1PSEA

The three-dimensional solution structure of psae from the cyanobacterium synechococcus sp. strain pcc 7002: a photosystem i protein that shows structural homology with sh3 domains
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
AIERGSKVKILRKESYWYGDVGTVASIDKSGIIYPVIVRFNKVNYNGFSGSAGGLNTNNFAEHELEVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional solution structure of PsaE from the cyanobacterium Synechococcus sp. strain PCC 7002, a photosystem I protein that shows structural homology with SH3 domains.
pubmed doi rcsb
molecule keywords PHOTOSYSTEM I ACCESSORY PROTEIN E
source organism Synechococcus sp.
molecule tags Photosystem i
total genus 7
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1994-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1pseA00
2CYZB 4OB0B 3A8LB 3X20B 1UGPB 2DXCA 2WSFE 2ZPEB 2ZCFB 4RKUE 2PUOB 1QP2A 1IREB 2CZ1B 3WVDB 1V29B 4Y28E 2QDYB 1GXIE 2ZPBB 2CZ6B 4OB3B 2ZPFB 3WVEB 3QZ9B 2DXBA 4FM4B 4OB2B 3QYHB 3X24B 1JB0E 3X28B 3X25B 2AHJB 3A8GB 1UGQB 4XK8E 3LW5E 3VYGA 2PVDB 4KT0E 3QXEB 4OB1B 4ZGJB 2CZ7B 2DD4A 1UGSB 2CZ0B 2PU9B 3A8MB 3A8OB 3QZ5B 2ZZDA 3QYGB 4L6V5 1AHJB 2PVOB 2O01E 2PUKB 1DJ7B 1PSFA 2DPPB 4ZGEB 2DD5A 1UGRB 4ZGDB 3HHTB 5L8RE 2ZPGB 2ZPIB 3VYHB 2WSEE 2D0QB 1PSEA 2ZPHB 2PVGB 3X26B 1QP3A 3A8HB 2WSCE
chains in the Genus database with same CATH superfamily
5GAN2 1X6OA 3OS1A 5FWCA 2CYZB 1KIKA 4II1A 3AHUA 3WXMB 3EGXB 3A8LB 2X4WA 2RHXA 2DRKA 1VQLT 1PD0A 1VQ7T 2B86A 5HK3A 1WHLA 2K5LA 1YN8A 1ZA2B 3ZFJA 4LD9K 1PWTA 3CCET 2I0NA 4MDWA 4GLKA 1RAEB 3OW2A 1IO6A 3OBYA 4DOWA 3OS0A 1UEBA 1VQ6A 1B07A 1S72T 4C92A 3OMCA 4IUVA 4QKUA 5GMKe 2VC8A 4E7KA 2J7IA 3CCVT 2LCLA 5FU7B 1KSWA 4JLGA 5LJ3f 4KT0E 2VWFA 7AT1B 2EBPA 4HA8A 4C92C 2PNIA 3G6EA 5AT1B 2DTIA 1AD5A 1QCOA 4X9DA 2LJ3A 1SSHA 1YITT 4IIMA 1FXXA 2PU9B 3OYBA 2LQ8A 4CC2A 4F04B 2CP6A 3CCUQ 3NHNA 3GBQA 5EC7A 1V1CA 4XQ3A 3TQ7P 1YJ9Q 1M9SA 4M77F 3NMZC 4M75E 2HL5C 4RTZA 4Z02A 2ENMA 3HRTA 3JCMh 2EYZA 1R8OB 3CXCS 3CCMT 3EHQA 3NFCA 4AFSC 1BYMA 4B9XA 3DB3A 2CT4A 5GAMe 1M90C 3M4GA 3H0FA 3EGDB 1IRXA 3OYNA 2A36A 3H6ZA 2JN0A 4C0DC 5IHKA 2M16A 4BE1A 1KD1U 2EQMA 4PJOA 1B3QA 3RKWA 5CO7A 2E3HA 2RM4A 3I56Q 1H8KA 4JUVA 2FG0A 1Q82C 4DOVA 1TOVA 1TSFA 3E1SA 4OMFB 4PJOC 4J9DA 4J9CA 4RKUE 1IREB 1Z9ZA 2FB7A 1MHNA 3OW2S 1JBMA 1X69A 2VGNA 3SWNC 5KYXA 2HZYA 2FHDA 1YFNA 1Y7XA 1K9MC 3FJPA 4QVDA 4AMCA 3CBMA 1X6GA 4C5IA 3CXCP 4AG2C 2IIMA 4J83A 1UGQB 1U5SA 2K5IA 3KXTA 1TWBA 4RTTA 4HCKA 4CC7A 2RQTA 1K76A 1WXUA 4OGCA 1R77A 5GAOr 2V8JA 1AWXA 4M75F 1YIJA 2KE9A 2CZ7B 3LH5A 2DM1A 2V8IA 5J3BA 3REBB 1UGSB 3I55A 2RF0A 3MJXA 1AVZC 2YUNA 1U1TA 2EYWA 4OMMA 2W10A 2XKOC 3EFSA 3QUIA 2NLUA 2VXEA 4ME7A 3S3OA 1X01A 1W1FA 2KXCA 1O75A 1M90U 3EGXA 4X1VA 3GNGA 1X75C 4JJCA 1WA7A 1ZBJA 2XI9A 2F2WA 3EG1A 2A08A 2R57A 1V76A 5FU6B 3OW2P 4F7UE 2XIDA 1SPKA 2OX7A 4JJDA 3VS1A 2DIGA 4B6MA 3H41A 3RBBB 1Q82U 3UWNA 4DEYA 1Y96B 2ZAEA 3QWXX 2E6ZA 1MNEA 1W6XA 4DEXA 4OB0B 3CMAT 1UJYA 2QQAA 4JJBA 2EQJA 2A7YA 1YJ9T 5LJ5j 2HQEA 2AZVA 2EIFA 3TSZA 1YHQA 4HXJA 4QQGA 1UUEA 1K9MU 3JCMW 3G4ST 3EG3A 4FCYA 4OB3B 1VQ4A 2CSQA 1XOVA 5GAOp 2RO0A 2LNHB 2X4XA 3M57A 5FU7C 2EW3A 4LDXA 4JPBW 4OMPA 5LJ5h 1RAFB 2L8DA 2AHJB 4J9HA 5CR2A 1QVGA 4R55A 3OYAA 1QVPA 3OB9A 1QWEA 3I5SA 2QQBA 3VJPA 2VXFA 3QXEB 3VS3A 1HJDA 5A2QE 1R0CB 3EGDA 3NPFA 1M1GA 1I8FA 2B8AA 2CP3A 4JS4A 3UT1A 1KQSA 3EFRA 4BI4A 4F7UF 1PRLC 2ZZDA 2AK5A 2KR3A 3CC2Q 1ZUYA 3QJ6A 2KT8A 2EJFA 5IXBA 2EKOA 1YJNA 3PTAA 2DPPB 5GANj 1BI3A 2E3IA 4RUGA 3PVQA 5GMKi 1KK7A 2RA2A 3H8ZA 2KQWA 4QW2A 3RESA 1VQ9T 5GAN5 1QCFA 1D09B 2OTLQ 1QP3A 2NWMA 1PCXA 4M7DE 2XK0A 3CC7Q 2V1RA 2NUZA 4FT2A 1QMCA 5LJ5g 3L2WA 3CCST 2PZ1A 2BKDN 2Y90A 1WJRA 1UDLA 4BACA 1OYXA 2DZCA 3M59A 3SEMA 4QVZA 1ZA1B 1Q95G 2KMTA 2D9TA 5FLXE 1YBYA 4JRPA 1SHGA 1NJIC 2KK4A 5FROA 5GMKj 1FX7A 1MNDA 4FL6A 1D0YA 1RLQC 2CGHA 2DXUA 2YT6A 2RHYA 4HVUA 2RI3A 2RB6A 3TSWA 1QVGS 3FLGA 2EGCA 4AFQC 1T0JA 3IQLA 4DA4A 3PMIA 2YLCA 1AEYA 1QKXA 2QA4Q 4XAXB 4QT7A 1G3YA 1ARKA 3REAB 1WIEA 1G5VA 2HSPA 2YHTA 5GMKh 4FIBA 2EAYA 2DTHA 1QWFA 5KYWB 1PNJA 2SEMA 2V1QA 3RKXA 1VQ6T 1Y96A 2JW4A 3PT9A 3M0UA 5GMKl 3QZ5B 1WHHA 5GANg 5CKEA 1AHJB 2PVOB 2XICA 4A4EA 4C8QE 2R58A 3OS2A 1OULA 4JRIA 1PM3A 4N4HA 1N27A 3KUFA 2J6OA 2X51A 2EYQA 2ZGWA 5GAMj 2DRMA 4ZGEB 2LMJA 4EDUA 2XDPA 2Y4YA 5D6XA 3BDLA 2AIRB 3OBWA 4JZ4A 2XG8D 3G6ET 1XQHA 1IZ6A 4IUTA 2WSEE 2O9SA 3TEEA 3OYMA 1IGQA 1U1SA 5LJ5f 4J6XA 2VASA 1BBZA 2YXYA 4RMOA 1QVGP 2JVVA 2QTXA 2JOYA 4RCBA 1RAGB 1VQLQ 1VQ7Q 5GAMh 2HKQB 4QQ6A 4AT1B 5D7UA 3OYHA 1NJIU 2QK0A 4N0AA 3NTKA 3V8KA 3M0RA 3CCEQ 3L2UA 2DF6A 1V29B 4O6JA 1KQSP 1GXIE 5D6YA 1TUDA 3V7SA 3EHRA 3J81E 1M1KR 4N0AC 2LDMA 4DBFA 5A0DA 1VQNT 1HXDA 3EAEA 3CCVQ 1IGUA 4OMOA 4MDXA 3CC7T 2MOXA 2COWA 4ESRA 3G71A 2KXDA 3OYDA 2GCXA 4M77G 2KNBB 3CC4Q 4E7HA 2YRDA 1NLOC 3A98A 3SB2A 4XK8E 3JCMd 2DL3A 4EMGA 5J26A 3RNJA 2YUOA 2DA9A 3QDFA 1Q82R 2EKHA 1WJQA 2YLBA 4C8QF 1YITQ 2DJZA 2MCNA 4ANJA 1WPYA 1EZZB 3D7SB 5GANf 4LDWA 2K9GA 2JM8A 2RQWA 1RAAB 1Y07A 5GAMg 3BE3A 1WHJA 1K9MR 2L89A 3JRZA 2I2LA 2GQVA 2FL7A 2CP0A 3PE0A 3CCMQ 3CCQT 3UPUA 1YJWQ 2LQKA 4ORZA 4FW1A 1Q86C 4A4GA 4LDUA 4M7AE 3OSSC 1Y71A 1ZSZB 2P0QA 2BZXA 1YIJT 2VUBA 4PJLA 3JCMP 1VQ5T 2Z0WA 4K11A 3ME9A 1OZ3A 4M7DD 2EYXA 1G3WA 4XTVA 1U3OA 3GPLA 1H641 1G83A 2QGFB 3FDRA 1X2KA 1EIFA 2K2VA 4XTWA 4M78C 3Q1JA 1T3SA 4XTXA 4BDZA 2LX7A 4R0KA 3EG9B 3VS0A 4JRQA 3C94A 4IIOA 1UGPB 2MI6A 3M0PA 3HPWA 3MEVA 2OAUA 2ZPEB 3OYCA 4FYVB 4RTXA 1I5OB 2LZ6B 3WVDB 4GLMA 4M75G 3L2QA 3VV0A 2FPFA 5KYWA 4X9CA 3CBOA 2IG0A 4M78E 5KH6A 4JZ3A 2CSIA 2P0KA 1PKTA 2GNCA 1YHQT 3GOXA 2DMOA 2PVDB 3EH2A 2R5MA 1HK9A 1W4SA 4M7AF 1VQPA 2K3XA 2J6KA 5GAMf 1Q86U 3JB9J 3CQTA 4UC4A 2DL5A 3DLLA 2YRCA 2H3JA 4CI0C 1KJWA 2E5QA 4EIKA 3OYEA 4C8QD 2E64A 1WYXA 5CIUA 2XDBA 1LJOA 3CC4T 4ZTFA 1NEBA 5IHIA 2FZKB 1G3TA 2MMPA 4HKEA 1WGSA 5I11A 4A54A 1H3ZA 2P4RA 3CCJA 5GAN6 4ZNXA 4AFUC 5GJWB 3VS7A 2SRCA 3CMAQ 2DEQA 1JO8A 1GCPA 5IT9E 2E6NA 1KC8R 5CK9A 3FJ5A 2OAWA 1PRMC 1ZHIA 4C92E 3M0QA 5L23A 3MEUA 1YJWT 4M78F 5GAOq 5CKDA 3G4SQ 1YI2A 2DXCA 2PQWA 5C6SA 2QQRA 2DE0X 1M1KC 1OX8A 1BI2A 4X34A 4CC3A 2X3WD 1LVKA 2EQKA 4LNPA 3CD6T 1Q7YC 3CC2A 2QEXQ 2MPXC 3CCRQ 3VRYA 1WHGA 1X43A 3NTIA 3X24B 3TU4K 1VOMA 3TVTA 2M51A 2QASA 1HYOA 2BZYA 2OTLA 1Y0MA 2X9HA 3PVLA 1ZSZA 2KRMA 1E6HA 3ER0A 2EGAA 4MZMA 3NTHA 4PLLA 4KH0B 1ZX6A 4RCCA 2C0TA 1LPLA 3KFVA 1WQ7A 1W70A 4ELYC 3S6WA 2GTOA 1NJIR 2D6FA 1S1NA 1D1BA 2RJEA 2RK1A 1ZSZC 3DB4A 4PJOE 1M1FA 4FSXA 4F14A 1JEGA 1NEGA 4OMNA 4PK4A 4OMLA 3EG9A 1PSFA 1VQ9Q 5GJVB 3JB9F 1T3LA 2F2VA 5KCOA 2P84A 2GFUA 4C92F 3M53A 3JCMX 5J39A 3S3NA 3CCSQ 1Q81R 2JTEA 2PVGB 3X26B 1VQOQ 1YWOA 1ZUUA 1VQKA 2OTJA 2K2MA 1PKSA 2AZSA 2K4YA 2WSCE 5CAIA 2FEIA 5I22A 2GF7A 5HK0A 1M1KU 4BDYA 4OMQA 2O4XB 1VQMA 3UDCA 3P8BB 2RNAA 2X35A 1LNXA 1YCYA 1TUGB 1ZUKA 3GNFB 3OYYA 1Q7YU 3H0HA 2M9UA 1I5LA 2JMAA 2WSFE 4M77D 1GFDA 2XHCA 3M0TA 2DK3A 5KE2A 1KFZA 1GFCA 3QYHB 1IB8A 4BI3A 3HTRA 3X28B 2KRSA 3E2UA 4M7DG 3VU3C 2RH2A 5IH2A 2L5QA 2FZCB 3N5BB 4C5EA 4PJOF 2DBKA 3EG0A 3V8LA 4BY6B 1B34B 3MKDA 2X3XD 4EMKA 1VQ6Q 2K3YA 1VQLA 1VQ7A 1WNLA 2DKGA 3SDZA 2LC4A 2CZ0B 3A8MB 2QEXT 3QHSA 3QKJA 2G3RA 4J5YA 2C0IA 3CCRT 1K9AA 2KDSA 1N5ZA 1OU9A 2LVMA 1S72A 1VIFA 3G6EQ 2JM9A 1GCQA 1M2OA 3E9GA 4N4IA 2H8HA 2GFAA 1TU0B 3CCVA 3M56A 4WCIA 3RIRA 4A4HA 4WF2A 5LJ3d 2ZPIB 1ACMB 4FU6A 2RD1A 1KC8C 1BK2A 4CC4B 4M75D 3AT1B 3CMEA 1YITA 4FYXB 4QQDA 4PFZA 3MP1A 2RI2A 2DYBA 2EVRA 4XU3A 3X20B 2EGEA 1Q86R 1ABQA 3LGLA 3L1AA 4KH1B 4C8QG 3OY9A 1VQNQ 5IXFA 4F17A 5GMKm 3FEOA 2K3BA 2ZPBB 1VQ8T 1JJ2A 1K0SA 1OZ2A 3MO8A 1OQKA 3OYJA 4V2SA 1VQOT 1BCOA 1RLPC 1SF9A 4RTYA 4DBRA 1VUBA 2HEQA 1AZEA 3JCMe 5GANh 1D1AA 2E5KA 2MF2A 5GAOm 1VYTA 4KGXB 1IHVA 1NYFA 1FYNA 4HCBA 1K0XA 1WDXA 2JS2A 4N4GA 4M77B 1MMAA 3JB9H 1FWZA 2JTMA 1SG5A 2BZ8A 5GAN4 3CCLA 3JCMJ 3CCQQ 2D8HA 2COYA 3CEYA 2FRWA 3MP6A 2HAXA 3O8VA 1RAIB 4PJOD 2KGTA 4J6YA 5IAYA 2O4XA 4NS5A 2KEAA 2F1LA 1KC8U 3TCJA 5DM7R 1YIJQ 3OMGA 3L42A 1B7TA 4E2FB 1VQ5Q 1EX4A 1JXMA 1Q81C 3LH0A 5KYYB 1AT1B 3I55Q 1C0MA 2J06A 3HHTB 1YNZA 1QW1A 1RI9A 2EJGA 2DL8A 1VQPT 1KQSS 2DETA 5CCAA 3RMQA 1PD1A 2ZPHB 1G2BA 1MMNA 2EQUA 1CSKA 2P4TA 5FWBA 4GY5A 5KCHA 4LE9A 4KUIA 4FYWB 1JRIA 1K73C 1TS9A 5FU6C 2YUQA 2RHUA 1SHFA 3QG1A 4O5VA 1JU5C 4L5GA 3JB9I 2M0OA 1RI0A 1KQ2A 5GAOl 1WXTA 2CP5A 2J05A 4MMKA 2DVJA 1SRLA 3RUXA 4BE0A 2LQWA 3LGFA 1T0HA 1ZSGA 2XMFA 2HQXA 5HCKA 4F16A 2A0FB 2BE9B 1B34A 2K7AA 2MIOA 2KBTA 4M7AG 2JNGA 2CP2A 1PC0A 3WVEB 3GIBA 2JT4A 1N6AA 1MV3A 4HCZA 2FVUA 4M75B 1YHQQ 3C95A 4JS5A 2AKLA 2D0NA 5CQXA 4PJMA 3CCUA 2DL7A 1GBQA 4E7JA 4A53A 1JQQA 2RK2A 4NOYA 2E10A 1YJ9A 4LD6A 2EPDA 1D3BB 4ZGJB 1WI7A 5FW9A 4IUPA 5HKCA 4RTUA 1Q7YR 3G4SA 1Q81U 4FT4A 2OI3A 2KYBA 3QO3A 2LT4A 3META 4NL3A 2EQIA 2F69A 3QSUA 4D8KA 2QXFA 4M78G 2BIVA 2CREA 4C0DB 3JSCA 2CUBA 3EG2A 1K73U 3I56A 2E1HA 1M2VB 3MPUB 3RR6A 3M4YA 2RQVA 2L3RA 3V7RA 2J6FA 1BB9A 4Q5WA 2D0QB 3URGA 1Y57A 1UFFA 2L2PA 4LDVA 3PIOA 1RADB 3T9NA 5KYUB 2D1XA 2LTOA 4J9IA 1YJNQ 1H3HA 1AWWA 4RTVA 3UATA 2LCSA 2E65A 2QGGA 2VB6A 2LQNA 3SWNB 3CD6Q 2ZCFB 2AKKA 1QP2A 3I55T 3LWHA 1IHWA 1D0XA 2CS7A 4PNOA 4M77A 4EPCA 3MEAA 1I0CA 1R0BG 4C5HA 1VQKT 2MYSA 4MMLA 3ZBDA 2RHZA 3BFMA 2LJ1A 1YP5A 2MWPA 4WTOB 4KGZB 4PFPA 1AOJA 1KHIA 1G3SA 1VQMT 4FM4B 1WXBA 5AYFA 4J9BA 3X25B 3ZEHA 4IKFA 4M77C 3LX7A 2JMCA 4F7UB 3JB9G 3I5RA 5KYYA 3MEWA 3JCMQ 1BI0A 4C92G 4ZTJA 4OB1B 2FPEA 2L3SA 1D0ZA 2QYZA 4OF1A 1NLPC 2P0PA 4J9EA 9ATCB 4BI8B 1OPLA 5FRNA 1P92A 3FC3A 2X4YA 4PJNA 1FMWA 1PHTA 2RI5A 2C0OA 4L6V5 2EYYA 2L3PA 4PLIA 1MUZA 3RERA 1BI1A 1DJ7B 1BKBA 2L3QA 1LCKA 4XTUA 1CKBA 3ZL7C 4A63B 2DD5A 3A5ZB 1VQ4T 2EWNA 3PFSA 4BB7A 1KD1C 2F5KA 3R6NA 4C0FA 3JAME 2FZGB 2XU8A 2CH4W 3VRZA 3QWYA 2LNVA 1K4US 3A8HB 4LXCA 1UJ0A 2DEUA 3BY7A 1M4ZA 4M75A 2DJQA 4XU1A 3H9NA 3PMTA 4Z89A 3VUBA 2FO0A 4EMKB 3VS2A 4LUEA 4PJOG 1BU1A 1WZOA 4R56A 4LDYA 4Y28E 1D3BA 4M75C 1SSFA 1NG2A 3OS5A 5LJ5d 3OYLA 1RACB 1M3AA 3QZ9B 5HY6A 3CMET 3L2RA 1YJNT 4BE2A 4RTWA 1X27A 1NPRA 2IPOB 1K8AC 4J9GA 4ELZC 3F70A 3LW5E 1WQWA 2DX1A 1NZ9A 2COZA 2G6FX 1M2VA 4C0GA 2LRQA 1MGQA 4M7DB 3BW1A 1XJWB 3G71Q 2KVQG 3JV3A 4F7UG 1N9SA 2DYIA 5KYUA 4RG8A 3U23A 2NUPB 3E19A 1OV3A 2ECZA 4AFZC 1BIAA 1JXOA 2LX9A 1WHMA 2O31A 1W2BA 1VQNA 2O01E 1PG5B 3NGPA 2O88A 3CC7A 3M9QA 5LJ3e 1C6VX 2JZ2A 1GL5A 3GF5A 3SWNA 2RJDA 3GLXA 2XDDA 3EFOB 3S3MA 3VS5A 1EFNA 3TREA 4JRKA 2FRYA 5A0LA 4JJNK 3CCLT 1PSEA 1KQ1A 3LWIA 2DFUA 3P8DA 1WFWA 2QAZA 5GANd 2CH4A 4M7AD 1QKWA 2KROA 2KI7A 2MWOA 2BTTA 1D1CA 5I21A 3RDVA 2DILA 1A0NB 3JCMg 1UHFA 4J6WA 3CCQA 4F7UA 1VQ8Q 3UA6A 4L59A 4KBMB 1J3TA 4KRTA 4LUDA 2QDYB 5GAN7 2GBQA 3LYIA 3QBYA 1MV0B 1OPKA 4MZTA 3L2VA 2CZ6B 4E6RA 2QA4A 1GRIA 2JJ9A 4PJJA 3M58A 3FRNA 1VYVA 1K8AU 4JLIA 1M3CA 3VKIA 3FIFA 2RPNA 1VQ5A 2W0ZA 2YDLA 4C8QB 1K73R 1TUCA 1U8RA 4OB2B 3OQ5A 4DQ2A 1RAHB 4J7FA 3M5AA 4EMHA 3SHWA 2XD0A 1SEMA 2HL3A 3UA7A 4FYYB 4GBQA 3VYGA 2QQ9A 2PTKA 2DXTA 2QTVA 4LN2A 2ESWA 2RQRA 2A28A 4BD3A 2C06A 4M78D 1ZQ1A 4BUGA 1GBRA 1NE8A 3QDRB 1H92A 2GGRA 1ABOA 5DLQE 5I2MA 1W2BS 3I9QA 3INZA 1K1ZA 4M4ZA 1ZBXA 4MZPA 3CCUT 1VQPQ 2HBPA 1OOTA 3O5ZA 4JDSA 5GAN8 3OYGA 1I4K1 2L0AA 3HFNA 4KGVB 3V7CA 4J8OA 5L8RE 2VYTA 2ZPGB 2LT1A 1HSQA 5CKBA 2LP5A 3G71T 3CCEA 2CUDA 3P8HA 5EG2A 2MK5A 2K6DA 4FW2A 4XU2A 5GAMd 4EMKC 1X2QA 2NUTB 1O9SA 3OYKA 3JCMf 1BCMA 3H0IA 3JCMc 4PKCC 3CCJQ 5KE3A 1N8RR 4OP0A 4PL6A 4IUQA 4IUUA 3I56T 3SD4A 1WJSA 3MCAB 3CC4A 2CZ1B 2EFIA 3L2ZA 5DY9A 4ZN1A 4M7DA 2JUFA 4HT9A 1GCQC 3VUZA 3JB9D 5CVIA 1W2BP 1G8XA 4RG2A 1AWJA 4DBHA 4C92D 3I35A 6AT1B 2NUPA 1YI2Q 2LJ0A 1M30A 2ROTA 1WLPB 3OSVA 4M7AB 1JB0E 2HMAA 1UECA 2WACA 2CKKA 1ZLMA 4M7DC 2RN8A 4OVAA 5IN1A 1I1JA 8AT1B 3QPHA 4HT8A 2HSEB 3QIIA 3CCMA 1TTHB 4XTYA 1YJWA 3EFOA 4A4KA 2DIQA 3FB9A 1RL2A 3OA6A 4IURA 1TXQA 3PIPA 1MMGA 1UTIA 2IVWA 4YTLA 2R5AA 3SFMA 3A1PA 3LLRA 2HNIA 1QLYA 4Z8AA 3CD6A 4C0ZA 4D6WA 2RMOA 5C0MA 1QVFA 1NM7A 1VYUA 4TVRA 2Y4XA 3M55A 3R6OA 5CQYA 3RMSA 1UGRB 2O9VA 2K5FA 4D8DA 4OGEA 1FMKA 2ROLA 2JXBA 5CKFA 2QQSA 4M78B 3CBPA 3J80E 1NPPA 4PFOA 1VA7A 1OX9A 4HVVA 3MP8A 2YWWA 5D6WA 4C8QA 1BIBA 3CPWA 2KSSA 2HKNA 4Y92A 1M3BA 2M0YA 4ZN3A 4E47A 1RUWA 3CPFA 2RHIA 4ATOA 4KUDK 2DNUA 3G1JA 1VQKQ 1I07A 3HRSA 2OTJQ 4C8QC 1OEBA 2JTFA 3EGUA 5KYNA 2GQIA 1X6BA 1KD1R 2AT1B 2EJ9A 1VQMQ 2LCCA 2FYKA 2D8JA 2CP7A 2M02A 3GP8A 3C12A 3PNWC 2A3LA 3JCMb 2NYSA 3MHXA 1XTDA 2DXBA 3JCMV 2K57A 3HL8A 3ULRB 1VIEA 1XNIA 1UE9A 4DBQA 1C1AA 1NBEB 2BUDA 1TG0A 2M1HA 3CCJT 2DERA 2DO3A 2GTJA 1JJ2S 4M7DF 2ED0A 4KULA 3QJYA 5IHNA 2E4HA 4QVCA 5A0GA 3HP9A 4A4FA 3THKA 2DAQA 4J9FA 4CRIA 1NYGA 1UHCA 4BY6C 1TH7A 5LJ3j 2RQUA 4Z88A 3V8JA 4C92B 2NUTA 1M27C 3HFOA 2E41A 1F1BB 1YI2T 1E6GA 2OJ2A 1QVFS 5I2SA 3CMAA 1VQ4Q 2PUKB 1HD3A 2HD0A 2CT3A 1K8AR 2YUPA 4NL2A 5FRMA 2ATCB 1UG1A 2HCKA 2JS0A 3CC2T 2KY9A 3EH1A 3VYHB 1N9RA 4XTZA 3E9FA 5LJ3h 5M9OA 2DTOA 4HCCA 3M54A 3HKSA 4HVWA 5DLOA 3CPWS 1N8RC 1S72Q 1M8MA 1M90R 2ABLA 2O2OA 2OTLT 4B9WA 1M5Q1 2DL4A 4M7AA 1LOJA 4Y91A 2QEXA 2QI2A 2HQHA 2KRNA 2QG9B 1JJ2P 2HBWA 2VVKA 3CCRA 1IXDA 1CKAA 2KT1A 2X4JA 2VKNA 2PUOB 5CKHA 1U06A 1SRMA 1E7OA 5LJ5e 4M7AC 2H3EB 3CMEQ 2ZPFB 4AG1C 1YCSB 2HDAA 1UGVA 3DLMA 4PJOB 1M8VA 3VS6A 2QDLA 1WX6A 1QVFP 2E70A 3HSBA 3M0SA 1QQJA 2KAFA 2YRVA 2RJFA 3DKMA 4C5GA 3ASKA 2VGMA 4VUBA 3A8GB 5GAN3 1I81A 4J7IA 3HRUA 1SKUB 2RJCA 2OTJT 3OYFA 1OU8A 3BDUA 5LJ3g 2V26A 2QA4T 2FPDA 2DD4A 1VQ9A 3CPWP 3J7AF 4M78A 3PGGA 1UB4A 4E7LA 4E7IA 5KYXB 2ED1A 3VS4A 3C0CA 5ECAA 5GAOn 3UF4A 1VQ8A 1MMDA 1OI1A 3A8OB 3RKYA 3CCSA 3QYGB 8ATCB 1QCNA 2BE7D 1VQOA 1KHCA 2DBMA 1FMVA 2K79A 5LL6S 2V8KA 2MAMA 3CCLQ 2KYMA 4E7ZA 4P5NA 2E12A 2VV5A 4ZGDB 2F2XA 1N8RU 1KG1A 3CXCA 1WHKA 2CDTA 1RABB 2YSQA 2DLPA 3G7ZA 1YWPA 5GANe 1Z9QA 3KBGA 2DVEA 4M77E 4E7SA 2F5TX 2A37A 3C4SA 1AWOA 2DZ9A 1AZGB 4FSSA 3OYIA 4XU0A
chains in the Genus database with same CATH topology
5GAN2 4M75D 2JVVA 5GANd 2QTXA 1X6OA 2JOYA 4RCBA 3OS1A 4M7AD 2CYZB 4II1A 3CMEA 1YITA 4QQDA 2MWOA 5GAMh 3AHUA 4QQ6A 3MP1A 3WXMB 2RI2A 3A8LB 5I21A 3OYHA 2X4WA 1NJIU 4XU3A 2RHXA 4N0AA 3X20B 3NTKA 3V8KA 3JCMg 4J6WA 1VQLT 1VQ7T 3CCQA 4F7UA 3LGLA 3L1AA 3L2UA 5HK3A 4C8QG 4L59A 4KBMB 3OY9A 2K5LA 1V29B 2QDYB 5GAN7 3LYIA 3QBYA 4O6JA 3ZFJA 4MZTA 3L2VA 4LD9K 5GMKm 3FEOA 5D6YA 1GXIE 2ZPBB 2CZ6B 1VQ8T 2QA4A 1JJ2A 3CCET 3M58A 3V7SA 1OZ2A 3FRNA 3MO8A 4MDWA 3J81E 1K8AU 4GLKA 4JLIA 3VKIA 3FIFA 3OW2A 3OYJA 4V2SA 1VQOT 3OBYA 2LDMA 4N0AC 5A0DA 4DOWA 1HXDA 3EAEA 3OS0A 1VUBA 1VQ5A 1VQNT 1UEBA 4C8QB 3CC7T 4MDXA 1VQ6A 3JCMe 5GANh 1S72T 4C92A 1U8RA 3OMCA 2MF2A 4OB2B 3G71A 3OQ5A 5GAOm 4IUVA 4DQ2A 5GMKe 2VC8A 3OYDA 4E7KA 4J7FA 2GCXA 3M5AA 4M77G 3CCVT 4E7HA 4EMHA 3CCVA 3SB2A 4XK8E 3JCMd 2XD0A 2LCLA 4EMGA 5FU7B 5J26A 4JLGA 5LJ3f 2QQ9A 3VYGA 4HCBA 4KT0E 2DXTA 1WJQA 2YLBA 4C8QF 2DJZA 4HA8A 4N4GA 4C92C 4M77B 3JB9H 4BD3A 1FWZA 2JTMA 3G6EA 2C06A 4M78D 1ZQ1A 1WPYA 2DTIA 4BUGA 4X9DA 5GAN4 3CCLA 5GANf 3JCMJ 1YITT 4LDWA 1FXXA 2PU9B 1NE8A 3QDRB 3OYBA 2LQ8A 3CEYA 1N8RU 1Y07A 3MP6A 2HAXA 5GAMg 3O8VA 5DLQE 5I2MA 1W2BS 4PJOD 4J6YA 3INZA 2L89A 3JRZA 2I2LA 2GQVA 2FL7A 2O4XA 4NS5A 4XQ3A 5IAYA 3CCQT 1M9SA 3UPUA 4M77F 1ZBXA 2LQKA 4MZPA 4M75E 1Q86C 3TCJA 1KC8U 5DM7R 4Z02A 4A4GA 4LDUA 3OMGA 3HRTA 3OSSC 3CCUT 3L42A 2HBPA 4JDSA 3JCMh 3OYGA 5GAN8 4M7AE 1Y71A 1I4K1 1R8OB 1Q81C 3HFNA 3LH0A 2P0QA 3CXCS 3CCMT 3V7CA 3NFCA 4J8OA 1BYMA 4B9XA 3HHTB 1QW1A 5L8RE 2VUBA 2VYTA 3DB3A 1YIJT 2ZPGB 2EJGA 3JCMP 1VQPT 1KQSS 2LT1A 1VQ5T 5CKBA 5CCAA 5GAMe 3RMQA 1M90C 3M4GA 3ME9A 2ZPHB 3OYNA 3H6ZA 1OZ3A 2EQUA 2JN0A 4C0DC 3G71T 4M7DD 2P4TA 3CCEA 2M16A 4GY5A 3P8HA 5KCHA 4BE1A 1G3WA 4XTVA 4KUIA 2EQMA 1JRIA 5EG2A 1K73C 4XU2A 3GPLA 5FU6C 1KD1U 4PJOA 5GAMd 3RKWA 1H641 2RHUA 4EMKC 5CO7A 1O9SA 3FDRA 3OYKA 1EIFA 2RM4A 3QG1A 2K2VA 4O5VA 4XTWA 4M78C 3JCMf 3Q1JA 4L5GA 4XTXA 2M0OA 3JCMc 3JB9I 4BDZA 1RI0A 1KQ2A 5GAOl 4PKCC 4MMKA 4JUVA 5KE3A 4JRQA 1Q82C 3C94A 4DOVA 4OP0A 1UGPB 2MI6A 3LGFA 4IUQA 4IUUA 4PL6A 3RUXA 4BE0A 3I56T 3HPWA 3MEVA 2OAUA 2HQXA 2ZPEB 3E1SA 1WJSA 4OMFB 3SD4A 3OYCA 4PJOC 4RKUE 3MCAB 3CC4A 1IREB 2CZ1B 2EFIA 3WVDB 3L2ZA 4M75G 1B34A 5DY9A 4M7AG 4ZN1A 3L2QA 4M7DA 2JUFA 2FB7A 4HT9A 1MHNA 3OW2S 2JNGA 1JBMA 3VV0A 3VUZA 4X9CA 3WVEB 3JB9D 2VGNA 3CBOA 3SWNC 2IG0A 5CVIA 3GIBA 2FHDA 4RG2A 1Y7XA 1N6AA 4M78E 5KH6A 4C92D 1K9MC 4HCZA 3FJPA 2FVUA 4M75B 3C95A 3OSVA 4M7AB 1JB0E 4QVDA 4JS5A 3CBMA 2WACA 2CKKA 4C5IA 5CQXA 2P0KA 4M7DC 5IN1A 4OVAA 4J83A 1UGQB 2K5IA 3KXTA 1YHQT 3GOXA 3CCUA 3QPHA 2PVDB 4E7JA 4HT8A 3QIIA 4A53A 2RK2A 2R5MA 4NOYA 3CCMA 4OGCA 2E10A 1HK9A 1YJ9A 5GAOr 1W4SA 4LD6A 4XTYA 1YJWA 1D3BB 4A4KA 2V8JA 4M75F 1YIJA 4ZGJB 2CZ7B 2DIQA 3FB9A 4M7AF 2V8IA 1VQPA 4IUPA 2K3XA 1RL2A 3OA6A 5J3BA 5HKCA 4IURA 5GAMf 1Q86U 1UGSB 3JB9J 3I55A 3PIPA 4UC4A 2IVWA 4YTLA 1U1TA 3G4SA 1Q81U 2R5AA 3SFMA 3DLLA 4FT4A 3LLRA 2HNIA 3QO3A 3CD6A 2LT4A 2XKOC 2H3JA 3META 4C0ZA 4NL3A 3EFSA 3QUIA 4CI0C 2F69A 2E5QA 4D6WA 2NLUA 2VXEA 3OYEA 4C8QD 4ME7A 5C0MA 3S3OA 1X01A 3QSUA 2E64A 1O75A 5CIUA 2QXFA 1M90U 2XDBA 1LJOA 1QVFA 3CC4T 4ZTFA 4M78G 2BIVA 4TVRA 2Y4XA 3GNGA 4C0DB 1X75C 1G3TA 2MMPA 3JSCA 3M55A 3R6OA 4HKEA 5CQYA 3RMSA 1K73U 1UGRB 1WGSA 2XI9A 3I56A 2E1HA 4A54A 2R57A 2K5FA 5FU6B 1H3ZA 3M4YA 4OGEA 4F7UE 2XIDA 2L3RA 3CCJA 5GAN6 3V7RA 5CKFA 4Q5WA 2QQSA 2D0QB 3CBPA 4M78B 2DIGA 3J80E 3URGA 4LDVA 1NPPA 3PIOA 1Q82U 3UWNA 2DEQA 3T9NA 1Y96B 2E6ZA 5IT9E 3MP8A 2LTOA 5D6WA 2E6NA 4C8QA 1BIBA 5CK9A 3CPWA 2KSSA 1ZHIA 4OB0B 3CMAT 2QQAA 2EQJA 4C92E 2A7YA 1YJ9T 3MEUA 4ZN3A 1YJWT 4E47A 4M78F 5GAOq 5LJ5j 3CPFA 2E65A 2RHIA 2HQEA 5CKDA 4ATOA 2EIFA 1YI2A 2DXCA 4KUDK 1YHQA 2PQWA 5C6SA 2QQRA 4QQGA 3SWNB 3HRSA 1M1KC 2ZCFB 1K9MU 1BI2A 3JCMW 1QP2A 3I55T 4C8QC 3LWHA 2JTFA 2CS7A 4PNOA 4X34A 4M77A 4EPCA 3G4ST 3MEAA 2EJ9A 4C5HA 2EQKA 2LCCA 4OB3B 3CD6T 1Q7YC 1VQKT 1VQ4A 3CC2A 1XOVA 2FYKA 4MMLA 2RO0A 3ZBDA 5GAOp 2RHZA 2X4XA 3BFMA 3GP8A 3C12A 3M57A 2MWPA 2A3LA 3PNWC 5FU7C 3JCMb 4LDXA 3MHXA 1XTDA 1KHIA 1G3SA 2DXBA 2K57A 4FM4B 3HL8A 5AYFA 3JCMV 1VQMT 3NTIA 3X24B 3TU4K 5LJ5h 1VIEA 2L8DA 1XNIA 3X25B 2AHJB 3ZEHA 4IKFA 4M77C 2BUDA 5CR2A 1QVGA 2M1HA 4R55A 3OYAA 3LX7A 1QVPA 3CCJT 2OTLA 3OB9A 4F7UB 2DO3A 3JB9G 1JJ2S 4M7DF 2QQBA 3VJPA 3ER0A 4KULA 3MEWA 3QJYA 2VXFA 1BI0A 4MZMA 3QXEB 3JCMQ 3NTHA 4C92G 4PLLA 4ZTJA 4OB1B 4QVCA 5A0GA 4RCCA 5A2QE 1WQ7A 3HP9A 4OF1A 4A4FA 2DAQA 4ELYC 3S6WA 1M1GA 2P0PA 1I8FA 2B8AA 2D6FA 4JS4A 4CRIA 3UT1A 4BI8B 2RJEA 5FRNA 1KQSA 1KG1A 2RK1A 1TH7A 3EFRA 1P92A 4BI4A 4BY6C 4F7UF 5LJ3j 2X4YA 3V8JA 4C92B 3FC3A 3DB4A 2RI5A 2ZZDA 3HFOA 4PJOE 1M1FA 2E41A 4FSXA 4L6V5 1YI2T 4PLIA 1QVFS 5I2SA 3CMAA 3RERA 1BI1A 3QJ6A 2PUKB 1DJ7B 1BKBA 2EJFA 2EKOA 4XTUA 2HD0A 1YJNA 1PSFA 3PTAA 2DPPB 3JB9F 5GANj 4NL2A 1BI3A 2DD5A 5FRMA 3CC2T 3A5ZB 1VQ4T 2KY9A 2EWNA 3PFSA 5KCOA 4BB7A 5GMKi 1KD1C 2GFUA 2F5KA 4C92F 3M53A 2RA2A 4C0FA 5J39A 3H8ZA 3VYHB 3JCMX 2KQWA 3JAME 4QW2A 3RESA 1VQ9T 1N9RA 5GAN5 2XU8A 4XTZA 3S3NA 3E9FA 2PVGB 3X26B 1QP3A 5LJ3h 5M9OA 2DTOA 2LNVA 4HCCA 3M54A 1VQKA 4M7DE 2OTJA 3HKSA 3A8HB 2XK0A 5DLOA 2K4YA 2WSCE 5CAIA 3BY7A 3CPWS 4FT2A 1N8RC 5LJ5g 2GF7A 3L2WA 3CCST 2BKDN 1M4ZA 5HK0A 4M75A 1M1KU 2OTLT 4B9WA 1M5Q1 4BDYA 2Y90A 1VQMA 2O4XB 1WJRA 3UDCA 4M7AA 1LOJA 4XU1A 3P8BB 4Y91A 2QEXA 4BACA 2QI2A 1OYXA 2X35A 1LNXA 3PMTA 1YCYA 3GNFB 2DZCA 3CCRA 3OYYA 3M59A 1Q7YU 3VUBA 4QVZA 2M9UA 4EMKB 1I5LA 2WSFE 2X4JA 2KMTA 4PJOG 2D9TA 4R56A 5FLXE 4LDYA 2PUOB 5CKHA 4M77D 1YBYA 4Y28E 4JRPA 1D3BA 4M75C 5LJ5e 1SSFA 2XHCA 4M7AC 1NJIC 2KK4A 2ZPFB 5FROA 5GMKj 1FX7A 3DLMA 2DK3A 4PJOB 1M8VA 3OS5A 5KE2A 4FL6A 5LJ5d 3OYLA 2E70A 3HSBA 2CGHA 3QZ9B 5HY6A 2DXUA 2KAFA 3CMET 2YRVA 3QYHB 2RJFA 3DKMA 4C5GA 3L2RA 2RHYA 1YJNT 4BI3A 3ASKA 2VGMA 3X28B 2RI3A 2RB6A 4BE2A 1QVGS 3FLGA 4VUBA 4M7DG 3VU3C 3A8GB 1NPRA 2RH2A 5GAN3 4DA4A 1K8AC 3PMIA 2L5QA 1I81A 2YLCA 3F70A 4ELZC 4J7IA 3LW5E 1WQWA 3N5BB 4XAXB 4C5EA 1G3YA 4PJOF 3HRUA 1G5VA 1NZ9A 2RJCA 2YHTA 2OTJT 3V8LA 4BY6B 1B34B 3OYFA 4C0GA 4EMKA 3BDUA 5LJ3g 2LRQA 1MGQA 5GMKh 4M7DB 3BW1A 2K3YA 4FIBA 1VQLA 2QA4T 1VQ7A 2EAYA 2DTHA 2KVQG 2DD4A 1VQ9A 1WNLA 4M78A 4F7UG 3J7AF 3PGGA 2DKGA 3SDZA 1UB4A 2LC4A 4E7LA 4E7IA 1N9SA 2CZ0B 3A8MB 2QEXT 3RKXA 3QHSA 3QKJA 1Y96A 1VQ6T 4RG8A 2G3RA 4J5YA 5GAOn 3PT9A 3E19A 3A8OB 1OI1A 3CCRT 5GMKl 3QZ5B 1VQ8A 3RKYA 1BIAA 5GANg 3CCSA 2LX9A 3QYGB 2KDSA 2LVMA 1VQOA 5CKEA 1W2BA 1AHJB 2PVOB 2XICA 1KHCA 4A4EA 4C8QE 2R58A 1VQNA 2O01E 3OS2A 3CC7A 3M9QA 4JRIA 5LJ3e 4N4HA 1S72A 1VIFA 5LL6S 1N27A 3KUFA 2JZ2A 2V8KA 2EYQA 2ZGWA 5GAMj 2MAMA 3E9GA 4ZGEB 4N4IA 4EDUA 2XDPA 2GFAA 2Y4YA 4P5NA 2E12A 2VV5A 3GF5A 5D6XA 3BDLA 3M56A 2RJDA 3GLXA 3RIRA 3SWNA 4ZGDB 3OBWA 4A4HA 2XDDA 4WF2A 5LJ3d 3CXCA 3S3MA 2ZPIB 2XG8D 3G6ET 4FU6A 3TREA 1XQHA 1IZ6A 2RD1A 4JRKA 4IUTA 2WSEE 3G7ZA 3TEEA 1KC8C 5A0LA 4JJNK 3OYMA 1U1SA 5GANe 3CCLT 3KBGA 1PSEA 5LJ5f 2DVEA 4J6XA 4M77E 2F5TX 1KQ1A 3C4SA 3LWIA 2DZ9A 3P8DA 4RMOA 3OYIA 4XU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CYZ B;  4OB0 B;  3A8L B;  3X20 B;  1UGP B;  2DXC A;  2WSF E;  2ZPE B;  2ZCF B;  4RKU E;  2PUO B;  1QP2 A;  1IRE B;  2CZ1 B;  3WVD B;  1V29 B;  4Y28 E;  2QDY B;  1GXI E;  2ZPB B;  2CZ6 B;  4OB3 B;  2ZPF B;  3WVE B;  3QZ9 B;  2DXB A;  4FM4 B;  4OB2 B;  3QYH B;  3X24 B;  1JB0 E;  3X28 B;  3X25 B;  2AHJ B;  3A8G B;  1UGQ B;  4XK8 E;  3LW5 E;  3VYG A;  2PVD B;  4KT0 E;  3QXE B;  4OB1 B;  4ZGJ B;  2CZ7 B;  2DD4 A;  1UGS B;  2CZ0 B;  2PU9 B;  3A8M B;  3A8O B;  3QZ5 B;  2ZZD A;  3QYG B;  4L6V 5;  1AHJ B;  2PVO B;  2O01 E;  2PUK B;  1DJ7 B;  1PSF A;  2DPP B;  4ZGE B;  2DD5 A;  1UGR B;  4ZGD B;  3HHT B;  5L8R E;  2ZPG B;  2ZPI B;  3VYH B;  2WSE E;  2D0Q B;  1PSE A;  2ZPH B;  2PVG B;  3X26 B;  1QP3 A;  3A8H B;  2WSC E; 
#chains in the Genus database with same CATH topology
 5GAN 2;  1X6O A;  3OS1 A;  5FWC A;  2CYZ B;  1KIK A;  4II1 A;  3AHU A;  3WXM B;  3EGX B;  3A8L B;  2X4W A;  2RHX A;  2DRK A;  1VQL T;  1PD0 A;  1VQ7 T;  2B86 A;  5HK3 A;  1WHL A;  2K5L A;  1YN8 A;  1ZA2 B;  3ZFJ A;  4LD9 K;  1PWT A;  3CCE T;  2I0N A;  4MDW A;  4GLK A;  1RAE B;  3OW2 A;  1IO6 A;  3OBY A;  4DOW A;  3OS0 A;  1UEB A;  1VQ6 A;  1B07 A;  1S72 T;  4C92 A;  3OMC A;  4IUV A;  4QKU A;  5GMK e;  2VC8 A;  4E7K A;  2J7I A;  3CCV T;  2LCL A;  5FU7 B;  1KSW A;  4JLG A;  5LJ3 f;  4KT0 E;  2VWF A;  7AT1 B;  2EBP A;  4HA8 A;  4C92 C;  2PNI A;  3G6E A;  5AT1 B;  2DTI A;  1AD5 A;  1QCO A;  4X9D A;  2LJ3 A;  1SSH A;  1YIT T;  4IIM A;  1FXX A;  2PU9 B;  3OYB A;  2LQ8 A;  4CC2 A;  4F04 B;  2CP6 A;  3CCU Q;  3NHN A;  3GBQ A;  5EC7 A;  1V1C A;  4XQ3 A;  3TQ7 P;  1YJ9 Q;  1M9S A;  4M77 F;  3NMZ C;  4M75 E;  2HL5 C;  4RTZ A;  4Z02 A;  2ENM A;  3HRT A;  3JCM h;  2EYZ A;  1R8O B;  3CXC S;  3CCM T;  3EHQ A;  3NFC A;  4AFS C;  1BYM A;  4B9X A;  3DB3 A;  2CT4 A;  5GAM e;  1M90 C;  3M4G A;  3H0F A;  3EGD B;  1IRX A;  3OYN A;  2A36 A;  3H6Z A;  2JN0 A;  4C0D C;  5IHK A;  2M16 A;  4BE1 A;  1KD1 U;  2EQM A;  4PJO A;  1B3Q A;  3RKW A;  5CO7 A;  2E3H A;  2RM4 A;  3I56 Q;  1H8K A;  4JUV A;  2FG0 A;  1Q82 C;  4DOV A;  1TOV A;  1TSF A;  3E1S A;  4OMF B;  4PJO C;  4J9D A;  4J9C A;  4RKU E;  1IRE B;  1Z9Z A;  2FB7 A;  1MHN A;  3OW2 S;  1JBM A;  1X69 A;  2VGN A;  3SWN C;  5KYX A;  2HZY A;  2FHD A;  1YFN A;  1Y7X A;  1K9M C;  3FJP A;  4QVD A;  4AMC A;  3CBM A;  1X6G A;  4C5I A;  3CXC P;  4AG2 C;  2IIM A;  4J83 A;  1UGQ B;  1U5S A;  2K5I A;  3KXT A;  1TWB A;  4RTT A;  4HCK A;  4CC7 A;  2RQT A;  1K76 A;  1WXU A;  4OGC A;  1R77 A;  5GAO r;  2V8J A;  1AWX A;  4M75 F;  1YIJ A;  2KE9 A;  2CZ7 B;  3LH5 A;  2DM1 A;  2V8I A;  5J3B A;  3REB B;  1UGS B;  3I55 A;  2RF0 A;  3MJX A;  1AVZ C;  2YUN A;  1U1T A;  2EYW A;  4OMM A;  2W10 A;  2XKO C;  3EFS A;  3QUI A;  2NLU A;  2VXE A;  4ME7 A;  3S3O A;  1X01 A;  1W1F A;  2KXC A;  1O75 A;  1M90 U;  3EGX A;  4X1V A;  3GNG A;  1X75 C;  4JJC A;  1WA7 A;  1ZBJ A;  2XI9 A;  2F2W A;  3EG1 A;  2A08 A;  2R57 A;  1V76 A;  5FU6 B;  3OW2 P;  4F7U E;  2XID A;  1SPK A;  2OX7 A;  4JJD A;  3VS1 A;  2DIG A;  4B6M A;  3H41 A;  3RBB B;  1Q82 U;  3UWN A;  4DEY A;  1Y96 B;  2ZAE A;  3QWX X;  2E6Z A;  1MNE A;  1W6X A;  4DEX A;  4OB0 B;  3CMA T;  1UJY A;  2QQA A;  4JJB A;  2EQJ A;  2A7Y A;  1YJ9 T;  5LJ5 j;  2HQE A;  2AZV A;  2EIF A;  3TSZ A;  1YHQ A;  4HXJ A;  4QQG A;  1UUE A;  1K9M U;  3JCM W;  3G4S T;  3EG3 A;  4FCY A;  4OB3 B;  1VQ4 A;  2CSQ A;  1XOV A;  5GAO p;  2RO0 A;  2LNH B;  2X4X A;  3M57 A;  5FU7 C;  2EW3 A;  4LDX A;  4JPB W;  4OMP A;  5LJ5 h;  1RAF B;  2L8D A;  2AHJ B;  4J9H A;  5CR2 A;  1QVG A;  4R55 A;  3OYA A;  1QVP A;  3OB9 A;  1QWE A;  3I5S A;  2QQB A;  3VJP A;  2VXF A;  3QXE B;  3VS3 A;  1HJD A;  5A2Q E;  1R0C B;  3EGD A;  3NPF A;  1M1G A;  1I8F A;  2B8A A;  2CP3 A;  4JS4 A;  3UT1 A;  1KQS A;  3EFR A;  4BI4 A;  4F7U F;  1PRL C;  2ZZD A;  2AK5 A;  2KR3 A;  3CC2 Q;  1ZUY A;  3QJ6 A;  2KT8 A;  2EJF A;  5IXB A;  2EKO A;  1YJN A;  3PTA A;  2DPP B;  5GAN j;  1BI3 A;  2E3I A;  4RUG A;  3PVQ A;  5GMK i;  1KK7 A;  2RA2 A;  3H8Z A;  2KQW A;  4QW2 A;  3RES A;  1VQ9 T;  5GAN 5;  1QCF A;  1D09 B;  2OTL Q;  1QP3 A;  2NWM A;  1PCX A;  4M7D E;  2XK0 A;  3CC7 Q;  2V1R A;  2NUZ A;  4FT2 A;  1QMC A;  5LJ5 g;  3L2W A;  3CCS T;  2PZ1 A;  2BKD N;  2Y90 A;  1WJR A;  1UDL A;  4BAC A;  1OYX A;  2DZC A;  3M59 A;  3SEM A;  4QVZ A;  1ZA1 B;  1Q95 G;  2KMT A;  2D9T A;  5FLX E;  1YBY A;  4JRP A;  1SHG A;  1NJI C;  2KK4 A;  5FRO A;  5GMK j;  1FX7 A;  1MND A;  4FL6 A;  1D0Y A;  1RLQ C;  2CGH A;  2DXU A;  2YT6 A;  2RHY A;  4HVU A;  2RI3 A;  2RB6 A;  3TSW A;  1QVG S;  3FLG A;  2EGC A;  4AFQ C;  1T0J A;  3IQL A;  4DA4 A;  3PMI A;  2YLC A;  1AEY A;  1QKX A;  2QA4 Q;  4XAX B;  4QT7 A;  1G3Y A;  1ARK A;  3REA B;  1WIE A;  1G5V A;  2HSP A;  2YHT A;  5GMK h;  4FIB A;  2EAY A;  2DTH A;  1QWF A;  5KYW B;  1PNJ A;  2SEM A;  2V1Q A;  3RKX A;  1VQ6 T;  1Y96 A;  2JW4 A;  3PT9 A;  3M0U A;  5GMK l;  3QZ5 B;  1WHH A;  5GAN g;  5CKE A;  1AHJ B;  2PVO B;  2XIC A;  4A4E A;  4C8Q E;  2R58 A;  3OS2 A;  1OUL A;  4JRI A;  1PM3 A;  4N4H A;  1N27 A;  3KUF A;  2J6O A;  2X51 A;  2EYQ A;  2ZGW A;  5GAM j;  2DRM A;  4ZGE B;  2LMJ A;  4EDU A;  2XDP A;  2Y4Y A;  5D6X A;  3BDL A;  2AIR B;  3OBW A;  4JZ4 A;  2XG8 D;  3G6E T;  1XQH A;  1IZ6 A;  4IUT A;  2WSE E;  2O9S A;  3TEE A;  3OYM A;  1IGQ A;  1U1S A;  5LJ5 f;  4J6X A;  2VAS A;  1BBZ A;  2YXY A;  4RMO A;  1QVG P;  2JVV A;  2QTX A;  2JOY A;  4RCB A;  1RAG B;  1VQL Q;  1VQ7 Q;  5GAM h;  2HKQ B;  4QQ6 A;  4AT1 B;  5D7U A;  3OYH A;  1NJI U;  2QK0 A;  4N0A A;  3NTK A;  3V8K A;  3M0R A;  3CCE Q;  3L2U A;  2DF6 A;  1V29 B;  4O6J A;  1KQS P;  1GXI E;  5D6Y A;  1TUD A;  3V7S A;  3EHR A;  3J81 E;  1M1K R;  4N0A C;  2LDM A;  4DBF A;  5A0D A;  1VQN T;  1HXD A;  3EAE A;  3CCV Q;  1IGU A;  4OMO A;  4MDX A;  3CC7 T;  2MOX A;  2COW A;  4ESR A;  3G71 A;  2KXD A;  3OYD A;  2GCX A;  4M77 G;  2KNB B;  3CC4 Q;  4E7H A;  2YRD A;  1NLO C;  3A98 A;  3SB2 A;  4XK8 E;  3JCM d;  2DL3 A;  4EMG A;  5J26 A;  3RNJ A;  2YUO A;  2DA9 A;  3QDF A;  1Q82 R;  2EKH A;  1WJQ A;  2YLB A;  4C8Q F;  1YIT Q;  2DJZ A;  2MCN A;  4ANJ A;  1WPY A;  1EZZ B;  3D7S B;  5GAN f;  4LDW A;  2K9G A;  2JM8 A;  2RQW A;  1RAA B;  1Y07 A;  5GAM g;  3BE3 A;  1WHJ A;  1K9M R;  2L89 A;  3JRZ A;  2I2L A;  2GQV A;  2FL7 A;  2CP0 A;  3PE0 A;  3CCM Q;  3CCQ T;  3UPU A;  1YJW Q;  2LQK A;  4ORZ A;  4FW1 A;  1Q86 C;  4A4G A;  4LDU A;  4M7A E;  3OSS C;  1Y71 A;  1ZSZ B;  2P0Q A;  2BZX A;  1YIJ T;  2VUB A;  4PJL A;  3JCM P;  1VQ5 T;  2Z0W A;  4K11 A;  3ME9 A;  1OZ3 A;  4M7D D;  2EYX A;  1G3W A;  4XTV A;  1U3O A;  3GPL A;  1H64 1;  1G83 A;  2QGF B;  3FDR A;  1X2K A;  1EIF A;  2K2V A;  4XTW A;  4M78 C;  3Q1J A;  1T3S A;  4XTX A;  4BDZ A;  2LX7 A;  4R0K A;  3EG9 B;  3VS0 A;  4JRQ A;  3C94 A;  4IIO A;  1UGP B;  2MI6 A;  3M0P A;  3HPW A;  3MEV A;  2OAU A;  2ZPE B;  3OYC A;  4FYV B;  4RTX A;  1I5O B;  2LZ6 B;  3WVD B;  4GLM A;  4M75 G;  3L2Q A;  3VV0 A;  2FPF A;  5KYW A;  4X9C A;  3CBO A;  2IG0 A;  4M78 E;  5KH6 A;  4JZ3 A;  2CSI A;  2P0K A;  1PKT A;  2GNC A;  1YHQ T;  3GOX A;  2DMO A;  2PVD B;  3EH2 A;  2R5M A;  1HK9 A;  1W4S A;  4M7A F;  1VQP A;  2K3X A;  2J6K A;  5GAM f;  1Q86 U;  3JB9 J;  3CQT A;  4UC4 A;  2DL5 A;  3DLL A;  2YRC A;  2H3J A;  4CI0 C;  1KJW A;  2E5Q A;  4EIK A;  3OYE A;  4C8Q D;  2E64 A;  1WYX A;  5CIU A;  2XDB A;  1LJO A;  3CC4 T;  4ZTF A;  1NEB A;  5IHI A;  2FZK B;  1G3T A;  2MMP A;  4HKE A;  1WGS A;  5I11 A;  4A54 A;  1H3Z A;  2P4R A;  3CCJ A;  5GAN 6;  4ZNX A;  4AFU C;  5GJW B;  3VS7 A;  2SRC A;  3CMA Q;  2DEQ A;  1JO8 A;  1GCP A;  5IT9 E;  2E6N A;  1KC8 R;  5CK9 A;  3FJ5 A;  2OAW A;  1PRM C;  1ZHI A;  4C92 E;  3M0Q A;  5L23 A;  3MEU A;  1YJW T;  4M78 F;  5GAO q;  5CKD A;  3G4S Q;  1YI2 A;  2DXC A;  2PQW A;  5C6S A;  2QQR A;  2DE0 X;  1M1K C;  1OX8 A;  1BI2 A;  4X34 A;  4CC3 A;  2X3W D;  1LVK A;  2EQK A;  4LNP A;  3CD6 T;  1Q7Y C;  3CC2 A;  2QEX Q;  2MPX C;  3CCR Q;  3VRY A;  1WHG A;  1X43 A;  3NTI A;  3X24 B;  3TU4 K;  1VOM A;  3TVT A;  2M51 A;  2QAS A;  1HYO A;  2BZY A;  2OTL A;  1Y0M A;  2X9H A;  3PVL A;  1ZSZ A;  2KRM A;  1E6H A;  3ER0 A;  2EGA A;  4MZM A;  3NTH A;  4PLL A;  4KH0 B;  1ZX6 A;  4RCC A;  2C0T A;  1LPL A;  3KFV A;  1WQ7 A;  1W70 A;  4ELY C;  3S6W A;  2GTO A;  1NJI R;  2D6F A;  1S1N A;  1D1B A;  2RJE A;  2RK1 A;  1ZSZ C;  3DB4 A;  4PJO E;  1M1F A;  4FSX A;  4F14 A;  1JEG A;  1NEG A;  4OMN A;  4PK4 A;  4OML A;  3EG9 A;  1PSF A;  1VQ9 Q;  5GJV B;  3JB9 F;  1T3L A;  2F2V A;  5KCO A;  2P84 A;  2GFU A;  4C92 F;  3M53 A;  3JCM X;  5J39 A;  3S3N A;  3CCS Q;  1Q81 R;  2JTE A;  2PVG B;  3X26 B;  1VQO Q;  1YWO A;  1ZUU A;  1VQK A;  2OTJ A;  2K2M A;  1PKS A;  2AZS A;  2K4Y A;  2WSC E;  5CAI A;  2FEI A;  5I22 A;  2GF7 A;  5HK0 A;  1M1K U;  4BDY A;  4OMQ A;  2O4X B;  1VQM A;  3UDC A;  3P8B B;  2RNA A;  2X35 A;  1LNX A;  1YCY A;  1TUG B;  1ZUK A;  3GNF B;  3OYY A;  1Q7Y U;  3H0H A;  2M9U A;  1I5L A;  2JMA A;  2WSF E;  4M77 D;  1GFD A;  2XHC A;  3M0T A;  2DK3 A;  5KE2 A;  1KFZ A;  1GFC A;  3QYH B;  1IB8 A;  4BI3 A;  3HTR A;  3X28 B;  2KRS A;  3E2U A;  4M7D G;  3VU3 C;  2RH2 A;  5IH2 A;  2L5Q A;  2FZC B;  3N5B B;  4C5E A;  4PJO F;  2DBK A;  3EG0 A;  3V8L A;  4BY6 B;  1B34 B;  3MKD A;  2X3X D;  4EMK A;  1VQ6 Q;  2K3Y A;  1VQL A;  1VQ7 A;  1WNL A;  2DKG A;  3SDZ A;  2LC4 A;  2CZ0 B;  3A8M B;  2QEX T;  3QHS A;  3QKJ A;  2G3R A;  4J5Y A;  2C0I A;  3CCR T;  1K9A A;  2KDS A;  1N5Z A;  1OU9 A;  2LVM A;  1S72 A;  1VIF A;  3G6E Q;  2JM9 A;  1GCQ A;  1M2O A;  3E9G A;  4N4I A;  2H8H A;  2GFA A;  1TU0 B;  3CCV A;  3M56 A;  4WCI A;  3RIR A;  4A4H A;  4WF2 A;  5LJ3 d;  2ZPI B;  1ACM B;  4FU6 A;  2RD1 A;  1KC8 C;  1BK2 A;  4CC4 B;  4M75 D;  3AT1 B;  3CME A;  1YIT A;  4FYX B;  4QQD A;  4PFZ A;  3MP1 A;  2RI2 A;  2DYB A;  2EVR A;  4XU3 A;  3X20 B;  2EGE A;  1Q86 R;  1ABQ A;  3LGL A;  3L1A A;  4KH1 B;  4C8Q G;  3OY9 A;  1VQN Q;  5IXF A;  4F17 A;  5GMK m;  3FEO A;  2K3B A;  2ZPB B;  1VQ8 T;  1JJ2 A;  1K0S A;  1OZ2 A;  3MO8 A;  1OQK A;  3OYJ A;  4V2S A;  1VQO T;  1BCO A;  1RLP C;  1SF9 A;  4RTY A;  4DBR A;  1VUB A;  2HEQ A;  1AZE A;  3JCM e;  5GAN h;  1D1A A;  2E5K A;  2MF2 A;  5GAO m;  1VYT A;  4KGX B;  1IHV A;  1NYF A;  1FYN A;  4HCB A;  1K0X A;  1WDX A;  2JS2 A;  4N4G A;  4M77 B;  1MMA A;  3JB9 H;  1FWZ A;  2JTM A;  1SG5 A;  2BZ8 A;  5GAN 4;  3CCL A;  3JCM J;  3CCQ Q;  2D8H A;  2COY A;  3CEY A;  2FRW A;  3MP6 A;  2HAX A;  3O8V A;  1RAI B;  4PJO D;  2KGT A;  4J6Y A;  5IAY A;  2O4X A;  4NS5 A;  2KEA A;  2F1L A;  1KC8 U;  3TCJ A;  5DM7 R;  1YIJ Q;  3OMG A;  3L42 A;  1B7T A;  4E2F B;  1VQ5 Q;  1EX4 A;  1JXM A;  1Q81 C;  3LH0 A;  5KYY B;  1AT1 B;  3I55 Q;  1C0M A;  2J06 A;  3HHT B;  1YNZ A;  1QW1 A;  1RI9 A;  2EJG A;  2DL8 A;  1VQP T;  1KQS S;  2DET A;  5CCA A;  3RMQ A;  1PD1 A;  2ZPH B;  1G2B A;  1MMN A;  2EQU A;  1CSK A;  2P4T A;  5FWB A;  4GY5 A;  5KCH A;  4LE9 A;  4KUI A;  4FYW B;  1JRI A;  1K73 C;  1TS9 A;  5FU6 C;  2YUQ A;  2RHU A;  1SHF A;  3QG1 A;  4O5V A;  1JU5 C;  4L5G A;  3JB9 I;  2M0O A;  1RI0 A;  1KQ2 A;  5GAO l;  1WXT A;  2CP5 A;  2J05 A;  4MMK A;  2DVJ A;  1SRL A;  3RUX A;  4BE0 A;  2LQW A;  3LGF A;  1T0H A;  1ZSG A;  2XMF A;  2HQX A;  5HCK A;  4F16 A;  2A0F B;  2BE9 B;  1B34 A;  2K7A A;  2MIO A;  2KBT A;  4M7A G;  2JNG A;  2CP2 A;  1PC0 A;  3WVE B;  3GIB A;  2JT4 A;  1N6A A;  1MV3 A;  4HCZ A;  2FVU A;  4M75 B;  1YHQ Q;  3C95 A;  4JS5 A;  2AKL A;  2D0N A;  5CQX A;  4PJM A;  3CCU A;  2DL7 A;  1GBQ A;  4E7J A;  4A53 A;  1JQQ A;  2RK2 A;  4NOY A;  2E10 A;  1YJ9 A;  4LD6 A;  2EPD A;  1D3B B;  4ZGJ B;  1WI7 A;  5FW9 A;  4IUP A;  5HKC A;  4RTU A;  1Q7Y R;  3G4S A;  1Q81 U;  4FT4 A;  2OI3 A;  2KYB A;  3QO3 A;  2LT4 A;  3MET A;  4NL3 A;  2EQI A;  2F69 A;  3QSU A;  4D8K A;  2QXF A;  4M78 G;  2BIV A;  2CRE A;  4C0D B;  3JSC A;  2CUB A;  3EG2 A;  1K73 U;  3I56 A;  2E1H A;  1M2V B;  3MPU B;  3RR6 A;  3M4Y A;  2RQV A;  2L3R A;  3V7R A;  2J6F A;  1BB9 A;  4Q5W A;  2D0Q B;  3URG A;  1Y57 A;  1UFF A;  2L2P A;  4LDV A;  3PIO A;  1RAD B;  3T9N A;  5KYU B;  2D1X A;  2LTO A;  4J9I A;  1YJN Q;  1H3H A;  1AWW A;  4RTV A;  3UAT A;  2LCS A;  2E65 A;  2QGG A;  2VB6 A;  2LQN A;  3SWN B;  3CD6 Q;  2ZCF B;  2AKK A;  1QP2 A;  3I55 T;  3LWH A;  1IHW A;  1D0X A;  2CS7 A;  4PNO A;  4M77 A;  4EPC A;  3MEA A;  1I0C A;  1R0B G;  4C5H A;  1VQK T;  2MYS A;  4MML A;  3ZBD A;  2RHZ A;  3BFM A;  2LJ1 A;  1YP5 A;  2MWP A;  4WTO B;  4KGZ B;  4PFP A;  1AOJ A;  1KHI A;  1G3S A;  1VQM T;  4FM4 B;  1WXB A;  5AYF A;  4J9B A;  3X25 B;  3ZEH A;  4IKF A;  4M77 C;  3LX7 A;  2JMC A;  4F7U B;  3JB9 G;  3I5R A;  5KYY A;  3MEW A;  3JCM Q;  1BI0 A;  4C92 G;  4ZTJ A;  4OB1 B;  2FPE A;  2L3S A;  1D0Z A;  2QYZ A;  4OF1 A;  1NLP C;  2P0P A;  4J9E A;  9ATC B;  4BI8 B;  1OPL A;  5FRN A;  1P92 A;  3FC3 A;  2X4Y A;  4PJN A;  1FMW A;  1PHT A;  2RI5 A;  2C0O A;  4L6V 5;  2EYY A;  2L3P A;  4PLI A;  1MUZ A;  3RER A;  1BI1 A;  1DJ7 B;  1BKB A;  2L3Q A;  1LCK A;  4XTU A;  1CKB A;  3ZL7 C;  4A63 B;  2DD5 A;  3A5Z B;  1VQ4 T;  2EWN A;  3PFS A;  4BB7 A;  1KD1 C;  2F5K A;  3R6N A;  4C0F A;  3JAM E;  2FZG B;  2XU8 A;  2CH4 W;  3VRZ A;  3QWY A;  2LNV A;  1K4U S;  3A8H B;  4LXC A;  1UJ0 A;  2DEU A;  3BY7 A;  1M4Z A;  4M75 A;  2DJQ A;  4XU1 A;  3H9N A;  3PMT A;  4Z89 A;  3VUB A;  2FO0 A;  4EMK B;  3VS2 A;  4LUE A;  4PJO G;  1BU1 A;  1WZO A;  4R56 A;  4LDY A;  4Y28 E;  1D3B A;  4M75 C;  1SSF A;  1NG2 A;  3OS5 A;  5LJ5 d;  3OYL A;  1RAC B;  1M3A A;  3QZ9 B;  5HY6 A;  3CME T;  3L2R A;  1YJN T;  4BE2 A;  4RTW A;  1X27 A;  1NPR A;  2IPO B;  1K8A C;  4J9G A;  4ELZ C;  3F70 A;  3LW5 E;  1WQW A;  2DX1 A;  1NZ9 A;  2COZ A;  2G6F X;  1M2V A;  4C0G A;  2LRQ A;  1MGQ A;  4M7D B;  3BW1 A;  1XJW B;  3G71 Q;  2KVQ G;  3JV3 A;  4F7U G;  1N9S A;  2DYI A;  5KYU A;  4RG8 A;  3U23 A;  2NUP B;  3E19 A;  1OV3 A;  2ECZ A;  4AFZ C;  1BIA A;  1JXO A;  2LX9 A;  1WHM A;  2O31 A;  1W2B A;  1VQN A;  2O01 E;  1PG5 B;  3NGP A;  2O88 A;  3CC7 A;  3M9Q A;  5LJ3 e;  1C6V X;  2JZ2 A;  1GL5 A;  3GF5 A;  3SWN A;  2RJD A;  3GLX A;  2XDD A;  3EFO B;  3S3M A;  3VS5 A;  1EFN A;  3TRE A;  4JRK A;  2FRY A;  5A0L A;  4JJN K;  3CCL T;  1PSE A;  1KQ1 A;  3LWI A;  2DFU A;  3P8D A;  1WFW A;  2QAZ A;  5GAN d;  2CH4 A;  4M7A D;  1QKW A;  2KRO A;  2KI7 A;  2MWO A;  2BTT A;  1D1C A;  5I21 A;  3RDV A;  2DIL A;  1A0N B;  3JCM g;  1UHF A;  4J6W A;  3CCQ A;  4F7U A;  1VQ8 Q;  3UA6 A;  4L59 A;  4KBM B;  1J3T A;  4KRT A;  4LUD A;  2QDY B;  5GAN 7;  2GBQ A;  3LYI A;  3QBY A;  1MV0 B;  1OPK A;  4MZT A;  3L2V A;  2CZ6 B;  4E6R A;  2QA4 A;  1GRI A;  2JJ9 A;  4PJJ A;  3M58 A;  3FRN A;  1VYV A;  1K8A U;  4JLI A;  1M3C A;  3VKI A;  3FIF A;  2RPN A;  1VQ5 A;  2W0Z A;  2YDL A;  4C8Q B;  1K73 R;  1TUC A;  1U8R A;  4OB2 B;  3OQ5 A;  4DQ2 A;  1RAH B;  4J7F A;  3M5A A;  4EMH A;  3SHW A;  2XD0 A;  1SEM A;  2HL3 A;  3UA7 A;  4FYY B;  4GBQ A;  3VYG A;  2QQ9 A;  2PTK A;  2DXT A;  2QTV A;  4LN2 A;  2ESW A;  2RQR A;  2A28 A;  4BD3 A;  2C06 A;  4M78 D;  1ZQ1 A;  4BUG A;  1GBR A;  1NE8 A;  3QDR B;  1H92 A;  2GGR A;  1ABO A;  5DLQ E;  5I2M A;  1W2B S;  3I9Q A;  3INZ A;  1K1Z A;  4M4Z A;  1ZBX A;  4MZP A;  3CCU T;  1VQP Q;  2HBP A;  1OOT A;  3O5Z A;  4JDS A;  5GAN 8;  3OYG A;  1I4K 1;  2L0A A;  3HFN A;  4KGV B;  3V7C A;  4J8O A;  5L8R E;  2VYT A;  2ZPG B;  2LT1 A;  1HSQ A;  5CKB A;  2LP5 A;  3G71 T;  3CCE A;  2CUD A;  3P8H A;  5EG2 A;  2MK5 A;  2K6D A;  4FW2 A;  4XU2 A;  5GAM d;  4EMK C;  1X2Q A;  2NUT B;  1O9S A;  3OYK A;  3JCM f;  1BCM A;  3H0I A;  3JCM c;  4PKC C;  3CCJ Q;  5KE3 A;  1N8R R;  4OP0 A;  4PL6 A;  4IUQ A;  4IUU A;  3I56 T;  3SD4 A;  1WJS A;  3MCA B;  3CC4 A;  2CZ1 B;  2EFI A;  3L2Z A;  5DY9 A;  4ZN1 A;  4M7D A;  2JUF A;  4HT9 A;  1GCQ C;  3VUZ A;  3JB9 D;  5CVI A;  1W2B P;  1G8X A;  4RG2 A;  1AWJ A;  4DBH A;  4C92 D;  3I35 A;  6AT1 B;  2NUP A;  1YI2 Q;  2LJ0 A;  1M30 A;  2ROT A;  1WLP B;  3OSV A;  4M7A B;  1JB0 E;  2HMA A;  1UEC A;  2WAC A;  2CKK A;  1ZLM A;  4M7D C;  2RN8 A;  4OVA A;  5IN1 A;  1I1J A;  8AT1 B;  3QPH A;  4HT8 A;  2HSE B;  3QII A;  3CCM A;  1TTH B;  4XTY A;  1YJW A;  3EFO A;  4A4K A;  2DIQ A;  3FB9 A;  1RL2 A;  3OA6 A;  4IUR A;  1TXQ A;  3PIP A;  1MMG A;  1UTI A;  2IVW A;  4YTL A;  2R5A A;  3SFM A;  3A1P A;  3LLR A;  2HNI A;  1QLY A;  4Z8A A;  3CD6 A;  4C0Z A;  4D6W A;  2RMO A;  5C0M A;  1QVF A;  1NM7 A;  1VYU A;  4TVR A;  2Y4X A;  3M55 A;  3R6O A;  5CQY A;  3RMS A;  1UGR B;  2O9V A;  2K5F A;  4D8D A;  4OGE A;  1FMK A;  2ROL A;  2JXB A;  5CKF A;  2QQS A;  4M78 B;  3CBP A;  3J80 E;  1NPP A;  4PFO A;  1VA7 A;  1OX9 A;  4HVV A;  3MP8 A;  2YWW A;  5D6W A;  4C8Q A;  1BIB A;  3CPW A;  2KSS A;  2HKN A;  4Y92 A;  1M3B A;  2M0Y A;  4ZN3 A;  4E47 A;  1RUW A;  3CPF A;  2RHI A;  4ATO A;  4KUD K;  2DNU A;  3G1J A;  1VQK Q;  1I07 A;  3HRS A;  2OTJ Q;  4C8Q C;  1OEB A;  2JTF A;  3EGU A;  5KYN A;  2GQI A;  1X6B A;  1KD1 R;  2AT1 B;  2EJ9 A;  1VQM Q;  2LCC A;  2FYK A;  2D8J A;  2CP7 A;  2M02 A;  3GP8 A;  3C12 A;  3PNW C;  2A3L A;  3JCM b;  2NYS A;  3MHX A;  1XTD A;  2DXB A;  3JCM V;  2K57 A;  3HL8 A;  3ULR B;  1VIE A;  1XNI A;  1UE9 A;  4DBQ A;  1C1A A;  1NBE B;  2BUD A;  1TG0 A;  2M1H A;  3CCJ T;  2DER A;  2DO3 A;  2GTJ A;  1JJ2 S;  4M7D F;  2ED0 A;  4KUL A;  3QJY A;  5IHN A;  2E4H A;  4QVC A;  5A0G A;  3HP9 A;  4A4F A;  3THK A;  2DAQ A;  4J9F A;  4CRI A;  1NYG A;  1UHC A;  4BY6 C;  1TH7 A;  5LJ3 j;  2RQU A;  4Z88 A;  3V8J A;  4C92 B;  2NUT A;  1M27 C;  3HFO A;  2E41 A;  1F1B B;  1YI2 T;  1E6G A;  2OJ2 A;  1QVF S;  5I2S A;  3CMA A;  1VQ4 Q;  2PUK B;  1HD3 A;  2HD0 A;  2CT3 A;  1K8A R;  2YUP A;  4NL2 A;  5FRM A;  2ATC B;  1UG1 A;  2HCK A;  2JS0 A;  3CC2 T;  2KY9 A;  3EH1 A;  3VYH B;  1N9R A;  4XTZ A;  3E9F A;  5LJ3 h;  5M9O A;  2DTO A;  4HCC A;  3M54 A;  3HKS A;  4HVW A;  5DLO A;  3CPW S;  1N8R C;  1S72 Q;  1M8M A;  1M90 R;  2ABL A;  2O2O A;  2OTL T;  4B9W A;  1M5Q 1;  2DL4 A;  4M7A A;  1LOJ A;  4Y91 A;  2QEX A;  2QI2 A;  2HQH A;  2KRN A;  2QG9 B;  1JJ2 P;  2HBW A;  2VVK A;  3CCR A;  1IXD A;  1CKA A;  2KT1 A;  2X4J A;  2VKN A;  2PUO B;  5CKH A;  1U06 A;  1SRM A;  1E7O A;  5LJ5 e;  4M7A C;  2H3E B;  3CME Q;  2ZPF B;  4AG1 C;  1YCS B;  2HDA A;  1UGV A;  3DLM A;  4PJO B;  1M8V A;  3VS6 A;  2QDL A;  1WX6 A;  1QVF P;  2E70 A;  3HSB A;  3M0S A;  1QQJ A;  2KAF A;  2YRV A;  2RJF A;  3DKM A;  4C5G A;  3ASK A;  2VGM A;  4VUB A;  3A8G B;  5GAN 3;  1I81 A;  4J7I A;  3HRU A;  1SKU B;  2RJC A;  2OTJ T;  3OYF A;  1OU8 A;  3BDU A;  5LJ3 g;  2V26 A;  2QA4 T;  2FPD A;  2DD4 A;  1VQ9 A;  3CPW P;  3J7A F;  4M78 A;  3PGG A;  1UB4 A;  4E7L A;  4E7I A;  5KYX B;  2ED1 A;  3VS4 A;  3C0C A;  5ECA A;  5GAO n;  3UF4 A;  1VQ8 A;  1MMD A;  1OI1 A;  3A8O B;  3RKY A;  3CCS A;  3QYG B;  8ATC B;  1QCN A;  2BE7 D;  1VQO A;  1KHC A;  2DBM A;  1FMV A;  2K79 A;  5LL6 S;  2V8K A;  2MAM A;  3CCL Q;  2KYM A;  4E7Z A;  4P5N A;  2E12 A;  2VV5 A;  4ZGD B;  2F2X A;  1N8R U;  1KG1 A;  3CXC A;  1WHK A;  2CDT A;  1RAB B;  2YSQ A;  2DLP A;  3G7Z A;  1YWP A;  5GAN e;  1Z9Q A;  3KBG A;  2DVE A;  4M77 E;  4E7S A;  2F5T X;  2A37 A;  3C4S A;  1AWO A;  2DZ9 A;  1AZG B;  4FSS A;  3OYI A;  4XU0 A; 
#chains in the Genus database with same CATH homology
 5GAN 2;  4M75 D;  2JVV A;  5GAN d;  2QTX A;  1X6O A;  2JOY A;  4RCB A;  3OS1 A;  4M7A D;  2CYZ B;  4II1 A;  3CME A;  1YIT A;  4QQD A;  2MWO A;  5GAM h;  3AHU A;  4QQ6 A;  3MP1 A;  3WXM B;  2RI2 A;  3A8L B;  5I21 A;  3OYH A;  2X4W A;  1NJI U;  4XU3 A;  2RHX A;  4N0A A;  3X20 B;  3NTK A;  3V8K A;  3JCM g;  4J6W A;  1VQL T;  1VQ7 T;  3CCQ A;  4F7U A;  3LGL A;  3L1A A;  3L2U A;  5HK3 A;  4C8Q G;  4L59 A;  4KBM B;  3OY9 A;  2K5L A;  1V29 B;  2QDY B;  5GAN 7;  3LYI A;  3QBY A;  4O6J A;  3ZFJ A;  4MZT A;  3L2V A;  4LD9 K;  5GMK m;  3FEO A;  5D6Y A;  1GXI E;  2ZPB B;  2CZ6 B;  1VQ8 T;  2QA4 A;  1JJ2 A;  3CCE T;  3M58 A;  3V7S A;  1OZ2 A;  3FRN A;  3MO8 A;  4MDW A;  3J81 E;  1K8A U;  4GLK A;  4JLI A;  3VKI A;  3FIF A;  3OW2 A;  3OYJ A;  4V2S A;  1VQO T;  3OBY A;  2LDM A;  4N0A C;  5A0D A;  4DOW A;  1HXD A;  3EAE A;  3OS0 A;  1VUB A;  1VQ5 A;  1VQN T;  1UEB A;  4C8Q B;  3CC7 T;  4MDX A;  1VQ6 A;  3JCM e;  5GAN h;  1S72 T;  4C92 A;  1U8R A;  3OMC A;  2MF2 A;  4OB2 B;  3G71 A;  3OQ5 A;  5GAO m;  4IUV A;  4DQ2 A;  5GMK e;  2VC8 A;  3OYD A;  4E7K A;  4J7F A;  2GCX A;  3M5A A;  4M77 G;  3CCV T;  4E7H A;  4EMH A;  3CCV A;  3SB2 A;  4XK8 E;  3JCM d;  2XD0 A;  2LCL A;  4EMG A;  5FU7 B;  5J26 A;  4JLG A;  5LJ3 f;  2QQ9 A;  3VYG A;  4HCB A;  4KT0 E;  2DXT A;  1WJQ A;  2YLB A;  4C8Q F;  2DJZ A;  4HA8 A;  4N4G A;  4C92 C;  4M77 B;  3JB9 H;  4BD3 A;  1FWZ A;  2JTM A;  3G6E A;  2C06 A;  4M78 D;  1ZQ1 A;  1WPY A;  2DTI A;  4BUG A;  4X9D A;  5GAN 4;  3CCL A;  5GAN f;  3JCM J;  1YIT T;  4LDW A;  1FXX A;  2PU9 B;  1NE8 A;  3QDR B;  3OYB A;  2LQ8 A;  3CEY A;  1N8R U;  1Y07 A;  3MP6 A;  2HAX A;  5GAM g;  3O8V A;  5DLQ E;  5I2M A;  1W2B S;  4PJO D;  4J6Y A;  3INZ A;  2L89 A;  3JRZ A;  2I2L A;  2GQV A;  2FL7 A;  2O4X A;  4NS5 A;  4XQ3 A;  5IAY A;  3CCQ T;  1M9S A;  3UPU A;  4M77 F;  1ZBX A;  2LQK A;  4MZP A;  4M75 E;  1Q86 C;  3TCJ A;  1KC8 U;  5DM7 R;  4Z02 A;  4A4G A;  4LDU A;  3OMG A;  3HRT A;  3OSS C;  3CCU T;  3L42 A;  2HBP A;  4JDS A;  3JCM h;  3OYG A;  5GAN 8;  4M7A E;  1Y71 A;  1I4K 1;  1R8O B;  1Q81 C;  3HFN A;  3LH0 A;  2P0Q A;  3CXC S;  3CCM T;  3V7C A;  3NFC A;  4J8O A;  1BYM A;  4B9X A;  3HHT B;  1QW1 A;  5L8R E;  2VUB A;  2VYT A;  3DB3 A;  1YIJ T;  2ZPG B;  2EJG A;  3JCM P;  1VQP T;  1KQS S;  2LT1 A;  1VQ5 T;  5CKB A;  5CCA A;  5GAM e;  3RMQ A;  1M90 C;  3M4G A;  3ME9 A;  2ZPH B;  3OYN A;  3H6Z A;  1OZ3 A;  2EQU A;  2JN0 A;  4C0D C;  3G71 T;  4M7D D;  2P4T A;  3CCE A;  2M16 A;  4GY5 A;  3P8H A;  5KCH A;  4BE1 A;  1G3W A;  4XTV A;  4KUI A;  2EQM A;  1JRI A;  5EG2 A;  1K73 C;  4XU2 A;  3GPL A;  5FU6 C;  1KD1 U;  4PJO A;  5GAM d;  3RKW A;  1H64 1;  2RHU A;  4EMK C;  5CO7 A;  1O9S A;  3FDR A;  3OYK A;  1EIF A;  2RM4 A;  3QG1 A;  2K2V A;  4O5V A;  4XTW A;  4M78 C;  3JCM f;  3Q1J A;  4L5G A;  4XTX A;  2M0O A;  3JCM c;  3JB9 I;  4BDZ A;  1RI0 A;  1KQ2 A;  5GAO l;  4PKC C;  4MMK A;  4JUV A;  5KE3 A;  4JRQ A;  1Q82 C;  3C94 A;  4DOV A;  4OP0 A;  1UGP B;  2MI6 A;  3LGF A;  4IUQ A;  4IUU A;  4PL6 A;  3RUX A;  4BE0 A;  3I56 T;  3HPW A;  3MEV A;  2OAU A;  2HQX A;  2ZPE B;  3E1S A;  1WJS A;  4OMF B;  3SD4 A;  3OYC A;  4PJO C;  4RKU E;  3MCA B;  3CC4 A;  1IRE B;  2CZ1 B;  2EFI A;  3WVD B;  3L2Z A;  4M75 G;  1B34 A;  5DY9 A;  4M7A G;  4ZN1 A;  3L2Q A;  4M7D A;  2JUF A;  2FB7 A;  4HT9 A;  1MHN A;  3OW2 S;  2JNG A;  1JBM A;  3VV0 A;  3VUZ A;  4X9C A;  3WVE B;  3JB9 D;  2VGN A;  3CBO A;  3SWN C;  2IG0 A;  5CVI A;  3GIB A;  2FHD A;  4RG2 A;  1Y7X A;  1N6A A;  4M78 E;  5KH6 A;  4C92 D;  1K9M C;  4HCZ A;  3FJP A;  2FVU A;  4M75 B;  3C95 A;  3OSV A;  4M7A B;  1JB0 E;  4QVD A;  4JS5 A;  3CBM A;  2WAC A;  2CKK A;  4C5I A;  5CQX A;  2P0K A;  4M7D C;  5IN1 A;  4OVA A;  4J83 A;  1UGQ B;  2K5I A;  3KXT A;  1YHQ T;  3GOX A;  3CCU A;  3QPH A;  2PVD B;  4E7J A;  4HT8 A;  3QII A;  4A53 A;  2RK2 A;  2R5M A;  4NOY A;  3CCM A;  4OGC A;  2E10 A;  1HK9 A;  1YJ9 A;  5GAO r;  1W4S A;  4LD6 A;  4XTY A;  1YJW A;  1D3B B;  4A4K A;  2V8J A;  4M75 F;  1YIJ A;  4ZGJ B;  2CZ7 B;  2DIQ A;  3FB9 A;  4M7A F;  2V8I A;  1VQP A;  4IUP A;  2K3X A;  1RL2 A;  3OA6 A;  5J3B A;  5HKC A;  4IUR A;  5GAM f;  1Q86 U;  1UGS B;  3JB9 J;  3I55 A;  3PIP A;  4UC4 A;  2IVW A;  4YTL A;  1U1T A;  3G4S A;  1Q81 U;  2R5A A;  3SFM A;  3DLL A;  4FT4 A;  3LLR A;  2HNI A;  3QO3 A;  3CD6 A;  2LT4 A;  2XKO C;  2H3J A;  3MET A;  4C0Z A;  4NL3 A;  3EFS A;  3QUI A;  4CI0 C;  2F69 A;  2E5Q A;  4D6W A;  2NLU A;  2VXE A;  3OYE A;  4C8Q D;  4ME7 A;  5C0M A;  3S3O A;  1X01 A;  3QSU A;  2E64 A;  1O75 A;  5CIU A;  2QXF A;  1M90 U;  2XDB A;  1LJO A;  1QVF A;  3CC4 T;  4ZTF A;  4M78 G;  2BIV A;  4TVR A;  2Y4X A;  3GNG A;  4C0D B;  1X75 C;  1G3T A;  2MMP A;  3JSC A;  3M55 A;  3R6O A;  4HKE A;  5CQY A;  3RMS A;  1K73 U;  1UGR B;  1WGS A;  2XI9 A;  3I56 A;  2E1H A;  4A54 A;  2R57 A;  2K5F A;  5FU6 B;  1H3Z A;  3M4Y A;  4OGE A;  4F7U E;  2XID A;  2L3R A;  3CCJ A;  5GAN 6;  3V7R A;  5CKF A;  4Q5W A;  2QQS A;  2D0Q B;  3CBP A;  4M78 B;  2DIG A;  3J80 E;  3URG A;  4LDV A;  1NPP A;  3PIO A;  1Q82 U;  3UWN A;  2DEQ A;  3T9N A;  1Y96 B;  2E6Z A;  5IT9 E;  3MP8 A;  2LTO A;  5D6W A;  2E6N A;  4C8Q A;  1BIB A;  5CK9 A;  3CPW A;  2KSS A;  1ZHI A;  4OB0 B;  3CMA T;  2QQA A;  2EQJ A;  4C92 E;  2A7Y A;  1YJ9 T;  3MEU A;  4ZN3 A;  1YJW T;  4E47 A;  4M78 F;  5GAO q;  5LJ5 j;  3CPF A;  2E65 A;  2RHI A;  2HQE A;  5CKD A;  4ATO A;  2EIF A;  1YI2 A;  2DXC A;  4KUD K;  1YHQ A;  2PQW A;  5C6S A;  2QQR A;  4QQG A;  3SWN B;  3HRS A;  1M1K C;  2ZCF B;  1K9M U;  1BI2 A;  3JCM W;  1QP2 A;  3I55 T;  4C8Q C;  3LWH A;  2JTF A;  2CS7 A;  4PNO A;  4X34 A;  4M77 A;  4EPC A;  3G4S T;  3MEA A;  2EJ9 A;  4C5H A;  2EQK A;  2LCC A;  4OB3 B;  3CD6 T;  1Q7Y C;  1VQK T;  1VQ4 A;  3CC2 A;  1XOV A;  2FYK A;  4MML A;  2RO0 A;  3ZBD A;  5GAO p;  2RHZ A;  2X4X A;  3BFM A;  3GP8 A;  3C12 A;  3M57 A;  2MWP A;  2A3L A;  3PNW C;  5FU7 C;  3JCM b;  4LDX A;  3MHX A;  1XTD A;  1KHI A;  1G3S A;  2DXB A;  2K57 A;  4FM4 B;  3HL8 A;  5AYF A;  3JCM V;  1VQM T;  3NTI A;  3X24 B;  3TU4 K;  5LJ5 h;  1VIE A;  2L8D A;  1XNI A;  3X25 B;  2AHJ B;  3ZEH A;  4IKF A;  4M77 C;  2BUD A;  5CR2 A;  1QVG A;  2M1H A;  4R55 A;  3OYA A;  3LX7 A;  1QVP A;  3CCJ T;  2OTL A;  3OB9 A;  4F7U B;  2DO3 A;  3JB9 G;  1JJ2 S;  4M7D F;  2QQB A;  3VJP A;  3ER0 A;  4KUL A;  3MEW A;  3QJY A;  2VXF A;  1BI0 A;  4MZM A;  3QXE B;  3JCM Q;  3NTH A;  4C92 G;  4PLL A;  4ZTJ A;  4OB1 B;  4QVC A;  5A0G A;  4RCC A;  5A2Q E;  1WQ7 A;  3HP9 A;  4OF1 A;  4A4F A;  2DAQ A;  4ELY C;  3S6W A;  1M1G A;  2P0P A;  1I8F A;  2B8A A;  2D6F A;  4JS4 A;  4CRI A;  3UT1 A;  4BI8 B;  2RJE A;  5FRN A;  1KQS A;  1KG1 A;  2RK1 A;  1TH7 A;  3EFR A;  1P92 A;  4BI4 A;  4BY6 C;  4F7U F;  5LJ3 j;  2X4Y A;  3V8J A;  4C92 B;  3FC3 A;  3DB4 A;  2RI5 A;  2ZZD A;  3HFO A;  4PJO E;  1M1F A;  2E41 A;  4FSX A;  4L6V 5;  1YI2 T;  4PLI A;  1QVF S;  5I2S A;  3CMA A;  3RER A;  1BI1 A;  3QJ6 A;  2PUK B;  1DJ7 B;  1BKB A;  2EJF A;  2EKO A;  4XTU A;  2HD0 A;  1YJN A;  1PSF A;  3PTA A;  2DPP B;  3JB9 F;  5GAN j;  4NL2 A;  1BI3 A;  2DD5 A;  5FRM A;  3CC2 T;  3A5Z B;  1VQ4 T;  2KY9 A;  2EWN A;  3PFS A;  5KCO A;  4BB7 A;  5GMK i;  1KD1 C;  2GFU A;  2F5K A;  4C92 F;  3M53 A;  2RA2 A;  4C0F A;  5J39 A;  3H8Z A;  3VYH B;  3JCM X;  2KQW A;  3JAM E;  4QW2 A;  3RES A;  1VQ9 T;  1N9R A;  5GAN 5;  2XU8 A;  4XTZ A;  3S3N A;  3E9F A;  2PVG B;  3X26 B;  1QP3 A;  5LJ3 h;  5M9O A;  2DTO A;  2LNV A;  4HCC A;  3M54 A;  1VQK A;  4M7D E;  2OTJ A;  3HKS A;  3A8H B;  2XK0 A;  5DLO A;  2K4Y A;  2WSC E;  5CAI A;  3BY7 A;  3CPW S;  4FT2 A;  1N8R C;  5LJ5 g;  2GF7 A;  3L2W A;  3CCS T;  2BKD N;  1M4Z A;  5HK0 A;  4M75 A;  1M1K U;  2OTL T;  4B9W A;  1M5Q 1;  4BDY A;  2Y90 A;  1VQM A;  2O4X B;  1WJR A;  3UDC A;  4M7A A;  1LOJ A;  4XU1 A;  3P8B B;  4Y91 A;  2QEX A;  4BAC A;  2QI2 A;  1OYX A;  2X35 A;  1LNX A;  3PMT A;  1YCY A;  3GNF B;  2DZC A;  3CCR A;  3OYY A;  3M59 A;  1Q7Y U;  3VUB A;  4QVZ A;  2M9U A;  4EMK B;  1I5L A;  2WSF E;  2X4J A;  2KMT A;  4PJO G;  2D9T A;  4R56 A;  5FLX E;  4LDY A;  2PUO B;  5CKH A;  4M77 D;  1YBY A;  4Y28 E;  4JRP A;  1D3B A;  4M75 C;  5LJ5 e;  1SSF A;  2XHC A;  4M7A C;  1NJI C;  2KK4 A;  2ZPF B;  5FRO A;  5GMK j;  1FX7 A;  3DLM A;  2DK3 A;  4PJO B;  1M8V A;  3OS5 A;  5KE2 A;  4FL6 A;  5LJ5 d;  3OYL A;  2E70 A;  3HSB A;  2CGH A;  3QZ9 B;  5HY6 A;  2DXU A;  2KAF A;  3CME T;  2YRV A;  3QYH B;  2RJF A;  3DKM A;  4C5G A;  3L2R A;  2RHY A;  1YJN T;  4BI3 A;  3ASK A;  2VGM A;  3X28 B;  2RI3 A;  2RB6 A;  4BE2 A;  1QVG S;  3FLG A;  4VUB A;  4M7D G;  3VU3 C;  3A8G B;  1NPR A;  2RH2 A;  5GAN 3;  4DA4 A;  1K8A C;  3PMI A;  2L5Q A;  1I81 A;  2YLC A;  3F70 A;  4ELZ C;  4J7I A;  3LW5 E;  1WQW A;  3N5B B;  4XAX B;  4C5E A;  1G3Y A;  4PJO F;  3HRU A;  1G5V A;  1NZ9 A;  2RJC A;  2YHT A;  2OTJ T;  3V8L A;  4BY6 B;  1B34 B;  3OYF A;  4C0G A;  4EMK A;  3BDU A;  5LJ3 g;  2LRQ A;  1MGQ A;  5GMK h;  4M7D B;  3BW1 A;  2K3Y A;  4FIB A;  1VQL A;  2QA4 T;  1VQ7 A;  2EAY A;  2DTH A;  2KVQ G;  2DD4 A;  1VQ9 A;  1WNL A;  4M78 A;  4F7U G;  3J7A F;  3PGG A;  2DKG A;  3SDZ A;  1UB4 A;  2LC4 A;  4E7L A;  4E7I A;  1N9S A;  2CZ0 B;  3A8M B;  2QEX T;  3RKX A;  3QHS A;  3QKJ A;  1Y96 A;  1VQ6 T;  4RG8 A;  2G3R A;  4J5Y A;  5GAO n;  3PT9 A;  3E19 A;  3A8O B;  1OI1 A;  3CCR T;  5GMK l;  3QZ5 B;  1VQ8 A;  3RKY A;  1BIA A;  5GAN g;  3CCS A;  2LX9 A;  3QYG B;  2KDS A;  2LVM A;  1VQO A;  5CKE A;  1W2B A;  1AHJ B;  2PVO B;  2XIC A;  1KHC A;  4A4E A;  4C8Q E;  2R58 A;  1VQN A;  2O01 E;  3OS2 A;  3CC7 A;  3M9Q A;  4JRI A;  5LJ3 e;  4N4H A;  1S72 A;  1VIF A;  5LL6 S;  1N27 A;  3KUF A;  2JZ2 A;  2V8K A;  2EYQ A;  2ZGW A;  5GAM j;  2MAM A;  3E9G A;  4ZGE B;  4N4I A;  4EDU A;  2XDP A;  2GFA A;  2Y4Y A;  4P5N A;  2E12 A;  2VV5 A;  3GF5 A;  5D6X A;  3BDL A;  3M56 A;  2RJD A;  3GLX A;  3RIR A;  3SWN A;  4ZGD B;  3OBW A;  4A4H A;  2XDD A;  4WF2 A;  5LJ3 d;  3CXC A;  3S3M A;  2ZPI B;  2XG8 D;  3G6E T;  4FU6 A;  3TRE A;  1XQH A;  1IZ6 A;  2RD1 A;  4JRK A;  4IUT A;  2WSE E;  3G7Z A;  3TEE A;  1KC8 C;  5A0L A;  4JJN K;  3OYM A;  1U1S A;  5GAN e;  3CCL T;  3KBG A;  1PSE A;  5LJ5 f;  2DVE A;  4J6X A;  4M77 E;  2F5T X;  1KQ1 A;  3C4S A;  3LWI A;  2DZ9 A;  3P8D A;  4RMO A;  3OYI A;  4XU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...