1PSEA

The three-dimensional solution structure of psae from the cyanobacterium synechococcus sp. strain pcc 7002: a photosystem i protein that shows structural homology with sh3 domains
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
AIERGSKVKILRKESYWYGDVGTVASIDKSGIIYPVIVRFNKVNYNGFSGSAGGLNTNNFAEHELEVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM I ACCESSORY PROTEIN E
publication title Three-dimensional solution structure of PsaE from the cyanobacterium Synechococcus sp. strain PCC 7002, a photosystem I protein that shows structural homology with SH3 domains.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Photosystem i
total genus 7
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1994-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1pseA00
4ZGJB 1DJ7B 2ZPBB 3QYHB 3LW5E 4OB3B 2ZCFB 2O01E 4OB1B 4RKUE 1QP3A 3VYGA 2ZPFB 3WVDB 4ZGEB 1QP2A 4FM4B 4L6V5 1GXIE 2DPPB 3A8HB 1UGRB 3QYGB 2CZ7B 2AHJB 3WVEB 4OB0B 2ZPGB 1UGPB 2DXCA 3A8OB 2CYZB 3QXEB 1AHJB 3QZ5B 2DD5A 3X24B 3A8LB 5L8RE 3A8MB 2DXBA 2QDYB 2WSEE 3VYHB 1V29B 4ZGDB 4XK8E 2ZPIB 3A8GB 2ZPHB 2DD4A 2WSFE 4KT0E 1PSEA 2PUKB 2CZ0B 2WSCE 1UGQB 3X25B 4Y28E 2PVOB 1JB0E 2CZ6B 1PSFA 3X28B 1UGSB 2CZ1B 1IREB 2PVGB 2PUOB 2D0QB 2PU9B 2ZZDA 3QZ9B 3X20B 2PVDB 2ZPEB 3HHTB 4OB2B 3X26B
chains in the Genus database with same CATH superfamily
1SRMA 4JS4A 4AFQC 4CC4B 4IUPA 3PFSA 1YHQT 4C92B 4ELZC 4JJNK 4ATOA 3C95A 1T0JA 2OAWA 4LNPA 5DLQE 1O75A 5KH6A 1R0BG 1QW1A 2MAMA 1G3YA 2RD1A 2KQWA 3THKA 4IUQA 1ABQA 2L3QA 1TXQA 4JJCA 1NLPC 2O9SA 3BY7A 5IXFA 1YI2T 4BI8B 2NLUA 2RHUA 4JUVA 1NZ9A 1JJ2A 1Q86C 1UGRB 4B9XA 3PT9A 3HSBA 1VQOQ 1K9MR 1ZUYA 1JQQA 4F14A 1M2VA 3GF5A 4XTWA 3M53A 3SHWA 4PJOA 2KEAA 2AT1B 2QTVA 4A63B 2CREA 2YHTA 2JM9A 1VQ4Q 2KYMA 2GQIA 3RKXA 3EFOB 4HT9A 1VQ6T 5CKFA 4M75D 5FRMA 1UTIA 1KIKA 3OYJA 2GNCA 4M78G 3CC4T 1TU0B 2HQEA 4C92F 2ROTA 2E5QA 5IH2A 1Q81C 1VA7A 2ZPHB 1RAFB 5KCHA 2V1RA 2H3JA 1PSEA 3V8KA 4JJBA 2RHIA 4BD3A 1EZZB 1AWWA 1WGSA 1WHMA 4OMLA 2DXTA 2KT1A 1T3SA 1QCFA 2GFAA 1HJDA 3GIBA 4EMKB 2JN0A 1AZGB 3QG1A 4A53A 4OVAA 1PD0A 2DETA 1U1SA 2IVWA 3IQLA 2BUDA 2LQKA 3TEEA 2H8HA 2HQXA 1Q7YU 4RTYA 2RHYA 2FPDA 3HKSA 2RQRA 2ZPBB 4C92C 3RESA 2J06A 3NFCA 4VUBA 2CP7A 1YHQA 1K4US 1K8AR 3M4YA 2CSIA 5GAOm 1WHGA 4NOYA 3G6ET 5I2MA 3V8LA 4QQ6A 2LCCA 1VQ4T 4OB1B 2E41A 3PE0A 2RJCA 1M90C 2D8JA 2DL8A 5GANh 3SWNA 1YI2A 2DPPB 3QWXX 4Z02A 1K73R 3OYFA 5GAN4 2CZ7B 1B7TA 4LN2A 1MMGA 1WQWA 2CUDA 2KNBB 3JCMd 2OTJQ 2OJ2A 2RA2A 1M2VB 5CQXA 2DVJA 4PJOB 4C0ZA 1I07A 1M8VA 4J5YA 2YDLA 3QIIA 4M75E 1ZUKA 3P8BB 1W70A 5LJ3h 5L8RE 2O88A 3GBQA 1U3OA 1M1KC 2D0NA 1LPLA 3NMZC 3CC4A 1D0ZA 2QDYB 3UATA 3M58A 1G3SA 4Z89A 1X01A 2WACA 3CCQA 3RIRA 1UJYA 3LX7A 4BE2A 2HL5C 1W4SA 1NPPA 1KC8U 1ZBXA 1QMCA 4FW2A 5GANg 2QGGA 5GAMd 1PM3A 5I2SA 2HBPA 1E6GA 3GLXA 2V1QA 5A0LA 2CZ6B 4EMKC 4M7DE 2Y90A 1M2OA 2RK1A 1KQSA 1JJ2P 3HTRA 1KFZA 1ACMB 4PJOF 2EIFA 5LJ3g 2RJDA 3OYIA 1Q82R 3FIFA 4XTYA 2XI9A 1I0CA 2A0FB 4DOVA 2R5AA 2DRKA 3J81E 4L5GA 4HVVA 3C94A 4A4EA 1D1AA 1J3TA 4HVUA 1Y7XA 5D6XA 1K9AA 2E10A 1I8FA 1VQ9A 2DK3A 1O9SA 1YFNA 2AKKA 2C0IA 2RI2A 4FSSA 5CKHA 3JB9G 5HK3A 4M7AD 4ZTJA 2RHXA 4F7UG 1KD1C 4OB0B 2QEXQ 3OBWA 1YJ9T 4J9CA 5DY9A 4PJOC 4PK4A 2QAZA 4RUGA 3INZA 1M4ZA 1MMNA 1D0YA 4Y92A 1YCSB 4C8QD 2DERA 3NHNA 3EFRA 2QQRA 3GP8A 2JMCA 1XTDA 4QVDA 1YJNQ 3RNJA 1GCPA 2DMOA 3KFVA 2LDMA 3CCVQ 4PJMA 3META 1QLYA 2VXFA 1K8AU 4FW1A 2VASA 2DL3A 1YIJA 2QI2A 1FYNA 4BACA 1JU5C 4M75A 2EPDA 2DILA 3EGXA 3AT1B 3CCLQ 4E7KA 1HXDA 2EGAA 3OYDA 4CC3A 3JB9H 2EYXA 3WXMB 3MEAA 2ECZA 4FU6A 4C5EA 2Y4XA 2K9GA 1JJ2S 5GAOn 3RR6A 3CCRQ 3I55A 4EDUA 2MOXA 4C92E 5C6SA 2EJGA 2K57A 1ZBJA 4CC2A 1Q86R 1NG2A 2COZA 3OS1A 4M7DA 1QCOA 1RABB 2CP2A 1CKBA 1D0XA 1SF9A 4QVCA 2GQVA 2BE7D 3CPWA 2OTLA 3HRUA 1S72Q 2DZ9A 4HKEA 2CP0A 4C5IA 1YJNT 3ER0A 1BCMA 3JCMh 3RKWA 2MMPA 2E3IA 1G3WA 2PTKA 4M7AE 1IRXA 4QQGA 3OW2P 5FWCA 2RHZA 3CCSA 4KUDK 2L3PA 3JCMQ 2MCNA 1YJ9A 3NTKA 1KHCA 1Q81R 3JB9I 2YLBA 1RLPC 2CYZB 5CKEA 1PD1A 1PKSA 5LL6S 4M77G 3QSUA 2YRDA 4XTXA 1KQSP 3A8LB 3CCLT 1TS9A 1AWOA 1OU9A 3PIPA 5GAOr 5GAOl 3DB3A 1UEBA 3QJYA 4HCZA 4ZGDB 1Q82U 5CR2A 4BY6B 1VQKT 4IUVA 3VJPA 2KXCA 2R5MA 1U8RA 5J39A 2NYSA 5GAMh 5HCKA 2DTOA 3CCRT 2MPXC 1LVKA 4E47A 2KSSA 2P4TA 1JEGA 4HA8A 2D1XA 4V2SA 1QCNA 2K3BA 3JCMg 1WHJA 4D6WA 4M75B 4RTXA 4XU3A 1OZ3A 2RN8A 1RI0A 3EGXB 3DLMA 2KYBA 4AMCA 3S3MA 1NEGA 4PL6A 4XAXB 5KE3A 4HT8A 1YP5A 1R77A 2E3HA 3MEWA 1VQ8T 5D6WA 4X34A 2K4YA 1WNLA 4B9WA 1M90R 3L2QA 2FVUA 3QYHB 1LNXA 3CMEA 1B3QA 2QQBA 2ED0A 1NYFA 3ULRB 1BYMA 2A08A 1I4K1 2CS7A 1HK9A 3CCEA 2LNHB 1NEBA 1IB8A 5GAMg 4JRIA 1G2BA 4ZTFA 1WPYA 4J7FA 2J05A 3MP1A 4PFOA 1QP2A 1XQHA 2EJ9A 3TSZA 3A1PA 3OYHA 1M1KR 4M75F 2XIDA 2XDDA 2I0NA 3H6ZA 3OMGA 4QKUA 3QO3A 3JCMX 3OW2S 1VQMA 1GL5A 1VQ7A 1XNIA 2HD0A 2EKHA 3OYLA 4JS5A 1VQLT 2CT3A 1OI1A 2HBWA 5AT1B 4E7JA 5GAN5 2K5FA 3NTIA 1KQSS 4UC4A 3OA6A 2A28A 5I22A 2DBKA 4DEYA 2YT6A 2V8JA 4M7AA 1BB9A 1V29B 4BY6C 1D1CA 1OPKA 2WSFE 4E7IA 1OYXA 2K6DA 1ZA2B 2VGMA 5GMKm 4JRKA 1N6AA 3GPLA 4HVWA 1OX9A 1FMKA 4WCIA 4Y28E 1KG1A 4M75C 4XQ3A 1GCQA 1MMAA 2LJ0A 2J6KA 2K5IA 3CC2T 2CP6A 5EC7A 5GAN2 3T9NA 4C5HA 1X43A 2KI7A 3CPWP 1UGSB 3CC7Q 1UHFA 4XU0A 2JZ2A 1C0MA 2C0OA 3I56T 2EYQA 5KYWA 1QKXA 1AVZC 1BI2A 4XTZA 2RQUA 4MZMA 3E9FA 2FPEA 4KRTA 4OMQA 4DA4A 2FZCB 2DE0X 2LJ3A 1TUDA 2VWFA 4B6MA 2EVRA 3MO8A 4FCYA 5D7UA 4FT4A 1UG1A 1WXUA 2CH4W 3LH0A 4C5GA 3MPUB 2DEUA 1H641 3O8VA 2AIRB 2F69A 3VYGA 3CD6T 1Z9QA 2QG9B 3OY9A 3U23A 4ZGEB 4FM4B 3CBPA 1WQ7A 1X2QA 2HMAA 4RTVA 3VS5A 2NWMA 4ORZA 5FU7B 4IUTA 3OYBA 3M4GA 4RCCA 4DBFA 2M0YA 2VGNA 1KQ2A 4M78D 3OYKA 2PZ1A 1VQLA 3OMCA 3VU3C 3L1AA 4JPBW 2VC8A 1ARKA 4LUEA 2KE9A 1UE9A 4AT1B 3CC7T 2VV5A 2ABLA 3VYHB 1V1CA 4JJDA 4M7AB 2DZCA 2FZGB 4J8OA 4M4ZA 1M90U 2EGCA 4PJJA 2JTFA 3CMAA 2FL7A 1T0HA 5HY6A 5GANe 3G4SA 2XD0A 4R55A 2LJ1A 3F70A 3URGA 2GFUA 2CUBA 2D6FA 2J7IA 1M1FA 3EHRA 1YNZA 2RI5A 3HRTA 1YJWQ 2FG0A 4QQDA 3OYGA 2GTJA 3CPWS 2AK5A 3I56A 4YTLA 2JNGA 1M1KU 5KYWB 3CCMQ 2KMTA 5LJ3e 1VQ9Q 1N5ZA 5IHKA 4CC7A 2RJEA 5GAOq 3CEYA 1RL2A 2A37A 1B34A 5GAOp 1PKTA 2K2VA 3LGFA 1GBQA 3MEUA 3A5ZB 2MYSA 2MI6A 2V26A 2ZCFB 1TG0A 4M7AF 1GFDA 3A98A 1K76A 3EG1A 3CCJQ 2FPFA 1VIFA 1BIAA 2DIGA 1BCOA 3RKYA 5FU7C 1ZA1B 2AZSA 2IIMA 4BE1A 3ZFJA 3QYGB 1VQOT 3E1SA 5GANj 4C8QF 3LLRA 4ME7A 3CQTA 4HCKA 2GBQA 2YRVA 5M9OA 1AHJB 2M16A 3ZL7C 1YIJQ 1UGVA 2JTEA 1MHNA 2JVVA 3RBBB 3VS0A 2ATCB 2BIVA 1YJWT 3C0CA 4M7AC 3QKJA 1P92A 3EG2A 5LJ3j 2LT1A 4RTWA 4HCBA 4XK8E 2DKGA 1IHVA 2QGFB 3FLGA 4KT0E 3QDRB 3OSVA 2VB6A 2X4WA 5GANf 2G6FX 4M7DG 3P8HA 1HD3A 2YXYA 2CZ0B 1OPLA 4OGCA 3UF4A 3JCMP 3OSSC 3V8JA 1KD1U 1GCQC 2FB7A 1VQ6A 3RERA 4PFPA 1ZUUA 1E6HA 2J6FA 3VS3A 3HRSA 1U1TA 4IURA 2QXFA 2BE9B 4DBRA 5GMKi 2PVGB 2P4RA 2EWNA 2P0QA 3QZ9B 3MEVA 5LJ3f 5FU6B 4A4KA 3CCJT 2LCLA 4FYYB 4BI3A 2EFIA 1I81A 3OW2A 2P84A 1C1AA 2RMOA 5A2QE 3VRZA 4LE9A 5CCAA 3M0PA 3L2ZA 4J9IA 3FJPA 2JUFA 1B34B 2LT4A 1NJIC 2CH4A 2ESWA 4J9GA 4NL3A 2CP3A 3JB9D 4AFUC 2RNAA 1N8RC 1K9MU 1YITQ 3CBOA 3EGDA 2O2OA 2JS2A 2ENMA 4F17A 4CRIA 2FEIA 1Q7YC 2AHJB 2OTJT 2O9VA 5FRNA 1VQPQ 4II1A 3G6EA 2XU8A 1FWZA 5CVIA 1M1GA 1IGQA 1VQ4A 1T3LA 2X3WD 2X51A 4NS5A 1TTHB 3L2VA 3OYAA 1WXTA 3X24B 5I21A 2G3RA 1VQ5Q 4WTOB 2JM8A 3A8MB 4KUIA 2K3YA 1YN8A 4J6WA 3V7RA 2MIOA 5LJ5d 4N0AA 4AFSC 4KBMB 2HDAA 3QJ6A 3VS7A 3AHUA 2C06A 2AZVA 4KGVB 2WSCE 1CSKA 1UDLA 5CIUA 5HKCA 3JCMe 4CI0C 1JB0E 2ZAEA 4DBQA 2P0PA 1AEYA 2EQUA 3CCUQ 5KE2A 4C92G 4LDXA 2E5KA 3VRYA 4FIBA 2ZZDA 5FU6C 3X20B 1YITT 2VXEA 4QW2A 3JAME 3I35A 1WZOA 2EQKA 2QA4Q 1UJ0A 4J83A 1KC8C 2EYYA 1I5LA 2M51A 1YWPA 1VQPT 8ATCB 2EBPA 3H0HA 1R8OB 2F2WA 1AOJA 1TH7A 5GAMe 1X69A 2O01E 1K73U 1QP3A 3TVTA 1D1BA 4ELYC 4JLIA 5J26A 4R56A 4Z8AA 3OS2A 1KSWA 1SPKA 4F7UE 3EGDB 4Q5WA 1UHCA 2MWPA 1SRLA 4EMHA 2QK0A 2E64A 3RMQA 1HSQA 2OTJA 4M77D 2QEXT 4N4GA 3JCMW 3PTAA 3BFMA 3G71Q 2RQTA 1VQNQ 2YWWA 4FYXB 1YBYA 1UECA 1NBEB 5CQYA 3H41A 3V7CA 4LDYA 1RADB 4AG2C 4RTZA 2DYIA 2JJ9A 1NM7A 9ATCB 3EFSA 2MK5A 2LCSA 3CCVT 4RTUA 3S3OA 2KK4A 3JV3A 3TU4K 2HCKA 2E6NA 2ZPIB 2DJZA 2YSQA 2X4JA 4EPCA 2F2VA 4KULA 2QA4T 3JCMf 4ESRA 1RI9A 2YUOA 4M78B 1X6OA 3ME9A 2JOYA 1SHFA 1PRLC 5GAMj 4C8QE 2KAFA 1AZEA 2KT8A 2L3SA 2QQ9A 2KVQG 4R0KA 2OAUA 2GF7A 2HNIA 4O6JA 4WF2A 3FRNA 2KGTA 3SB2A 1BI1A 2ZPEB 4FSXA 3CPFA 3TREA 4ZGJB 2GTOA 1M3BA 2W10A 2E4HA 1V76A 1EFNA 1EIFA 2LQWA 3HFOA 3EH1A 3M5AA 5GAMf 3G71T 1JRIA 1VYVA 3BDUA 4FYVB 1VQNT 2QDLA 2FHDA 3SEMA 2XKOC 2MF2A 1MMDA 3JCMV 2KRSA 2EQJA 3KXTA 1S72T 1MGQA 4P5NA 4A4GA 4PJOG 3M9QA 4DBHA 4X9DA 5GMKh 1TOVA 3S3NA 3M0QA 4M78F 5I11A 3LH5A 4JZ4A 1D09B 1LJOA 1ZSZB 2NUPA 2QYZA 4M77E 1Y57A 2CKKA 5LJ5j 2DXCA 1OQKA 1W1FA 1EX4A 3BDLA 2V8KA 5C0MA 2X9HA 3JB9J 4AFZC 1RAGB 3VS1A 4F7UA 5IHNA 2XMFA 3M0RA 1YJNA 1VYUA 2HSEB 4HCCA 5LJ5h 4C0GA 1ABOA 2W0ZA 4N0AC 2JXBA 2M0OA 1I1JA 2DX1A 4J9DA 2L3RA 1WYXA 3MCAB 3NPFA 4M78C 4QVZA 4RG2A 2F2XA 1UB4A 2YUQA 1MV0B 2K5LA 2L0AA 5KYNA 4PJNA 2RK2A 2RQWA 3CCLA 3VUZA 3QUIA 3JCMb 2RM4A 1ZSGA 3X28B 2PUOB 1WJSA 2JMAA 1NJIR 2DNUA 1VQKA 1YWOA 3PGGA 3HHTB 4OB2B 1Q86U 2DTIA 3CCRA 3X25B 5CK9A 3KUFA 1N8RR 3DB4A 5LJ5g 2DBMA 4K11A 4C8QA 1WFWA 2RO0A 1YHQQ 1Q7YR 3M55A 2E65A 2B8AA 1LOJA 1IO6A 4PLIA 3G1JA 4PFZA 4NL2A 1VYTA 2ZPFB 3FB9A 3WVDB 1KHIA 1ZHIA 1R0CB 2ZGWA 1VQ8A 1YI2Q 1Q81U 2V8IA 2RH2A 3H0IA 3M0TA 1WA7A 1ZSZC 5DLOA 3I5RA 1IZ6A 3OQ5A 2NUPB 3JCMJ 4J6YA 3ZBDA 1BK2A 3PMIA 2SEMA 4EMGA 5KYUA 3JRZA 3E9GA 3QXEB 4C0FA 3FJ5A 1FMWA 3Q1JA 1X75C 2L2PA 2VUBA 1H3ZA 3VS6A 1QWFA 1VQ6Q 3EH2A 4F7UB 4LD9K 2K2MA 3M54A 3MJXA 1PWTA 2X3XD 2QASA 1K0SA 1OULA 3CC4Q 3VS4A 3UDCA 2WSEE 2M02A 3S6WA 3CCQQ 1X2KA 1WHHA 3L42A 3LGLA 4M77A 1OV3A 4FT2A 1AT1B 2DVEA 2O31A 5FLXE 3H9NA 3J7AF 2DYBA 3RDVA 2M1HA 4MZPA 3VUBA 4GBQA 1KC8R 1PSFA 3OYEA 3EAEA 5GJVB 2HKQB 2I2LA 2OI3A 2JTMA 2Z0WA 4E2FB 1IGUA 3X26B 4MZTA 2D8HA 1E7OA 2D9TA 1PG5B 2DRMA 1M30A 3UPUA 3JB9F 5AYFA 1NLOC 2HQHA 4ZN1A 4C8QB 4F7UF 4ANJA 3CC2A 3KBGA 1M8MA 2A7YA 1Y07A 4A54A 2L89A 2VKNA 3PNWC 1OOTA 3CXCP 3G6EQ 2LVMA 1N9SA 2J6OA 2LQNA 1WX6A 4RKUE 4D8DA 1H3HA 2DTHA 2EGEA 3ZEHA 2CDTA 2CSQA 5J3BA 4L6V5 3E19A 1QKWA 2DF6A 1AWXA 2GCXA 2QQSA 2DFUA 3CCQT 2DEQA 2X35A 1BU1A 3OYCA 3A8OB 4J7IA 5GAN3 4E7LA 1PRMC 1Q95G 5KYUB 4GLKA 2KROA 4DOWA 3PMTA 2DXUA 3ASKA 3L2WA 2IPOB 2RPNA 3CD6A 3JCMc 4J9EA 3LWHA 1NJIU 1SSFA 3PIOA 2NUZA 4M7DD 1U5SA 2LMJA 3M57A 2E12A 7AT1B 3C12A 3MHXA 4ZN3A 1N8RU 4M75G 1QVGP 4BDYA 3MP6A 4M77B 5CAIA 1CKAA 5GJWB 4M78E 3H0FA 1N27A 2VYTA 1QQJA 4XTUA 5FROA 3N5BB 3L2RA 1H8KA 2RF0A 2RQVA 4EIKA 1F1BB 2YLCA 1VUBA 2NUTA 3CC7A 2CZ1B 4AG1C 3QPHA 3R6NA 2DL7A 3PVLA 3CCMT 1M3AA 4HXJA 1VQ9T 3HP9A 2KRMA 5GAN6 2EJFA 1RACB 4LUDA 1B07A 1OX8A 3I55Q 2F1LA 2DM1A 4C8QC 1WXBA 1RAAB 1BI0A 1PCXA 1RAIB 3LW5E 5D6YA 5KYXA 3OB9A 1OU8A 1OZ2A 4C0DB 2YRCA 5A0GA 1TUCA 5EG2A 3I9QA 3CXCS 1D3BA 5HK0A 4M77F 3R6OA 4X1VA 1IHWA 2QTXA 2BZYA 2OTLQ 1M27C 1GXIE 2M9UA 5KYYA 1W2BA 3A8HB 4Y91A 4OGEA 3M0UA 3M0SA 1G8XA 3UWNA 3WVEB 8AT1B 4O5VA 4J9FA 4E7SA 3CCSQ 2IG0A 2EYZA 1LCKA 1YJ9Q 5GMKl 1YIJT 4BB7A 2GGRA 2C0TA 4MMKA 2RI3A 2K79A 1X27A 4TVRA 1PHTA 3OS0A 4QT7A 2HZYA 1SHGA 1VQOA 4LDVA 4JRQA 4M77C 3A8GB 2XG8D 2DD4A 1QVGS 2E6ZA 4FL6A 2JW4A 2PUKB 4X9CA 1X6BA 2FRWA 3I55T 2CP5A 4PKCC 2DL5A 2PNIA 4C92D 5GAN7 1A0NB 3HPWA 2LX9A 2FO0A 3EGUA 1S1NA 1HYOA 1GFCA 1YJWA 4XU2A 4OMPA 2NUTB 1MV3A 3SFMA 1IREB 3E2UA 3EG9A 1XJWB 2DAQA 4KGXB 2L8DA 1WIEA 2PVDB 3CCMA 2OTLT 3LYIA 5ECAA 4M78A 2K3XA 1M9SA 3DKMA 3SWNB 1SKUB 1KQ1A 2JS0A 2BZ8A 4LXCA 3VS2A 3CMEQ 3FC3A 6AT1B 2RJFA 3CCST 5KYXB 4C0DC 1TWBA 1M3CA 3CCEQ 1G83A 1WI7A 4J6XA 1D3BB 2O4XA 3OBYA 2F5TX 3CCJA 4OMMA 2FYKA 4IIMA 2A36A 4JRPA 4A4HA 1GRIA 1QVFA 1X6GA 4MDWA 3V7SA 1WLPB 1G5VA 5KYYB 3HL8A 3OYMA 4BE0A 3SDZA 4BDZA 2KDSA 1VIEA 2YUNA 2ZPGB 2XHCA 2R58A 2XDPA 1VQMQ 1VQ7Q 4M7AG 3EG0A 1WJQA 4A4FA 2RB6A 1VQ5T 2DA9A 2LZ6B 4BI4A 1H92A 1K1ZA 2LC4A 1WHLA 3RMSA 3OYNA 4IKFA 4IUUA 1IXDA 1KK7A 1RUWA 2KR3A 1K9MC 3NGPA 2H3EB 2LRQA 1ZSZA 4C8QG 3CBMA 3VV0A 1VQKQ 1RLQC 1BIBA 2PQWA 2E1HA 2EW3A 3EG3A 4Z88A 1Y96A 5GMKe 1MNEA 1G3TA 1MNDA 4JZ3A 1OEBA 3CMET 5A0DA 4XTVA 4OMNA 5IAYA 4PJLA 3CCUT 3SD4A 1KJWA 3OYYA 2LQ8A 4OF1A 3CCET 2KXDA 2LP5A 2DL4A 3QBYA 1C6VX 2D0QB 2XK0A 2L5QA 3GOXA 1W2BP 3EG9B 4JLGA 2XICA 4MDXA 2BKDN 4LDUA 1I5OB 3SWNC 3RUXA 2LTOA 1VQ8Q 2P0KA 3OS5A 5LJ5e 1JXMA 1FMVA 2COWA 4JDSA 1WHKA 3UA7A 5KCOA 3O5ZA 4GY5A 5IXBA 2DJQA 4KH1B 1N9RA 1ZX6A 4PJOD 1VQMT 3PVQA 2MWOA 1JBMA 2YUPA 1VQ7T 2KBTA 3FDRA 2CGHA 2JT4A 3M56A 2K7AA 2O4XB 1YITA 2COYA 3JSCA 2HEQA 1WDXA 5CO7A 3J80E 2ED1A 1AWJA 2EQIA 1QVPA 3UT1A 1Y0MA 1K8AC 1M5Q1 2DLPA 1VQPA 1JXOA 1Y71A 4LDWA 5GMKj 1WJRA 4RTTA 1SG5A 3QZ5B 2DD5A 1VQLQ 1VQ5A 2DO3A 3REAB 2KRNA 1BKBA 4RCBA 3UA6A 1K73C 5GAN8 2DXBA 2HL3A 2X4XA 1W6XA 2QEXA 1QWEA 4RMOA 2FZKB 4L59A 3QDFA 1SEMA 2EYWA 3CMAQ 3H8ZA 3P8DA 4XU1A 3MP8A 1Y96B 3G4SQ 1TUGB 2BTTA 4RG8A 5L23A 2PVOB 3CXCA 1JO8A 4E6RA 3FEOA 4E7ZA 1Z9ZA 3CCUA 3CC2Q 3TCJA 4BUGA 4F16A 4M7DB 3CCVA 1MUZA 5IT9E 1QVFP 4IIOA 2EKOA 5IHIA 4DEXA 3I56Q 1GBRA 1W2BS 3TQ7P 3D7SB 2FRYA 2QA4A 1SSHA 5LJ5f 1NPRA 4KGZB 4N4IA 4OP0A 1DJ7B 2HKNA 4PLLA 4C92A 4DQ2A 5IN1A 1NE8A 3BW1A 2EAYA 1BBZA 2HAXA 4OB3B 1ZLMA 4OMFB 4FYWB 3DLLA 3MKDA 4PJOE 4ZNXA 1VOMA 2LNVA 2BZXA 1XOVA 1Q82C 3CD6Q 5CKDA 1NYGA 1TSFA 2QQAA 1QVGA 4J9HA 3VKIA 2E70A 2EQMA 3EHQA 3TSWA 1FX7A 5GANd 3GNFB 4LD6A 3GNGA 1FXXA 1RAHB 2X4YA 3M59A 4GLMA 1UGPB 4PNOA 3G71A 1VQNA 4M7DF 3G7ZA 3CMAT 1PNJA 1UFFA 3G4ST 3LWIA 5FW9A 5DM7R 3EFOA 1AD5A 1YCYA 2ROLA 4MMLA 4E7HA 1S72A 5CKBA 2B86A 3REBB 2LX7A 3C4SA 3BE3A 5LJ3d 2VVKA 3HFNA 2F5KA 1BI3A 1UUEA 3L2UA 4F04B 2SRCA 3QWYA 2Y4YA 1UGQB 3I5SA 3QHSA 4J9BA 2A3LA 4OMOA 2AKLA 2R57A 1RAEB 3NTHA 4KH0B 1PC0A 2KY9A 4M7DC 4EMKA 2OX7A 4N4HA 1KD1R 1K0XA 2DIQA 5FWBA 2CT4A 2PU9B 1QVFS 1U06A 4D8KA 1ZQ1A 2HSPA 2XDBA
chains in the Genus database with same CATH topology
5D6WA 4X34A 2K4YA 4J83A 1WNLA 4B9WA 4JS4A 3L2QA 2FVUA 4IUPA 3PFSA 4C8QC 3QYHB 1LNXA 4C92B 4ELZC 3CMEA 4JJNK 2QQBA 3C95A 1KC8C 1I5LA 1BI0A 4ATOA 5DLQE 1O75A 3LW5E 5KH6A 1VQPT 1BYMA 1QW1A 2MAMA 1G3YA 5D6YA 1I4K1 1R8OB 1OZ2A 3OB9A 2CS7A 1HK9A 2RD1A 3CCEA 2KQWA 1TH7A 4C0DB 4IUQA 5GAMe 5A0GA 5GAMg 4JRIA 5EG2A 2O01E 1K73U 3CXCS 1D3BA 1QP3A 4ELYC 5HK0A 4M77F 1WPYA 4JLIA 4J7FA 4ZTFA 3R6OA 5J26A 4R56A 3OS2A 3MP1A 4F7UE 2QTXA 3BY7A 1QP2A 4Q5WA 1YI2T 2MWPA 4BI8B 2NLUA 2RHUA 1XQHA 1GXIE 4JUVA 2EJ9A 4EMHA 2M9UA 1W2BA 3A8HB 1NZ9A 4Y91A 1JJ2A 4OGEA 1Q86C 2E64A 1UGRB 3RMQA 4B9XA 3PT9A 3OYHA 3HSBA 3UWNA 4M75F 2XIDA 2OTJA 3WVEB 4M77D 2XDDA 3H6ZA 4O5VA 3OMGA 2QEXT 4N4GA 3JCMW 3PTAA 3GF5A 4XTWA 3QO3A 3BFMA 3JCMX 3OW2S 2IG0A 3M53A 1VQMA 4PJOA 5GMKl 1XNIA 1VQ7A 1YIJT 2HD0A 2YHTA 1YBYA 4BB7A 3OYLA 4JS5A 1VQLT 5CQYA 1OI1A 3RKXA 4HT9A 3V7CA 1VQ6T 4LDYA 4MMKA 5CKFA 4M75D 2RI3A 4E7JA 5FRMA 5GAN5 3OYJA 4TVRA 2K5FA 3NTIA 1KQSS 4UC4A 3OA6A 3EFSA 4M78G 3OS0A 3CC4T 3CCVT 1VQOA 3S3OA 2KK4A 2V8JA 4M7AA 2HQEA 1V29B 4BY6C 4LDVA 4C92F 4JRQA 2E5QA 3TU4K 4M77C 2E6NA 2ZPIB 2XG8D 2ZPHB 3A8GB 1Q81C 2DD4A 2DJZA 2WSFE 2X4JA 5KCHA 4E7IA 2H3JA 1OYXA 1QVGS 1PSEA 2E6ZA 3V8KA 4EPCA 2VGMA 5GMKm 4FL6A 4JRKA 2RHIA 4KULA 1N6AA 4BD3A 2PUKB 2QA4T 3GPLA 3JCMf 4X9CA 3CCRA 1WGSA 4M78B 3I55T 1X6OA 3ME9A 2JOYA 4Y28E 4PKCC 1KG1A 2DXTA 4C92D 4M75C 4XQ3A 5GAN7 5GAMj 4C8QE 3HPWA 2LX9A 2KAFA 2K5IA 2QQ9A 2KVQG 3CC2T 2OAUA 2GF7A 2GFAA 5GAN2 3T9NA 1YJWA 3GIBA 4XU2A 4C5HA 2JN0A 4EMKB 3QG1A 1KD1C 4A53A 4OVAA 3SFMA 1UGSB 1IREB 2HNIA 4XU0A 2JZ2A 1U1SA 4O6JA 2IVWA 4WF2A 2DAQA 3FRNA 3I56T 2EYQA 2L8DA 2BUDA 2PVDB 3SB2A 2LQKA 1BI1A 3TEEA 2HQXA 2ZPEB 4FSXA 3CCMA 1Q7YU 2OTLT 3CPFA 3TREA 3LYIA 2RHYA 1BI2A 4XTZA 4M78A 4MZMA 3E9FA 2K3XA 4ZGJB 1M9SA 3HKSA 3DKMA 3SWNB 4DA4A 2ZPBB 4C92C 3RESA 1KQ1A 3NFCA 4VUBA 1YHQA 1EIFA 3MO8A 3M4YA 3FC3A 3HFOA 2RJFA 3CCST 5GAOm 3M5AA 4FT4A 5GAMf 4NOYA 1JRIA 3G71T 3G6ET 3BDUA 3LH0A 4C0DC 4C5GA 5I2MA 3V8LA 1VQNT 2FHDA 4QQ6A 1H641 2LCCA 3O8VA 2XKOC 1VQ4T 4OB1B 4J6XA 2MF2A 2E41A 2F69A 3VYGA 1D3BB 2O4XA 3OBYA 2F5TX 3CD6T 3JCMV 3CCJA 2EQJA 2RJCA 3KXTA 2FYKA 1S72T 1MGQA 4P5NA 3OY9A 4A4HA 4A4GA 4JRPA 1YHQT 4ZGEB 1M90C 4PJOG 1QVFA 3M9QA 3CBPA 4FM4B 1WQ7A 4MDWA 5GANh 3SWNA 1YI2A 3V7SA 4X9DA 5GMKh 2DPPB 3S3NA 4M78F 5FU7B 1G5VA 4Z02A 3OYFA 5GAN4 2CZ7B 3HL8A 1LJOA 4IUTA 3OYMA 4BE0A 3SDZA 3OYBA 4BDZA 1WQWA 2KDSA 3M4GA 1VIEA 3JCMd 4M77E 4RCCA 2ZPGB 2XHCA 2RA2A 2R58A 2CKKA 5LJ5j 2DXCA 2XDPA 5CQXA 4PJOB 3BDLA 4C0ZA 2V8KA 2VGNA 5C0MA 4M78D 1KQ2A 3OYKA 4A4FA 1WJQA 4M7AG 1M8VA 4J5YA 3JB9J 1VQLA 2RB6A 1VQ5T 3OMCA 3QIIA 4M75E 4F7UA 3P8BB 3VU3C 4BI4A 3L1AA 5LJ3h 2LC4A 5L8RE 3RMSA 2VC8A 3OYNA 1YJNA 4IKFA 4IUUA 4HCCA 1M1KC 1K9MC 5LJ5h 4C0GA 3CC4A 2QDYB 3CC7T 2VV5A 2LRQA 1G3SA 3M58A 2WACA 1X01A 3VYHB 3CCQA 4M7AB 3RIRA 2DZCA 4J8OA 4C8QG 4N0AC 1M90U 3CBMA 3LX7A 2M0OA 3VV0A 4BE2A 2L3RA 3MCAB 1W4SA 1BIBA 2JTFA 3CMAA 1NPPA 1KC8U 2PQWA 2E1HA 1ZBXA 2FL7A 4M78C 4QVZA 5HY6A 5GANe 1Y96A 4RG2A 5GANg 4R55A 3G4SA 5GMKe 2XD0A 1UB4A 1G3TA 5GAMd 2K5LA 5I2SA 3F70A 3CMET 3URGA 5A0DA 2HBPA 4XTVA 2RK2A 5IAYA 3CCLA 3VUZA 3GLXA 3QUIA 3CCUT 3SD4A 2GFUA 2CZ6B 5A0LA 3OYYA 2LQ8A 2RM4A 4EMKC 3JCMb 4OF1A 2D6FA 4M7DE 2Y90A 1M1FA 3X28B 2RI5A 3HRTA 3CCET 2RK1A 1KQSA 4QQDA 3QBYA 2PUOB 1WJSA 3OYGA 2D0QB 3CPWS 2XK0A 1VQKA 2L5QA 3GOXA 3I56A 4JLGA 4YTLA 3PGGA 2XICA 3HHTB 2BKDN 2JNGA 1M1KU 4OB2B 4MDXA 4LDUA 1Q86U 2DTIA 2KMTA 5LJ3e 4PJOF 2EIFA 3X25B 5CK9A 2RJDA 3KUFA 5LJ3g 3OYIA 3SWNC 3FIFA 4XTYA 2XI9A 3RUXA 2LTOA 2RJEA 2P0KA 3OS5A 5LJ5e 3DB4A 5LJ5g 5GAOq 3CEYA 4DOVA 2R5AA 4JDSA 3J81E 4C8QA 4L5GA 2RO0A 3C94A 3M55A 2E65A 1RL2A 2B8AA 4A4EA 1LOJA 5KCOA 1B34A 4GY5A 5GAOp 2K2VA 3LGFA 3MEUA 1N9RA 3A5ZB 4PLIA 2MI6A 1VQMT 4PJOD 2ZCFB 1Y7XA 2MWOA 1JBMA 1VQ7T 5D6XA 4M7AF 1Q82U 3FDRA 4NL2A 2CGHA 2E10A 3M56A 2ZPFB 2O4XB 3FB9A 3WVDB 1YITA 1KHIA 1ZHIA 3JSCA 1I8FA 1VQ9A 2DK3A 5CO7A 3J80E 1VIFA 1O9SA 1BIAA 2DIGA 3RKYA 2ZGWA 1VQ8A 5FU7C 1QVPA 3UT1A 1Q81U 4BE1A 1K8AC 2V8IA 3ZFJA 2RI2A 1M5Q1 2RH2A 5CKHA 1VQ8T 3JB9G 3QYGB 1VQOT 5HK3A 4M7AD 4ZTJA 3E1SA 5DLOA 2RHXA 1IZ6A 4F7UG 5GANj 3OQ5A 1Y71A 4OB0B 4LDWA 4C8QF 5GMKj 3JCMJ 1VQPA 4J6YA 3LLRA 4ME7A 1WJRA 3ZBDA 3OBWA 1YJ9T 5DY9A 4PJOC 2YRVA 5M9OA 3PMIA 4EMGA 3JRZA 3E9GA 3QXEB 4C0FA 1AHJB 2M16A 3Q1JA 3QZ5B 2DD5A 1X75C 3INZA 1M4ZA 2VUBA 1VQ5A 1H3ZA 2DO3A 1MHNA 4C8QD 4F7UB 4RCBA 1BKBA 1K73C 3EFRA 4LD9K 2QQRA 3M54A 2JVVA 3GP8A 5GAN8 1XTDA 4QVDA 3MEWA 2BIVA 1YJWT 2DXBA 4M7AC 3QKJA 1P92A 2LDMA 2X4XA 2WSEE 2LT1A 3UDCA 5LJ3j 4HCBA 3S6WA 4XK8E 2DKGA 3L42A 3LGLA 2QEXA 4M77A 3FLGA 3META 4KT0E 4RMOA 3QDRB 4L59A 3OSVA 2X4WA 4FT2A 2VXFA 5GANf 1K8AU 2DVEA 3P8HA 4M7DG 5FLXE 2CZ0B 1YIJA 3H8ZA 4OGCA 2QI2A 3J7AF 3P8DA 4XU1A 3MP8A 1Y96B 3JCMP 3OSSC 3V8JA 1KD1U 4RG8A 4BACA 2FB7A 1VQ6A 2PVOB 3RERA 2M1HA 4M75A 3CXCA 4MZPA 3VUBA 3FEOA 3HRSA 4E7KA 1HXDA 1U1TA 3CCUA 4IURA 1PSFA 3TCJA 2QXFA 4BUGA 3OYDA 3OYEA 4M7DB 3CCVA 3EAEA 5GMKi 5IT9E 3JB9H 2I2LA 2PVGB 2EKOA 3WXMB 2EWNA 3MEAA 4FU6A 2P0QA 3QZ9B 2JTMA 2Y4XA 4C5EA 3MEVA 5LJ3f 5FU6B 4A4KA 3CCJT 2LCLA 4BI3A 1W2BS 2EFIA 1JJ2S 5GAOn 1I81A 2QA4A 3X26B 4MZTA 1NPRA 5LJ5f 3OW2A 2D9TA 4N4IA 4OP0A 5A2QE 3I55A 1DJ7B 4EDUA 4PLLA 4C92E 3UPUA 5C6SA 4C92A 3JB9F 2EJGA 2K57A 4DQ2A 5AYFA 5IN1A 5CCAA 1NE8A 4ZN1A 4C8QB 3L2ZA 4F7UF 3CC2A 3BW1A 3KBGA 2A7YA 2EAYA 3OS1A 2HAXA 3FJPA 1Y07A 2JUFA 4OB3B 4A54A 1B34B 2LT4A 4OMFB 4M7DA 1NJIC 2L89A 3PNWC 3DLLA 4PJOE 4NL3A 2LVMA 1N9SA 4RKUE 3JB9D 2LNVA 4QVCA 1XOVA 2DTHA 2GQVA 1Q82C 1N8RC 1K9MU 3CBOA 3ZEHA 5CKDA 3CPWA 3HRUA 2OTLA 2DZ9A 2QQAA 4HKEA 5J3BA 4L6V5 3E19A 4C5IA 1QVGA 1YJNT 3VKIA 3ER0A 4CRIA 2GCXA 2E70A 2EQMA 1Q7YC 1FX7A 3RKWA 2MMPA 3JCMh 2QQSA 1G3WA 5GANd 2AHJB 3GNFB 2DEQA 4LD6A 3CCQT 3GNGA 4QQGA 4M7AE 2OTJT 2X35A 5FRNA 2RHZA 3CCSA 1FXXA 4II1A 2X4YA 3M59A 4PNOA 3JCMQ 1UGPB 3G6EA 3G71A 4KUDK 2XU8A 3OYCA 3NTKA 1KHCA 3A8OB 4J7IA 5GAN3 3JB9I 4E7LA 2YLBA 1FWZA 2CYZB 3G7ZA 3CMAT 1VQNA 4M7DF 4GLKA 5CKEA 5CVIA 4DOWA 1M1GA 3PMTA 2DXUA 1VQ4A 3ASKA 3G4ST 4NS5A 3L2WA 3LWIA 5DM7R 5LL6S 1YCYA 4M77G 3JCMc 3CD6A 3QSUA 4MMLA 4XTXA 3L2VA 3OYAA 3LWHA 4E7HA 1S72A 3X24B 5I21A 2G3RA 1NJIU 5CKBA 3A8LB 3CCLT 1SSFA 3PIOA 3A8MB 4KUIA 2K3YA 3PIPA 5GAOr 4M7DD 3C4SA 3M57A 5GAOl 5LJ3d 2E12A 3HFNA 2F5KA 3DB3A 1UEBA 3QJYA 3C12A 3MHXA 4HCZA 4J6WA 3V7RA 1BI3A 4M75G 4ZGDB 4ZN3A 1YJ9A 5CR2A 1N8RU 4BY6B 4BDYA 3MP6A 5LJ5d 1VQKT 4IUVA 4M77B 3VJPA 4N0AA 5CAIA 3L2UA 4KBMB 2R5MA 1U8RA 3QJ6A 5J39A 3AHUA 5GAMh 2DTOA 3CCRT 2C06A 4M78E 4E47A 2KSSA 2P4TA 2Y4YA 2WSCE 1N27A 1UGQB 2VYTA 4HA8A 4V2SA 5CIUA 5HKCA 3JCMe 3QHSA 3JCMg 4XTUA 5FROA 4D6WA 2A3LA 2R57A 3NTHA 3N5BB 4M75B 3L2RA 4CI0C 1JB0E 4XU3A 1OZ3A 1RI0A 2KY9A 3DLMA 2P0PA 4M7DC 2EQUA 4EMKA 2YLCA 1VUBA 5KE2A 3S3MA 4N4HA 3CC7A 4PL6A 4XAXB 2CZ1B 4C92G 5KE3A 4LDXA 3QPHA 2DIQA 4HT8A 2PU9B 4FIBA 2ZZDA 5FU6C 1QVFS 3X20B 1YITT 3CCMT 2VXEA 4QW2A 1ZQ1A 3JAME 1VQ9T 3HP9A 2XDBA 2EQKA 5GAN6 2EJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZGJ B;  1DJ7 B;  2ZPB B;  3QYH B;  3LW5 E;  4OB3 B;  2ZCF B;  2O01 E;  4OB1 B;  4RKU E;  1QP3 A;  3VYG A;  2ZPF B;  3WVD B;  4ZGE B;  1QP2 A;  4FM4 B;  4L6V 5;  1GXI E;  2DPP B;  3A8H B;  1UGR B;  3QYG B;  2CZ7 B;  2AHJ B;  3WVE B;  4OB0 B;  2ZPG B;  1UGP B;  2DXC A;  3A8O B;  2CYZ B;  3QXE B;  1AHJ B;  3QZ5 B;  2DD5 A;  3X24 B;  3A8L B;  5L8R E;  3A8M B;  2DXB A;  2QDY B;  2WSE E;  3VYH B;  1V29 B;  4ZGD B;  4XK8 E;  2ZPI B;  3A8G B;  2ZPH B;  2DD4 A;  2WSF E;  4KT0 E;  1PSE A;  2PUK B;  2CZ0 B;  2WSC E;  1UGQ B;  3X25 B;  4Y28 E;  2PVO B;  1JB0 E;  2CZ6 B;  1PSF A;  3X28 B;  1UGS B;  2CZ1 B;  1IRE B;  2PVG B;  2PUO B;  2D0Q B;  2PU9 B;  2ZZD A;  3QZ9 B;  3X20 B;  2PVD B;  2ZPE B;  3HHT B;  4OB2 B;  3X26 B; 
#chains in the Genus database with same CATH topology
 1SRM A;  4JS4 A;  4AFQ C;  4CC4 B;  4IUP A;  3PFS A;  1YHQ T;  4C92 B;  4ELZ C;  4JJN K;  4ATO A;  3C95 A;  1T0J A;  2OAW A;  4LNP A;  5DLQ E;  1O75 A;  5KH6 A;  1R0B G;  1QW1 A;  2MAM A;  1G3Y A;  2RD1 A;  2KQW A;  3THK A;  4IUQ A;  1ABQ A;  2L3Q A;  1TXQ A;  4JJC A;  1NLP C;  2O9S A;  3BY7 A;  5IXF A;  1YI2 T;  4BI8 B;  2NLU A;  2RHU A;  4JUV A;  1NZ9 A;  1JJ2 A;  1Q86 C;  1UGR B;  4B9X A;  3PT9 A;  3HSB A;  1VQO Q;  1K9M R;  1ZUY A;  1JQQ A;  4F14 A;  1M2V A;  3GF5 A;  4XTW A;  3M53 A;  3SHW A;  4PJO A;  2KEA A;  2AT1 B;  2QTV A;  4A63 B;  2CRE A;  2YHT A;  2JM9 A;  1VQ4 Q;  2KYM A;  2GQI A;  3RKX A;  3EFO B;  4HT9 A;  1VQ6 T;  5CKF A;  4M75 D;  5FRM A;  1UTI A;  1KIK A;  3OYJ A;  2GNC A;  4M78 G;  3CC4 T;  1TU0 B;  2HQE A;  4C92 F;  2ROT A;  2E5Q A;  5IH2 A;  1Q81 C;  1VA7 A;  2ZPH B;  1RAF B;  5KCH A;  2V1R A;  2H3J A;  1PSE A;  3V8K A;  4JJB A;  2RHI A;  4BD3 A;  1EZZ B;  1AWW A;  1WGS A;  1WHM A;  4OML A;  2DXT A;  2KT1 A;  1T3S A;  1QCF A;  2GFA A;  1HJD A;  3GIB A;  4EMK B;  2JN0 A;  1AZG B;  3QG1 A;  4A53 A;  4OVA A;  1PD0 A;  2DET A;  1U1S A;  2IVW A;  3IQL A;  2BUD A;  2LQK A;  3TEE A;  2H8H A;  2HQX A;  1Q7Y U;  4RTY A;  2RHY A;  2FPD A;  3HKS A;  2RQR A;  2ZPB B;  4C92 C;  3RES A;  2J06 A;  3NFC A;  4VUB A;  2CP7 A;  1YHQ A;  1K4U S;  1K8A R;  3M4Y A;  2CSI A;  5GAO m;  1WHG A;  4NOY A;  3G6E T;  5I2M A;  3V8L A;  4QQ6 A;  2LCC A;  1VQ4 T;  4OB1 B;  2E41 A;  3PE0 A;  2RJC A;  1M90 C;  2D8J A;  2DL8 A;  5GAN h;  3SWN A;  1YI2 A;  2DPP B;  3QWX X;  4Z02 A;  1K73 R;  3OYF A;  5GAN 4;  2CZ7 B;  1B7T A;  4LN2 A;  1MMG A;  1WQW A;  2CUD A;  2KNB B;  3JCM d;  2OTJ Q;  2OJ2 A;  2RA2 A;  1M2V B;  5CQX A;  2DVJ A;  4PJO B;  4C0Z A;  1I07 A;  1M8V A;  4J5Y A;  2YDL A;  3QII A;  4M75 E;  1ZUK A;  3P8B B;  1W70 A;  5LJ3 h;  5L8R E;  2O88 A;  3GBQ A;  1U3O A;  1M1K C;  2D0N A;  1LPL A;  3NMZ C;  3CC4 A;  1D0Z A;  2QDY B;  3UAT A;  3M58 A;  1G3S A;  4Z89 A;  1X01 A;  2WAC A;  3CCQ A;  3RIR A;  1UJY A;  3LX7 A;  4BE2 A;  2HL5 C;  1W4S A;  1NPP A;  1KC8 U;  1ZBX A;  1QMC A;  4FW2 A;  5GAN g;  2QGG A;  5GAM d;  1PM3 A;  5I2S A;  2HBP A;  1E6G A;  3GLX A;  2V1Q A;  5A0L A;  2CZ6 B;  4EMK C;  4M7D E;  2Y90 A;  1M2O A;  2RK1 A;  1KQS A;  1JJ2 P;  3HTR A;  1KFZ A;  1ACM B;  4PJO F;  2EIF A;  5LJ3 g;  2RJD A;  3OYI A;  1Q82 R;  3FIF A;  4XTY A;  2XI9 A;  1I0C A;  2A0F B;  4DOV A;  2R5A A;  2DRK A;  3J81 E;  4L5G A;  4HVV A;  3C94 A;  4A4E A;  1D1A A;  1J3T A;  4HVU A;  1Y7X A;  5D6X A;  1K9A A;  2E10 A;  1I8F A;  1VQ9 A;  2DK3 A;  1O9S A;  1YFN A;  2AKK A;  2C0I A;  2RI2 A;  4FSS A;  5CKH A;  3JB9 G;  5HK3 A;  4M7A D;  4ZTJ A;  2RHX A;  4F7U G;  1KD1 C;  4OB0 B;  2QEX Q;  3OBW A;  1YJ9 T;  4J9C A;  5DY9 A;  4PJO C;  4PK4 A;  2QAZ A;  4RUG A;  3INZ A;  1M4Z A;  1MMN A;  1D0Y A;  4Y92 A;  1YCS B;  4C8Q D;  2DER A;  3NHN A;  3EFR A;  2QQR A;  3GP8 A;  2JMC A;  1XTD A;  4QVD A;  1YJN Q;  3RNJ A;  1GCP A;  2DMO A;  3KFV A;  2LDM A;  3CCV Q;  4PJM A;  3MET A;  1QLY A;  2VXF A;  1K8A U;  4FW1 A;  2VAS A;  2DL3 A;  1YIJ A;  2QI2 A;  1FYN A;  4BAC A;  1JU5 C;  4M75 A;  2EPD A;  2DIL A;  3EGX A;  3AT1 B;  3CCL Q;  4E7K A;  1HXD A;  2EGA A;  3OYD A;  4CC3 A;  3JB9 H;  2EYX A;  3WXM B;  3MEA A;  2ECZ A;  4FU6 A;  4C5E A;  2Y4X A;  2K9G A;  1JJ2 S;  5GAO n;  3RR6 A;  3CCR Q;  3I55 A;  4EDU A;  2MOX A;  4C92 E;  5C6S A;  2EJG A;  2K57 A;  1ZBJ A;  4CC2 A;  1Q86 R;  1NG2 A;  2COZ A;  3OS1 A;  4M7D A;  1QCO A;  1RAB B;  2CP2 A;  1CKB A;  1D0X A;  1SF9 A;  4QVC A;  2GQV A;  2BE7 D;  3CPW A;  2OTL A;  3HRU A;  1S72 Q;  2DZ9 A;  4HKE A;  2CP0 A;  4C5I A;  1YJN T;  3ER0 A;  1BCM A;  3JCM h;  3RKW A;  2MMP A;  2E3I A;  1G3W A;  2PTK A;  4M7A E;  1IRX A;  4QQG A;  3OW2 P;  5FWC A;  2RHZ A;  3CCS A;  4KUD K;  2L3P A;  3JCM Q;  2MCN A;  1YJ9 A;  3NTK A;  1KHC A;  1Q81 R;  3JB9 I;  2YLB A;  1RLP C;  2CYZ B;  5CKE A;  1PD1 A;  1PKS A;  5LL6 S;  4M77 G;  3QSU A;  2YRD A;  4XTX A;  1KQS P;  3A8L B;  3CCL T;  1TS9 A;  1AWO A;  1OU9 A;  3PIP A;  5GAO r;  5GAO l;  3DB3 A;  1UEB A;  3QJY A;  4HCZ A;  4ZGD B;  1Q82 U;  5CR2 A;  4BY6 B;  1VQK T;  4IUV A;  3VJP A;  2KXC A;  2R5M A;  1U8R A;  5J39 A;  2NYS A;  5GAM h;  5HCK A;  2DTO A;  3CCR T;  2MPX C;  1LVK A;  4E47 A;  2KSS A;  2P4T A;  1JEG A;  4HA8 A;  2D1X A;  4V2S A;  1QCN A;  2K3B A;  3JCM g;  1WHJ A;  4D6W A;  4M75 B;  4RTX A;  4XU3 A;  1OZ3 A;  2RN8 A;  1RI0 A;  3EGX B;  3DLM A;  2KYB A;  4AMC A;  3S3M A;  1NEG A;  4PL6 A;  4XAX B;  5KE3 A;  4HT8 A;  1YP5 A;  1R77 A;  2E3H A;  3MEW A;  1VQ8 T;  5D6W A;  4X34 A;  2K4Y A;  1WNL A;  4B9W A;  1M90 R;  3L2Q A;  2FVU A;  3QYH B;  1LNX A;  3CME A;  1B3Q A;  2QQB A;  2ED0 A;  1NYF A;  3ULR B;  1BYM A;  2A08 A;  1I4K 1;  2CS7 A;  1HK9 A;  3CCE A;  2LNH B;  1NEB A;  1IB8 A;  5GAM g;  4JRI A;  1G2B A;  4ZTF A;  1WPY A;  4J7F A;  2J05 A;  3MP1 A;  4PFO A;  1QP2 A;  1XQH A;  2EJ9 A;  3TSZ A;  3A1P A;  3OYH A;  1M1K R;  4M75 F;  2XID A;  2XDD A;  2I0N A;  3H6Z A;  3OMG A;  4QKU A;  3QO3 A;  3JCM X;  3OW2 S;  1VQM A;  1GL5 A;  1VQ7 A;  1XNI A;  2HD0 A;  2EKH A;  3OYL A;  4JS5 A;  1VQL T;  2CT3 A;  1OI1 A;  2HBW A;  5AT1 B;  4E7J A;  5GAN 5;  2K5F A;  3NTI A;  1KQS S;  4UC4 A;  3OA6 A;  2A28 A;  5I22 A;  2DBK A;  4DEY A;  2YT6 A;  2V8J A;  4M7A A;  1BB9 A;  1V29 B;  4BY6 C;  1D1C A;  1OPK A;  2WSF E;  4E7I A;  1OYX A;  2K6D A;  1ZA2 B;  2VGM A;  5GMK m;  4JRK A;  1N6A A;  3GPL A;  4HVW A;  1OX9 A;  1FMK A;  4WCI A;  4Y28 E;  1KG1 A;  4M75 C;  4XQ3 A;  1GCQ A;  1MMA A;  2LJ0 A;  2J6K A;  2K5I A;  3CC2 T;  2CP6 A;  5EC7 A;  5GAN 2;  3T9N A;  4C5H A;  1X43 A;  2KI7 A;  3CPW P;  1UGS B;  3CC7 Q;  1UHF A;  4XU0 A;  2JZ2 A;  1C0M A;  2C0O A;  3I56 T;  2EYQ A;  5KYW A;  1QKX A;  1AVZ C;  1BI2 A;  4XTZ A;  2RQU A;  4MZM A;  3E9F A;  2FPE A;  4KRT A;  4OMQ A;  4DA4 A;  2FZC B;  2DE0 X;  2LJ3 A;  1TUD A;  2VWF A;  4B6M A;  2EVR A;  3MO8 A;  4FCY A;  5D7U A;  4FT4 A;  1UG1 A;  1WXU A;  2CH4 W;  3LH0 A;  4C5G A;  3MPU B;  2DEU A;  1H64 1;  3O8V A;  2AIR B;  2F69 A;  3VYG A;  3CD6 T;  1Z9Q A;  2QG9 B;  3OY9 A;  3U23 A;  4ZGE B;  4FM4 B;  3CBP A;  1WQ7 A;  1X2Q A;  2HMA A;  4RTV A;  3VS5 A;  2NWM A;  4ORZ A;  5FU7 B;  4IUT A;  3OYB A;  3M4G A;  4RCC A;  4DBF A;  2M0Y A;  2VGN A;  1KQ2 A;  4M78 D;  3OYK A;  2PZ1 A;  1VQL A;  3OMC A;  3VU3 C;  3L1A A;  4JPB W;  2VC8 A;  1ARK A;  4LUE A;  2KE9 A;  1UE9 A;  4AT1 B;  3CC7 T;  2VV5 A;  2ABL A;  3VYH B;  1V1C A;  4JJD A;  4M7A B;  2DZC A;  2FZG B;  4J8O A;  4M4Z A;  1M90 U;  2EGC A;  4PJJ A;  2JTF A;  3CMA A;  2FL7 A;  1T0H A;  5HY6 A;  5GAN e;  3G4S A;  2XD0 A;  4R55 A;  2LJ1 A;  3F70 A;  3URG A;  2GFU A;  2CUB A;  2D6F A;  2J7I A;  1M1F A;  3EHR A;  1YNZ A;  2RI5 A;  3HRT A;  1YJW Q;  2FG0 A;  4QQD A;  3OYG A;  2GTJ A;  3CPW S;  2AK5 A;  3I56 A;  4YTL A;  2JNG A;  1M1K U;  5KYW B;  3CCM Q;  2KMT A;  5LJ3 e;  1VQ9 Q;  1N5Z A;  5IHK A;  4CC7 A;  2RJE A;  5GAO q;  3CEY A;  1RL2 A;  2A37 A;  1B34 A;  5GAO p;  1PKT A;  2K2V A;  3LGF A;  1GBQ A;  3MEU A;  3A5Z B;  2MYS A;  2MI6 A;  2V26 A;  2ZCF B;  1TG0 A;  4M7A F;  1GFD A;  3A98 A;  1K76 A;  3EG1 A;  3CCJ Q;  2FPF A;  1VIF A;  1BIA A;  2DIG A;  1BCO A;  3RKY A;  5FU7 C;  1ZA1 B;  2AZS A;  2IIM A;  4BE1 A;  3ZFJ A;  3QYG B;  1VQO T;  3E1S A;  5GAN j;  4C8Q F;  3LLR A;  4ME7 A;  3CQT A;  4HCK A;  2GBQ A;  2YRV A;  5M9O A;  1AHJ B;  2M16 A;  3ZL7 C;  1YIJ Q;  1UGV A;  2JTE A;  1MHN A;  2JVV A;  3RBB B;  3VS0 A;  2ATC B;  2BIV A;  1YJW T;  3C0C A;  4M7A C;  3QKJ A;  1P92 A;  3EG2 A;  5LJ3 j;  2LT1 A;  4RTW A;  4HCB A;  4XK8 E;  2DKG A;  1IHV A;  2QGF B;  3FLG A;  4KT0 E;  3QDR B;  3OSV A;  2VB6 A;  2X4W A;  5GAN f;  2G6F X;  4M7D G;  3P8H A;  1HD3 A;  2YXY A;  2CZ0 B;  1OPL A;  4OGC A;  3UF4 A;  3JCM P;  3OSS C;  3V8J A;  1KD1 U;  1GCQ C;  2FB7 A;  1VQ6 A;  3RER A;  4PFP A;  1ZUU A;  1E6H A;  2J6F A;  3VS3 A;  3HRS A;  1U1T A;  4IUR A;  2QXF A;  2BE9 B;  4DBR A;  5GMK i;  2PVG B;  2P4R A;  2EWN A;  2P0Q A;  3QZ9 B;  3MEV A;  5LJ3 f;  5FU6 B;  4A4K A;  3CCJ T;  2LCL A;  4FYY B;  4BI3 A;  2EFI A;  1I81 A;  3OW2 A;  2P84 A;  1C1A A;  2RMO A;  5A2Q E;  3VRZ A;  4LE9 A;  5CCA A;  3M0P A;  3L2Z A;  4J9I A;  3FJP A;  2JUF A;  1B34 B;  2LT4 A;  1NJI C;  2CH4 A;  2ESW A;  4J9G A;  4NL3 A;  2CP3 A;  3JB9 D;  4AFU C;  2RNA A;  1N8R C;  1K9M U;  1YIT Q;  3CBO A;  3EGD A;  2O2O A;  2JS2 A;  2ENM A;  4F17 A;  4CRI A;  2FEI A;  1Q7Y C;  2AHJ B;  2OTJ T;  2O9V A;  5FRN A;  1VQP Q;  4II1 A;  3G6E A;  2XU8 A;  1FWZ A;  5CVI A;  1M1G A;  1IGQ A;  1VQ4 A;  1T3L A;  2X3W D;  2X51 A;  4NS5 A;  1TTH B;  3L2V A;  3OYA A;  1WXT A;  3X24 B;  5I21 A;  2G3R A;  1VQ5 Q;  4WTO B;  2JM8 A;  3A8M B;  4KUI A;  2K3Y A;  1YN8 A;  4J6W A;  3V7R A;  2MIO A;  5LJ5 d;  4N0A A;  4AFS C;  4KBM B;  2HDA A;  3QJ6 A;  3VS7 A;  3AHU A;  2C06 A;  2AZV A;  4KGV B;  2WSC E;  1CSK A;  1UDL A;  5CIU A;  5HKC A;  3JCM e;  4CI0 C;  1JB0 E;  2ZAE A;  4DBQ A;  2P0P A;  1AEY A;  2EQU A;  3CCU Q;  5KE2 A;  4C92 G;  4LDX A;  2E5K A;  3VRY A;  4FIB A;  2ZZD A;  5FU6 C;  3X20 B;  1YIT T;  2VXE A;  4QW2 A;  3JAM E;  3I35 A;  1WZO A;  2EQK A;  2QA4 Q;  1UJ0 A;  4J83 A;  1KC8 C;  2EYY A;  1I5L A;  2M51 A;  1YWP A;  1VQP T;  8ATC B;  2EBP A;  3H0H A;  1R8O B;  2F2W A;  1AOJ A;  1TH7 A;  5GAM e;  1X69 A;  2O01 E;  1K73 U;  1QP3 A;  3TVT A;  1D1B A;  4ELY C;  4JLI A;  5J26 A;  4R56 A;  4Z8A A;  3OS2 A;  1KSW A;  1SPK A;  4F7U E;  3EGD B;  4Q5W A;  1UHC A;  2MWP A;  1SRL A;  4EMH A;  2QK0 A;  2E64 A;  3RMQ A;  1HSQ A;  2OTJ A;  4M77 D;  2QEX T;  4N4G A;  3JCM W;  3PTA A;  3BFM A;  3G71 Q;  2RQT A;  1VQN Q;  2YWW A;  4FYX B;  1YBY A;  1UEC A;  1NBE B;  5CQY A;  3H41 A;  3V7C A;  4LDY A;  1RAD B;  4AG2 C;  4RTZ A;  2DYI A;  2JJ9 A;  1NM7 A;  9ATC B;  3EFS A;  2MK5 A;  2LCS A;  3CCV T;  4RTU A;  3S3O A;  2KK4 A;  3JV3 A;  3TU4 K;  2HCK A;  2E6N A;  2ZPI B;  2DJZ A;  2YSQ A;  2X4J A;  4EPC A;  2F2V A;  4KUL A;  2QA4 T;  3JCM f;  4ESR A;  1RI9 A;  2YUO A;  4M78 B;  1X6O A;  3ME9 A;  2JOY A;  1SHF A;  1PRL C;  5GAM j;  4C8Q E;  2KAF A;  1AZE A;  2KT8 A;  2L3S A;  2QQ9 A;  2KVQ G;  4R0K A;  2OAU A;  2GF7 A;  2HNI A;  4O6J A;  4WF2 A;  3FRN A;  2KGT A;  3SB2 A;  1BI1 A;  2ZPE B;  4FSX A;  3CPF A;  3TRE A;  4ZGJ B;  2GTO A;  1M3B A;  2W10 A;  2E4H A;  1V76 A;  1EFN A;  1EIF A;  2LQW A;  3HFO A;  3EH1 A;  3M5A A;  5GAM f;  3G71 T;  1JRI A;  1VYV A;  3BDU A;  4FYV B;  1VQN T;  2QDL A;  2FHD A;  3SEM A;  2XKO C;  2MF2 A;  1MMD A;  3JCM V;  2KRS A;  2EQJ A;  3KXT A;  1S72 T;  1MGQ A;  4P5N A;  4A4G A;  4PJO G;  3M9Q A;  4DBH A;  4X9D A;  5GMK h;  1TOV A;  3S3N A;  3M0Q A;  4M78 F;  5I11 A;  3LH5 A;  4JZ4 A;  1D09 B;  1LJO A;  1ZSZ B;  2NUP A;  2QYZ A;  4M77 E;  1Y57 A;  2CKK A;  5LJ5 j;  2DXC A;  1OQK A;  1W1F A;  1EX4 A;  3BDL A;  2V8K A;  5C0M A;  2X9H A;  3JB9 J;  4AFZ C;  1RAG B;  3VS1 A;  4F7U A;  5IHN A;  2XMF A;  3M0R A;  1YJN A;  1VYU A;  2HSE B;  4HCC A;  5LJ5 h;  4C0G A;  1ABO A;  2W0Z A;  4N0A C;  2JXB A;  2M0O A;  1I1J A;  2DX1 A;  4J9D A;  2L3R A;  1WYX A;  3MCA B;  3NPF A;  4M78 C;  4QVZ A;  4RG2 A;  2F2X A;  1UB4 A;  2YUQ A;  1MV0 B;  2K5L A;  2L0A A;  5KYN A;  4PJN A;  2RK2 A;  2RQW A;  3CCL A;  3VUZ A;  3QUI A;  3JCM b;  2RM4 A;  1ZSG A;  3X28 B;  2PUO B;  1WJS A;  2JMA A;  1NJI R;  2DNU A;  1VQK A;  1YWO A;  3PGG A;  3HHT B;  4OB2 B;  1Q86 U;  2DTI A;  3CCR A;  3X25 B;  5CK9 A;  3KUF A;  1N8R R;  3DB4 A;  5LJ5 g;  2DBM A;  4K11 A;  4C8Q A;  1WFW A;  2RO0 A;  1YHQ Q;  1Q7Y R;  3M55 A;  2E65 A;  2B8A A;  1LOJ A;  1IO6 A;  4PLI A;  3G1J A;  4PFZ A;  4NL2 A;  1VYT A;  2ZPF B;  3FB9 A;  3WVD B;  1KHI A;  1ZHI A;  1R0C B;  2ZGW A;  1VQ8 A;  1YI2 Q;  1Q81 U;  2V8I A;  2RH2 A;  3H0I A;  3M0T A;  1WA7 A;  1ZSZ C;  5DLO A;  3I5R A;  1IZ6 A;  3OQ5 A;  2NUP B;  3JCM J;  4J6Y A;  3ZBD A;  1BK2 A;  3PMI A;  2SEM A;  4EMG A;  5KYU A;  3JRZ A;  3E9G A;  3QXE B;  4C0F A;  3FJ5 A;  1FMW A;  3Q1J A;  1X75 C;  2L2P A;  2VUB A;  1H3Z A;  3VS6 A;  1QWF A;  1VQ6 Q;  3EH2 A;  4F7U B;  4LD9 K;  2K2M A;  3M54 A;  3MJX A;  1PWT A;  2X3X D;  2QAS A;  1K0S A;  1OUL A;  3CC4 Q;  3VS4 A;  3UDC A;  2WSE E;  2M02 A;  3S6W A;  3CCQ Q;  1X2K A;  1WHH A;  3L42 A;  3LGL A;  4M77 A;  1OV3 A;  4FT2 A;  1AT1 B;  2DVE A;  2O31 A;  5FLX E;  3H9N A;  3J7A F;  2DYB A;  3RDV A;  2M1H A;  4MZP A;  3VUB A;  4GBQ A;  1KC8 R;  1PSF A;  3OYE A;  3EAE A;  5GJV B;  2HKQ B;  2I2L A;  2OI3 A;  2JTM A;  2Z0W A;  4E2F B;  1IGU A;  3X26 B;  4MZT A;  2D8H A;  1E7O A;  2D9T A;  1PG5 B;  2DRM A;  1M30 A;  3UPU A;  3JB9 F;  5AYF A;  1NLO C;  2HQH A;  4ZN1 A;  4C8Q B;  4F7U F;  4ANJ A;  3CC2 A;  3KBG A;  1M8M A;  2A7Y A;  1Y07 A;  4A54 A;  2L89 A;  2VKN A;  3PNW C;  1OOT A;  3CXC P;  3G6E Q;  2LVM A;  1N9S A;  2J6O A;  2LQN A;  1WX6 A;  4RKU E;  4D8D A;  1H3H A;  2DTH A;  2EGE A;  3ZEH A;  2CDT A;  2CSQ A;  5J3B A;  4L6V 5;  3E19 A;  1QKW A;  2DF6 A;  1AWX A;  2GCX A;  2QQS A;  2DFU A;  3CCQ T;  2DEQ A;  2X35 A;  1BU1 A;  3OYC A;  3A8O B;  4J7I A;  5GAN 3;  4E7L A;  1PRM C;  1Q95 G;  5KYU B;  4GLK A;  2KRO A;  4DOW A;  3PMT A;  2DXU A;  3ASK A;  3L2W A;  2IPO B;  2RPN A;  3CD6 A;  3JCM c;  4J9E A;  3LWH A;  1NJI U;  1SSF A;  3PIO A;  2NUZ A;  4M7D D;  1U5S A;  2LMJ A;  3M57 A;  2E12 A;  7AT1 B;  3C12 A;  3MHX A;  4ZN3 A;  1N8R U;  4M75 G;  1QVG P;  4BDY A;  3MP6 A;  4M77 B;  5CAI A;  1CKA A;  5GJW B;  4M78 E;  3H0F A;  1N27 A;  2VYT A;  1QQJ A;  4XTU A;  5FRO A;  3N5B B;  3L2R A;  1H8K A;  2RF0 A;  2RQV A;  4EIK A;  1F1B B;  2YLC A;  1VUB A;  2NUT A;  3CC7 A;  2CZ1 B;  4AG1 C;  3QPH A;  3R6N A;  2DL7 A;  3PVL A;  3CCM T;  1M3A A;  4HXJ A;  1VQ9 T;  3HP9 A;  2KRM A;  5GAN 6;  2EJF A;  1RAC B;  4LUD A;  1B07 A;  1OX8 A;  3I55 Q;  2F1L A;  2DM1 A;  4C8Q C;  1WXB A;  1RAA B;  1BI0 A;  1PCX A;  1RAI B;  3LW5 E;  5D6Y A;  5KYX A;  3OB9 A;  1OU8 A;  1OZ2 A;  4C0D B;  2YRC A;  5A0G A;  1TUC A;  5EG2 A;  3I9Q A;  3CXC S;  1D3B A;  5HK0 A;  4M77 F;  3R6O A;  4X1V A;  1IHW A;  2QTX A;  2BZY A;  2OTL Q;  1M27 C;  1GXI E;  2M9U A;  5KYY A;  1W2B A;  3A8H B;  4Y91 A;  4OGE A;  3M0U A;  3M0S A;  1G8X A;  3UWN A;  3WVE B;  8AT1 B;  4O5V A;  4J9F A;  4E7S A;  3CCS Q;  2IG0 A;  2EYZ A;  1LCK A;  1YJ9 Q;  5GMK l;  1YIJ T;  4BB7 A;  2GGR A;  2C0T A;  4MMK A;  2RI3 A;  2K79 A;  1X27 A;  4TVR A;  1PHT A;  3OS0 A;  4QT7 A;  2HZY A;  1SHG A;  1VQO A;  4LDV A;  4JRQ A;  4M77 C;  3A8G B;  2XG8 D;  2DD4 A;  1QVG S;  2E6Z A;  4FL6 A;  2JW4 A;  2PUK B;  4X9C A;  1X6B A;  2FRW A;  3I55 T;  2CP5 A;  4PKC C;  2DL5 A;  2PNI A;  4C92 D;  5GAN 7;  1A0N B;  3HPW A;  2LX9 A;  2FO0 A;  3EGU A;  1S1N A;  1HYO A;  1GFC A;  1YJW A;  4XU2 A;  4OMP A;  2NUT B;  1MV3 A;  3SFM A;  1IRE B;  3E2U A;  3EG9 A;  1XJW B;  2DAQ A;  4KGX B;  2L8D A;  1WIE A;  2PVD B;  3CCM A;  2OTL T;  3LYI A;  5ECA A;  4M78 A;  2K3X A;  1M9S A;  3DKM A;  3SWN B;  1SKU B;  1KQ1 A;  2JS0 A;  2BZ8 A;  4LXC A;  3VS2 A;  3CME Q;  3FC3 A;  6AT1 B;  2RJF A;  3CCS T;  5KYX B;  4C0D C;  1TWB A;  1M3C A;  3CCE Q;  1G83 A;  1WI7 A;  4J6X A;  1D3B B;  2O4X A;  3OBY A;  2F5T X;  3CCJ A;  4OMM A;  2FYK A;  4IIM A;  2A36 A;  4JRP A;  4A4H A;  1GRI A;  1QVF A;  1X6G A;  4MDW A;  3V7S A;  1WLP B;  1G5V A;  5KYY B;  3HL8 A;  3OYM A;  4BE0 A;  3SDZ A;  4BDZ A;  2KDS A;  1VIE A;  2YUN A;  2ZPG B;  2XHC A;  2R58 A;  2XDP A;  1VQM Q;  1VQ7 Q;  4M7A G;  3EG0 A;  1WJQ A;  4A4F A;  2RB6 A;  1VQ5 T;  2DA9 A;  2LZ6 B;  4BI4 A;  1H92 A;  1K1Z A;  2LC4 A;  1WHL A;  3RMS A;  3OYN A;  4IKF A;  4IUU A;  1IXD A;  1KK7 A;  1RUW A;  2KR3 A;  1K9M C;  3NGP A;  2H3E B;  2LRQ A;  1ZSZ A;  4C8Q G;  3CBM A;  3VV0 A;  1VQK Q;  1RLQ C;  1BIB A;  2PQW A;  2E1H A;  2EW3 A;  3EG3 A;  4Z88 A;  1Y96 A;  5GMK e;  1MNE A;  1G3T A;  1MND A;  4JZ3 A;  1OEB A;  3CME T;  5A0D A;  4XTV A;  4OMN A;  5IAY A;  4PJL A;  3CCU T;  3SD4 A;  1KJW A;  3OYY A;  2LQ8 A;  4OF1 A;  3CCE T;  2KXD A;  2LP5 A;  2DL4 A;  3QBY A;  1C6V X;  2D0Q B;  2XK0 A;  2L5Q A;  3GOX A;  1W2B P;  3EG9 B;  4JLG A;  2XIC A;  4MDX A;  2BKD N;  4LDU A;  1I5O B;  3SWN C;  3RUX A;  2LTO A;  1VQ8 Q;  2P0K A;  3OS5 A;  5LJ5 e;  1JXM A;  1FMV A;  2COW A;  4JDS A;  1WHK A;  3UA7 A;  5KCO A;  3O5Z A;  4GY5 A;  5IXB A;  2DJQ A;  4KH1 B;  1N9R A;  1ZX6 A;  4PJO D;  1VQM T;  3PVQ A;  2MWO A;  1JBM A;  2YUP A;  1VQ7 T;  2KBT A;  3FDR A;  2CGH A;  2JT4 A;  3M56 A;  2K7A A;  2O4X B;  1YIT A;  2COY A;  3JSC A;  2HEQ A;  1WDX A;  5CO7 A;  3J80 E;  2ED1 A;  1AWJ A;  2EQI A;  1QVP A;  3UT1 A;  1Y0M A;  1K8A C;  1M5Q 1;  2DLP A;  1VQP A;  1JXO A;  1Y71 A;  4LDW A;  5GMK j;  1WJR A;  4RTT A;  1SG5 A;  3QZ5 B;  2DD5 A;  1VQL Q;  1VQ5 A;  2DO3 A;  3REA B;  2KRN A;  1BKB A;  4RCB A;  3UA6 A;  1K73 C;  5GAN 8;  2DXB A;  2HL3 A;  2X4X A;  1W6X A;  2QEX A;  1QWE A;  4RMO A;  2FZK B;  4L59 A;  3QDF A;  1SEM A;  2EYW A;  3CMA Q;  3H8Z A;  3P8D A;  4XU1 A;  3MP8 A;  1Y96 B;  3G4S Q;  1TUG B;  2BTT A;  4RG8 A;  5L23 A;  2PVO B;  3CXC A;  1JO8 A;  4E6R A;  3FEO A;  4E7Z A;  1Z9Z A;  3CCU A;  3CC2 Q;  3TCJ A;  4BUG A;  4F16 A;  4M7D B;  3CCV A;  1MUZ A;  5IT9 E;  1QVF P;  4IIO A;  2EKO A;  5IHI A;  4DEX A;  3I56 Q;  1GBR A;  1W2B S;  3TQ7 P;  3D7S B;  2FRY A;  2QA4 A;  1SSH A;  5LJ5 f;  1NPR A;  4KGZ B;  4N4I A;  4OP0 A;  1DJ7 B;  2HKN A;  4PLL A;  4C92 A;  4DQ2 A;  5IN1 A;  1NE8 A;  3BW1 A;  2EAY A;  1BBZ A;  2HAX A;  4OB3 B;  1ZLM A;  4OMF B;  4FYW B;  3DLL A;  3MKD A;  4PJO E;  4ZNX A;  1VOM A;  2LNV A;  2BZX A;  1XOV A;  1Q82 C;  3CD6 Q;  5CKD A;  1NYG A;  1TSF A;  2QQA A;  1QVG A;  4J9H A;  3VKI A;  2E70 A;  2EQM A;  3EHQ A;  3TSW A;  1FX7 A;  5GAN d;  3GNF B;  4LD6 A;  3GNG A;  1FXX A;  1RAH B;  2X4Y A;  3M59 A;  4GLM A;  1UGP B;  4PNO A;  3G71 A;  1VQN A;  4M7D F;  3G7Z A;  3CMA T;  1PNJ A;  1UFF A;  3G4S T;  3LWI A;  5FW9 A;  5DM7 R;  3EFO A;  1AD5 A;  1YCY A;  2ROL A;  4MML A;  4E7H A;  1S72 A;  5CKB A;  2B86 A;  3REB B;  2LX7 A;  3C4S A;  3BE3 A;  5LJ3 d;  2VVK A;  3HFN A;  2F5K A;  1BI3 A;  1UUE A;  3L2U A;  4F04 B;  2SRC A;  3QWY A;  2Y4Y A;  1UGQ B;  3I5S A;  3QHS A;  4J9B A;  2A3L A;  4OMO A;  2AKL A;  2R57 A;  1RAE B;  3NTH A;  4KH0 B;  1PC0 A;  2KY9 A;  4M7D C;  4EMK A;  2OX7 A;  4N4H A;  1KD1 R;  1K0X A;  2DIQ A;  5FWB A;  2CT4 A;  2PU9 B;  1QVF S;  1U06 A;  4D8K A;  1ZQ1 A;  2HSP A;  2XDB A; 
#chains in the Genus database with same CATH homology
 5D6W A;  4X34 A;  2K4Y A;  4J83 A;  1WNL A;  4B9W A;  4JS4 A;  3L2Q A;  2FVU A;  4IUP A;  3PFS A;  4C8Q C;  3QYH B;  1LNX A;  4C92 B;  4ELZ C;  3CME A;  4JJN K;  2QQB A;  3C95 A;  1KC8 C;  1I5L A;  1BI0 A;  4ATO A;  5DLQ E;  1O75 A;  3LW5 E;  5KH6 A;  1VQP T;  1BYM A;  1QW1 A;  2MAM A;  1G3Y A;  5D6Y A;  1I4K 1;  1R8O B;  1OZ2 A;  3OB9 A;  2CS7 A;  1HK9 A;  2RD1 A;  3CCE A;  2KQW A;  1TH7 A;  4C0D B;  4IUQ A;  5GAM e;  5A0G A;  5GAM g;  4JRI A;  5EG2 A;  2O01 E;  1K73 U;  3CXC S;  1D3B A;  1QP3 A;  4ELY C;  5HK0 A;  4M77 F;  1WPY A;  4JLI A;  4J7F A;  4ZTF A;  3R6O A;  5J26 A;  4R56 A;  3OS2 A;  3MP1 A;  4F7U E;  2QTX A;  3BY7 A;  1QP2 A;  4Q5W A;  1YI2 T;  2MWP A;  4BI8 B;  2NLU A;  2RHU A;  1XQH A;  1GXI E;  4JUV A;  2EJ9 A;  4EMH A;  2M9U A;  1W2B A;  3A8H B;  1NZ9 A;  4Y91 A;  1JJ2 A;  4OGE A;  1Q86 C;  2E64 A;  1UGR B;  3RMQ A;  4B9X A;  3PT9 A;  3OYH A;  3HSB A;  3UWN A;  4M75 F;  2XID A;  2OTJ A;  3WVE B;  4M77 D;  2XDD A;  3H6Z A;  4O5V A;  3OMG A;  2QEX T;  4N4G A;  3JCM W;  3PTA A;  3GF5 A;  4XTW A;  3QO3 A;  3BFM A;  3JCM X;  3OW2 S;  2IG0 A;  3M53 A;  1VQM A;  4PJO A;  5GMK l;  1XNI A;  1VQ7 A;  1YIJ T;  2HD0 A;  2YHT A;  1YBY A;  4BB7 A;  3OYL A;  4JS5 A;  1VQL T;  5CQY A;  1OI1 A;  3RKX A;  4HT9 A;  3V7C A;  1VQ6 T;  4LDY A;  4MMK A;  5CKF A;  4M75 D;  2RI3 A;  4E7J A;  5FRM A;  5GAN 5;  3OYJ A;  4TVR A;  2K5F A;  3NTI A;  1KQS S;  4UC4 A;  3OA6 A;  3EFS A;  4M78 G;  3OS0 A;  3CC4 T;  3CCV T;  1VQO A;  3S3O A;  2KK4 A;  2V8J A;  4M7A A;  2HQE A;  1V29 B;  4BY6 C;  4LDV A;  4C92 F;  4JRQ A;  2E5Q A;  3TU4 K;  4M77 C;  2E6N A;  2ZPI B;  2XG8 D;  2ZPH B;  3A8G B;  1Q81 C;  2DD4 A;  2DJZ A;  2WSF E;  2X4J A;  5KCH A;  4E7I A;  2H3J A;  1OYX A;  1QVG S;  1PSE A;  2E6Z A;  3V8K A;  4EPC A;  2VGM A;  5GMK m;  4FL6 A;  4JRK A;  2RHI A;  4KUL A;  1N6A A;  4BD3 A;  2PUK B;  2QA4 T;  3GPL A;  3JCM f;  4X9C A;  3CCR A;  1WGS A;  4M78 B;  3I55 T;  1X6O A;  3ME9 A;  2JOY A;  4Y28 E;  4PKC C;  1KG1 A;  2DXT A;  4C92 D;  4M75 C;  4XQ3 A;  5GAN 7;  5GAM j;  4C8Q E;  3HPW A;  2LX9 A;  2KAF A;  2K5I A;  2QQ9 A;  2KVQ G;  3CC2 T;  2OAU A;  2GF7 A;  2GFA A;  5GAN 2;  3T9N A;  1YJW A;  3GIB A;  4XU2 A;  4C5H A;  2JN0 A;  4EMK B;  3QG1 A;  1KD1 C;  4A53 A;  4OVA A;  3SFM A;  1UGS B;  1IRE B;  2HNI A;  4XU0 A;  2JZ2 A;  1U1S A;  4O6J A;  2IVW A;  4WF2 A;  2DAQ A;  3FRN A;  3I56 T;  2EYQ A;  2L8D A;  2BUD A;  2PVD B;  3SB2 A;  2LQK A;  1BI1 A;  3TEE A;  2HQX A;  2ZPE B;  4FSX A;  3CCM A;  1Q7Y U;  2OTL T;  3CPF A;  3TRE A;  3LYI A;  2RHY A;  1BI2 A;  4XTZ A;  4M78 A;  4MZM A;  3E9F A;  2K3X A;  4ZGJ B;  1M9S A;  3HKS A;  3DKM A;  3SWN B;  4DA4 A;  2ZPB B;  4C92 C;  3RES A;  1KQ1 A;  3NFC A;  4VUB A;  1YHQ A;  1EIF A;  3MO8 A;  3M4Y A;  3FC3 A;  3HFO A;  2RJF A;  3CCS T;  5GAO m;  3M5A A;  4FT4 A;  5GAM f;  4NOY A;  1JRI A;  3G71 T;  3G6E T;  3BDU A;  3LH0 A;  4C0D C;  4C5G A;  5I2M A;  3V8L A;  1VQN T;  2FHD A;  4QQ6 A;  1H64 1;  2LCC A;  3O8V A;  2XKO C;  1VQ4 T;  4OB1 B;  4J6X A;  2MF2 A;  2E41 A;  2F69 A;  3VYG A;  1D3B B;  2O4X A;  3OBY A;  2F5T X;  3CD6 T;  3JCM V;  3CCJ A;  2EQJ A;  2RJC A;  3KXT A;  2FYK A;  1S72 T;  1MGQ A;  4P5N A;  3OY9 A;  4A4H A;  4A4G A;  4JRP A;  1YHQ T;  4ZGE B;  1M90 C;  4PJO G;  1QVF A;  3M9Q A;  3CBP A;  4FM4 B;  1WQ7 A;  4MDW A;  5GAN h;  3SWN A;  1YI2 A;  3V7S A;  4X9D A;  5GMK h;  2DPP B;  3S3N A;  4M78 F;  5FU7 B;  1G5V A;  4Z02 A;  3OYF A;  5GAN 4;  2CZ7 B;  3HL8 A;  1LJO A;  4IUT A;  3OYM A;  4BE0 A;  3SDZ A;  3OYB A;  4BDZ A;  1WQW A;  2KDS A;  3M4G A;  1VIE A;  3JCM d;  4M77 E;  4RCC A;  2ZPG B;  2XHC A;  2RA2 A;  2R58 A;  2CKK A;  5LJ5 j;  2DXC A;  2XDP A;  5CQX A;  4PJO B;  3BDL A;  4C0Z A;  2V8K A;  2VGN A;  5C0M A;  4M78 D;  1KQ2 A;  3OYK A;  4A4F A;  1WJQ A;  4M7A G;  1M8V A;  4J5Y A;  3JB9 J;  1VQL A;  2RB6 A;  1VQ5 T;  3OMC A;  3QII A;  4M75 E;  4F7U A;  3P8B B;  3VU3 C;  4BI4 A;  3L1A A;  5LJ3 h;  2LC4 A;  5L8R E;  3RMS A;  2VC8 A;  3OYN A;  1YJN A;  4IKF A;  4IUU A;  4HCC A;  1M1K C;  1K9M C;  5LJ5 h;  4C0G A;  3CC4 A;  2QDY B;  3CC7 T;  2VV5 A;  2LRQ A;  1G3S A;  3M58 A;  2WAC A;  1X01 A;  3VYH B;  3CCQ A;  4M7A B;  3RIR A;  2DZC A;  4J8O A;  4C8Q G;  4N0A C;  1M90 U;  3CBM A;  3LX7 A;  2M0O A;  3VV0 A;  4BE2 A;  2L3R A;  3MCA B;  1W4S A;  1BIB A;  2JTF A;  3CMA A;  1NPP A;  1KC8 U;  2PQW A;  2E1H A;  1ZBX A;  2FL7 A;  4M78 C;  4QVZ A;  5HY6 A;  5GAN e;  1Y96 A;  4RG2 A;  5GAN g;  4R55 A;  3G4S A;  5GMK e;  2XD0 A;  1UB4 A;  1G3T A;  5GAM d;  2K5L A;  5I2S A;  3F70 A;  3CME T;  3URG A;  5A0D A;  2HBP A;  4XTV A;  2RK2 A;  5IAY A;  3CCL A;  3VUZ A;  3GLX A;  3QUI A;  3CCU T;  3SD4 A;  2GFU A;  2CZ6 B;  5A0L A;  3OYY A;  2LQ8 A;  2RM4 A;  4EMK C;  3JCM b;  4OF1 A;  2D6F A;  4M7D E;  2Y90 A;  1M1F A;  3X28 B;  2RI5 A;  3HRT A;  3CCE T;  2RK1 A;  1KQS A;  4QQD A;  3QBY A;  2PUO B;  1WJS A;  3OYG A;  2D0Q B;  3CPW S;  2XK0 A;  1VQK A;  2L5Q A;  3GOX A;  3I56 A;  4JLG A;  4YTL A;  3PGG A;  2XIC A;  3HHT B;  2BKD N;  2JNG A;  1M1K U;  4OB2 B;  4MDX A;  4LDU A;  1Q86 U;  2DTI A;  2KMT A;  5LJ3 e;  4PJO F;  2EIF A;  3X25 B;  5CK9 A;  2RJD A;  3KUF A;  5LJ3 g;  3OYI A;  3SWN C;  3FIF A;  4XTY A;  2XI9 A;  3RUX A;  2LTO A;  2RJE A;  2P0K A;  3OS5 A;  5LJ5 e;  3DB4 A;  5LJ5 g;  5GAO q;  3CEY A;  4DOV A;  2R5A A;  4JDS A;  3J81 E;  4C8Q A;  4L5G A;  2RO0 A;  3C94 A;  3M55 A;  2E65 A;  1RL2 A;  2B8A A;  4A4E A;  1LOJ A;  5KCO A;  1B34 A;  4GY5 A;  5GAO p;  2K2V A;  3LGF A;  3MEU A;  1N9R A;  3A5Z B;  4PLI A;  2MI6 A;  1VQM T;  4PJO D;  2ZCF B;  1Y7X A;  2MWO A;  1JBM A;  1VQ7 T;  5D6X A;  4M7A F;  1Q82 U;  3FDR A;  4NL2 A;  2CGH A;  2E10 A;  3M56 A;  2ZPF B;  2O4X B;  3FB9 A;  3WVD B;  1YIT A;  1KHI A;  1ZHI A;  3JSC A;  1I8F A;  1VQ9 A;  2DK3 A;  5CO7 A;  3J80 E;  1VIF A;  1O9S A;  1BIA A;  2DIG A;  3RKY A;  2ZGW A;  1VQ8 A;  5FU7 C;  1QVP A;  3UT1 A;  1Q81 U;  4BE1 A;  1K8A C;  2V8I A;  3ZFJ A;  2RI2 A;  1M5Q 1;  2RH2 A;  5CKH A;  1VQ8 T;  3JB9 G;  3QYG B;  1VQO T;  5HK3 A;  4M7A D;  4ZTJ A;  3E1S A;  5DLO A;  2RHX A;  1IZ6 A;  4F7U G;  5GAN j;  3OQ5 A;  1Y71 A;  4OB0 B;  4LDW A;  4C8Q F;  5GMK j;  3JCM J;  1VQP A;  4J6Y A;  3LLR A;  4ME7 A;  1WJR A;  3ZBD A;  3OBW A;  1YJ9 T;  5DY9 A;  4PJO C;  2YRV A;  5M9O A;  3PMI A;  4EMG A;  3JRZ A;  3E9G A;  3QXE B;  4C0F A;  1AHJ B;  2M16 A;  3Q1J A;  3QZ5 B;  2DD5 A;  1X75 C;  3INZ A;  1M4Z A;  2VUB A;  1VQ5 A;  1H3Z A;  2DO3 A;  1MHN A;  4C8Q D;  4F7U B;  4RCB A;  1BKB A;  1K73 C;  3EFR A;  4LD9 K;  2QQR A;  3M54 A;  2JVV A;  3GP8 A;  5GAN 8;  1XTD A;  4QVD A;  3MEW A;  2BIV A;  1YJW T;  2DXB A;  4M7A C;  3QKJ A;  1P92 A;  2LDM A;  2X4X A;  2WSE E;  2LT1 A;  3UDC A;  5LJ3 j;  4HCB A;  3S6W A;  4XK8 E;  2DKG A;  3L42 A;  3LGL A;  2QEX A;  4M77 A;  3FLG A;  3MET A;  4KT0 E;  4RMO A;  3QDR B;  4L59 A;  3OSV A;  2X4W A;  4FT2 A;  2VXF A;  5GAN f;  1K8A U;  2DVE A;  3P8H A;  4M7D G;  5FLX E;  2CZ0 B;  1YIJ A;  3H8Z A;  4OGC A;  2QI2 A;  3J7A F;  3P8D A;  4XU1 A;  3MP8 A;  1Y96 B;  3JCM P;  3OSS C;  3V8J A;  1KD1 U;  4RG8 A;  4BAC A;  2FB7 A;  1VQ6 A;  2PVO B;  3RER A;  2M1H A;  4M75 A;  3CXC A;  4MZP A;  3VUB A;  3FEO A;  3HRS A;  4E7K A;  1HXD A;  1U1T A;  3CCU A;  4IUR A;  1PSF A;  3TCJ A;  2QXF A;  4BUG A;  3OYD A;  3OYE A;  4M7D B;  3CCV A;  3EAE A;  5GMK i;  5IT9 E;  3JB9 H;  2I2L A;  2PVG B;  2EKO A;  3WXM B;  2EWN A;  3MEA A;  4FU6 A;  2P0Q A;  3QZ9 B;  2JTM A;  2Y4X A;  4C5E A;  3MEV A;  5LJ3 f;  5FU6 B;  4A4K A;  3CCJ T;  2LCL A;  4BI3 A;  1W2B S;  2EFI A;  1JJ2 S;  5GAO n;  1I81 A;  2QA4 A;  3X26 B;  4MZT A;  1NPR A;  5LJ5 f;  3OW2 A;  2D9T A;  4N4I A;  4OP0 A;  5A2Q E;  3I55 A;  1DJ7 B;  4EDU A;  4PLL A;  4C92 E;  3UPU A;  5C6S A;  4C92 A;  3JB9 F;  2EJG A;  2K57 A;  4DQ2 A;  5AYF A;  5IN1 A;  5CCA A;  1NE8 A;  4ZN1 A;  4C8Q B;  3L2Z A;  4F7U F;  3CC2 A;  3BW1 A;  3KBG A;  2A7Y A;  2EAY A;  3OS1 A;  2HAX A;  3FJP A;  1Y07 A;  2JUF A;  4OB3 B;  4A54 A;  1B34 B;  2LT4 A;  4OMF B;  4M7D A;  1NJI C;  2L89 A;  3PNW C;  3DLL A;  4PJO E;  4NL3 A;  2LVM A;  1N9S A;  4RKU E;  3JB9 D;  2LNV A;  4QVC A;  1XOV A;  2DTH A;  2GQV A;  1Q82 C;  1N8R C;  1K9M U;  3CBO A;  3ZEH A;  5CKD A;  3CPW A;  3HRU A;  2OTL A;  2DZ9 A;  2QQA A;  4HKE A;  5J3B A;  4L6V 5;  3E19 A;  4C5I A;  1QVG A;  1YJN T;  3VKI A;  3ER0 A;  4CRI A;  2GCX A;  2E70 A;  2EQM A;  1Q7Y C;  1FX7 A;  3RKW A;  2MMP A;  3JCM h;  2QQS A;  1G3W A;  5GAN d;  2AHJ B;  3GNF B;  2DEQ A;  4LD6 A;  3CCQ T;  3GNG A;  4QQG A;  4M7A E;  2OTJ T;  2X35 A;  5FRN A;  2RHZ A;  3CCS A;  1FXX A;  4II1 A;  2X4Y A;  3M59 A;  4PNO A;  3JCM Q;  1UGP B;  3G6E A;  3G71 A;  4KUD K;  2XU8 A;  3OYC A;  3NTK A;  1KHC A;  3A8O B;  4J7I A;  5GAN 3;  3JB9 I;  4E7L A;  2YLB A;  1FWZ A;  2CYZ B;  3G7Z A;  3CMA T;  1VQN A;  4M7D F;  4GLK A;  5CKE A;  5CVI A;  4DOW A;  1M1G A;  3PMT A;  2DXU A;  1VQ4 A;  3ASK A;  3G4S T;  4NS5 A;  3L2W A;  3LWI A;  5DM7 R;  5LL6 S;  1YCY A;  4M77 G;  3JCM c;  3CD6 A;  3QSU A;  4MML A;  4XTX A;  3L2V A;  3OYA A;  3LWH A;  4E7H A;  1S72 A;  3X24 B;  5I21 A;  2G3R A;  1NJI U;  5CKB A;  3A8L B;  3CCL T;  1SSF A;  3PIO A;  3A8M B;  4KUI A;  2K3Y A;  3PIP A;  5GAO r;  4M7D D;  3C4S A;  3M57 A;  5GAO l;  5LJ3 d;  2E12 A;  3HFN A;  2F5K A;  3DB3 A;  1UEB A;  3QJY A;  3C12 A;  3MHX A;  4HCZ A;  4J6W A;  3V7R A;  1BI3 A;  4M75 G;  4ZGD B;  4ZN3 A;  1YJ9 A;  5CR2 A;  1N8R U;  4BY6 B;  4BDY A;  3MP6 A;  5LJ5 d;  1VQK T;  4IUV A;  4M77 B;  3VJP A;  4N0A A;  5CAI A;  3L2U A;  4KBM B;  2R5M A;  1U8R A;  3QJ6 A;  5J39 A;  3AHU A;  5GAM h;  2DTO A;  3CCR T;  2C06 A;  4M78 E;  4E47 A;  2KSS A;  2P4T A;  2Y4Y A;  2WSC E;  1N27 A;  1UGQ B;  2VYT A;  4HA8 A;  4V2S A;  5CIU A;  5HKC A;  3JCM e;  3QHS A;  3JCM g;  4XTU A;  5FRO A;  4D6W A;  2A3L A;  2R57 A;  3NTH A;  3N5B B;  4M75 B;  3L2R A;  4CI0 C;  1JB0 E;  4XU3 A;  1OZ3 A;  1RI0 A;  2KY9 A;  3DLM A;  2P0P A;  4M7D C;  2EQU A;  4EMK A;  2YLC A;  1VUB A;  5KE2 A;  3S3M A;  4N4H A;  3CC7 A;  4PL6 A;  4XAX B;  2CZ1 B;  4C92 G;  5KE3 A;  4LDX A;  3QPH A;  2DIQ A;  4HT8 A;  2PU9 B;  4FIB A;  2ZZD A;  5FU6 C;  1QVF S;  3X20 B;  1YIT T;  3CCM T;  2VXE A;  4QW2 A;  1ZQ1 A;  3JAM E;  1VQ9 T;  3HP9 A;  2XDB A;  2EQK A;  5GAN 6;  2EJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...