1PSEA

The three-dimensional solution structure of psae from the cyanobacterium synechococcus sp. strain pcc 7002: a photosystem i protein that shows structural homology with sh3 domains
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
b'AIERGSKVKILRKESYWYGDVGTVASIDKSGIIYPVIVRFNKVNYNGFSGSAGGLNTNNFAEHELEVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM I ACCESSORY PROTEIN E
publication title Three-dimensional solution structure of PsaE from the cyanobacterium Synechococcus sp. strain PCC 7002, a photosystem I protein that shows structural homology with SH3 domains.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Photosystem i
total genus 7
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1994-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1pseA00
1JB0E 1AHJB 3VYHB 1UGPB 2ZPFB 3LW5E 2WSEE 1DJ7B 4OB3B 3X25B 3A8MB 3QZ5B 3QZ9B 2PVOB 2CYZB 4OB2B 4L6V5 3X24B 5L8RE 1UGSB 2PVGB 2AHJB 4ZGJB 4RKUE 4XK8E 3WVEB 2WSCE 3QXEB 4OB0B 3VYGA 2ZPGB 4ZGEB 1GXIE 3X26B 1IREB 2CZ7B 2WSFE 3A8GB 2CZ1B 2ZZDA 2PU9B 2PUOB 3X28B 1QP3A 2D0QB 2ZPBB 1V29B 3A8LB 2ZCFB 4OB1B 4Y28E 4KT0E 2PVDB 3WVDB 4ZGDB 1PSFA 2O01E 3A8HB 1UGRB 2PUKB 1QP2A 2ZPHB 4FM4B 2DXCA 2ZPEB 2CZ6B 3QYGB 2ZPIB 2DD4A 2CZ0B 1PSEA 3HHTB 2DPPB 3X20B 1UGQB 3QYHB 2DXBA 2DD5A 3A8OB 2QDYB
chains in the Genus database with same CATH superfamily
3LGFA 1AWWA 5C0MA 1VYTA 2Y4YA 1GFCA 3JCMf 1X2KA 2A28A 3LW5E 2YSQA 3M0SA 1WYXA 1LJOA 3G71T 2KXDA 3HKSA 2EJFA 1NYFA 4QQDA 4HT9A 1RAIB 3M0RA 5DLOA 4HXJA 2LT1A 2M02A 3GF5A 4JJNK 1ZSZB 3OYDA 1KHIA 4ZGJB 4F7UB 2LP5A 4RKUE 3LWIA 1RACB 4Y92A 1BI1A 1N27A 2V8KA 3HFOA 2QTVA 2OJ2A 2HAXA 3NHNA 2YUNA 2ZPGB 4M7DB 1N8RU 4J9HA 3A1PA 1NEGA 2HQXA 2PNIA 1TWBA 3OBWA 1M1KR 2P0QA 1SPKA 2CS7A 1ZQ1A 1QVGP 4IUPA 5FWCA 2QGGA 5M9OA 5LJ5f 2K2VA 2DAQA 3OBYA 4MZPA 2EKHA 2CP7A 1K1ZA 2HKNA 2VVKA 3BDUA 8ATCB 3MKDA 2F2XA 3CCUT 2D8JA 1Y71A 3OA6A 1PM3A 2JMCA 3JB9J 1WXTA 5I22A 2KT8A 3DLLA 3CCQA 4XTYA 4E7IA 2GQVA 3CCSQ 4IIOA 1VQMQ 1K73C 2EGCA 1N8RR 4ZNXA 4PJOA 5LJ5j 3M4GA 3CCMQ 2MK5A 3OW2A 2XDPA 3UATA 4OMFB 5IN1A 3TCJA 1I0CA 1OYXA 2FPEA 2WSEE 1I07A 2DKGA 1M90U 1D1CA 1JEGA 2FO0A 5CKHA 5A2QE 1C6VX 3QZ9B 2RB6A 2J6OA 2XIDA 2QQAA 2G6FX 2EJGA 4N4IA 2K2MA 3ZEHA 4D8DA 3NPFA 1R0CB 1QQJA 2DTIA 3C4SA 1QVPA 3VV0A 1ZSZA 5HK3A 2WSCE 1VQ5T 4PJMA 4F7UA 4LDXA 3VYGA 3PT9A 1QKXA 5GMKj 2ED1A 4FT4A 3PVQA 3CCVA 3GIBA 4J9IA 2RQRA 4LD6A 5CAIA 1IREB 3E2UA 4M7DA 5AT1B 4C5GA 1YJ9T 4Z02A 3S3OA 1ZBJA 1ZUKA 4RTYA 1D09B 1A0NB 2FRYA 1M1GA 4M7AE 1H641 1HK9A 1WJRA 1VIEA 4E2FB 3S3MA 1M90R 1IO6A 2VASA 3H6ZA 3CCEA 3CMEA 2CZ6B 2AZSA 2RQTA 2C0IA 3L2QA 2FYKA 3HHTB 4L59A 3PFSA 2YUOA 3EG0A 1LPLA 1K4US 2JTMA 2QQ9A 4M78B 4BB7A 2GTJA 1E6HA 4GBQA 2EYZA 1QW1A 1GL5A 1VQLT 2JJ9A 1MNEA 2LQNA 3UA7A 3OW2S 4JZ4A 1XQHA 2GBQA 1UGPB 1YN8A 2QQSA 2RM4A 4FCYA 3L2RA 3G71Q 4C8QE 1M3AA 5CKBA 2DTOA 4OMOA 3A8MB 3M58A 2CKKA 2C06A 4ELYC 3JCMJ 3RKXA 1MMNA 1U5SA 2YRDA 3SHWA 2MPXC 3ULRB 3CCQT 3CCRA 5GAOq 1N6AA 3CEYA 2FRWA 1NBEB 2YLBA 3MP8A 3OYJA 2I2LA 5J39A 1OU9A 3H0IA 4EMKC 4M77F 3M4YA 3QXEB 4XU1A 5D7UA 5GAOm 2RD1A 3VS0A 4NL2A 4HA8A 2CT4A 4C0DB 1SRMA 4JJDA 2YRVA 2K7AA 2GQIA 4HVUA 1WJSA 3JCMb 4RUGA 4J9EA 4ORZA 2DTHA 4WF2A 2MMPA 4RTZA 5FLXE 3VJPA 3M9QA 4HVWA 3ZL7C 1JXOA 2NYSA 4RCCA 1U06A 1H8KA 1PD1A 1TSFA 1QP2A 2YDLA 2VUBA 1UDLA 3CCUQ 2YUPA 3CCVT 3QIIA 3I9QA 2CZ0B 4RTVA 1VQ6T 1Q81U 5CKDA 2DPPB 1LCKA 2M1HA 3BDLA 1PRLC 3JRZA 4A4EA 5KYYA 3QYHB 3OMGA 1OEBA 3GNGA 1KQ2A 2E5QA 2V26A 1Q82C 3AHUA 1H3ZA 2O88A 4J6WA 2C0TA 1RI9A 2GFUA 4IUUA 3NTIA 4J9DA 4C0ZA 3G4ST 3OS2A 2K79A 3CCET 2DL8A 3CMET 3M5AA 1M3BA 3NTHA 1T3LA 1FMWA 2Z0WA 1SSFA 1C0MA 2JT4A 5HCKA 1BK2A 2COWA 5CCAA 2O31A 2DFUA 2ENMA 2RF0A 4KGZB 4ZTJA 2BIVA 4Z8AA 3X24B 2E10A 3EGXB 2JXBA 3BW1A 2LCLA 3M0UA 3L42A 2X3WD 3H0HA 1VQ8A 5CO7A 1T0JA 2D1XA 3KUFA 1VQ5Q 3MPUB 4E7LA 5LJ5e 3TU4K 2LQ8A 4DA4A 2H8HA 3SEMA 1Q81R 3HTRA 2OX7A 2DEUA 2KXCA 4CC2A 4HCBA 1J3TA 1Q86C 4PJOE 3QDRB 3PMTA 3CXCA 3ZBDA 1VQNA 3ZFJA 5GAMg 1C1AA 2EAYA 1YJ9Q 3BE3A 2RO0A 2HBWA 1VA7A 2L2PA 2PU9B 4Q5WA 4KUIA 2RJDA 5GAOn 5KCOA 4A4FA 5L23A 4II1A 1AWXA 1U1SA 2CP3A 4PNOA 2DZCA 8AT1B 1R0BG 2PVDB 2XICA 2QDLA 3M59A 2MI6A 2IVWA 2A0FB 4JJBA 3CC4T 5GMKe 3I55T 2VB6A 4E7ZA 3QO3A 4M75D 2X4XA 1JQQA 2FEIA 3RIRA 2A37A 2ROLA 4JRKA 2J7IA 1YI2A 4F7UE 2OI3A 3MP1A 2EW3A 2COZA 4A4GA 1AWJA 3JCMc 2K3XA 3TSWA 2G3RA 2RN8A 4X34A 2E5KA 3CMAA 4KGVB 1MMDA 4M7DE 4ZTFA 2DILA 3SD4A 3H41A 1EZZB 3HRTA 2JS0A 3CCLA 4MDXA 1VUBA 2NLUA 5GAN8 5J3BA 1YJNA 2D9TA 3QUIA 2QA4T 2X51A 4AG2C 2CYZB 3CCQQ 3DB3A 1YWOA 2EIFA 4PLLA 2EWNA 2QI2A 2VYTA 1PKSA 3NGPA 2L3SA 1PC0A 1TU0B 1UGVA 5HKCA 1Y7XA 1M2VB 1SKUB 3E19A 2JN0A 2HZYA 2HMAA 2JM9A 5KYNA 3EGXA 2R58A 4M7AA 2HDAA 3D7SB 3OYLA 3U23A 4C92D 2K5FA 3GLXA 2RK2A 2F5TX 3VUBA 1WA7A 3G7ZA 3CXCS 1RAGB 2DL5A 5LL6S 1BB9A 1ZUUA 3RDVA 4Z88A 1JJ2A 1VQ9A 1VYVA 1VQ8T 1QP3A 2DXUA 2I0NA 6AT1B 4D6WA 4LNPA 4OB1B 2X4WA 1RUWA 1N9RA 1ZHIA 2YLCA 2CP0A 4CC7A 1QVFP 2VXFA 1H3HA 4F04B 3CCVQ 1ZX6A 3P8HA 1X43A 2EQKA 1VQ6Q 1VQNT 1PSEA 2KEAA 1KHCA 2BZ8A 3OYEA 1U8RA 4C8QA 4EMKB 4KBMB 4KUDK 3JCMd 4BI8B 1OULA 2Y4XA 2FZCB 1WXUA 1FWZA 2LQWA 4IUTA 2B86A 2DD5A 4P5NA 1SEMA 4LXCA 1SF9A 3V8KA 3G4SQ 1YIJA 2E4HA 4ZN1A 3CCEQ 4XAXB 2DBKA 3KBGA 3CMEQ 1M1FA 2KE9A 5GAMh 3VRZA 1NG2A 3HSBA 2JM8A 1W70A 3VS4A 3L2UA 2K9GA 2DRKA 3OY9A 1Q95G 1ARKA 5A0DA 3PE0A 2RHZA 5FU6C 3REBB 4IIMA 1O75A 1GBQA 1M3CA 4AFQC 2C0OA 2F69A 2K6DA 3L2VA 3P8DA 2DL7A 4O6JA 4XK8E 2X3XD 1IXDA 1WHHA 3LWHA 3VS2A 5KH6A 2XK0A 3VS5A 5CKEA 4M77D 2R5AA 5CKFA 4JDSA 2MWOA 1VQ7A 1M2VA 3CD6A 1F1BB 4FYVB 1NPRA 3LLRA 3OYAA 1GCQC 2YRCA 4M78E 3O5ZA 2VV5A 1JJ2S 4HT8A 1UFFA 2M51A 4JS5A 2EQJA 3CC2T 4BUGA 4KT0E 1Z9ZA 4QVCA 1B3QA 1SSHA 3A8HB 3LH5A 1MV0B 2ZPEB 1OOTA 3CC4Q 1IHVA 2CSQA 3NFCA 3I55Q 2ZPIB 4C0GA 3OYNA 2KROA 4J7IA 4B9WA 4LD9K 2HL3A 4KH0B 3X20B 2QQBA 2NUPB 2QK0A 1VQ9T 5D6WA 2B8AA 1R8OB 4X1VA 2DXBA 4M7DD 4QQ6A 3LGLA 4EMKA 4E7HA 2L8DA 1VQPT 3MEVA 5DM7R 4DBHA 1TXQA 1VQOA 2DBMA 3G6EA 4M75G 3UA6A 4ATOA 4AT1B 1YITT 1K73U 1AD5A 4M75F 3R6NA 3CC7A 2OTJA 1N5ZA 1B34B 1NJIC 3E9FA 2QA4Q 4XTXA 3RBBB 3I5SA 1YP5A 2FPDA 2P4RA 2Y90A 5GAMf 3EFSA 1X69A 1SRLA 2O2OA 1S72A 1E6GA 4R55A 1PHTA 3QDFA 4JZ3A 2KRSA 3SWNA 2JVVA 4RTWA 4AMCA 3I35A 4RG2A 3WVEB 4R0KA 1T3SA 3QHSA 2RI3A 1XNIA 3EGDB 2CSIA 3RR6A 3O8VA 1XOVA 2CGHA 5J26A 1GXIE 2L0AA 4LE9A 4F16A 2DZ9A 2V1QA 1VYUA 4M75C 4CRIA 3S6WA 3VRYA 1TH7A 2O4XB 5GAMj 2ZZDA 3V8LA 1HJDA 1VQ8Q 2V8IA 2NUZA 4DEXA 1K73R 3QKJA 4J9GA 2ATCB 4C92G 4C92F 1OX8A 2O01E 5IT9E 3PIPA 1BI2A 5GANg 3QPHA 1OPKA 2FG0A 1WNLA 1VQNQ 2K3YA 2DNUA 1AVZC 4OMMA 4OGCA 2QG9B 5D6YA 5GANe 1KQSP 2EYWA 1T0HA 3M54A 3PVLA 4AG1C 4J7FA 3REAB 1OZ3A 1WXBA 1Y0MA 1G8XA 1RL2A 1WZOA 1W2BP 3C94A 3L1AA 4N4HA 3VS7A 2BE7D 2NUPA 4FYWB 3G1JA 2R5MA 2DYBA 2J6FA 2CUBA 4LUEA 4Y91A 1M30A 2OAUA 1RAFB 4JRQA 1TOVA 1WIEA 4XU3A 2RNAA 2P4TA 4C92C 1KK7A 2ECZA 4OB2B 2BTTA 4K11A 1B34A 4QVDA 3L2WA 2KI7A 1YWPA 3HL8A 5GAN3 1GFDA 2DVEA 3EH1A 2D8HA 3RUXA 3JB9H 2DF6A 2KNBB 3OYFA 4LDVA 3JB9F 3OYCA 1VQOT 1WPYA 4LDUA 4EIKA 1QKWA 4OB0B 5GJVB 3CC7T 1G5VA 1OI1A 5IXFA 1K9MC 1Z9QA 1Y57A 1UHFA 3GNFB 2DXTA 5LJ3g 3T9NA 1QCFA 2AZVA 4FSSA 3X26B 3EFOB 2VXEA 1VQ4A 2E64A 4EMHA 7AT1B 2ESWA 2CZ1B 4E7SA 3RKWA 3CC2Q 4M77G 3RMQA 1HD3A 4FYXB 4JLGA 2O4XA 4FYYB 5C6SA 2KVQG 2IG0A 4PJOF 3NTKA 4TVRA 2YHTA 3HP9A 4XTVA 1I1JA 1BYMA 5FU6B 1PSFA 2M16A 2XG8D 1WHJA 3CBOA 1UGRB 1W6XA 2EKOA 2EQIA 1Q7YC 2LCSA 1WX6A 4OMPA 2CUDA 2JNGA 3QWYA 2CT3A 3HRUA 2CH4W 2BZXA 1AT1B 1VOMA 1UJ0A 1VQ9Q 1P92A 1CKBA 1KD1C 4DBRA 1YJWA 1EIFA 2RJCA 3HFNA 2VWFA 4MMLA 1WHGA 4MDWA 1VQPQ 2DYIA 2RH2A 5GAN4 4J8OA 2H3JA 3MHXA 3VYHB 1YITQ 3MCAB 1OU8A 1Q82U 4M77C 1D1AA 4PLIA 4F7UF 1UECA 1I5LA 1DJ7B 1WI7A 5FW9A 4EDUA 4HCZA 3LYIA 2LNHB 3IQLA 2FHDA 4HCKA 2YUQA 2EBPA 4M7DF 4XTWA 4BACA 4QVZA 1AEYA 1TS9A 2OTLA 3RMSA 4BY6C 2ABLA 4M78A 1QVGA 2E1HA 2JMAA 5GANh 4IKFA 2E12A 4LDYA 1ZSGA 2EQMA 2SRCA 2YT6A 4QKUA 1VQMA 1W4SA 5CK9A 2HNIA 1XJWB 2QYZA 1K8AC 2NUTB 4ZGEB 3CCMA 3EG2A 5DY9A 4DQ2A 1CSKA 1LVKA 1QWFA 3UDCA 1UEBA 4N0AC 4LN2A 4A4HA 9ATCB 4OVAA 1KIKA 4FL6A 4C5EA 1YHQA 1FMKA 4A63B 1Q86U 1PKTA 3FJ5A 1BBZA 3EFOA 1Q82R 1BCMA 4WCIA 2D0QB 1BI0A 4YTLA 3WXMB 1V29B 2VC8A 1FXXA 4X9DA 4J6XA 3MJXA 2VGMA 3MP6A 4RTTA 2HQHA 2XD0A 4AFUC 3EG1A 5KYUB 1X6OA 2DJZA 2LC4A 2RQVA 1O9SA 3CCRT 1FX7A 1AOJA 3V8JA 1JBMA 1VQ4T 2W10A 4M7AD 1K0XA 3JB9I 4QT7A 2DL3A 1ABOA 5KE2A 5GAMe 1HSQA 3H9NA 4DEYA 3FDRA 1AWOA 3QWXX 4A53A 4KH1B 4JS4A 1M27C 3URGA 2X9HA 2QDYB 4LDWA 4M75B 5HY6A 4N4GA 4F14A 4E7KA 5DLQE 5LJ3h 2FB7A 1G83A 2ZPFB 4GLKA 1FMVA 2COYA 4PFPA 1Y96B 4GLMA 4OB3B 1Q86R 5KE3A 1ZA1B 1GCQA 2OAWA 1ZLMA 2SEMA 2PVOB 2EVRA 1M4ZA 2KAFA 2QEXA 2QGFB 1JXMA 1SHGA 3CBMA 1BU1A 4OMLA 3OW2P 4KGXB 3S3NA 5IHIA 1VQOQ 3ER0A 3TREA 1QVGS 4C8QD 2LJ0A 2A08A 2JTFA 2LJ1A 4IUQA 5CIUA 3PIOA 2XDBA 4FIBA 2A3LA 3CC7Q 2DEQA 1IZ6A 2F2VA 2DIQA 4C0FA 2ZAEA 2RJFA 5GANf 3ME9A 2NWMA 4RTXA 5GAOl 2CZ7B 2MAMA 1PG5B 3OS5A 2E6ZA 3OYMA 2OTLT 5GJWB 2XI9A 3DLMA 2PUOB 1S1NA 2RPNA 4C92B 2DO3A 4J9CA 4BI3A 4JRIA 2KBTA 3PGGA 4BDYA 1D3BB 1KG1A 4RCBA 2DXCA 2J05A 3M0TA 4QQGA 5GANj 3FB9A 1EX4A 4LUDA 3CCJA 2AKKA 3C95A 1VQKA 5CQYA 1YHQT 4M4ZA 1KQ1A 3RESA 1TUCA 1RADB 4CI0C 1YBYA 1WDXA 2KY9A 3TEEA 3N5BB 4BE2A 1OPLA 4ANJA 1PD0A 1M9SA 2FZKB 3OYIA 2RHUA 5I11A 3LH0A 1WGSA 2KRMA 1N9SA 2HEQA 5LJ3f 4HCCA 3JCMP 1IGQA 3CCUA 2QXFA 3HRSA 2LRQA 4GY5A 1KSWA 5L8RE 1WHKA 3VS6A 1D0XA 4XU0A 4J6YA 1MMAA 2GF7A 1NM7A 2WACA 4CC3A 3JB9D 1GRIA 1ZBXA 1NYGA 2JS2A 2K3BA 1D0ZA 2CREA 3TVTA 3EG3A 1YI2T 3I5RA 3I56A 3JCMQ 5LJ3j 3C0CA 2LNVA 3PNWC 2KMTA 1YCYA 1X2QA 5KYXB 4ME7A 2XU8A 3CMAT 2DMOA 4M77B 2MIOA 2HD0A 2BKDN 4NL3A 1M5Q1 2XMFA 3CCLT 2KT1A 2H3EB 4PJOD 3JV3A 3WVDB 1QMCA 2CP2A 4DOVA 1YJNT 1QCOA 1XTDA 2DETA 1HXDA 1IGUA 5LJ5d 4C92A 3CCRQ 2CP6A 4KULA 1VQ4Q 1VQ5A 4V2SA 4BY6B 1D3BA 4DBQA 3C12A 1M1KC 2EYQA 4KRTA 3OYHA 2ZGWA 2FPFA 1OV3A 3VS1A 1MMGA 1NE8A 1IHWA 2PTKA 3J81E 1YJ9A 4OGEA 4WTOB 4J9FA 1JB0E 5GAMd 3FRNA 3M57A 2EGAA 2A36A 4M7AG 2EQUA 3RERA 5IHKA 2KYBA 4M7AF 2P84A 3OS0A 3CCJT 1LNXA 4FU6A 3X25B 1VQKT 4RMOA 2A7YA 2E6NA 4DOWA 1RLQC 1YJWQ 2E3HA 1EFNA 1NJIU 4PL6A 5I2SA 2ROTA 2DE0X 1BIBA 1ZUYA 2GFAA 5A0GA 2HSEB 3NMZC 2VGNA 1NZ9A 1N8RC 2L89A 1X6BA 4BE1A 3FIFA 1OX9A 5GAOp 1VQLA 5FWBA 2PQWA 4IURA 4C5HA 1WJQA 4XU2A 1PCXA 1M8MA 1V76A 4VUBA 2FL7A 4M7AC 1NEBA 3JAME 2FVUA 4C8QG 4PKCC 2OTLQ 2LX9A 1NLPC 2M9UA 2BZYA 4C8QF 4B6MA 4OMQA 3UWNA 1YIJT 2L5QA 3KXTA 1FYNA 1ACMB 2EPDA 1UB4A 4BD3A 5KYXA 2ZCFB 1JO8A 2LT4A 3R6OA 5GMKl 1M2OA 4A54A 4M77A 3OSSC 2K5IA 3ASKA 2RI2A 2RQUA 4BE0A 2QAZA 3BY7A 1RAEB 3I56T 1NJIR 3CXCP 4PFZA 2L3QA 2DD4A 4E6RA 3L2ZA 3F70A 2CDTA 2HKQB 1YHQQ 1QLYA 2GCXA 2K4YA 2JUFA 3GOXA 2DX1A 4HVVA 4E7JA 4D8KA 3VKIA 1RAAB 1VQ7T 5IHNA 2YXYA 4C8QC 3CD6T 2AT1B 4HKEA 1M90C 3KFVA 1GCPA 3DB4A 3H8ZA 3JCMX 4J9BA 1UG1A 1H92A 4N0AA 4FSXA 4Z89A 1JRIA 1B07A 4A4KA 3QZ5B 3M56A 4OP0A 1GBRA 1G3YA 4L6V5 3THKA 2HCKA 2BE9B 4ELZC 3V7CA 3AT1B 1I4K1 1BIAA 3QJ6A 1UGSB 3EHQA 4JUVA 1VQ6A 2J06A 2MCNA 1BCOA 3META 2LJ3A 4ESRA 1W1FA 1I5OB 1TTHB 2F2WA 3P8BB 2LX7A 1YCSB 1AZGB 3PTAA 2EYYA 1YI2Q 3GPLA 2L3RA 3FEOA 2P0KA 1QVFA 1X75C 3G4SA 2BUDA 1AZEA 2DLPA 2QEXQ 4QW2A 5KYYB 2KGTA 1K9MU 3CMAQ 3A8GB 1RI0A 1B7TA 3JB9G 4PJJA 2DIGA 3G6ET 4M75E 2KQWA 3CCLQ 1QWEA 1WLPB 3QBYA 2E3IA 3A8LB 2V1RA 2OTJT 4ZN3A 1YJNQ 3CPWA 1YNZA 3EH2A 1TG0A 1Y07A 2JZ2A 1PWTA 3EFRA 2PUKB 4M78D 2DERA 4E47A 3EGDA 1PRMC 1TUGB 1S72T 5FU7C 1JJ2P 2QTXA 5LJ3e 1Q7YU 5ECAA 4PFOA 4PJOG 3RNJA 1D0YA 2LDMA 2RQWA 1I81A 4EPCA 4IUVA 1KD1U 1UE9A 1NPPA 4O5VA 1K9MR 3UF4A 4BDZA 4NS5A 3M53A 1WQ7A 3CCJQ 4OMNA 1VIFA 1VQKQ 3E9GA 4PJLA 5GAOr 2RHXA 1D1BA 5IXBA 1R77A 4JJCA 3V7SA 5GAN2 2X4YA 1JU5C 3CC4A 2GNCA 4C92E 3I55A 1M8VA 3H0FA 4C5IA 2AHJB 1RAHB 2AIRB 5KCHA 2AKLA 4F7UG 5KYWB 2CP5A 4AFSC 2EJ9A 3VUZA 1UTIA 2F5KA 4PJOC 3JCMg 3SWNC 1Q7YR 4M7DG 1QVFS 2JW4A 5I21A 3JCMe 1KD1R 1K8AU 4FW1A 2RHIA 1YIJQ 2E41A 5AYFA 2DRMA 3X28B 2QA4A 1SHFA 1PNJA 1CKAA 2O9VA 2W0ZA 3OYYA 3CCSA 3EGUA 1X6GA 3CPWS 2MF2A 3TQ7P 3OQ5A 1TUDA 3I56Q 1ZSZC 5FRMA 3UPUA 1RLPC 3FJPA 1Q81C 2QQRA 4PJNA 3VU3C 2V8JA 3QG1A 2XHCA 1X27A 2LZ6B 3A5ZB 2JTEA 1IRXA 3EAEA 3FC3A 1K0SA 5FROA 1MV3A 2DK3A 2KR3A 4M7DC 2RMOA 1X01A 3EHRA 3OYBA 1VQ7Q 4CC4B 4DBFA 5LJ5g 3CD6Q 2HBPA 4AFZC 1I8FA 4M7AB 1BKBA 2FZGB 1OZ2A 4FT2A 1K8AR 2F1LA 2O9SA 3INZA 4BI4A 2GGRA 4J5YA 4M77E 1MNDA 3SFMA 2IIMA 1RABB 3Q1JA 4RTUA 1MGQA 2K5LA 5GANd 2PVGB 2E65A 2GTOA 2LTOA 4MZTA 5CQXA 2MYSA 1MUZA 3SDZA 5GAN6 1KC8U 2QASA 3RKYA 2RK1A 5GAN7 1QCNA 5KYWA 2MWPA 3GBQA 2KDSA 2M0YA 5CVIA 4R56A 5FRNA 1YJWT 1OQKA 2J6KA 3EG9B 3CQTA 2R57A 3A98A 3E1SA 4C8QB 5GAN5 2WSFE 1KC8C 1K9AA 3G6EQ 1KQSA 1UHCA 2ZPBB 4B9XA 2KYMA 5I2MA 2OTJQ 2LCCA 2JOYA 1W2BA 4Y28E 2VKNA 2D6FA 3BFMA 1YFNA 1VQLQ 2HSPA 2EYXA 2YWWA 2DM1A 1G3TA 1K76A 2ED0A 3QSUA 5GMKi 1V1CA 3GP8A 1S72Q 3G71A 2RJEA 2NUTA 3SB2A 3JCMV 3MEUA 3OYKA 5IH2A 3CBPA 4F17A 1KJWA 2DVJA 1UUEA 1UGQB 2EGEA 3M0QA 3QJYA 2LQKA 2XKOC 5CR2A 4MZMA 4JLIA 1KC8R 4XTZA 4UC4A 3CCST 4M78G 3JCMh 1VQMT 5LJ3d 3M55A 4M78F 1AHJB 3CCMT 3PMIA 4FW2A 3MO8A 2PZ1A 3V7RA 3OSVA 3TSZA 3UT1A 3CC2A 1KFZA 3DKMA 5KYUA 2DJQA 1IB8A 3M0PA 1HYOA 5EC7A 5A0LA 2X35A 3CPFA 1G3SA 4MMKA 2P0PA 1G2BA 4EMGA 2AK5A 4NOYA 4OF1A 5IAYA 4JPBW 2HL5C 2LMJA 5GMKm 3MEWA 2DL4A 3LX7A 5D6XA 2RI5A 1UJYA 2XDDA 5FU7B 2DA9A 2K57A 4M75A 3JCMW 4M78C 3J7AF 1SG5A 1VQPA 3VS3A 1Y96A 3OS1A 1ABQA 4JRPA 1YITA 3MEAA 1ZA2B 2KSSA 2RA2A 4L5GA 5EG2A 2HQEA 5LJ5h 2LVMA 3J80E 2D0NA 2MOXA 2RHYA 1U3OA 3EG9A 3JSCA 4X9CA 1KQSS 2CH4A 4J83A 1WHLA 1W2BS 1WQWA 2KRNA 3CPWP 4ZGDB 1NLOC 3OMCA 1E7OA 4XTUA 1MHNA 3FLGA 2ZPHB 4FM4B 4RG8A 5HK0A 2IPOB 1BI3A 2QEXT 3QYGB 2X4JA 2M0OA 1G3WA 2EFIA 1U1TA 4PK4A 3OB9A 4PJOB 1WFWA 2E70A 2KK4A 1WHMA 3SWNB 1M1KU 3OYGA 5GMKh 3A8OB 3HPWA 4C0DC 4XQ3A 1LOJA 2L3PA
chains in the Genus database with same CATH topology
2RH2A 5GAN4 4J8OA 2H3JA 4HKEA 3MHXA 4ZTFA 3LGFA 3SD4A 4M7DE 1M90C 3VYHB 3MCAB 3HRTA 4M77C 1Q82U 4PLIA 5C0MA 2Y4YA 3DB4A 3H8ZA 4F7UF 3JCMf 1I5LA 3JCMX 3LW5E 3CCLA 4MDXA 1VUBA 1DJ7B 1LJOA 3G71T 2NLUA 3HKSA 4N0AA 2EJFA 4FSXA 1JRIA 2D9TA 5J3BA 5GAN8 1YJNA 4A4KA 3QZ5B 3M56A 4QQDA 3QUIA 4EDUA 4OP0A 4HT9A 4HCZA 3LYIA 2QA4T 2CYZB 2FHDA 1G3YA 3DB3A 4L6V5 5DLOA 2EIFA 4PLLA 4M7DF 4XTWA 4BACA 4QVZA 2EWNA 2LT1A 2QI2A 4ELZC 3V7CA 2VYTA 1I4K1 3GF5A 4JJNK 3OYDA 1BIAA 2OTLA 1KHIA 3QJ6A 1UGSB 4JUVA 3RMSA 1VQ6A 4ZGJB 4F7UB 4RKUE 3LWIA 3META 4BY6C 1QVGA 4M78A 2E1HA 5HKCA 1Y7XA 1BI1A 5GANh 1N27A 4IKFA 2E12A 3E19A 4LDYA 2JN0A 2EQMA 2V8KA 3P8BB 3HFOA 2R58A 3PTAA 2HAXA 4M7AA 1VQMA 1W4SA 2ZPGB 5CK9A 4M7DB 2HNIA 3OYLA 1N8RU 3GPLA 2L3RA 4C92D 3FEOA 1K8AC 2P0KA 4ZGEB 1X75C 2K5FA 3CCMA 3GLXA 2BUDA 5DY9A 4DQ2A 2HQXA 2RK2A 3G4SA 2F5TX 3UDCA 1UEBA 4QW2A 3G7ZA 4N0AC 3VUBA 3OBWA 4A4HA 3CXCS 2P0QA 4OVAA 1K9MU 5LL6S 3A8GB 4FL6A 4C5EA 1RI0A 1YHQA 3JB9G 2CS7A 1JJ2A 1Q86U 1ZQ1A 1VQ9A 4IUPA 2DIGA 3G6ET 4M75E 1VQ8T 1QP3A 2D0QB 2DXUA 2KQWA 1BI0A 4YTLA 3WXMB 5M9OA 3QBYA 1V29B 4D6WA 3A8LB 2K2VA 2VC8A 4OB1B 1FXXA 2DAQA 2X4WA 4X9DA 2OTJT 3OBYA 4ZN3A 3CPWA 4MZPA 4J6XA 1N9RA 2VGMA 1Y07A 1ZHIA 2YLCA 3MP6A 2JZ2A 3EFRA 2PUKB 2XD0A 5LJ5f 4M78D 2VXFA 1X6OA 3BDUA 4E47A 2DJZA 2LC4A 3P8HA 2EQKA 3CCUT 1O9SA 3CCRT 1FX7A 3V8JA 1JBMA 1VQ4T 1VQNT 1S72T 1PSEA 1Y71A 3CD6T 4M7AD 5FU7C 3OA6A 3JB9I 1KHCA 2QTXA 5LJ3e 3OYEA 3JB9J 1U8RA 1Q7YU 4C8QA 4EMKB 4KBMB 4KUDK 3DLLA 3JCMd 4PJOG 3CCQA 5KE2A 4XTYA 5GAMe 4BI8B 4E7IA 2GQVA 3FDRA 2LDMA 1I81A 4A53A 2Y4XA 4EPCA 4IUTA 1FWZA 1K73C 4IUVA 4JS4A 2DD5A 4P5NA 3URGA 4PJOA 5LJ5j 3M4GA 1KD1U 3OW2A 2QDYB 3V8KA 4LDWA 4M75B 1NPPA 5HY6A 1YIJA 4ZN1A 2XDPA 4N4GA 4E7KA 5DLQE 4XAXB 5LJ3h 3KBGA 2FB7A 4O5VA 1M1FA 4OMFB 2ZPFB 4GLKA 5IN1A 3TCJA 4BDZA 4NS5A 3M53A 1WQ7A 5GAMh 1OYXA 2WSEE 1Y96B 4OB3B 3HSBA 1VIFA 5KE3A 3L2UA 2DKGA 1M90U 3E9GA 1QVFA 5GAOr 3OY9A 5CKHA 2RHXA 5A2QE 3QZ9B 2RB6A 5A0DA 2PVOB 2RHZA 3V7SA 5FU6C 2XIDA 5GAN2 2X4YA 2QQAA 1M4ZA 2KAFA 2QEXA 1O75A 3CC4A 4C92E 3I55A 2F69A 1M8VA 2EJGA 3L2VA 3CBMA 4C5IA 4N4IA 2AHJB 3P8DA 3ZEHA 5KCHA 4O6JA 3S3NA 4F7UG 4XK8E 3ER0A 2DTIA 3TREA 4C8QD 3LWHA 2EJ9A 3C4SA 2JTFA 1QVGS 5KH6A 1QVPA 4IUQA 5CIUA 3VUZA 2F5KA 3VV0A 3PIOA 2XDBA 5HK3A 4PJOC 2WSCE 2XK0A 1VQ5T 4FIBA 2A3LA 5CKEA 4M77D 4F7UA 2DEQA 2R5AA 5CKFA 4LDXA 1IZ6A 4JDSA 3JCMg 2MWOA 3SWNC 1VQ7A 3VYGA 3PT9A 2DIQA 4C0FA 3CD6A 5GMKj 2RJFA 5GANf 4M7DG 4FT4A 3ME9A 3CCVA 1QVFS 3GIBA 1NPRA 3LLRA 3OYAA 4LD6A 5CAIA 1IREB 5I21A 4M7DA 5GAOl 2CZ7B 2MAMA 4M78E 3JCMe 2VV5A 4C5GA 3OS5A 1YJ9T 1K8AU 2E6ZA 2RHIA 4Z02A 3OYMA 2E41A 3S3OA 2OTLT 5AYFA 2XI9A 1JJ2S 3DLMA 2PUOB 3X28B 4HT8A 2QA4A 1M1GA 4JS5A 2EQJA 3CC2T 4M7AE 1H641 1HK9A 4C92B 3OYYA 3CCSA 1WJRA 1VIEA 2DO3A 4BUGA 4KT0E 3S3MA 4BI3A 4JRIA 4QVCA 3PGGA 3CPWS 2MF2A 4BDYA 3OQ5A 3A8HB 1D3BB 1KG1A 4RCBA 5FRMA 3H6ZA 2DXCA 3CCEA 3UPUA 3FJPA 2ZPEB 1Q81C 3CMEA 2CZ6B 2QQRA 4QQGA 5GANj 3VU3C 2V8JA 3QG1A 3NFCA 2ZPIB 3FB9A 4C0GA 2XHCA 3OYNA 3CCJA 3A5ZB 4J7IA 3EAEA 4B9WA 3L2QA 3FC3A 4LD9K 3C95A 1VQKA 2FYKA 3HHTB 5CQYA 4L59A 1YHQT 5FROA 1KQ1A 3RESA 3PFSA 2DK3A 3X20B 2QQBA 1VQ9T 4M7DC 4CI0C 5D6WA 1X01A 2B8AA 1YBYA 2JTMA 2QQ9A 4M78B 4BB7A 1R8OB 3OYBA 2DXBA 4M7DD 4QQ6A 2KY9A 5LJ5g 1QW1A 3LGLA 4EMKA 1VQLT 3TEEA 2HBPA 2L8DA 4E7HA 1VQPT 3MEVA 5DM7R 1I8FA 3N5BB 4BE2A 4M7AB 3OW2S 1VQOA 1BKBA 3G6EA 1XQHA 4M75G 4ATOA 1UGPB 2QQSA 1YITT 1K73U 1M9SA 2RM4A 4M75F 1OZ2A 3OYIA 4FT2A 3L2RA 3CC7A 2OTJA 2RHUA 1B34B 4C8QE 3LH0A 5CKBA 1NJIC 1WGSA 2DTOA 3INZA 1N9SA 4BI4A 3A8MB 4J5YA 3E9FA 3M58A 2CKKA 5LJ3f 2C06A 4XTXA 4HCCA 4M77E 4ELYC 3JCMJ 3RKXA 2Y90A 5GAMf 3SFMA 3EFSA 3CCQT 3JCMP 3CCUA 3Q1JA 3CCRA 2QXFA 3HRSA 1MGQA 2LRQA 4GY5A 1N6AA 5GAOq 3CEYA 2K5LA 5L8RE 5GANd 1S72A 2PVGB 4R55A 3SWNA 2E65A 2YLBA 2JVVA 2LTOA 3MP8A 3OYJA 4MZTA 4XU0A 5CQXA 4J6YA 2I2LA 4RG2A 5J39A 2GF7A 3JB9D 2WACA 3WVEB 3QHSA 4EMKC 2RI3A 4M77F 3M4YA 3QXEB 3SDZA 5GAN6 1KC8U 1ZBXA 4XU1A 1XNIA 2RK1A 3RKYA 5GAN7 2RD1A 5GAOm 4NL2A 2MWPA 4HA8A 2KDSA 3O8VA 1YI2T 5CVIA 1XOVA 3I56A 4R56A 2CGHA 5FRNA 5J26A 1GXIE 1YJWT 3JCMQ 2DZ9A 5LJ3j 2LNVA 3PNWC 2KMTA 4M75C 4CRIA 2R57A 3S6WA 3E1SA 4C0DB 4C8QB 1YCYA 2WSFE 2YRVA 5GAN5 1TH7A 2O4XB 4ME7A 5GAMj 1WJSA 3JCMb 2ZZDA 1KC8C 2XU8A 3CMAT 3V8LA 4M77B 2DTHA 4WF2A 2MMPA 2V8IA 2HD0A 1KQSA 5FLXE 2BKDN 2ZPBB 4B9XA 4NL3A 3VJPA 1M5Q1 3M9QA 5I2MA 2LCCA 2JOYA 3QKJA 1W2BA 4Y28E 3CCLT 4C92G 2D6FA 3BFMA 4RCCA 4PJOD 3WVDB 4C92F 4DOVA 1YJNT 1XTDA 2O01E 5IT9E 3PIPA 1HXDA 1BI2A 1G3TA 1QP2A 5LJ5d 4C92A 3QSUA 5GANg 2VUBA 3QPHA 5GMKi 4KULA 3CCVT 3GP8A 1WNLA 3QIIA 1VQ5A 2K3YA 4V2SA 2CZ0B 2RJEA 3G71A 4BY6B 1D3BA 3SB2A 3JCMV 1VQ6T 3MEUA 4OGCA 3OYKA 3C12A 3CBPA 1M1KC 1Q81U 2EYQA 2DPPB 2M1HA 3BDLA 3JRZA 5D6YA 4A4EA 5CKDA 5GANe 1UGQB 3M54A 3OYHA 3QJYA 4J7FA 3OMGA 1OZ3A 2ZGWA 2LQKA 2XKOC 3GNGA 1RL2A 3QYHB 4JLIA 4MZMA 4XTZA 5CR2A 2E5QA 1KQ2A 3C94A 1Q82C 3L1AA 3AHUA 1NE8A 4N4HA 4UC4A 1H3ZA 3CCST 4M78G 3JCMh 1VQMT 3J81E 5LJ3d 1YJ9A 4OGEA 3M55A 4J6WA 4M78F 2GFUA 2R5MA 3NTIA 1JB0E 4IUUA 1AHJB 4C0ZA 5GAMd 3FRNA 3PMIA 3CCMT 3G4ST 4Y91A 3MO8A 3OS2A 3M57A 3V7RA 3OSVA 3UT1A 3CC2A 3CCET 4M7AG 2EQUA 3RERA 2OAUA 3CMET 4JRQA 4M7AF 3DKMA 3M5AA 4XU3A 3NTHA 3OS0A 2P4TA 1LNXA 4C92C 1SSFA 3CCJT 4FU6A 3X25B 1VQNA 1VQKT 5A0LA 2X35A 4RMOA 2A7YA 3CPFA 1G3SA 2E6NA 4DOWA 5CCAA 4MMKA 2P0PA 4OB2B 4EMGA 1B34A 4QVDA 4NOYA 3L2WA 1NJIU 3HL8A 5GAN3 4PL6A 4OF1A 4ZTJA 5IAYA 2DVEA 2BIVA 5I2SA 3RUXA 3X24B 3JB9H 1BIBA 2E10A 5GMKm 3BW1A 2GFAA 3MEWA 5A0GA 2LCLA 3L42A 2VGNA 1VQ8A 1NZ9A 3OYFA 4LDVA 3LX7A 5CO7A 3OYCA 1N8RC 2L89A 3JB9F 3KUFA 5D6XA 2RI5A 1VQOT 1WPYA 2XDDA 4E7LA 4LDUA 4BE1A 3FIFA 5FU7B 5LJ5e 3TU4K 2K57A 4M75A 2LQ8A 4OB0B 1G5VA 5GAOp 4DA4A 3CC7T 3JCMW 1OI1A 4M78C 1VQLA 1K9MC 3J7AF 1VQPA 4HCBA 3GNFB 2PQWA 4IURA 4C5HA 2DXTA 1Q86C 1WJQA 1Y96A 3QDRB 4XU2A 3T9NA 3X26B 5LJ3g 4PJOE 3PMTA 3OS1A 4JRPA 2VXEA 3CXCA 1YITA 4VUBA 3MEAA 3ZBDA 2FL7A 2KSSA 4M7AC 2RA2A 1VQ4A 2E64A 4L5GA 5EG2A 3ZFJA 5GAMg 2EAYA 2HQEA 4EMHA 3JAME 5LJ5h 2FVUA 2LVMA 4PKCC 4C8QG 2CZ1B 2LX9A 2RO0A 2M9UA 3J80E 2PU9B 4Q5WA 4C8QF 3RKWA 4KUIA 2RHYA 1YIJT 2RJDA 3UWNA 4M77G 2L5QA 3RMQA 5GAOn 3JSCA 5KCOA 3KXTA 4A4FA 4X9CA 1KQSS 1UB4A 4JLGA 2O4XA 4II1A 1U1SA 4J83A 4PNOA 4BD3A 5C6SA 2KVQG 2DZCA 2ZCFB 2LT4A 2IG0A 3R6OA 5GMKl 4PJOF 3NTKA 4M77A 4A54A 1W2BS 4TVRA 2PVDB 2YHTA 1WQWA 2XICA 3HP9A 2K5IA 3OSSC 3ASKA 2RI2A 4XTVA 5FU6B 4ZGDB 1PSFA 1BYMA 2M16A 2XG8D 3M59A 3CBOA 3OMCA 1UGRB 4XTUA 4BE0A 1MHNA 2MI6A 3BY7A 2IVWA 3FLGA 2ZPHB 4FM4B 4RG8A 5HK0A 3I56T 2EKOA 1BI3A 2QEXT 1Q7YC 3QYGB 3CC4T 2DD4A 2JNGA 3L2ZA 2X4JA 5GMKe 3F70A 3I55T 3HRUA 2M0OA 3QO3A 2X4XA 4M75D 2GCXA 3RIRA 1G3WA 2EFIA 2K4YA 2JUFA 4JRKA 1U1TA 1YI2A 4F7UE 4PJOB 3OB9A 3GOXA 1P92A 1KD1C 3MP1A 1YJWA 2E70A 4E7JA 2KK4A 3SWNB 4A4GA 1EIFA 3VKIA 2RJCA 3HFNA 3JCMc 2K3XA 1M1KU 3OYGA 4MMLA 1VQ7T 2G3RA 4X34A 3A8OB 3HPWA 4MDWA 5GMKh 4C0DC 4C8QC 3CMAA 4XQ3A 1LOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB0 E;  1AHJ B;  3VYH B;  1UGP B;  2ZPF B;  3LW5 E;  2WSE E;  1DJ7 B;  4OB3 B;  3X25 B;  3A8M B;  3QZ5 B;  3QZ9 B;  2PVO B;  2CYZ B;  4OB2 B;  4L6V 5;  3X24 B;  5L8R E;  1UGS B;  2PVG B;  2AHJ B;  4ZGJ B;  4RKU E;  4XK8 E;  3WVE B;  2WSC E;  3QXE B;  4OB0 B;  3VYG A;  2ZPG B;  4ZGE B;  1GXI E;  3X26 B;  1IRE B;  2CZ7 B;  2WSF E;  3A8G B;  2CZ1 B;  2ZZD A;  2PU9 B;  2PUO B;  3X28 B;  1QP3 A;  2D0Q B;  2ZPB B;  1V29 B;  3A8L B;  2ZCF B;  4OB1 B;  4Y28 E;  4KT0 E;  2PVD B;  3WVD B;  4ZGD B;  1PSF A;  2O01 E;  3A8H B;  1UGR B;  2PUK B;  1QP2 A;  2ZPH B;  4FM4 B;  2DXC A;  2ZPE B;  2CZ6 B;  3QYG B;  2ZPI B;  2DD4 A;  2CZ0 B;  1PSE A;  3HHT B;  2DPP B;  3X20 B;  1UGQ B;  3QYH B;  2DXB A;  2DD5 A;  3A8O B;  2QDY B; 
#chains in the Genus database with same CATH topology
 3LGF A;  1AWW A;  5C0M A;  1VYT A;  2Y4Y A;  1GFC A;  3JCM f;  1X2K A;  2A28 A;  3LW5 E;  2YSQ A;  3M0S A;  1WYX A;  1LJO A;  3G71 T;  2KXD A;  3HKS A;  2EJF A;  1NYF A;  4QQD A;  4HT9 A;  1RAI B;  3M0R A;  5DLO A;  4HXJ A;  2LT1 A;  2M02 A;  3GF5 A;  4JJN K;  1ZSZ B;  3OYD A;  1KHI A;  4ZGJ B;  4F7U B;  2LP5 A;  4RKU E;  3LWI A;  1RAC B;  4Y92 A;  1BI1 A;  1N27 A;  2V8K A;  3HFO A;  2QTV A;  2OJ2 A;  2HAX A;  3NHN A;  2YUN A;  2ZPG B;  4M7D B;  1N8R U;  4J9H A;  3A1P A;  1NEG A;  2HQX A;  2PNI A;  1TWB A;  3OBW A;  1M1K R;  2P0Q A;  1SPK A;  2CS7 A;  1ZQ1 A;  1QVG P;  4IUP A;  5FWC A;  2QGG A;  5M9O A;  5LJ5 f;  2K2V A;  2DAQ A;  3OBY A;  4MZP A;  2EKH A;  2CP7 A;  1K1Z A;  2HKN A;  2VVK A;  3BDU A;  8ATC B;  3MKD A;  2F2X A;  3CCU T;  2D8J A;  1Y71 A;  3OA6 A;  1PM3 A;  2JMC A;  3JB9 J;  1WXT A;  5I22 A;  2KT8 A;  3DLL A;  3CCQ A;  4XTY A;  4E7I A;  2GQV A;  3CCS Q;  4IIO A;  1VQM Q;  1K73 C;  2EGC A;  1N8R R;  4ZNX A;  4PJO A;  5LJ5 j;  3M4G A;  3CCM Q;  2MK5 A;  3OW2 A;  2XDP A;  3UAT A;  4OMF B;  5IN1 A;  3TCJ A;  1I0C A;  1OYX A;  2FPE A;  2WSE E;  1I07 A;  2DKG A;  1M90 U;  1D1C A;  1JEG A;  2FO0 A;  5CKH A;  5A2Q E;  1C6V X;  3QZ9 B;  2RB6 A;  2J6O A;  2XID A;  2QQA A;  2G6F X;  2EJG A;  4N4I A;  2K2M A;  3ZEH A;  4D8D A;  3NPF A;  1R0C B;  1QQJ A;  2DTI A;  3C4S A;  1QVP A;  3VV0 A;  1ZSZ A;  5HK3 A;  2WSC E;  1VQ5 T;  4PJM A;  4F7U A;  4LDX A;  3VYG A;  3PT9 A;  1QKX A;  5GMK j;  2ED1 A;  4FT4 A;  3PVQ A;  3CCV A;  3GIB A;  4J9I A;  2RQR A;  4LD6 A;  5CAI A;  1IRE B;  3E2U A;  4M7D A;  5AT1 B;  4C5G A;  1YJ9 T;  4Z02 A;  3S3O A;  1ZBJ A;  1ZUK A;  4RTY A;  1D09 B;  1A0N B;  2FRY A;  1M1G A;  4M7A E;  1H64 1;  1HK9 A;  1WJR A;  1VIE A;  4E2F B;  3S3M A;  1M90 R;  1IO6 A;  2VAS A;  3H6Z A;  3CCE A;  3CME A;  2CZ6 B;  2AZS A;  2RQT A;  2C0I A;  3L2Q A;  2FYK A;  3HHT B;  4L59 A;  3PFS A;  2YUO A;  3EG0 A;  1LPL A;  1K4U S;  2JTM A;  2QQ9 A;  4M78 B;  4BB7 A;  2GTJ A;  1E6H A;  4GBQ A;  2EYZ A;  1QW1 A;  1GL5 A;  1VQL T;  2JJ9 A;  1MNE A;  2LQN A;  3UA7 A;  3OW2 S;  4JZ4 A;  1XQH A;  2GBQ A;  1UGP B;  1YN8 A;  2QQS A;  2RM4 A;  4FCY A;  3L2R A;  3G71 Q;  4C8Q E;  1M3A A;  5CKB A;  2DTO A;  4OMO A;  3A8M B;  3M58 A;  2CKK A;  2C06 A;  4ELY C;  3JCM J;  3RKX A;  1MMN A;  1U5S A;  2YRD A;  3SHW A;  2MPX C;  3ULR B;  3CCQ T;  3CCR A;  5GAO q;  1N6A A;  3CEY A;  2FRW A;  1NBE B;  2YLB A;  3MP8 A;  3OYJ A;  2I2L A;  5J39 A;  1OU9 A;  3H0I A;  4EMK C;  4M77 F;  3M4Y A;  3QXE B;  4XU1 A;  5D7U A;  5GAO m;  2RD1 A;  3VS0 A;  4NL2 A;  4HA8 A;  2CT4 A;  4C0D B;  1SRM A;  4JJD A;  2YRV A;  2K7A A;  2GQI A;  4HVU A;  1WJS A;  3JCM b;  4RUG A;  4J9E A;  4ORZ A;  2DTH A;  4WF2 A;  2MMP A;  4RTZ A;  5FLX E;  3VJP A;  3M9Q A;  4HVW A;  3ZL7 C;  1JXO A;  2NYS A;  4RCC A;  1U06 A;  1H8K A;  1PD1 A;  1TSF A;  1QP2 A;  2YDL A;  2VUB A;  1UDL A;  3CCU Q;  2YUP A;  3CCV T;  3QII A;  3I9Q A;  2CZ0 B;  4RTV A;  1VQ6 T;  1Q81 U;  5CKD A;  2DPP B;  1LCK A;  2M1H A;  3BDL A;  1PRL C;  3JRZ A;  4A4E A;  5KYY A;  3QYH B;  3OMG A;  1OEB A;  3GNG A;  1KQ2 A;  2E5Q A;  2V26 A;  1Q82 C;  3AHU A;  1H3Z A;  2O88 A;  4J6W A;  2C0T A;  1RI9 A;  2GFU A;  4IUU A;  3NTI A;  4J9D A;  4C0Z A;  3G4S T;  3OS2 A;  2K79 A;  3CCE T;  2DL8 A;  3CME T;  3M5A A;  1M3B A;  3NTH A;  1T3L A;  1FMW A;  2Z0W A;  1SSF A;  1C0M A;  2JT4 A;  5HCK A;  1BK2 A;  2COW A;  5CCA A;  2O31 A;  2DFU A;  2ENM A;  2RF0 A;  4KGZ B;  4ZTJ A;  2BIV A;  4Z8A A;  3X24 B;  2E10 A;  3EGX B;  2JXB A;  3BW1 A;  2LCL A;  3M0U A;  3L42 A;  2X3W D;  3H0H A;  1VQ8 A;  5CO7 A;  1T0J A;  2D1X A;  3KUF A;  1VQ5 Q;  3MPU B;  4E7L A;  5LJ5 e;  3TU4 K;  2LQ8 A;  4DA4 A;  2H8H A;  3SEM A;  1Q81 R;  3HTR A;  2OX7 A;  2DEU A;  2KXC A;  4CC2 A;  4HCB A;  1J3T A;  1Q86 C;  4PJO E;  3QDR B;  3PMT A;  3CXC A;  3ZBD A;  1VQN A;  3ZFJ A;  5GAM g;  1C1A A;  2EAY A;  1YJ9 Q;  3BE3 A;  2RO0 A;  2HBW A;  1VA7 A;  2L2P A;  2PU9 B;  4Q5W A;  4KUI A;  2RJD A;  5GAO n;  5KCO A;  4A4F A;  5L23 A;  4II1 A;  1AWX A;  1U1S A;  2CP3 A;  4PNO A;  2DZC A;  8AT1 B;  1R0B G;  2PVD B;  2XIC A;  2QDL A;  3M59 A;  2MI6 A;  2IVW A;  2A0F B;  4JJB A;  3CC4 T;  5GMK e;  3I55 T;  2VB6 A;  4E7Z A;  3QO3 A;  4M75 D;  2X4X A;  1JQQ A;  2FEI A;  3RIR A;  2A37 A;  2ROL A;  4JRK A;  2J7I A;  1YI2 A;  4F7U E;  2OI3 A;  3MP1 A;  2EW3 A;  2COZ A;  4A4G A;  1AWJ A;  3JCM c;  2K3X A;  3TSW A;  2G3R A;  2RN8 A;  4X34 A;  2E5K A;  3CMA A;  4KGV B;  1MMD A;  4M7D E;  4ZTF A;  2DIL A;  3SD4 A;  3H41 A;  1EZZ B;  3HRT A;  2JS0 A;  3CCL A;  4MDX A;  1VUB A;  2NLU A;  5GAN 8;  5J3B A;  1YJN A;  2D9T A;  3QUI A;  2QA4 T;  2X51 A;  4AG2 C;  2CYZ B;  3CCQ Q;  3DB3 A;  1YWO A;  2EIF A;  4PLL A;  2EWN A;  2QI2 A;  2VYT A;  1PKS A;  3NGP A;  2L3S A;  1PC0 A;  1TU0 B;  1UGV A;  5HKC A;  1Y7X A;  1M2V B;  1SKU B;  3E19 A;  2JN0 A;  2HZY A;  2HMA A;  2JM9 A;  5KYN A;  3EGX A;  2R58 A;  4M7A A;  2HDA A;  3D7S B;  3OYL A;  3U23 A;  4C92 D;  2K5F A;  3GLX A;  2RK2 A;  2F5T X;  3VUB A;  1WA7 A;  3G7Z A;  3CXC S;  1RAG B;  2DL5 A;  5LL6 S;  1BB9 A;  1ZUU A;  3RDV A;  4Z88 A;  1JJ2 A;  1VQ9 A;  1VYV A;  1VQ8 T;  1QP3 A;  2DXU A;  2I0N A;  6AT1 B;  4D6W A;  4LNP A;  4OB1 B;  2X4W A;  1RUW A;  1N9R A;  1ZHI A;  2YLC A;  2CP0 A;  4CC7 A;  1QVF P;  2VXF A;  1H3H A;  4F04 B;  3CCV Q;  1ZX6 A;  3P8H A;  1X43 A;  2EQK A;  1VQ6 Q;  1VQN T;  1PSE A;  2KEA A;  1KHC A;  2BZ8 A;  3OYE A;  1U8R A;  4C8Q A;  4EMK B;  4KBM B;  4KUD K;  3JCM d;  4BI8 B;  1OUL A;  2Y4X A;  2FZC B;  1WXU A;  1FWZ A;  2LQW A;  4IUT A;  2B86 A;  2DD5 A;  4P5N A;  1SEM A;  4LXC A;  1SF9 A;  3V8K A;  3G4S Q;  1YIJ A;  2E4H A;  4ZN1 A;  3CCE Q;  4XAX B;  2DBK A;  3KBG A;  3CME Q;  1M1F A;  2KE9 A;  5GAM h;  3VRZ A;  1NG2 A;  3HSB A;  2JM8 A;  1W70 A;  3VS4 A;  3L2U A;  2K9G A;  2DRK A;  3OY9 A;  1Q95 G;  1ARK A;  5A0D A;  3PE0 A;  2RHZ A;  5FU6 C;  3REB B;  4IIM A;  1O75 A;  1GBQ A;  1M3C A;  4AFQ C;  2C0O A;  2F69 A;  2K6D A;  3L2V A;  3P8D A;  2DL7 A;  4O6J A;  4XK8 E;  2X3X D;  1IXD A;  1WHH A;  3LWH A;  3VS2 A;  5KH6 A;  2XK0 A;  3VS5 A;  5CKE A;  4M77 D;  2R5A A;  5CKF A;  4JDS A;  2MWO A;  1VQ7 A;  1M2V A;  3CD6 A;  1F1B B;  4FYV B;  1NPR A;  3LLR A;  3OYA A;  1GCQ C;  2YRC A;  4M78 E;  3O5Z A;  2VV5 A;  1JJ2 S;  4HT8 A;  1UFF A;  2M51 A;  4JS5 A;  2EQJ A;  3CC2 T;  4BUG A;  4KT0 E;  1Z9Z A;  4QVC A;  1B3Q A;  1SSH A;  3A8H B;  3LH5 A;  1MV0 B;  2ZPE B;  1OOT A;  3CC4 Q;  1IHV A;  2CSQ A;  3NFC A;  3I55 Q;  2ZPI B;  4C0G A;  3OYN A;  2KRO A;  4J7I A;  4B9W A;  4LD9 K;  2HL3 A;  4KH0 B;  3X20 B;  2QQB A;  2NUP B;  2QK0 A;  1VQ9 T;  5D6W A;  2B8A A;  1R8O B;  4X1V A;  2DXB A;  4M7D D;  4QQ6 A;  3LGL A;  4EMK A;  4E7H A;  2L8D A;  1VQP T;  3MEV A;  5DM7 R;  4DBH A;  1TXQ A;  1VQO A;  2DBM A;  3G6E A;  4M75 G;  3UA6 A;  4ATO A;  4AT1 B;  1YIT T;  1K73 U;  1AD5 A;  4M75 F;  3R6N A;  3CC7 A;  2OTJ A;  1N5Z A;  1B34 B;  1NJI C;  3E9F A;  2QA4 Q;  4XTX A;  3RBB B;  3I5S A;  1YP5 A;  2FPD A;  2P4R A;  2Y90 A;  5GAM f;  3EFS A;  1X69 A;  1SRL A;  2O2O A;  1S72 A;  1E6G A;  4R55 A;  1PHT A;  3QDF A;  4JZ3 A;  2KRS A;  3SWN A;  2JVV A;  4RTW A;  4AMC A;  3I35 A;  4RG2 A;  3WVE B;  4R0K A;  1T3S A;  3QHS A;  2RI3 A;  1XNI A;  3EGD B;  2CSI A;  3RR6 A;  3O8V A;  1XOV A;  2CGH A;  5J26 A;  1GXI E;  2L0A A;  4LE9 A;  4F16 A;  2DZ9 A;  2V1Q A;  1VYU A;  4M75 C;  4CRI A;  3S6W A;  3VRY A;  1TH7 A;  2O4X B;  5GAM j;  2ZZD A;  3V8L A;  1HJD A;  1VQ8 Q;  2V8I A;  2NUZ A;  4DEX A;  1K73 R;  3QKJ A;  4J9G A;  2ATC B;  4C92 G;  4C92 F;  1OX8 A;  2O01 E;  5IT9 E;  3PIP A;  1BI2 A;  5GAN g;  3QPH A;  1OPK A;  2FG0 A;  1WNL A;  1VQN Q;  2K3Y A;  2DNU A;  1AVZ C;  4OMM A;  4OGC A;  2QG9 B;  5D6Y A;  5GAN e;  1KQS P;  2EYW A;  1T0H A;  3M54 A;  3PVL A;  4AG1 C;  4J7F A;  3REA B;  1OZ3 A;  1WXB A;  1Y0M A;  1G8X A;  1RL2 A;  1WZO A;  1W2B P;  3C94 A;  3L1A A;  4N4H A;  3VS7 A;  2BE7 D;  2NUP A;  4FYW B;  3G1J A;  2R5M A;  2DYB A;  2J6F A;  2CUB A;  4LUE A;  4Y91 A;  1M30 A;  2OAU A;  1RAF B;  4JRQ A;  1TOV A;  1WIE A;  4XU3 A;  2RNA A;  2P4T A;  4C92 C;  1KK7 A;  2ECZ A;  4OB2 B;  2BTT A;  4K11 A;  1B34 A;  4QVD A;  3L2W A;  2KI7 A;  1YWP A;  3HL8 A;  5GAN 3;  1GFD A;  2DVE A;  3EH1 A;  2D8H A;  3RUX A;  3JB9 H;  2DF6 A;  2KNB B;  3OYF A;  4LDV A;  3JB9 F;  3OYC A;  1VQO T;  1WPY A;  4LDU A;  4EIK A;  1QKW A;  4OB0 B;  5GJV B;  3CC7 T;  1G5V A;  1OI1 A;  5IXF A;  1K9M C;  1Z9Q A;  1Y57 A;  1UHF A;  3GNF B;  2DXT A;  5LJ3 g;  3T9N A;  1QCF A;  2AZV A;  4FSS A;  3X26 B;  3EFO B;  2VXE A;  1VQ4 A;  2E64 A;  4EMH A;  7AT1 B;  2ESW A;  2CZ1 B;  4E7S A;  3RKW A;  3CC2 Q;  4M77 G;  3RMQ A;  1HD3 A;  4FYX B;  4JLG A;  2O4X A;  4FYY B;  5C6S A;  2KVQ G;  2IG0 A;  4PJO F;  3NTK A;  4TVR A;  2YHT A;  3HP9 A;  4XTV A;  1I1J A;  1BYM A;  5FU6 B;  1PSF A;  2M16 A;  2XG8 D;  1WHJ A;  3CBO A;  1UGR B;  1W6X A;  2EKO A;  2EQI A;  1Q7Y C;  2LCS A;  1WX6 A;  4OMP A;  2CUD A;  2JNG A;  3QWY A;  2CT3 A;  3HRU A;  2CH4 W;  2BZX A;  1AT1 B;  1VOM A;  1UJ0 A;  1VQ9 Q;  1P92 A;  1CKB A;  1KD1 C;  4DBR A;  1YJW A;  1EIF A;  2RJC A;  3HFN A;  2VWF A;  4MML A;  1WHG A;  4MDW A;  1VQP Q;  2DYI A;  2RH2 A;  5GAN 4;  4J8O A;  2H3J A;  3MHX A;  3VYH B;  1YIT Q;  3MCA B;  1OU8 A;  1Q82 U;  4M77 C;  1D1A A;  4PLI A;  4F7U F;  1UEC A;  1I5L A;  1DJ7 B;  1WI7 A;  5FW9 A;  4EDU A;  4HCZ A;  3LYI A;  2LNH B;  3IQL A;  2FHD A;  4HCK A;  2YUQ A;  2EBP A;  4M7D F;  4XTW A;  4BAC A;  4QVZ A;  1AEY A;  1TS9 A;  2OTL A;  3RMS A;  4BY6 C;  2ABL A;  4M78 A;  1QVG A;  2E1H A;  2JMA A;  5GAN h;  4IKF A;  2E12 A;  4LDY A;  1ZSG A;  2EQM A;  2SRC A;  2YT6 A;  4QKU A;  1VQM A;  1W4S A;  5CK9 A;  2HNI A;  1XJW B;  2QYZ A;  1K8A C;  2NUT B;  4ZGE B;  3CCM A;  3EG2 A;  5DY9 A;  4DQ2 A;  1CSK A;  1LVK A;  1QWF A;  3UDC A;  1UEB A;  4N0A C;  4LN2 A;  4A4H A;  9ATC B;  4OVA A;  1KIK A;  4FL6 A;  4C5E A;  1YHQ A;  1FMK A;  4A63 B;  1Q86 U;  1PKT A;  3FJ5 A;  1BBZ A;  3EFO A;  1Q82 R;  1BCM A;  4WCI A;  2D0Q B;  1BI0 A;  4YTL A;  3WXM B;  1V29 B;  2VC8 A;  1FXX A;  4X9D A;  4J6X A;  3MJX A;  2VGM A;  3MP6 A;  4RTT A;  2HQH A;  2XD0 A;  4AFU C;  3EG1 A;  5KYU B;  1X6O A;  2DJZ A;  2LC4 A;  2RQV A;  1O9S A;  3CCR T;  1FX7 A;  1AOJ A;  3V8J A;  1JBM A;  1VQ4 T;  2W10 A;  4M7A D;  1K0X A;  3JB9 I;  4QT7 A;  2DL3 A;  1ABO A;  5KE2 A;  5GAM e;  1HSQ A;  3H9N A;  4DEY A;  3FDR A;  1AWO A;  3QWX X;  4A53 A;  4KH1 B;  4JS4 A;  1M27 C;  3URG A;  2X9H A;  2QDY B;  4LDW A;  4M75 B;  5HY6 A;  4N4G A;  4F14 A;  4E7K A;  5DLQ E;  5LJ3 h;  2FB7 A;  1G83 A;  2ZPF B;  4GLK A;  1FMV A;  2COY A;  4PFP A;  1Y96 B;  4GLM A;  4OB3 B;  1Q86 R;  5KE3 A;  1ZA1 B;  1GCQ A;  2OAW A;  1ZLM A;  2SEM A;  2PVO B;  2EVR A;  1M4Z A;  2KAF A;  2QEX A;  2QGF B;  1JXM A;  1SHG A;  3CBM A;  1BU1 A;  4OML A;  3OW2 P;  4KGX B;  3S3N A;  5IHI A;  1VQO Q;  3ER0 A;  3TRE A;  1QVG S;  4C8Q D;  2LJ0 A;  2A08 A;  2JTF A;  2LJ1 A;  4IUQ A;  5CIU A;  3PIO A;  2XDB A;  4FIB A;  2A3L A;  3CC7 Q;  2DEQ A;  1IZ6 A;  2F2V A;  2DIQ A;  4C0F A;  2ZAE A;  2RJF A;  5GAN f;  3ME9 A;  2NWM A;  4RTX A;  5GAO l;  2CZ7 B;  2MAM A;  1PG5 B;  3OS5 A;  2E6Z A;  3OYM A;  2OTL T;  5GJW B;  2XI9 A;  3DLM A;  2PUO B;  1S1N A;  2RPN A;  4C92 B;  2DO3 A;  4J9C A;  4BI3 A;  4JRI A;  2KBT A;  3PGG A;  4BDY A;  1D3B B;  1KG1 A;  4RCB A;  2DXC A;  2J05 A;  3M0T A;  4QQG A;  5GAN j;  3FB9 A;  1EX4 A;  4LUD A;  3CCJ A;  2AKK A;  3C95 A;  1VQK A;  5CQY A;  1YHQ T;  4M4Z A;  1KQ1 A;  3RES A;  1TUC A;  1RAD B;  4CI0 C;  1YBY A;  1WDX A;  2KY9 A;  3TEE A;  3N5B B;  4BE2 A;  1OPL A;  4ANJ A;  1PD0 A;  1M9S A;  2FZK B;  3OYI A;  2RHU A;  5I11 A;  3LH0 A;  1WGS A;  2KRM A;  1N9S A;  2HEQ A;  5LJ3 f;  4HCC A;  3JCM P;  1IGQ A;  3CCU A;  2QXF A;  3HRS A;  2LRQ A;  4GY5 A;  1KSW A;  5L8R E;  1WHK A;  3VS6 A;  1D0X A;  4XU0 A;  4J6Y A;  1MMA A;  2GF7 A;  1NM7 A;  2WAC A;  4CC3 A;  3JB9 D;  1GRI A;  1ZBX A;  1NYG A;  2JS2 A;  2K3B A;  1D0Z A;  2CRE A;  3TVT A;  3EG3 A;  1YI2 T;  3I5R A;  3I56 A;  3JCM Q;  5LJ3 j;  3C0C A;  2LNV A;  3PNW C;  2KMT A;  1YCY A;  1X2Q A;  5KYX B;  4ME7 A;  2XU8 A;  3CMA T;  2DMO A;  4M77 B;  2MIO A;  2HD0 A;  2BKD N;  4NL3 A;  1M5Q 1;  2XMF A;  3CCL T;  2KT1 A;  2H3E B;  4PJO D;  3JV3 A;  3WVD B;  1QMC A;  2CP2 A;  4DOV A;  1YJN T;  1QCO A;  1XTD A;  2DET A;  1HXD A;  1IGU A;  5LJ5 d;  4C92 A;  3CCR Q;  2CP6 A;  4KUL A;  1VQ4 Q;  1VQ5 A;  4V2S A;  4BY6 B;  1D3B A;  4DBQ A;  3C12 A;  1M1K C;  2EYQ A;  4KRT A;  3OYH A;  2ZGW A;  2FPF A;  1OV3 A;  3VS1 A;  1MMG A;  1NE8 A;  1IHW A;  2PTK A;  3J81 E;  1YJ9 A;  4OGE A;  4WTO B;  4J9F A;  1JB0 E;  5GAM d;  3FRN A;  3M57 A;  2EGA A;  2A36 A;  4M7A G;  2EQU A;  3RER A;  5IHK A;  2KYB A;  4M7A F;  2P84 A;  3OS0 A;  3CCJ T;  1LNX A;  4FU6 A;  3X25 B;  1VQK T;  4RMO A;  2A7Y A;  2E6N A;  4DOW A;  1RLQ C;  1YJW Q;  2E3H A;  1EFN A;  1NJI U;  4PL6 A;  5I2S A;  2ROT A;  2DE0 X;  1BIB A;  1ZUY A;  2GFA A;  5A0G A;  2HSE B;  3NMZ C;  2VGN A;  1NZ9 A;  1N8R C;  2L89 A;  1X6B A;  4BE1 A;  3FIF A;  1OX9 A;  5GAO p;  1VQL A;  5FWB A;  2PQW A;  4IUR A;  4C5H A;  1WJQ A;  4XU2 A;  1PCX A;  1M8M A;  1V76 A;  4VUB A;  2FL7 A;  4M7A C;  1NEB A;  3JAM E;  2FVU A;  4C8Q G;  4PKC C;  2OTL Q;  2LX9 A;  1NLP C;  2M9U A;  2BZY A;  4C8Q F;  4B6M A;  4OMQ A;  3UWN A;  1YIJ T;  2L5Q A;  3KXT A;  1FYN A;  1ACM B;  2EPD A;  1UB4 A;  4BD3 A;  5KYX A;  2ZCF B;  1JO8 A;  2LT4 A;  3R6O A;  5GMK l;  1M2O A;  4A54 A;  4M77 A;  3OSS C;  2K5I A;  3ASK A;  2RI2 A;  2RQU A;  4BE0 A;  2QAZ A;  3BY7 A;  1RAE B;  3I56 T;  1NJI R;  3CXC P;  4PFZ A;  2L3Q A;  2DD4 A;  4E6R A;  3L2Z A;  3F70 A;  2CDT A;  2HKQ B;  1YHQ Q;  1QLY A;  2GCX A;  2K4Y A;  2JUF A;  3GOX A;  2DX1 A;  4HVV A;  4E7J A;  4D8K A;  3VKI A;  1RAA B;  1VQ7 T;  5IHN A;  2YXY A;  4C8Q C;  3CD6 T;  2AT1 B;  4HKE A;  1M90 C;  3KFV A;  1GCP A;  3DB4 A;  3H8Z A;  3JCM X;  4J9B A;  1UG1 A;  1H92 A;  4N0A A;  4FSX A;  4Z89 A;  1JRI A;  1B07 A;  4A4K A;  3QZ5 B;  3M56 A;  4OP0 A;  1GBR A;  1G3Y A;  4L6V 5;  3THK A;  2HCK A;  2BE9 B;  4ELZ C;  3V7C A;  3AT1 B;  1I4K 1;  1BIA A;  3QJ6 A;  1UGS B;  3EHQ A;  4JUV A;  1VQ6 A;  2J06 A;  2MCN A;  1BCO A;  3MET A;  2LJ3 A;  4ESR A;  1W1F A;  1I5O B;  1TTH B;  2F2W A;  3P8B B;  2LX7 A;  1YCS B;  1AZG B;  3PTA A;  2EYY A;  1YI2 Q;  3GPL A;  2L3R A;  3FEO A;  2P0K A;  1QVF A;  1X75 C;  3G4S A;  2BUD A;  1AZE A;  2DLP A;  2QEX Q;  4QW2 A;  5KYY B;  2KGT A;  1K9M U;  3CMA Q;  3A8G B;  1RI0 A;  1B7T A;  3JB9 G;  4PJJ A;  2DIG A;  3G6E T;  4M75 E;  2KQW A;  3CCL Q;  1QWE A;  1WLP B;  3QBY A;  2E3I A;  3A8L B;  2V1R A;  2OTJ T;  4ZN3 A;  1YJN Q;  3CPW A;  1YNZ A;  3EH2 A;  1TG0 A;  1Y07 A;  2JZ2 A;  1PWT A;  3EFR A;  2PUK B;  4M78 D;  2DER A;  4E47 A;  3EGD A;  1PRM C;  1TUG B;  1S72 T;  5FU7 C;  1JJ2 P;  2QTX A;  5LJ3 e;  1Q7Y U;  5ECA A;  4PFO A;  4PJO G;  3RNJ A;  1D0Y A;  2LDM A;  2RQW A;  1I81 A;  4EPC A;  4IUV A;  1KD1 U;  1UE9 A;  1NPP A;  4O5V A;  1K9M R;  3UF4 A;  4BDZ A;  4NS5 A;  3M53 A;  1WQ7 A;  3CCJ Q;  4OMN A;  1VIF A;  1VQK Q;  3E9G A;  4PJL A;  5GAO r;  2RHX A;  1D1B A;  5IXB A;  1R77 A;  4JJC A;  3V7S A;  5GAN 2;  2X4Y A;  1JU5 C;  3CC4 A;  2GNC A;  4C92 E;  3I55 A;  1M8V A;  3H0F A;  4C5I A;  2AHJ B;  1RAH B;  2AIR B;  5KCH A;  2AKL A;  4F7U G;  5KYW B;  2CP5 A;  4AFS C;  2EJ9 A;  3VUZ A;  1UTI A;  2F5K A;  4PJO C;  3JCM g;  3SWN C;  1Q7Y R;  4M7D G;  1QVF S;  2JW4 A;  5I21 A;  3JCM e;  1KD1 R;  1K8A U;  4FW1 A;  2RHI A;  1YIJ Q;  2E41 A;  5AYF A;  2DRM A;  3X28 B;  2QA4 A;  1SHF A;  1PNJ A;  1CKA A;  2O9V A;  2W0Z A;  3OYY A;  3CCS A;  3EGU A;  1X6G A;  3CPW S;  2MF2 A;  3TQ7 P;  3OQ5 A;  1TUD A;  3I56 Q;  1ZSZ C;  5FRM A;  3UPU A;  1RLP C;  3FJP A;  1Q81 C;  2QQR A;  4PJN A;  3VU3 C;  2V8J A;  3QG1 A;  2XHC A;  1X27 A;  2LZ6 B;  3A5Z B;  2JTE A;  1IRX A;  3EAE A;  3FC3 A;  1K0S A;  5FRO A;  1MV3 A;  2DK3 A;  2KR3 A;  4M7D C;  2RMO A;  1X01 A;  3EHR A;  3OYB A;  1VQ7 Q;  4CC4 B;  4DBF A;  5LJ5 g;  3CD6 Q;  2HBP A;  4AFZ C;  1I8F A;  4M7A B;  1BKB A;  2FZG B;  1OZ2 A;  4FT2 A;  1K8A R;  2F1L A;  2O9S A;  3INZ A;  4BI4 A;  2GGR A;  4J5Y A;  4M77 E;  1MND A;  3SFM A;  2IIM A;  1RAB B;  3Q1J A;  4RTU A;  1MGQ A;  2K5L A;  5GAN d;  2PVG B;  2E65 A;  2GTO A;  2LTO A;  4MZT A;  5CQX A;  2MYS A;  1MUZ A;  3SDZ A;  5GAN 6;  1KC8 U;  2QAS A;  3RKY A;  2RK1 A;  5GAN 7;  1QCN A;  5KYW A;  2MWP A;  3GBQ A;  2KDS A;  2M0Y A;  5CVI A;  4R56 A;  5FRN A;  1YJW T;  1OQK A;  2J6K A;  3EG9 B;  3CQT A;  2R57 A;  3A98 A;  3E1S A;  4C8Q B;  5GAN 5;  2WSF E;  1KC8 C;  1K9A A;  3G6E Q;  1KQS A;  1UHC A;  2ZPB B;  4B9X A;  2KYM A;  5I2M A;  2OTJ Q;  2LCC A;  2JOY A;  1W2B A;  4Y28 E;  2VKN A;  2D6F A;  3BFM A;  1YFN A;  1VQL Q;  2HSP A;  2EYX A;  2YWW A;  2DM1 A;  1G3T A;  1K76 A;  2ED0 A;  3QSU A;  5GMK i;  1V1C A;  3GP8 A;  1S72 Q;  3G71 A;  2RJE A;  2NUT A;  3SB2 A;  3JCM V;  3MEU A;  3OYK A;  5IH2 A;  3CBP A;  4F17 A;  1KJW A;  2DVJ A;  1UUE A;  1UGQ B;  2EGE A;  3M0Q A;  3QJY A;  2LQK A;  2XKO C;  5CR2 A;  4MZM A;  4JLI A;  1KC8 R;  4XTZ A;  4UC4 A;  3CCS T;  4M78 G;  3JCM h;  1VQM T;  5LJ3 d;  3M55 A;  4M78 F;  1AHJ B;  3CCM T;  3PMI A;  4FW2 A;  3MO8 A;  2PZ1 A;  3V7R A;  3OSV A;  3TSZ A;  3UT1 A;  3CC2 A;  1KFZ A;  3DKM A;  5KYU A;  2DJQ A;  1IB8 A;  3M0P A;  1HYO A;  5EC7 A;  5A0L A;  2X35 A;  3CPF A;  1G3S A;  4MMK A;  2P0P A;  1G2B A;  4EMG A;  2AK5 A;  4NOY A;  4OF1 A;  5IAY A;  4JPB W;  2HL5 C;  2LMJ A;  5GMK m;  3MEW A;  2DL4 A;  3LX7 A;  5D6X A;  2RI5 A;  1UJY A;  2XDD A;  5FU7 B;  2DA9 A;  2K57 A;  4M75 A;  3JCM W;  4M78 C;  3J7A F;  1SG5 A;  1VQP A;  3VS3 A;  1Y96 A;  3OS1 A;  1ABQ A;  4JRP A;  1YIT A;  3MEA A;  1ZA2 B;  2KSS A;  2RA2 A;  4L5G A;  5EG2 A;  2HQE A;  5LJ5 h;  2LVM A;  3J80 E;  2D0N A;  2MOX A;  2RHY A;  1U3O A;  3EG9 A;  3JSC A;  4X9C A;  1KQS S;  2CH4 A;  4J83 A;  1WHL A;  1W2B S;  1WQW A;  2KRN A;  3CPW P;  4ZGD B;  1NLO C;  3OMC A;  1E7O A;  4XTU A;  1MHN A;  3FLG A;  2ZPH B;  4FM4 B;  4RG8 A;  5HK0 A;  2IPO B;  1BI3 A;  2QEX T;  3QYG B;  2X4J A;  2M0O A;  1G3W A;  2EFI A;  1U1T A;  4PK4 A;  3OB9 A;  4PJO B;  1WFW A;  2E70 A;  2KK4 A;  1WHM A;  3SWN B;  1M1K U;  3OYG A;  5GMK h;  3A8O B;  3HPW A;  4C0D C;  4XQ3 A;  1LOJ A;  2L3P A; 
#chains in the Genus database with same CATH homology
 2RH2 A;  5GAN 4;  4J8O A;  2H3J A;  4HKE A;  3MHX A;  4ZTF A;  3LGF A;  3SD4 A;  4M7D E;  1M90 C;  3VYH B;  3MCA B;  3HRT A;  4M77 C;  1Q82 U;  4PLI A;  5C0M A;  2Y4Y A;  3DB4 A;  3H8Z A;  4F7U F;  3JCM f;  1I5L A;  3JCM X;  3LW5 E;  3CCL A;  4MDX A;  1VUB A;  1DJ7 B;  1LJO A;  3G71 T;  2NLU A;  3HKS A;  4N0A A;  2EJF A;  4FSX A;  1JRI A;  2D9T A;  5J3B A;  5GAN 8;  1YJN A;  4A4K A;  3QZ5 B;  3M56 A;  4QQD A;  3QUI A;  4EDU A;  4OP0 A;  4HT9 A;  4HCZ A;  3LYI A;  2QA4 T;  2CYZ B;  2FHD A;  1G3Y A;  3DB3 A;  4L6V 5;  5DLO A;  2EIF A;  4PLL A;  4M7D F;  4XTW A;  4BAC A;  4QVZ A;  2EWN A;  2LT1 A;  2QI2 A;  4ELZ C;  3V7C A;  2VYT A;  1I4K 1;  3GF5 A;  4JJN K;  3OYD A;  1BIA A;  2OTL A;  1KHI A;  3QJ6 A;  1UGS B;  4JUV A;  3RMS A;  1VQ6 A;  4ZGJ B;  4F7U B;  4RKU E;  3LWI A;  3MET A;  4BY6 C;  1QVG A;  4M78 A;  2E1H A;  5HKC A;  1Y7X A;  1BI1 A;  5GAN h;  1N27 A;  4IKF A;  2E12 A;  3E19 A;  4LDY A;  2JN0 A;  2EQM A;  2V8K A;  3P8B B;  3HFO A;  2R58 A;  3PTA A;  2HAX A;  4M7A A;  1VQM A;  1W4S A;  2ZPG B;  5CK9 A;  4M7D B;  2HNI A;  3OYL A;  1N8R U;  3GPL A;  2L3R A;  4C92 D;  3FEO A;  1K8A C;  2P0K A;  4ZGE B;  1X75 C;  2K5F A;  3CCM A;  3GLX A;  2BUD A;  5DY9 A;  4DQ2 A;  2HQX A;  2RK2 A;  3G4S A;  2F5T X;  3UDC A;  1UEB A;  4QW2 A;  3G7Z A;  4N0A C;  3VUB A;  3OBW A;  4A4H A;  3CXC S;  2P0Q A;  4OVA A;  1K9M U;  5LL6 S;  3A8G B;  4FL6 A;  4C5E A;  1RI0 A;  1YHQ A;  3JB9 G;  2CS7 A;  1JJ2 A;  1Q86 U;  1ZQ1 A;  1VQ9 A;  4IUP A;  2DIG A;  3G6E T;  4M75 E;  1VQ8 T;  1QP3 A;  2D0Q B;  2DXU A;  2KQW A;  1BI0 A;  4YTL A;  3WXM B;  5M9O A;  3QBY A;  1V29 B;  4D6W A;  3A8L B;  2K2V A;  2VC8 A;  4OB1 B;  1FXX A;  2DAQ A;  2X4W A;  4X9D A;  2OTJ T;  3OBY A;  4ZN3 A;  3CPW A;  4MZP A;  4J6X A;  1N9R A;  2VGM A;  1Y07 A;  1ZHI A;  2YLC A;  3MP6 A;  2JZ2 A;  3EFR A;  2PUK B;  2XD0 A;  5LJ5 f;  4M78 D;  2VXF A;  1X6O A;  3BDU A;  4E47 A;  2DJZ A;  2LC4 A;  3P8H A;  2EQK A;  3CCU T;  1O9S A;  3CCR T;  1FX7 A;  3V8J A;  1JBM A;  1VQ4 T;  1VQN T;  1S72 T;  1PSE A;  1Y71 A;  3CD6 T;  4M7A D;  5FU7 C;  3OA6 A;  3JB9 I;  1KHC A;  2QTX A;  5LJ3 e;  3OYE A;  3JB9 J;  1U8R A;  1Q7Y U;  4C8Q A;  4EMK B;  4KBM B;  4KUD K;  3DLL A;  3JCM d;  4PJO G;  3CCQ A;  5KE2 A;  4XTY A;  5GAM e;  4BI8 B;  4E7I A;  2GQV A;  3FDR A;  2LDM A;  1I81 A;  4A53 A;  2Y4X A;  4EPC A;  4IUT A;  1FWZ A;  1K73 C;  4IUV A;  4JS4 A;  2DD5 A;  4P5N A;  3URG A;  4PJO A;  5LJ5 j;  3M4G A;  1KD1 U;  3OW2 A;  2QDY B;  3V8K A;  4LDW A;  4M75 B;  1NPP A;  5HY6 A;  1YIJ A;  4ZN1 A;  2XDP A;  4N4G A;  4E7K A;  5DLQ E;  4XAX B;  5LJ3 h;  3KBG A;  2FB7 A;  4O5V A;  1M1F A;  4OMF B;  2ZPF B;  4GLK A;  5IN1 A;  3TCJ A;  4BDZ A;  4NS5 A;  3M53 A;  1WQ7 A;  5GAM h;  1OYX A;  2WSE E;  1Y96 B;  4OB3 B;  3HSB A;  1VIF A;  5KE3 A;  3L2U A;  2DKG A;  1M90 U;  3E9G A;  1QVF A;  5GAO r;  3OY9 A;  5CKH A;  2RHX A;  5A2Q E;  3QZ9 B;  2RB6 A;  5A0D A;  2PVO B;  2RHZ A;  3V7S A;  5FU6 C;  2XID A;  5GAN 2;  2X4Y A;  2QQA A;  1M4Z A;  2KAF A;  2QEX A;  1O75 A;  3CC4 A;  4C92 E;  3I55 A;  2F69 A;  1M8V A;  2EJG A;  3L2V A;  3CBM A;  4C5I A;  4N4I A;  2AHJ B;  3P8D A;  3ZEH A;  5KCH A;  4O6J A;  3S3N A;  4F7U G;  4XK8 E;  3ER0 A;  2DTI A;  3TRE A;  4C8Q D;  3LWH A;  2EJ9 A;  3C4S A;  2JTF A;  1QVG S;  5KH6 A;  1QVP A;  4IUQ A;  5CIU A;  3VUZ A;  2F5K A;  3VV0 A;  3PIO A;  2XDB A;  5HK3 A;  4PJO C;  2WSC E;  2XK0 A;  1VQ5 T;  4FIB A;  2A3L A;  5CKE A;  4M77 D;  4F7U A;  2DEQ A;  2R5A A;  5CKF A;  4LDX A;  1IZ6 A;  4JDS A;  3JCM g;  2MWO A;  3SWN C;  1VQ7 A;  3VYG A;  3PT9 A;  2DIQ A;  4C0F A;  3CD6 A;  5GMK j;  2RJF A;  5GAN f;  4M7D G;  4FT4 A;  3ME9 A;  3CCV A;  1QVF S;  3GIB A;  1NPR A;  3LLR A;  3OYA A;  4LD6 A;  5CAI A;  1IRE B;  5I21 A;  4M7D A;  5GAO l;  2CZ7 B;  2MAM A;  4M78 E;  3JCM e;  2VV5 A;  4C5G A;  3OS5 A;  1YJ9 T;  1K8A U;  2E6Z A;  2RHI A;  4Z02 A;  3OYM A;  2E41 A;  3S3O A;  2OTL T;  5AYF A;  2XI9 A;  1JJ2 S;  3DLM A;  2PUO B;  3X28 B;  4HT8 A;  2QA4 A;  1M1G A;  4JS5 A;  2EQJ A;  3CC2 T;  4M7A E;  1H64 1;  1HK9 A;  4C92 B;  3OYY A;  3CCS A;  1WJR A;  1VIE A;  2DO3 A;  4BUG A;  4KT0 E;  3S3M A;  4BI3 A;  4JRI A;  4QVC A;  3PGG A;  3CPW S;  2MF2 A;  4BDY A;  3OQ5 A;  3A8H B;  1D3B B;  1KG1 A;  4RCB A;  5FRM A;  3H6Z A;  2DXC A;  3CCE A;  3UPU A;  3FJP A;  2ZPE B;  1Q81 C;  3CME A;  2CZ6 B;  2QQR A;  4QQG A;  5GAN j;  3VU3 C;  2V8J A;  3QG1 A;  3NFC A;  2ZPI B;  3FB9 A;  4C0G A;  2XHC A;  3OYN A;  3CCJ A;  3A5Z B;  4J7I A;  3EAE A;  4B9W A;  3L2Q A;  3FC3 A;  4LD9 K;  3C95 A;  1VQK A;  2FYK A;  3HHT B;  5CQY A;  4L59 A;  1YHQ T;  5FRO A;  1KQ1 A;  3RES A;  3PFS A;  2DK3 A;  3X20 B;  2QQB A;  1VQ9 T;  4M7D C;  4CI0 C;  5D6W A;  1X01 A;  2B8A A;  1YBY A;  2JTM A;  2QQ9 A;  4M78 B;  4BB7 A;  1R8O B;  3OYB A;  2DXB A;  4M7D D;  4QQ6 A;  2KY9 A;  5LJ5 g;  1QW1 A;  3LGL A;  4EMK A;  1VQL T;  3TEE A;  2HBP A;  2L8D A;  4E7H A;  1VQP T;  3MEV A;  5DM7 R;  1I8F A;  3N5B B;  4BE2 A;  4M7A B;  3OW2 S;  1VQO A;  1BKB A;  3G6E A;  1XQH A;  4M75 G;  4ATO A;  1UGP B;  2QQS A;  1YIT T;  1K73 U;  1M9S A;  2RM4 A;  4M75 F;  1OZ2 A;  3OYI A;  4FT2 A;  3L2R A;  3CC7 A;  2OTJ A;  2RHU A;  1B34 B;  4C8Q E;  3LH0 A;  5CKB A;  1NJI C;  1WGS A;  2DTO A;  3INZ A;  1N9S A;  4BI4 A;  3A8M B;  4J5Y A;  3E9F A;  3M58 A;  2CKK A;  5LJ3 f;  2C06 A;  4XTX A;  4HCC A;  4M77 E;  4ELY C;  3JCM J;  3RKX A;  2Y90 A;  5GAM f;  3SFM A;  3EFS A;  3CCQ T;  3JCM P;  3CCU A;  3Q1J A;  3CCR A;  2QXF A;  3HRS A;  1MGQ A;  2LRQ A;  4GY5 A;  1N6A A;  5GAO q;  3CEY A;  2K5L A;  5L8R E;  5GAN d;  1S72 A;  2PVG B;  4R55 A;  3SWN A;  2E65 A;  2YLB A;  2JVV A;  2LTO A;  3MP8 A;  3OYJ A;  4MZT A;  4XU0 A;  5CQX A;  4J6Y A;  2I2L A;  4RG2 A;  5J39 A;  2GF7 A;  3JB9 D;  2WAC A;  3WVE B;  3QHS A;  4EMK C;  2RI3 A;  4M77 F;  3M4Y A;  3QXE B;  3SDZ A;  5GAN 6;  1KC8 U;  1ZBX A;  4XU1 A;  1XNI A;  2RK1 A;  3RKY A;  5GAN 7;  2RD1 A;  5GAO m;  4NL2 A;  2MWP A;  4HA8 A;  2KDS A;  3O8V A;  1YI2 T;  5CVI A;  1XOV A;  3I56 A;  4R56 A;  2CGH A;  5FRN A;  5J26 A;  1GXI E;  1YJW T;  3JCM Q;  2DZ9 A;  5LJ3 j;  2LNV A;  3PNW C;  2KMT A;  4M75 C;  4CRI A;  2R57 A;  3S6W A;  3E1S A;  4C0D B;  4C8Q B;  1YCY A;  2WSF E;  2YRV A;  5GAN 5;  1TH7 A;  2O4X B;  4ME7 A;  5GAM j;  1WJS A;  3JCM b;  2ZZD A;  1KC8 C;  2XU8 A;  3CMA T;  3V8L A;  4M77 B;  2DTH A;  4WF2 A;  2MMP A;  2V8I A;  2HD0 A;  1KQS A;  5FLX E;  2BKD N;  2ZPB B;  4B9X A;  4NL3 A;  3VJP A;  1M5Q 1;  3M9Q A;  5I2M A;  2LCC A;  2JOY A;  3QKJ A;  1W2B A;  4Y28 E;  3CCL T;  4C92 G;  2D6F A;  3BFM A;  4RCC A;  4PJO D;  3WVD B;  4C92 F;  4DOV A;  1YJN T;  1XTD A;  2O01 E;  5IT9 E;  3PIP A;  1HXD A;  1BI2 A;  1G3T A;  1QP2 A;  5LJ5 d;  4C92 A;  3QSU A;  5GAN g;  2VUB A;  3QPH A;  5GMK i;  4KUL A;  3CCV T;  3GP8 A;  1WNL A;  3QII A;  1VQ5 A;  2K3Y A;  4V2S A;  2CZ0 B;  2RJE A;  3G71 A;  4BY6 B;  1D3B A;  3SB2 A;  3JCM V;  1VQ6 T;  3MEU A;  4OGC A;  3OYK A;  3C12 A;  3CBP A;  1M1K C;  1Q81 U;  2EYQ A;  2DPP B;  2M1H A;  3BDL A;  3JRZ A;  5D6Y A;  4A4E A;  5CKD A;  5GAN e;  1UGQ B;  3M54 A;  3OYH A;  3QJY A;  4J7F A;  3OMG A;  1OZ3 A;  2ZGW A;  2LQK A;  2XKO C;  3GNG A;  1RL2 A;  3QYH B;  4JLI A;  4MZM A;  4XTZ A;  5CR2 A;  2E5Q A;  1KQ2 A;  3C94 A;  1Q82 C;  3L1A A;  3AHU A;  1NE8 A;  4N4H A;  4UC4 A;  1H3Z A;  3CCS T;  4M78 G;  3JCM h;  1VQM T;  3J81 E;  5LJ3 d;  1YJ9 A;  4OGE A;  3M55 A;  4J6W A;  4M78 F;  2GFU A;  2R5M A;  3NTI A;  1JB0 E;  4IUU A;  1AHJ B;  4C0Z A;  5GAM d;  3FRN A;  3PMI A;  3CCM T;  3G4S T;  4Y91 A;  3MO8 A;  3OS2 A;  3M57 A;  3V7R A;  3OSV A;  3UT1 A;  3CC2 A;  3CCE T;  4M7A G;  2EQU A;  3RER A;  2OAU A;  3CME T;  4JRQ A;  4M7A F;  3DKM A;  3M5A A;  4XU3 A;  3NTH A;  3OS0 A;  2P4T A;  1LNX A;  4C92 C;  1SSF A;  3CCJ T;  4FU6 A;  3X25 B;  1VQN A;  1VQK T;  5A0L A;  2X35 A;  4RMO A;  2A7Y A;  3CPF A;  1G3S A;  2E6N A;  4DOW A;  5CCA A;  4MMK A;  2P0P A;  4OB2 B;  4EMG A;  1B34 A;  4QVD A;  4NOY A;  3L2W A;  1NJI U;  3HL8 A;  5GAN 3;  4PL6 A;  4OF1 A;  4ZTJ A;  5IAY A;  2DVE A;  2BIV A;  5I2S A;  3RUX A;  3X24 B;  3JB9 H;  1BIB A;  2E10 A;  5GMK m;  3BW1 A;  2GFA A;  3MEW A;  5A0G A;  2LCL A;  3L42 A;  2VGN A;  1VQ8 A;  1NZ9 A;  3OYF A;  4LDV A;  3LX7 A;  5CO7 A;  3OYC A;  1N8R C;  2L89 A;  3JB9 F;  3KUF A;  5D6X A;  2RI5 A;  1VQO T;  1WPY A;  2XDD A;  4E7L A;  4LDU A;  4BE1 A;  3FIF A;  5FU7 B;  5LJ5 e;  3TU4 K;  2K57 A;  4M75 A;  2LQ8 A;  4OB0 B;  1G5V A;  5GAO p;  4DA4 A;  3CC7 T;  3JCM W;  1OI1 A;  4M78 C;  1VQL A;  1K9M C;  3J7A F;  1VQP A;  4HCB A;  3GNF B;  2PQW A;  4IUR A;  4C5H A;  2DXT A;  1Q86 C;  1WJQ A;  1Y96 A;  3QDR B;  4XU2 A;  3T9N A;  3X26 B;  5LJ3 g;  4PJO E;  3PMT A;  3OS1 A;  4JRP A;  2VXE A;  3CXC A;  1YIT A;  4VUB A;  3MEA A;  3ZBD A;  2FL7 A;  2KSS A;  4M7A C;  2RA2 A;  1VQ4 A;  2E64 A;  4L5G A;  5EG2 A;  3ZFJ A;  5GAM g;  2EAY A;  2HQE A;  4EMH A;  3JAM E;  5LJ5 h;  2FVU A;  2LVM A;  4PKC C;  4C8Q G;  2CZ1 B;  2LX9 A;  2RO0 A;  2M9U A;  3J80 E;  2PU9 B;  4Q5W A;  4C8Q F;  3RKW A;  4KUI A;  2RHY A;  1YIJ T;  2RJD A;  3UWN A;  4M77 G;  2L5Q A;  3RMQ A;  5GAO n;  3JSC A;  5KCO A;  3KXT A;  4A4F A;  4X9C A;  1KQS S;  1UB4 A;  4JLG A;  2O4X A;  4II1 A;  1U1S A;  4J83 A;  4PNO A;  4BD3 A;  5C6S A;  2KVQ G;  2DZC A;  2ZCF B;  2LT4 A;  2IG0 A;  3R6O A;  5GMK l;  4PJO F;  3NTK A;  4M77 A;  4A54 A;  1W2B S;  4TVR A;  2PVD B;  2YHT A;  1WQW A;  2XIC A;  3HP9 A;  2K5I A;  3OSS C;  3ASK A;  2RI2 A;  4XTV A;  5FU6 B;  4ZGD B;  1PSF A;  1BYM A;  2M16 A;  2XG8 D;  3M59 A;  3CBO A;  3OMC A;  1UGR B;  4XTU A;  4BE0 A;  1MHN A;  2MI6 A;  3BY7 A;  2IVW A;  3FLG A;  2ZPH B;  4FM4 B;  4RG8 A;  5HK0 A;  3I56 T;  2EKO A;  1BI3 A;  2QEX T;  1Q7Y C;  3QYG B;  3CC4 T;  2DD4 A;  2JNG A;  3L2Z A;  2X4J A;  5GMK e;  3F70 A;  3I55 T;  3HRU A;  2M0O A;  3QO3 A;  2X4X A;  4M75 D;  2GCX A;  3RIR A;  1G3W A;  2EFI A;  2K4Y A;  2JUF A;  4JRK A;  1U1T A;  1YI2 A;  4F7U E;  4PJO B;  3OB9 A;  3GOX A;  1P92 A;  1KD1 C;  3MP1 A;  1YJW A;  2E70 A;  4E7J A;  2KK4 A;  3SWN B;  4A4G A;  1EIF A;  3VKI A;  2RJC A;  3HFN A;  3JCM c;  2K3X A;  1M1K U;  3OYG A;  4MML A;  1VQ7 T;  2G3R A;  4X34 A;  3A8O B;  3HPW A;  4MDW A;  5GMK h;  4C0D C;  4C8Q C;  3CMA A;  4XQ3 A;  1LOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...