN e;  3CBM A;  3OYI A;  2PU9 B;  4M75 D;  1YJN A;  4FT2 A;  1YHQ A;  3PIP A;  3L2W A;  3M9Q A;  1M90 C;  3BFM A;  3QUI A;  2HQE A;  2RJC A;  4JDS A;  5LJ5 e;  2IVW A;  3CBP A;  5GAO r;  1VQL A;  4II1 A;  2VUB A;  3P8H A;  4QW2 A;  4HCC A;  5KH6 A;  2K2V A;  3OS2 A;  1VQN T;  4O5V A;  2JN0 A;  3VV0 A;  2X35 A;  5DLQ E;  3TCJ A;  4M7D G;  4ME7 A;  3KXT A;  2R5A A;  3H6Z A;  3OYB A;  2QEX A;  4GY5 A;  3OS1 A;  2E65 A;  3OBW A;  5GAN h;  3L2V A;  5CCA A;  4XU1 A;  3S3M A;  2EKO A;  1KQS S;  2D6F A;  2RK1 A;  3C12 A;  4HT9 A;  2HBP A;  4RCB A;  4F7U B;  2I2L A;  3NTK A;  4XTX A;  3UT1 A;  4JRQ A;  4BE1 A;  1K8A U;  5LJ5 h;  5LJ3 e;  4A4H A;  3CMA A;  3JCM Q;  2CYZ B;  3ME9 A;  1Q86 C;  1JRI A;  3M54 A;  2DXU A;  3PIO A;  3C95 A;  2QA4 A;  2JNG A;  4EPC A;  3CC4 T;  2V8K A;  1I8F A;  4XTV A;  3OYM A;  4CI0 C;  4DA4 A;  3Q1J A;  3HSB A;  4J6W A;  2KDS A;  2RHY A;  4M77 A;  3CC2 T;  4KUL A;  2MMP A;  2LDM A;  4M78 C;  5CIU A;  1OZ3 A;  5CQX A;  3S3O A;  4HCB A;  2F5T X;  4XTY A;  1Y96 B;  5J3B A;  3QYG B;  3CME A;  2A3L A;  3CPW S;  4C8Q C;  2E41 A;  5GAN 2;  5LJ3 h;  1XTD A;  2MWO A;  3PNW C;  1VQP A;  2EIF A;  4J5Y A;  4A54 A;  3FC3 A;  2RHU A;  3H8Z A;  3JCM e;  3OMG A;  2M16 A;  2PUK B;  3OYK A;  5FRM A;  3SB2 A;  3OW2 A;  4M7A C;  2G3R A;  2DO3 A;  3M55 A;  2VGN A;  3MEU A;  3CCU A;  1RI0 A;  2AHJ B;  1YIJ A;  2E6N A;  4Z02 A;  1QP2 A;  4HCZ A;  4OB1 B;  3CCJ T;  2GF7 A;  3J80 E;  2E70 A;  5GMK m;  4M75 A;  3CCV A;  3CXC S;  4C92 C;  2PUO B;  3OB9 A;  2EAY A;  4BE2 A;  4FT4 A;  5IN1 A;  4B9X A;  1QVP A;  4MDX A;  1BI0 A;  4M78 B;  3JCM h;  1M1G A;  4QQD A;  4R56 A;  4BD3 A;  1B34 B;  5GAN 7;  1YI2 T;  3DLM A;  3M58 A;  1VQK T;  5L8R E;  4C8Q B;  4BI4 A;  5CAI A;  1V29 B;  1VQ7 A;  1KQ2 A;  2XID A;  3E1S A;  3OMC A;  3CCS T;  5GAN 3;  1MGQ A;  3S6W A;  1BI3 A;  3VYG A;  1WNL A;  2DXB A;  3J7A F;  5HKC A;  2WSF E;  3QBY A;  3N5B B;  2A7Y A;  3GNG A;  4PJO C;  2R58 A;  2ZPH B;  3A8G B;  3PFS A;  3JB9 G;  1O9S A;  3SDZ A;  4JJN K;  3RUX A;  2DIG A;  3NTH A;  1KD1 C;  4IUQ A;  3LWI A;  4C92 B;  4C5H A;  5GAO q;  1M8V A;  3CBO A;  3EAE A;  4A4G A;  1WQW A;  4C8Q D;  2KQW A;  2CS7 A;  3DB3 A;  3PMI A;  1VQ6 A;  4ELZ C;  4RKU E;  3M57 A;  1KC8 U;  2RJF A;  3FEO A;  5GMK j;  4E7L A;  2R5M A;  3MET A;  3HFO A;  2MF2 A;  5AYF A;  3GF5 A;  4M7A D;  1G3W A;  2X4W A;  4XU0 A;  3WXM B;  4FM4 B;  3RKW A;  4M75 F;  3ZBD A;  3MHX A;  4F7U A;  3GIB A;  1BIA A;  2ZCF B;  4LDW A;  2LCC A;  4Y91 A;  4JRK A;  3HRT A;  4E7I A;  2VGM A;  2X4X A;  3V7C A;  1WJR A;  2K57 A;  1W4S A;  2OTJ A;  4X9C A;  2WSE E;  1Y71 A;  2QI2 A;  1VQ9 T;  3RMQ A;  5I21 A;  3I55 A;  1QVF A;  3RKY A;  4M75 E;  4DOV A;  3LWH A;  3OYY A;  4C92 D;  4QVC A;  5GAN 5;  3OY9 A;  3HHT B;  3NFC A;  4Y28 E;  3FRN A;  4NOY A;  4A4K A;  4JLG A;  3G71 T;  4FSX A;  1UGS B;  5GAM f;  4NL2 A;  3QDR B;  3JCM X;  2LT4 A;  4JLI A;  3RMS A;  5IT9 E;  2E6Z A;  3VUB A;  4ZN1 A;  4X9D A;  3QO3 A;  4FU6 A;  1QVG A;  5GAN 4;  3OYD A;  3OA6 A;  5GAO n;  4KUD K;  2XDD A;  3GP8 A;  2YLB A;  2DPP B;  2GQV A;  1K73 C;  3FJP A;  1KHI A;  4M75 G;  2KVQ G;  4IKF A;  3OW2 S;  4EMK C;  2PVG B;  3ASK A;  2EYQ A;  2E10 A;  5D6Y A;  3V7R A;  2O01 E;  3JCM d;  4OVA A;  1X75 C;  4A4F A;  2ZPE B;  2LTO A;  4FIB A;  4C0D C;  2E5Q A;  1UB4 A;  2RD1 A;  5M9O A;  4PJO D;  5A0D A;  4L6V 5;  1N8R C;  2DEQ A;  3VU3 C;  2QQR A;  2Y4X A;  2ZPG B;  3HKS A;  2QXF A;  2VYT A;  3TU4 K;  3E9G A;  1VQ8 T;  3DKM A;  5DY9 A;  1NJI U;  4QQ6 A;  1VIE A;  3V7S A;  2OTL T;  3SWN A;  5GAO l;  5IAY A;  4M78 A;  4IUV A;  4F7U F;  1R8O B;  1FX7 A;  1YCY A;  2RH2 A;  3QZ9 B;  1N9R A;  1UGP B;  2KSS A;  2FHD A;  3VYH B;  3CCU T;  1Q81 C;  1M1K C;  2BKD N;  2P0Q A;  3P8D A;  4V2S A;  2QQA A;  3VKI A;  5HK3 A;  2K5F A;  1VQM T;  2DXT A;  4F7U E;  3EFR A;  3CCV T;  4QQG A;  3CC7 T;  5FU7 C;  4KUI A;  3X26 B;  3L2R A;  4EMK B;  2E64 A;  2FB7 A;  3LGL A;  3CCM A;  2LVM A;  2JZ2 A;  3X28 B;  2QDY B;  2LRQ A;  1NPP A;  4C0D B;  2E1H A;  4ZGJ B;  4E7K A;  1X01 A;  2EJF A;  2ZPI B;  5GAN 8;  2DZC A;  5D6W A;  3V8J A;  1BYM A;  4CRI A;  1YJ9 A;  1M5Q 1;  3WVE B;  4F7U G;  4C92 A;  2X4Y A;  3RIR A;  3UDC A;  1Q82 U;  5CQY A;  3QXE B;  2JUF A;  2O4X B;  3EFS A;  3QPH A;  2PVD B;  2CZ1 B;  3LLR A;  3MCA B;  4P5N A;  1JJ2 A;  3A8M B;  3CD6 A;  1I5L A;  4RG2 A;  1OZ2 A;  3RKX A;  4JS4 A;  4M7D D;  2ZGW A;  1VQ5 T;  2YHT A;  4RMO A;  2XK0 A;  3V8K A;  3M56 A;  4J6X A;  3OYA A;  2B8A A;  3LH0 A;  4BB7 A;  4C0G A;  3QYH B;  5CR2 A;  3CCL A;  3CCQ A;  5HK0 A;  2GFU A;  5FU7 B;  2LX9 A;  1Q7Y C;  1FWZ A;  1K9M U;  3O8V A;  1VQO T;  2DJZ A;  4M78 F;  4EDU A;  1QVF S;  3S3N A;  1VQ4 A;  4OB2 B;  2RJD A;  5D6X A;  4C8Q F;  4XK8 E;  2MAM A;  4EMG A;  1LOJ A;  2Y90 A;  1IZ6 A;  4M78 E;  3OYC A;  1PSE A;  2JOY A;  2VC8 A;  4XTU A;  3HRS A;  1QVG S;  3JSC A;  2XDP A;  3OYL A;  4M7A F;  1WJQ A;  3GNF B;  1XNI A;  4RCC A;  4C8Q E;  3GOX A;  1N6A A;  3CCE T;  1QW1 A;  3CCR T;  4J83 A;  2X4J A;  1KHC A;  4E7J A;  2H3J A;  1MHN A;  3FB9 A;  1HK9 A;  2ZPF B;  3JCM V;  4C5I A;  1M1F A;  4ZGD B;  2HAX A;  4M7A E;  4M7A B;  3L2Q A;  1YIT T;  5GAN f;  3JB9 I;  1N9S A;  3G4S T;  4M78 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...