1PSQA

Structure of a probable thiol peroxidase from streptococcus pneumoniae
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
163
structure length
163
Chain Sequence
MVTFLGNPVSFTGKQLQVGDKALDFSLTTTDLSKKSLADFDGKKKVLSVVPSIDTGICSTQTRRFNEELAGLDNTVVLTVSMDLPFAQKRWCGAEGLDNAIMLSDYFDHSFGRDYALLINEWHLLARAVFVLDTDNTIRYVEYVDNINSEPNFEAAIAAAKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable thiol peroxidase
publication title Structure of a probable thiol peroxidase from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Oxidoreductase
total genus 48
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2003-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1psqA00
2IJYA 4ZB9A 3RHBA 4OO5A 1DBYA 2O8VB 3WD6A 2QGVA 2VL3A 3OR5A 1R7HA 4ZL9A 4I6XA 2H1DA 3MWHA 1WIKA 3D0ZA 2K6VA 2V2GA 4TN8A 1EGRA 2IFQA 2PBJA 4WXTA 3IRAA 2JZRA 3FW2A 1PL2A 1Z7RA 2B5XA 2LNSA 5G31A 4O7HA 4PX1A 3GTUA 3CBUA 1TK8B 3IHQA 4FO5A 4HI7A 1ACVA 2F9SA 1SJIA 4NHWA 4E8EA 4IELA 3GIXA 3D6IA 1FB0A 1AC1A 2CZ2A 5ECNB 5DALB 2D2ZA 3UOMA 2PU9C 4PNGA 1SD8A 4KH7A 1QFNA 2MMAA 4MJAA 3L9SA 1M0UA 3KZQA 3RBTA 1ZOFA 1YF0A 1EZKA 3KP9A 1SL1B 4K7OA 4OCFA 3TJBA 1A8LA 3QFBC 2NDOA 2RUEA 1JFUA 1QXHA 2WZ9A 3TRQA 3VLNA 3E9JB 2VCVA 1XZOA 3VWVA 4JE1A 3GX8A 2VLTA 4AF2A 2TIRA 1PSQA 2M72A 2YZUA 3KGKA 4QL7A 2DJKA 2GT6A 1PX7A 2DJ1A 2ON7A 2H1GA 4TXOA 5J4UA 3U5RE 1A2MA 3F0IA 2I4AA 1M2DA 5HFIA 1PGTA 1EP8A 3LJRA 4ML1A 3VK9A 3I43A 2CVKA 1A23A 10GSA 1BAYA 2VD1A 2VM2A 3TKQA 2VLVA 4GTUA 1MEKA 3RPNA 2E2MA 4ILFA 3FYGA 2DIZA 2ZCTA 4N0ZA 5CO3A 1T4ZA 3KEBA 4YQMA 1THXA 3TGZA 4XS4A 1SJ6A 5ECQB 3PGTA 1MDKA 1GSYA 5DCHA 3TJJA 6GSTA 1QK8A 1CQGA 3UBKA 1VF2A 1I5GA 6GSWA 2GSQA 3IV4A 2VCQA 3H4KA 4FIWA 2FWFA 2K8SA 2JSYA 4MABA 1C72A 2P5RA 4KSOA 4WKWA 1GUMA 2B6MA 1XOAA 2LV3A 5DJLA 1QUWA 3HJMA 4AGSA 2CVBA 4XHMA 4E8HA 1XIYA 4F0BA 4NV5A 2PGTA 3GV1A 3KIJA 2AV4A 2AB6A 2ON5A 4JR6A 3GRXA 5JCGA 3C1RA 1V57A 2V1MA 3CSJA 2RIIA 2X8GA 1YDKA 1LBKA 2C0FA 2HRNA 6GSYA 2YJ7A 2F3MA 5J5NA 1ERTA 3I9V2 4ML6A 4IBPA 5A4WA 4J56E 2QSIA 1V40A 4HU9A 2HE3A 3ZL5A 1USBA 1GSDA 3FR6A 4F2IA 2JZSA 3GURA 1XOBA 1Z9HA 1UA5A 3LXZA 3CSHA 4TR3A 3P7XA 1GP1A 3GH9A 3A3TA 4CHSA 1Y6EA 4MZBA 4YAPA 3NZNA 3TKRA 3WT1A 2CVDA 2CX3A 1PX6A 2E7PA 5A4UA 4NWYA 1B9XC 4ECJA 4IVFA 1Z6NA 3AY8A 2TRXA 4XRAA 3K8NA 1K3LA 2FGXA 4MK3A 3VWWA 4PXOA 3HY2A 4H86A 2N5AA 4F0CA 3KXOA 4K0NA 4KW6A 5CNWA 2LS5A 1OAZA 3QD9A 3VI7A 3CXGA 1G7OA 5GSSA 2OE1A 3ZMKA 4IP1A 4IQAA 3CMIA 5A5KA 2VL9A 1WE0A 2CV4A 4MH3A 2EC4A 4DSSA 3KP8A 4ACSA 1WJKA 3PH9A 2JACA 1OKTA 2WGRA 3DWVA 3APOA 2RLIA 1RQMA 2HLSA 1TI3A 2I9HA 3DEXA 2AAWA 3HJOA 3KTLA 5B6MA 4HDEA 1EOHA 3D4TA 2RM5A 1U88A 5EY6A 3HKRA 4TR4A 1V9WA 2FHEA 4GCIA 1SYRA 2ES7A 2O89A 4KX4A 16GSA 2A2SA 5EL8A 2H71A 5ECHB 2LKUA 3ISOA 2VOCA 2V41A 3GL5A 1TDIA 1K3YA 2N5FA 1ZZYA 5DAKA 3GUSA 2IPAA 4G2EA 1SK1A 3QAGA 3IXRA 3WT2A 1AUCA 1O8WA 2ALBA 3FZ4A 1DE1A 3RDWA 4J57E 1Z7PA 1X5CA 2L4QA 1FVJA 2GZYA 4GQCA 1NHOA 1T00A 1CQHA 1URMA 4F03A 4F9ZA 2L57A 4NXIA 2LRCA 2OJLA 1S3DA 1BX9A 2MBTA 3N9JA 1XWCA 2L5OA 1GRXA 1U6TA 3M3MA 4I2TA 2GSRA 1PL1A 3QR6A 1AQXA 3GFKA 4XS4B 22GSA 2XHFA 2CAIA 4J2FA 2G2QA 1HYUA 3ZZXA 3LORA 4CDOA 2LJAA 3ERFA 2VIMA 2AUVA 1SD9A 1A2JA 2A4VA 3L0HA 4I97A 2VCXA 3ZVJD 2OADA 2H0IA 2L59A 1ZYEA 3VFIA 5HR3A 1BYEA 1K3OA 4X1UA 3DXBA 5IOWA 1XWAA 4GXZA 3ZFBA 2LRNA 4JR4A 3P2AA 4L0WA 1TKDB 1M9AA 19GSA 1PRXA 2JADA 4POLA 5AN1A 4TOPA 3HXSA 2XC2A 1XPVA 3O6TA 2CX4A 5IPGA 2NBSA 4O32A 1E6BA 3ZIJA 4MZCA 2YANA 1F9MA 1X5DA 4K7IA 3C1SA 20GSA 2GQLA 4FYUA 4JBBA 5B6NA 4ZILA 1F3AA 1R26A 3HDCA 5IMFA 3LXTA 5GAPD 4KCEA 3TDGA 2C0EA 4QQ7A 5EPFA 5CRGA 3UVTA 4GF0A 1XXUA 4FYCA 2NTOA 2B7KA 1G7EA 4V2LA 3G7JA 1ILOA 4EDZA 2GVPA 2C3TA 3GN3A 1TRVA 3Q18A 1WPIA 2R3XA 3BCKA 2OKAA 3ZLPA 4V2NA 1J0FA 4I5QA 2YV7A 4MMMA 3V1WA 2Z9SA 4D73B 1EV9A 4IP6A 1N2AA 5G5EA 14GSA 1EWXA 1GWCA 3HVSA 1U3IA 4ISDA 1F2EA 3IK9A 2KP2A 3FZ9A 1B4QA 1SU9A 4K7NA 3EE2A 2H0GA 4PQ1A 4Q5NA 1SK2A 1G6WA 3F3QA 1GSQA 1OC9A 3UJ1A 2HZEB 3ERGA 4ECBA 5JWQB 3F63A 1NM3A 3DGQA 4TVEA 5KN2A 1FO5A 1TK5B 4MPGA 3M0FA 3D22A 5D9TA 3CRUA 3L9UA 1R4WA 3VI5A 1S3CA 1HNBA 2H1BA 3KM6A 3NIVA 4XCSA 3TUEA 5DJMA 5C04A 2YP6A 1IYIA 3VPTA 2IL3A 3UARA 3EMXA 2M46A 4XS6A 3TKPA 2YWIA 4TR1A 2L6DA 2YCDA 5GAND 4LLRA 6GSXA 1A0RP 1EGOA 4FH8A 3APQA 4HJ2A 5G5FA 2YOIA 2I1UA 2HSYA 4ZIJA 3FEUA 3DVWA 1ERWA 3E3EA 4OO4A 4MPFA 5D9VA 2DJ2A 3VWXA 2WB9A 1V2AA 5FT3A 3A5WA 3UL3A 3KMNA 4DSRA 1PD21 3HYPA 1PMTA 3UVHA 4KGIA 5ECIB 5JWOB 5AISA 2VO4A 3TCOA 4YAVA 2WFCA 3F9UA 1V58A 2LTKA 1WWJA 2KHPA 1SJZA 3GA4A 1HQOA 2LNTA 1Z5YE 3I6AA 3F6DA 4KNDA 1WRYA 4RQRA 1GSSA 1FB6A 2WULA 4OFNA 3HZ8A 2XBIA 2M80A 2H74A 1EEJA 2P31A 2RM6A 2N5BA 2E2GA 1Q98A 3TRXA 3I69A 3H79A 1Z6MA 5H5QA 2CAQA 1OKDA 1YQ1A 3F6FA 2MMOA 3DD3A 3QMXA 3ZIVA 1AAZA 3U6VA 1LJRA 2EIRA 2CA8A 3CSIA 2OBIA 1K0MA 1BEDA 1DUGA 1EOGA 4POKA 1R5AA 2X64A 3CTFA 3KMOA 3IR4A 4NMUA 3TB2A 1HNAA 1SKWB 2VUPA 1GSUA 4MF7A 4V1Ap 4JU5A 4MH2A 4N11A 1OYJA 2H73A 3D4MA 1AQVA 3F8UA 1ZGNA 1B48A 1TU7A 2G0FA 1VF3A 2LSTA 5ID2B 2MZCA 1H75A 4L5LA 3P90A 4IJ3A 1W4VA 2L6CA 3HVXA 2QC7A 2F8FA 1TU8A 2FA8A 5D8IA 4ZXGA 3C7MA 4V1Ag 2HSHA 2O85A 1GLQA 2WDUA 2REMA 4MP4A 1ZL9A 1I9DA 3H1NA 3KCMA 5GZZB 2WRTA 1T4YA 2OA7A 4KSMA 3ME7A 1XVQA 4G10A 4BPYA 2YN1A 3IBHA 1WP0A 3UAPA 4OD7A 1XVWA 3RAZA 2IMIA 4MF6A 4TRXA 1FW1A 3DIEA 3WYWA 4HOJA 3SBCA 1ST9A 1GL8A 2PMTA 3APSA 1TJDA 3A2XA 3HZ4A 2I81A 2C3QA 1BJXA 1O6JA 1E2YA 4KDUA 3WGDA 5B8BA 4EVMA 1T3BA 3BJ5A 2XPDA 2DMLA 1WMJA 3FZ5A 4LA1A 4GQFA 3LWAA 1M2BA 3DYRA 3ZMLA 1ERUA 4K6XA 3TKSE 1WOUA 5G2ZA 2H01A 4MJEA 3D5JA 5HR2A 1XCCA 2XBQA 3KH9A 4DSQA 4HEA2 3FRCA 3ZYWA 4JRRA 3ERWA 5D73A 2IFQB 2VL2A 2F51A 2WCIA 4EDYA 4OCEA 5J3RA 2MBSA 3TRPA 2JU5A 1SKRB 3GTUB 1X9SB 1SL2B 2KP1A 1B9YC 4N10A 3SWLA 1A2LA 3IK7A 4MJBA 4ZB6A 1X9MB 2J23A 2VD0A 3QFAC 1VRSD 5HR1A 1XW5A 4XTSA 2H72A 5DALA 2IMDA 4MCUA 2JZTA 2LJKA 1FHEA 3Q74A 4P3YB 1EV4A 3VURA 5D96A 4ECIA 2R37A 3WGXA 1ZYQB 3ZREA 3PR8A 1K0AA 4WF5A 5HQPA 2GDRA 2BTOT 5KN3A 4PQHA 3QAVA 2FCHA 4WF4A 4X43A 1TRUA 1KBNA 3CRTA 4K9ZA 3IE3A 3D21A 3RHCA 2R6KA 4NV2A 5CYYA 2L4CA 4GSSA 1YEXA 4X0XA 4GSTA 2B1LA 2MMNA 2CT6A 1B4PA 3C71A 3DRNA 4G19A 4TXOB 2YNXA 3F4RA 4WETA 2I3YA 3M9KA 1TK0B 4XRDA 4IQ1A 5LCZA 1QGVA 2DMMA 4XIHA 4AJ8A 1F37A 2JL4A 1OC8A 4HZ2A 1GTBA 3GX0A 1HNCA 1JLVA 1J9BA 4KAEA 2IMFA 1M7TA 3IAS2 4EO3A 3HD5A 4K0GA 2HZFA 1A24A 2H0HA 3ED3A 4IHUA 4L5OA 4DVCA 4GSNA 5IPHA 4EF0A 3IPZA 1Z3EA 1GULA 5GSTA 1GLPA 1OE8A 2H75A 1TXXA 1KNGA 1S3AA 4ID0A 1O7UA 1K0BA 4L0UA 4K8MA 3ZRDA 2YWOA 4AJ7A 5ABRA 1AIUA 4K1FA 4PURA 1OVNA 2H70A 3TOTA 5B8AA 3FY7A 1ERVA 4ZB8A 1PQNA 4MF5A 1JZRA 3QAWA 3CYNA 1GSEA 5ECLB 4N0VA 4TKYA 4GRFA 2FLSA 2PVQA 4PGTA 9GSSA 1YZXA 1JZDA 1GNWA 2YV9A 5COHA 3QCPA 2H8LA 3GH6A 5JCWA 3H93A 4IJIA 1HD2A 3EWLA 3KTBA 5ECKB 4JZQA 4EUYA 4O5RA 2HFDA 5KEJA 1GUKA 1ZCPA 2V6OA 1V98A 1SKSB 1VF1A 3KJYA 4I2UA 2VCWA 4KDXA 5F07A 3EU3A 4MLYA 2CQ9A 5IO2A 4POMA 2B7JA 2GTUA 2X99A 4EL1A 1VGLA 2A2RA 3FKFA 3GKKA 3O76A 5ELAA 3E0UA 4AJ6A 3TKSA 1GSFA 1Q4JA 1T7PB 2LRTA 2C80A 3UMAA 5IOXA 2EIQA 3IDVA 2OBKA 18GSA 2YWMA 2FWHA 2OACA 2LEGA 2GS3A 1A0FA 1AW9A 2PUKC 3P8WA 4IN0A 2K9FA 3EINA 1Y25A 3EU4A 3MAKA 1AQWA 4HS1A 5A4VA 4F82A 2VM1A 4BA7A 1X9WB 4IKHA 5CREA 2HI7A 4RQXA 1YKCA 2BMXA 1NHYA 3LFLA 4MZWA 4YQUA 5LNKe 2MYGA 2VL2C 1ZMAA 1TP9A 4ZBAA 1PN9A 5IMVA 3QOUA 1K0CA 1NW2A 1B8XA 2AYTA 2RUFA 3MSZA 3TOUA 2C3NA 1TI1A 2H19A 4BWSA 2VCTA 2HYXA 2OE0A 4HQSA 3BD2A 5HFGA 5C00A 3J7Yk 4DSSB 5F05A 1O85A 3LSZA 1RW1A 5L71A 3A2VA 3G7YA 4WR4A 5IMZA 2EIOA 2O7KA 3IAM2 5AIVA 1F6MC 2VLUA 2FWEA 4MJCA 3LYKA 1THOA 4HJMA 1K0DA 4KE3A 2R5GA 3G9BA 1DE2A 1PA3A 4BL7A 1K0OA 3FK8A 4OFTA 2H1AA 4YH2A 5J9BA 1R5PA 1YF1A 5E59A 2LJRA 4NPBA 2YWNA 4LL1B 4PQIA 5DDLA 3DKSA 2HNLA 2PPTA 2DJJA 17GSA 5DAKB 3Q19A 4IS0A 4WBRD 2GSTA 5D9XA 4ZBBA 3GSTA 1GUHA 3FZAA 3F3RA 2F8AA 3G7IA 1AXDA 3LGCA 1FOVA 1XW9A 1JHBA 1G0TA 2KLXA 3MNGA 4Q5QA 3IOSA 1GTUA 2DBCA 5F06A 2X8HA 1J08A 2PWJA 4ZL7A 4JEDA 1YJ6A 5ECSA 1NSWA 1PKZA 4HQZA 4BVYA 1JZOA 2QKEA 2DLXA 4KCAA 4YQVA 1KTEA 2AHEA 5ECRB 3BBYA 12GSA 1M99A 4N30A 3LQ7A 2YZHA 2FY6A 4ECCA 2DJ0A 1RK4A 5ECMB 1YEPA 13GSA 2FA4A 3HA9A 4LL4B 2O87A 1UC7A 1MDJA 6GSSA 2H66A 2R2JA 1SK0A 3FHKA 1UN2A 2K18A 2PVOC 3R2QA 2B3SA 5HR0A 2FNOA 2MMZA 5E4WA 2LQQA 1YKAA 3BOAA 5AIXA 3PINA 4V2MA 4PUFC 2X8CA 5IMCA 4HUAA 5ECPB 1JZWA 3TKSC 1MD4A 1MDIA 3RPPA 1XFLA 5B7CA 1GTIA 4Q5FA 2NPBA 2R4VA 1VF4A 3HVVA 2FWGA 2FD3A 4ULXA 3KD0A 4DEJA 2LUSA 5DBQA 3IC4A 5IMAA 2GSSA 5H5RA 1FG4A 5CP1A 2IMEA 3US3A 2HT9A 4D73A 4HZ4A 1G6YA 1ABAA 1X0RA 3M9JA 2DC5A 3FR9A 3UIWA 1XWBA 5CRWA 4EKZA 2BJXA 4OWYA 2C8UA 2B5YA 3GMFA 1O81A 2P0GA 3DVXA 3EVIA 11GSA 2VCZA 4TR0A 4IW9A 3L4NA 2H30A 3F4SA 2HZEA 1OE7A 5HFKA 2H6ZA 4LMVA 2B5EA 3W6GA 5IM9A 1OC9B 1GTAA 2IWTA 3VWUA 1M2AA 5G1KA 2GQKA 2OE3A 2DJ3A 3M8NA 2WJUA 3ZFLA 1GNEA 4Q5RA 3IA1A 5J41A 3EC3A 3ZTLA 3MDKA 5ENUA 3VPQA 2J9HA 1F3BA 4KB3A 1TW9A 3W8JA 4EXJA 2V32A 1EEMA 2E0QA 4CW9A 3ME8A 3BCIA 3NOFA 3W8SA 2XPEA 2C0DA 4LMWA 5FHIA 1QMVA 1XW6A 1ML6A 1LU4A 4O92A 4RI6A 4TR1B 1TOFA 3QDNA 5KN0A 1PKWA 1U87A 5LD0A 2H6XA 2IN3A 1JLWA 4OFMA 5IIZA 5JWRB 3GHAA 4L8EA 1FVKA 2ZUPA 3DMLA 2KUCA 5IMDA 4BVXA 5DQSA 2LQOA 2K8VA 1OC3A 5CRHA 2WS2A 4K2DA 1MTCA 5ELGA 3LYPA 1XBSA 1SL0B 4Z7XA 2VAFA 4ZL8A 2B1KA 5CRDA 4GLTA 3L9VA 3TJKA 4PNFA 2H6YA 1TRWA 2L5LA 5DVBA 3LG6A 5H5SA 5G30A 4KA0A 4WR5A 1M9BA 3UEMA 2IIYA 4PUAA 1YY7A 3HCZA 1T8EB 2C0GA 3A2WA 5JCUA 3JCML 2HRFA 3S9FA 5IQYA 1KEBA 2C1YA 4NHZA 4EC0A 5CAXA 5D9WA 5DQYA 4WEYA 2NVLA 5IO0A 2DIYA 4GWRA 1N8JA 1XWKA 3M1GA 3GNJA 3FR3A 1GH2A 1SYXA 1IYHA 2TRCP 5ECOB 4MDCA 1O73A 2PERA 3CTGA 4RUVA 2GZZA 6GSVA 2AJQB 4KDYA 3GL3A 3EURA 2KOKA 4QL9A 4WBJA 3GKMA 2GLRA 3WGEA 8GSSA 1X5EA 7GSSA 4POBA 1T1VA 1H4OA 3L78A 3KH7A 5DCGA 3H8QA 3Q6OA 5ID2A 5EVOA 4G9HA 2GGTA 4NAXA 4BWQA 3EYTA 2ZNMA 1K0NA 4RI7A 4OMVA 5INYA 4XS1A 5D93A 2YPMA 1O8XA 2PN8A 3HJPA 3LEFA 3GKXA 3F4TA 1EP7A 4MA9A 3C73A 4TXVA 3EMPA 3O3TA 4HU7A 2DSAA 1QQ2A 3N5OA 1MD3A 3GKNA 2YJHA 3QPMA 4KUNA 2IMKA 1TTZA 1XWGA 4EE0A 2HXKA 1DSBA 2FUG2 1UVZA 3GSSA 5FWGA 2GZPA 3ZVJA 1FAAA 1SENA 2V6KA 3TJGA 3C8EA 4FYBA 1BG5A 3ZITA 2GT5A 4TW5A 3UBLA 5J9CA 5F0GA 5F8BA 3HHVA 1TRSA 1U3AA 5AGYA 2JSZA 3J7Yb 2GQMA 1W89A 3GYKA 4I8BA 5KN1A 6GSUA 2CZ3A 2P5QA 2C4JA 2H76A 1ON4A 4IGJA 4ZBDA 5G1LA 1BQ7A 3TJFA 1A8YA
chains in the Genus database with same CATH superfamily
2IJYA 4ZB9A 3RHBA 4EIQA 4OO5A 1DBYA 2O8VB 3WD6A 2QGVA 2VL3A 3OR5A 1R7HA 4ZL9A 4I6XA 2H1DA 3MWHA 1WIKA 3D0ZA 2K6VA 2V2GA 4TN8A 1EGRA 2IFQA 2PBJA 4WXTA 5KOWA 3IRAA 2JZRA 3FW2A 1PL2A 1Z7RA 2B5XA 2LNSA 5G31A 2R0CA 4O7HA 4PX1A 3GTUA 3CBUA 3HVNA 1TK8B 3IHQA 4FO5A 4HI7A 1ACVA 2F9SA 1SJIA 4NHWA 4E8EA 4IELA 3GIXA 2HRKA 3D6IA 1FB0A 1AC1A 2CZ2A 5ECNB 5DALB 2D2ZA 3UOMA 2PU9C 4PNGA 1SD8A 4KH7A 1QFNA 2MMAA 4MJAA 3L9SA 1M0UA 3KZQA 3RBTA 1ZOFA 1YF0A 1EZKA 3KP9A 1SL1B 4Z2TA 4K7OA 4OCFA 3TJBA 1A8LA 3QFBC 2NDOA 2RUEA 1JFUA 1QXHA 2WZ9A 3TRQA 3VLNA 3E9JB 2VCVA 1XZOA 3VWVA 4JE1A 3GX8A 2VLTA 4AF2A 2TIRA 1PSQA 2M72A 2YZUA 3KGKA 4QL7A 2DJKA 2GT6A 1PX7A 2DJ1A 2ON7A 2H1GA 4TXOA 5J4UA 3U5RE 1A2MA 3F0IA 2I4AA 1M2DA 5HFIA 1PGTA 1EP8A 3LJRA 4ML1A 3VK9A 1M3JA 3I43A 2CVKA 1A23A 10GSA 1BAYA 2VD1A 1S3RA 2VM2A 3TKQA 2VLVA 4GTUA 1MEKA 3RPNA 2E2MA 4ILFA 3FYGA 2DIZA 2ZCTA 4N0ZA 5CO3A 1T4ZA 3KEBA 3IHGA 4YQMA 1THXA 3TGZA 4XS4A 1SJ6A 5ECQB 3PGTA 1MDKA 1GSYA 5DCHA 1ZYNA 3TJJA 6GSTA 1QK8A 1CQGA 3UBKA 1VF2A 1I5GA 6GSWA 2GSQA 3IV4A 2VCQA 3H4KA 4FIWA 2FWFA 2K8SA 2JSYA 4MABA 1C72A 2P5RA 4KSOA 4WKWA 1GUMA 2B6MA 3IC8A 1XOAA 2LV3A 5DJLA 1QUWA 3HJMA 4AGSA 2CVBA 4XHMA 4E8HA 1XIYA 4F0BA 4NV5A 2PGTA 3GV1A 3KIJA 2AV4A 2AB6A 2ON5A 4JR6A 3GRXA 4USSA 5JCGA 2X49A 3C1RA 1V57A 2V1MA 3CSJA 2RIIA 2X8GA 4CY6A 1YDKA 1LBKA 2C0FA 2HRNA 6GSYA 2YJ7A 2F3MA 5J5NA 1ERTA 3I9V2 4ML6A 4IBPA 5A4WA 4J56E 2QSIA 1V40A 4HU9A 2HE3A 3ZL5A 1USBA 1GSDA 3FR6A 4F2IA 2JZSA 3GURA 1XOBA 1Z9HA 1UA5A 3LXZA 3CSHA 4TR3A 3P7XA 1GP1A 3GH9A 3A3TA 4CHSA 1Y6EA 4MZBA 4YAPA 3NZNA 3TKRA 3WT1A 2CVDA 2CX3A 1PX6A 2E7PA 5A4UA 4NWYA 1B9XC 4ECJA 4IVFA 1Z6NA 3AY8A 2TRXA 2R0PA 4XRAA 3K8NA 1M3IA 1K3LA 2FGXA 4MK3A 3VWWA 4PXOA 3HY2A 4H86A 2N5AA 4F0CA 3KXOA 4K0NA 5BMUA 4KW6A 5CNWA 2LS5A 1OAZA 3QD9A 3VI7A 3CXGA 1G7OA 5GSSA 2OE1A 3ZMKA 4IP1A 4IQAA 3CMIA 5A5KA 2VL9A 4G0LA 1WE0A 2CV4A 4MH3A 2EC4A 2HSMA 4DSSA 3KP8A 4ACSA 1WJKA 3PH9A 2JACA 1OKTA 2WGRA 3DWVA 3APOA 2RLIA 1RQMA 2HLSA 1TI3A 2I9HA 3DEXA 2AAWA 3HJOA 3KTLA 5B6MA 4HDEA 1EOHA 3D4TA 2RM5A 1U88A 5EY6A 3HKRA 4TR4A 1V9WA 2FHEA 4GCIA 1SYRA 4BL7B 2ES7A 2O89A 4KX4A 16GSA 2A2SA 5EL8A 2H71A 5ECHB 2LKUA 3ISOA 2VOCA 2V41A 3GL5A 1TDIA 4CY8A 1K3YA 5BRTA 2N5FA 1ZZYA 5DAKA 3GUSA 2IPAA 4G2EA 1SK1A 3QAGA 3IXRA 3WT2A 1AUCA 1O8WA 2ALBA 3FZ4A 1DE1A 3RDWA 4J57E 1Z7PA 1X5CA 2L4QA 1FVJA 2GZYA 4GQCA 1NHOA 1T00A 1CQHA 1URMA 4F03A 4YKFA 4F9ZA 2L57A 4NXIA 2LRCA 2OJLA 1S3DA 1BX9A 2MBTA 3N9JA 1XWCA 2L5OA 1GRXA 1U6TA 3M3MA 4I2TA 2GSRA 1PL1A 3QR6A 1AQXA 3GFKA 4XS4B 22GSA 2XHFA 2CAIA 4J2FA 2G2QA 1HYUA 3ZZXA 3LORA 4CDOA 2LJAA 3ERFA 2VIMA 2AUVA 1SD9A 1A2JA 2A4VA 3L0HA 4I97A 2HRAA 2VCXA 4BVYB 3ZVJD 2OADA 4O5QA 2H0IA 2L59A 1ZYEA 3VFIA 5HR3A 1BYEA 1K3OA 4X1UA 3DXBA 5IOWA 1XWAA 4GXZA 3ZFBA 2LRNA 4JR4A 3P2AA 4L0WA 1TKDB 1M9AA 19GSA 1PRXA 2JADA 4POLA 5AN1A 4TOPA 3HXSA 2XC2A 1XPVA 3O6TA 2CX4A 5IPGA 2NBSA 4O32A 1E6BA 3ZIJA 4MZCA 2YANA 1F9MA 1X5DA 4K7IA 3C1SA 20GSA 2GQLA 4K2XA 4FYUA 4JBBA 5B6NA 4ZILA 1F3AA 1R26A 3HDCA 5IMFA 3LXTA 5GAPD 4KCEA 3TDGA 2C0EA 4QQ7A 5EPFA 5CRGA 3UVTA 4GF0A 1XXUA 4FYCA 2NTOA 2B7KA 1G7EA 4V2LA 3G7JA 2QA1A 1ILOA 4EDZA 2GVPA 2C3TA 3GN3A 1TRVA 3Q18A 1WPIA 2R3XA 3BCKA 2OKAA 3ZLPA 4V2NA 1J0FA 4I5QA 2YV7A 4MMMA 3V1WA 2Z9SA 4D73B 1EV9A 4IP6A 1N2AA 5G5EA 14GSA 1EWXA 1GWCA 3HVSA 1U3IA 4ISDA 4K5SA 1F2EA 3IK9A 2KP2A 3FZ9A 2A2PA 1B4QA 1SU9A 4K7NA 3EE2A 2H0GA 4PQ1A 4Q5NA 1SK2A 1G6WA 3F3QA 1GSQA 1OC9A 3UJ1A 2HZEB 3ERGA 4ECBA 2X4AA 5JWQB 3F63A 1NM3A 3DGQA 4TVEA 5KN2A 1FO5A 1TK5B 4MPGA 3M0FA 3D22A 5D9TA 3CRUA 3L9UA 1R4WA 3VI5A 1S3CA 1HNBA 2H1BA 3KM6A 3NIVA 4XCSA 3TUEA 5DJMA 5C04A 2YP6A 1IYIA 3VPTA 2IL3A 3UARA 3EMXA 2M46A 4XS6A 3TKPA 2YWIA 4TR1A 2L6DA 2YCDA 5GAND 4LLRA 6GSXA 1A0RP 1EGOA 1PN0A 4FH8A 3APQA 4HJ2A 5G5FA 2YOIA 2I1UA 2HSYA 4ZIJA 3FEUA 3DVWA 1ERWA 3E3EA 4OO4A 4MPFA 5D9VA 4BVXB 2DJ2A 3VWXA 2WB9A 1V2AA 5FT3A 3A5WA 3UL3A 3KMNA 4DSRA 1PD21 3HYPA 1PMTA 3UVHA 4KGIA 5ECIB 5JWOB 5AISA 2VO4A 3TCOA 4YAVA 2WFCA 3F9UA 1V58A 2LTKA 1XG8A 1WWJA 2KHPA 1SJZA 3GA4A 1HQOA 2LNTA 1Z5YE 3I6AA 3F6DA 4KNDA 1WRYA 3LW9A 4RQRA 1GSSA 1FB6A 2WULA 4OFNA 3HZ8A 2XBIA 2M80A 2H74A 1EEJA 2P31A 2RM6A 2N5BA 2E2GA 1Q98A 3TRXA 3I69A 3H79A 1Z6MA 5H5QA 2CAQA 1OKDA 1YQ1A 3F6FA 2MMOA 3DD3A 3QMXA 3ZIVA 1AAZA 3U6VA 1LJRA 2EIRA 2CA8A 3CSIA 2OBIA 1K0MA 1BEDA 1DUGA 1EOGA 4POKA 1R5AA 2X64A 3CTFA 3KMOA 3IR4A 4NMUA 3TB2A 1HNAA 1SKWB 2VUPA 1GSUA 4MF7A 4V1Ap 4JU5A 4MH2A 4N11A 1OYJA 2H73A 3D4MA 1AQVA 3F8UA 1FOHA 1ZGNA 1B48A 1TU7A 2G0FA 1VF3A 2LSTA 5ID2B 2MZCA 1H75A 4L5LA 3P90A 4IJ3A 1W4VA 2L6CA 3HVXA 2QC7A 2F8FA 1TU8A 2FA8A 5D8IA 3EPTA 4ZXGA 4FQUA 3C7MA 4V1Ag 2HSHA 2O85A 1GLQA 2WDUA 2REMA 4MP4A 1ZL9A 1I9DA 3H1NA 3KCMA 5GZZB 2WRTA 1T4YA 2OA7A 4KSMA 3ME7A 1XVQA 4G10A 4BPYA 2YN1A 3IBHA 1WP0A 3UAPA 4OD7A 1XVWA 3RAZA 2IMIA 4MF6A 4TRXA 1FW1A 3DIEA 3WYWA 4HOJA 3SBCA 1ST9A 1GL8A 2PMTA 3APSA 1TJDA 3A2XA 3HZ4A 2I81A 2C3QA 1BJXA 1O6JA 1E2YA 4KDUA 3WGDA 5B8BA 4EVMA 1T3BA 3BJ5A 2XPDA 2DMLA 1WMJA 3FZ5A 4LA1A 4GQFA 3A5IA 3LWAA 1M2BA 3DYRA 3ZMLA 1ERUA 4K6XA 3TKSE 1WOUA 5G2ZA 2H01A 4MJEA 3D5JA 5HR2A 1XCCA 2XBQA 3KH9A 4DSQA 4HEA2 3FRCA 3ZYWA 4JRRA 3ERWA 2IFQB 2VL2A 5D73A 2F51A 2WCIA 4EDYA 4OCEA 5J3RA 2MBSA 3TRPA 2JU5A 4X4JA 1SKRB 3GTUB 1X9SB 1SL2B 2KP1A 1B9YC 4N10A 3SWLA 1A2LA 3IK7A 4MJBA 4ZB6A 1X9MB 2J23A 2VD0A 3QFAC 1VRSD 5HR1A 1XW5A 4XTSA 2H72A 5DALA 2IMDA 4MCUA 2JZTA 2LJKA 1FHEA 3Q74A 4YKGA 4P3YB 1EV4A 3VURA 5D96A 4ECIA 2R37A 3WGXA 1ZYQB 3ZREA 3PR8A 1K0AA 4WF5A 5HQPA 2GDRA 2BTOT 5KN3A 4PQHA 3QAVA 2FCHA 4WF4A 4X43A 1TRUA 1KBNA 3CRTA 4K9ZA 3IE3A 3D21A 3RHCA 2R6KA 4NV2A 5CYYA 2L4CA 4GSSA 2R0GA 1YEXA 4X0XA 4GSTA 2B1LA 2MMNA 2CT6A 1B4PA 3C71A 3DRNA 4G19A 4TXOB 2YNXA 3F4RA 4WETA 2I3YA 3M9KA 1TK0B 4XRDA 4IQ1A 5LCZA 1QGVA 3MYDA 2DMMA 4XIHA 4AJ8A 1F37A 2JL4A 1OC8A 4HZ2A 1GTBA 3GX0A 1HNCA 1JLVA 1J9BA 4KAEA 2IMFA 1M7TA 3IAS2 4EO3A 3HD5A 4K0GA 2HZFA 1A24A 2H0HA 3ED3A 4IHUA 4L5OA 4DVCA 4GSNA 5IPHA 4EF0A 3IPZA 1Z3EA 1GULA 5GSTA 1GLPA 1OE8A 2H75A 1TXXA 1KNGA 1S3AA 4ID0A 1O7UA 1K0BA 4L0UA 4K8MA 3ZRDA 2YWOA 4AJ7A 5ABRA 1AIUA 4K1FA 4PURA 1OVNA 2H70A 3TOTA 5B8AA 3FY7A 1ERVA 4ZB8A 1PQNA 4MF5A 1JZRA 3QAWA 3CYNA 1GSEA 5ECLB 4N0VA 4TKYA 4MNNA 4GRFA 2FLSA 2PVQA 4PGTA 9GSSA 1YZXA 1JZDA 1GNWA 2YV9A 5COHA 3QCPA 2H8LA 3GH6A 5JCWA 3H93A 4IJIA 1HD2A 3EWLA 3KTBA 5ECKB 4JZQA 4EUYA 4O5RA 2HFDA 5KEJA 1GUKA 1ZCPA 2V6OA 1V98A 1SKSB 1VF1A 3KJYA 4I2UA 2VCWA 4KDXA 5F07A 3EU3A 4MLYA 2CQ9A 5IO2A 4POMA 4HSCX 2B7JA 2GTUA 2X99A 4EL1A 1VGLA 2A2RA 3FKFA 3GKKA 3O76A 2DKHA 5ELAA 3E0UA 4AJ6A 3TKSA 1GSFA 1Q4JA 1T7PB 2LRTA 2C80A 3UMAA 5IOXA 2EIQA 3IDVA 2OBKA 18GSA 2YWMA 2FWHA 2OACA 2LEGA 2GS3A 1A0FA 1AW9A 2PUKC 3P8WA 4IN0A 2K9FA 3EINA 1Y25A 3EU4A 3MAKA 1AQWA 4HS1A 5A4VA 4F82A 2VM1A 4BA7A 1X9WB 4IKHA 5CREA 2HI7A 4RQXA 1YKCA 2BMXA 1NHYA 3LFLA 4MZWA 4YQUA 5LNKe 2MYGA 2VL2C 1ZMAA 5KOXA 2DKIA 1TP9A 4ZBAA 1PN9A 5IMVA 3QOUA 1K0CA 1NW2A 1B8XA 2AYTA 2RUFA 3MSZA 3TOUA 2C3NA 1TI1A 2H19A 4BWSA 2VCTA 2HYXA 2OE0A 4HQSA 3BD2A 5HFGA 5C00A 3J7Yk 4DSSB 5F05A 1O85A 3LSZA 1RW1A 5L71A 3A2VA 3G7YA 4WR4A 5IMZA 4G0KA 2EIOA 2O7KA 3IAM2 5AIVA 1F6MC 2VLUA 3PPUA 2FWEA 4MJCA 3LYKA 1THOA 4HJMA 1K0DA 1PFOA 4KE3A 2QA2A 2R5GA 3G9BA 1DE2A 1PA3A 4BL7A 2A4HA 1K0OA 3FK8A 4OFTA 2H1AA 4YH2A 5J9BA 1R5PA 1YF1A 5E59A 4EIPA 2LJRA 4NPBA 2YWNA 4LL1B 4PQIA 5DDLA 3DKSA 2HNLA 2PPTA 2DJJA 17GSA 5DAKB 4Z2RA 3R3EA 3Q19A 4IS0A 4WBRD 2GSTA 5D9XA 4ZBBA 3GSTA 1GUHA 3FZAA 3F3RA 2F8AA 3G7IA 1AXDA 3LGCA 1FOVA 1XW9A 1JHBA 1G0TA 2KLXA 3CQFA 3MNGA 4Q5QA 3IOSA 1GTUA 2DBCA 5F06A 2X8HA 1J08A 2PWJA 4ZL7A 4JEDA 1YJ6A 5ECSA 1NSWA 1PKZA 4HQZA 4BVYA 1JZOA 2QKEA 2DLXA 4KCAA 4YQVA 1KTEA 2AHEA 5ECRB 3BBYA 12GSA 1M99A 4N30A 3LQ7A 2YZHA 2FY6A 4ECCA 2DJ0A 1RK4A 5ECMB 1YEPA 13GSA 2FA4A 3HA9A 4LL4B 2O87A 1UC7A 1MDJA 6GSSA 2H66A 2R2JA 1SK0A 3FHKA 1UN2A 2K18A 2PVOC 3R2QA 2B3SA 5HR0A 2FNOA 2MMZA 5E4WA 2LQQA 1YKAA 3BOAA 5AIXA 3PINA 4V2MA 4PUFC 2X8CA 5IMCA 4HUAA 5ECPB 1JZWA 3TKSC 1MD4A 1MDIA 3RPPA 1XFLA 5B7CA 1GTIA 4Q5FA 2NPBA 2R4VA 1VF4A 3HVVA 4O5UA 2FWGA 2FD3A 4ULXA 3KD0A 4DEJA 2LUSA 5DBQA 3IC4A 5IMAA 2GSSA 5H5RA 1FG4A 3FMWA 5CP1A 2IMEA 3US3A 2HT9A 4D73A 3MIXA 4HZ4A 1G6YA 1ABAA 1X0RA 3M9JA 2DC5A 3FR9A 3UIWA 1XWBA 5CRWA 4EKZA 2BJXA 4OWYA 2C8UA 2B5YA 3GMFA 1O81A 4ICYA 2P0GA 3DVXA 3EVIA 11GSA 2VCZA 4TR0A 4IW9A 3L4NA 2H30A 3F4SA 2HZEA 1OE7A 5HFKA 2H6ZA 4LMVA 2B5EA 3W6GA 5IM9A 1OC9B 1GTAA 2IWTA 3VWUA 1M2AA 5G1KA 2GQKA 2OE3A 2DJ3A 3M8NA 2WJUA 3ZFLA 1GNEA 4Q5RA 3IA1A 5J41A 3EC3A 3ZTLA 3MDKA 5ENUA 3VPQA 2J9HA 1F3BA 4KB3A 1TW9A 3W8JA 4EXJA 2V32A 1EEMA 2E0QA 4CW9A 3ME8A 3BCIA 3NOFA 3W8SA 2XPEA 2C0DA 4LMWA 5FHIA 1QMVA 1XW6A 1ML6A 1LU4A 4O92A 4RI6A 4TR1B 1TOFA 3QDNA 5KN0A 1PKWA 1U87A 5LD0A 2H6XA 2IN3A 1JLWA 4OFMA 5IIZA 5JWRB 3GHAA 4L8EA 1FVKA 2ZUPA 3DMLA 1ZYPA 2KUCA 5IMDA 4BVXA 5DQSA 2LQOA 2K8VA 1OC3A 5CRHA 2WS2A 4K2DA 1MTCA 5ELGA 3LYPA 1XBSA 1SL0B 4Z7XA 2VAFA 4ZL8A 2B1KA 5CRDA 4GLTA 3L9VA 3TJKA 4PNFA 2H6YA 1TRWA 2L5LA 5DVBA 3LG6A 5H5SA 5G30A 4KA0A 4WR5A 1M9BA 3UEMA 2IIYA 4PUAA 1YY7A 3HCZA 1T8EB 2C0GA 3A2WA 5JCUA 3JCML 2HRFA 3S9FA 5IQYA 1KEBA 4BIKA 2C1YA 4NHZA 4EC0A 5CAXA 5D9WA 5DQYA 4WEYA 2NVLA 5IO0A 2DIYA 4GWRA 1N8JA 4PTSA 1XWKA 3M1GA 3GNJA 4A5PA 3FR3A 1GH2A 1SYXA 1IYHA 2TRCP 5ECOB 4MDCA 1O73A 4Z2UA 2PERA 4K5RA 3CTGA 4RUVA 2GZZA 6GSVA 2AJQB 4KDYA 3GL3A 3EURA 2KOKA 4QL9A 4WBJA 3GKMA 2GLRA 3WGEA 8GSSA 1X5EA 7GSSA 4POBA 1T1VA 1H4OA 3L78A 3KH7A 5DCGA 3H8QA 3Q6OA 5ID2A 5EVOA 4G9HA 2GGTA 4G0IA 4NAXA 4BWQA 3EYTA 2ZNMA 1K0NA 4RI7A 4OMVA 5INYA 4XS1A 5D93A 2YPMA 1O8XA 2PN8A 3HJPA 3LEFA 3GKXA 3F4TA 1EP7A 4MA9A 3C73A 4TXVA 4KF9A 3EMPA 3O3TA 4HU7A 2DSAA 1QQ2A 3N5OA 1MD3A 3GKNA 2YJHA 3QPMA 4KUNA 2IMKA 1TTZA 1XWGA 4EE0A 2HXKA 1DSBA 2FUG2 1UVZA 3GSSA 5FWGA 2GZPA 3ZVJA 1FAAA 1SENA 2V6KA 2UZ8A 3TJGA 3C8EA 4FYBA 1BG5A 3ZITA 2GT5A 4TW5A 3UBLA 5J9CA 5F0GA 5F8BA 3HHVA 1TRSA 1U3AA 5AGYA 2JSZA 3J7Yb 2GQMA 1W89A 3GYKA 4I8BA 5KN1A 6GSUA 2CZ3A 2P5QA 2C4JA 2H76A 1ON4A 4IGJA 4ZBDA 5G1LA 1BQ7A 3TJFA 1A8YA
chains in the Genus database with same CATH topology
2IJYA 4ZB9A 3RHBA 4EIQA 4OO5A 1DBYA 2O8VB 3WD6A 2QGVA 2VL3A 3OR5A 1R7HA 4ZL9A 4I6XA 2H1DA 3MWHA 1WIKA 3D0ZA 2K6VA 2V2GA 4TN8A 1EGRA 2IFQA 2PBJA 4WXTA 5KOWA 3IRAA 2JZRA 3FW2A 1PL2A 1Z7RA 2B5XA 2LNSA 5G31A 2R0CA 4O7HA 4PX1A 3GTUA 3CBUA 1TK8B 3IHQA 4FO5A 4HI7A 1ACVA 2F9SA 1SJIA 4NHWA 4E8EA 4IELA 3GIXA 2HRKA 3D6IA 1FB0A 1AC1A 2CZ2A 5ECNB 5DALB 2D2ZA 3UOMA 2PU9C 4PNGA 1SD8A 4KH7A 1QFNA 2MMAA 4MJAA 3L9SA 1M0UA 3KZQA 3RBTA 1ZOFA 1YF0A 1EZKA 3KP9A 1SL1B 4Z2TA 4K7OA 4OCFA 3TJBA 1A8LA 3QFBC 2NDOA 2RUEA 1JFUA 1QXHA 2WZ9A 3TRQA 3VLNA 3E9JB 2VCVA 1XZOA 3VWVA 4JE1A 3GX8A 2VLTA 4AF2A 2TIRA 1PSQA 2M72A 2YZUA 3KGKA 4QL7A 2DJKA 2GT6A 1PX7A 2DJ1A 2ON7A 2H1GA 4TXOA 5J4UA 3U5RE 1A2MA 3F0IA 2I4AA 1M2DA 5HFIA 1PGTA 1EP8A 3LJRA 4ML1A 3VK9A 3I43A 2CVKA 1A23A 10GSA 1BAYA 2VD1A 2VM2A 3TKQA 2VLVA 4GTUA 1MEKA 3RPNA 2E2MA 4ILFA 3FYGA 2DIZA 2ZCTA 4N0ZA 5CO3A 1T4ZA 3KEBA 3IHGA 4YQMA 1THXA 3TGZA 4XS4A 1SJ6A 5ECQB 3PGTA 1MDKA 1GSYA 5DCHA 1ZYNA 3TJJA 6GSTA 1QK8A 1CQGA 3UBKA 1VF2A 1I5GA 6GSWA 2GSQA 3IV4A 2VCQA 3H4KA 4FIWA 2FWFA 2K8SA 2JSYA 4MABA 1C72A 2P5RA 4KSOA 4WKWA 1GUMA 2B6MA 3IC8A 1XOAA 2LV3A 5DJLA 1QUWA 3HJMA 4AGSA 2CVBA 4XHMA 4E8HA 1XIYA 4F0BA 4NV5A 2PGTA 3GV1A 3KIJA 2AV4A 2AB6A 2ON5A 4JR6A 3GRXA 4USSA 5JCGA 2X49A 3C1RA 1V57A 2V1MA 3CSJA 2RIIA 2X8GA 4CY6A 1YDKA 1LBKA 2C0FA 2HRNA 6GSYA 2YJ7A 2F3MA 5J5NA 1ERTA 3I9V2 4ML6A 4IBPA 5A4WA 4J56E 2QSIA 1V40A 4HU9A 2HE3A 3ZL5A 1USBA 1GSDA 3FR6A 4F2IA 2JZSA 3GURA 1XOBA 1Z9HA 1UA5A 3LXZA 3CSHA 4TR3A 3P7XA 1GP1A 3GH9A 3A3TA 4CHSA 1Y6EA 4MZBA 4YAPA 3NZNA 3TKRA 3WT1A 2CVDA 2CX3A 1PX6A 2E7PA 5A4UA 4NWYA 1B9XC 4ECJA 4IVFA 1Z6NA 3AY8A 2TRXA 2R0PA 4XRAA 3K8NA 1K3LA 2FGXA 4MK3A 3VWWA 4PXOA 3HY2A 4H86A 2N5AA 4F0CA 3KXOA 4K0NA 5BMUA 4KW6A 5CNWA 2LS5A 1OAZA 3QD9A 3VI7A 3CXGA 1G7OA 5GSSA 2OE1A 3ZMKA 4IP1A 4IQAA 3CMIA 5A5KA 2VL9A 4G0LA 1WE0A 2CV4A 4MH3A 2EC4A 2HSMA 4DSSA 3KP8A 4ACSA 1WJKA 3PH9A 2JACA 1OKTA 2WGRA 3DWVA 3APOA 2RLIA 1RQMA 2HLSA 1TI3A 2I9HA 3DEXA 2AAWA 3HJOA 3KTLA 5B6MA 4HDEA 1EOHA 3D4TA 2RM5A 1U88A 5EY6A 3HKRA 4TR4A 1V9WA 2FHEA 4GCIA 1SYRA 4BL7B 2ES7A 2O89A 4KX4A 16GSA 2A2SA 5EL8A 2H71A 5ECHB 2LKUA 3ISOA 2VOCA 2V41A 3GL5A 1TDIA 4CY8A 1K3YA 5BRTA 2N5FA 1ZZYA 5DAKA 3GUSA 2IPAA 4G2EA 1SK1A 3QAGA 3IXRA 3WT2A 1AUCA 1O8WA 2ALBA 3FZ4A 1DE1A 3RDWA 4J57E 1Z7PA 1X5CA 2L4QA 1FVJA 2GZYA 4GQCA 1NHOA 1T00A 1CQHA 1URMA 4F03A 4YKFA 4F9ZA 2L57A 4NXIA 2LRCA 2OJLA 1S3DA 1BX9A 2MBTA 3N9JA 1XWCA 2L5OA 1GRXA 1U6TA 3M3MA 4I2TA 2GSRA 1PL1A 3QR6A 1AQXA 3GFKA 4XS4B 22GSA 2XHFA 2CAIA 4J2FA 2G2QA 1HYUA 3ZZXA 3LORA 4CDOA 2LJAA 3ERFA 2VIMA 2AUVA 1SD9A 1A2JA 2A4VA 3L0HA 4I97A 2HRAA 2VCXA 4BVYB 3ZVJD 2OADA 4O5QA 2H0IA 2L59A 1ZYEA 3VFIA 5HR3A 1BYEA 1K3OA 4X1UA 3DXBA 5IOWA 1XWAA 4GXZA 3ZFBA 2LRNA 4JR4A 3P2AA 4L0WA 1TKDB 1M9AA 19GSA 1PRXA 2JADA 4POLA 5AN1A 4TOPA 3HXSA 2XC2A 1XPVA 3O6TA 2CX4A 5IPGA 2NBSA 4O32A 1E6BA 3ZIJA 4MZCA 2YANA 1F9MA 1X5DA 4K7IA 3C1SA 20GSA 2GQLA 4K2XA 4FYUA 4JBBA 5B6NA 4ZILA 1F3AA 1R26A 3HDCA 5IMFA 3LXTA 5GAPD 4KCEA 3TDGA 2C0EA 4QQ7A 5EPFA 5CRGA 3UVTA 4GF0A 1XXUA 4FYCA 2NTOA 2B7KA 1G7EA 4V2LA 3G7JA 2QA1A 1ILOA 4EDZA 2GVPA 2C3TA 3GN3A 1TRVA 3Q18A 1WPIA 2R3XA 3BCKA 2OKAA 3ZLPA 4V2NA 1J0FA 4I5QA 2YV7A 4MMMA 3V1WA 2Z9SA 4D73B 1EV9A 4IP6A 1N2AA 5G5EA 14GSA 1EWXA 1GWCA 3HVSA 1U3IA 4ISDA 4K5SA 1F2EA 3IK9A 2KP2A 3FZ9A 2A2PA 1B4QA 1SU9A 4K7NA 3EE2A 2H0GA 4PQ1A 4Q5NA 1SK2A 1G6WA 3F3QA 1GSQA 1OC9A 3UJ1A 2HZEB 3ERGA 4ECBA 2X4AA 5JWQB 3F63A 1NM3A 3DGQA 4TVEA 5KN2A 1FO5A 1TK5B 4MPGA 3M0FA 3D22A 5D9TA 3CRUA 3L9UA 1R4WA 3VI5A 1S3CA 1HNBA 2H1BA 3KM6A 3NIVA 4XCSA 3TUEA 5DJMA 5C04A 2YP6A 1IYIA 3VPTA 2IL3A 3UARA 3EMXA 2M46A 4XS6A 3TKPA 2YWIA 4TR1A 2L6DA 2YCDA 5GAND 4LLRA 6GSXA 1A0RP 1EGOA 1PN0A 4FH8A 3APQA 4HJ2A 5G5FA 2YOIA 2I1UA 2HSYA 4ZIJA 3FEUA 3DVWA 1ERWA 3E3EA 4OO4A 4MPFA 5D9VA 4BVXB 2DJ2A 3VWXA 2WB9A 1V2AA 5FT3A 3A5WA 3UL3A 3KMNA 4DSRA 1PD21 3HYPA 1PMTA 3UVHA 4KGIA 5ECIB 5JWOB 5AISA 2VO4A 3TCOA 4YAVA 2WFCA 3F9UA 1V58A 2LTKA 1WWJA 2KHPA 1SJZA 3GA4A 1HQOA 2LNTA 1Z5YE 3I6AA 3F6DA 4KNDA 1WRYA 3LW9A 4RQRA 1GSSA 1FB6A 2WULA 4OFNA 3HZ8A 2XBIA 2M80A 2H74A 1EEJA 2P31A 2RM6A 2N5BA 2E2GA 1Q98A 3TRXA 3I69A 3H79A 1Z6MA 5H5QA 2CAQA 1OKDA 1YQ1A 3F6FA 2MMOA 3DD3A 3QMXA 3ZIVA 1AAZA 3U6VA 1LJRA 2EIRA 2CA8A 3CSIA 2OBIA 1K0MA 1BEDA 1DUGA 1EOGA 4POKA 1R5AA 2X64A 3CTFA 3KMOA 3IR4A 4NMUA 3TB2A 1HNAA 1SKWB 2VUPA 1GSUA 4MF7A 4V1Ap 4JU5A 4MH2A 4N11A 1OYJA 2H73A 3D4MA 1AQVA 3F8UA 1FOHA 1ZGNA 1B48A 1TU7A 2G0FA 1VF3A 2LSTA 5ID2B 2MZCA 1H75A 4L5LA 3P90A 4IJ3A 1W4VA 2L6CA 3HVXA 2QC7A 2F8FA 1TU8A 2FA8A 5D8IA 3EPTA 4ZXGA 4FQUA 3C7MA 4V1Ag 2HSHA 2O85A 1GLQA 2WDUA 2REMA 4MP4A 1ZL9A 1I9DA 3H1NA 3KCMA 5GZZB 2WRTA 1T4YA 2OA7A 4KSMA 3ME7A 1XVQA 4G10A 4BPYA 2YN1A 3IBHA 1WP0A 3UAPA 4OD7A 1XVWA 3RAZA 2IMIA 4MF6A 4TRXA 1FW1A 3DIEA 3WYWA 4HOJA 3SBCA 1ST9A 1GL8A 2PMTA 3APSA 1TJDA 3A2XA 3HZ4A 2I81A 2C3QA 1BJXA 1O6JA 1E2YA 4KDUA 3WGDA 5B8BA 4EVMA 1T3BA 3BJ5A 2XPDA 2DMLA 1WMJA 3FZ5A 4LA1A 4GQFA 3A5IA 3LWAA 1M2BA 3DYRA 3ZMLA 1ERUA 4K6XA 3TKSE 1WOUA 5G2ZA 2H01A 4MJEA 3D5JA 5HR2A 1XCCA 2XBQA 3KH9A 4DSQA 4HEA2 3FRCA 3ZYWA 4JRRA 3ERWA 5D73A 2IFQB 2VL2A 2F51A 2WCIA 4EDYA 4OCEA 5J3RA 2MBSA 3TRPA 2JU5A 4X4JA 1SKRB 3GTUB 1X9SB 1SL2B 2KP1A 1B9YC 4N10A 3SWLA 1A2LA 3IK7A 4MJBA 4ZB6A 1X9MB 2J23A 2VD0A 3QFAC 1VRSD 5HR1A 1XW5A 4XTSA 2H72A 5DALA 2IMDA 4MCUA 2JZTA 2LJKA 1FHEA 3Q74A 4YKGA 4P3YB 1EV4A 3VURA 5D96A 4ECIA 2R37A 3WGXA 1ZYQB 3ZREA 3PR8A 1K0AA 4WF5A 5HQPA 2GDRA 2BTOT 5KN3A 4PQHA 3QAVA 2FCHA 4WF4A 4X43A 1TRUA 1KBNA 3CRTA 4K9ZA 3IE3A 3D21A 3RHCA 2R6KA 4NV2A 5CYYA 2L4CA 4GSSA 2R0GA 1YEXA 4X0XA 4GSTA 2B1LA 2MMNA 2CT6A 1B4PA 3C71A 3DRNA 4G19A 4TXOB 2YNXA 3F4RA 4WETA 2I3YA 3M9KA 1TK0B 4XRDA 4IQ1A 5LCZA 1QGVA 3MYDA 2DMMA 4XIHA 4AJ8A 1F37A 2JL4A 1OC8A 4HZ2A 1GTBA 3GX0A 1HNCA 1JLVA 1J9BA 4KAEA 2IMFA 1M7TA 3IAS2 4EO3A 3HD5A 4K0GA 2HZFA 1A24A 2H0HA 3ED3A 4IHUA 4L5OA 4DVCA 4GSNA 5IPHA 4EF0A 3IPZA 1Z3EA 1GULA 5GSTA 1GLPA 1OE8A 2H75A 1TXXA 1KNGA 1S3AA 4ID0A 1O7UA 1K0BA 4L0UA 4K8MA 3ZRDA 2YWOA 4AJ7A 5ABRA 1AIUA 4K1FA 4PURA 1OVNA 2H70A 3TOTA 5B8AA 3FY7A 1ERVA 4ZB8A 1PQNA 4MF5A 1JZRA 3QAWA 3CYNA 1GSEA 5ECLB 4N0VA 4TKYA 4MNNA 4GRFA 2FLSA 2PVQA 4PGTA 9GSSA 1YZXA 1JZDA 1GNWA 2YV9A 5COHA 3QCPA 2H8LA 3GH6A 5JCWA 3H93A 4IJIA 1HD2A 3EWLA 3KTBA 5ECKB 4JZQA 4EUYA 4O5RA 2HFDA 5KEJA 1GUKA 1ZCPA 2V6OA 1V98A 1SKSB 1VF1A 3KJYA 4I2UA 2VCWA 4KDXA 5F07A 3EU3A 4MLYA 2CQ9A 5IO2A 4POMA 2B7JA 2GTUA 2X99A 4EL1A 1VGLA 2A2RA 3FKFA 3GKKA 3O76A 2DKHA 5ELAA 3E0UA 4AJ6A 3TKSA 1GSFA 1Q4JA 1T7PB 2LRTA 2C80A 3UMAA 5IOXA 2EIQA 3IDVA 2OBKA 18GSA 2YWMA 2FWHA 2OACA 2LEGA 2GS3A 1A0FA 1AW9A 2PUKC 3P8WA 4IN0A 2K9FA 3EINA 1Y25A 3EU4A 3MAKA 1AQWA 4HS1A 5A4VA 4F82A 2VM1A 4BA7A 1X9WB 4IKHA 5CREA 2HI7A 4RQXA 1YKCA 2BMXA 1NHYA 3LFLA 4MZWA 4YQUA 5LNKe 2MYGA 2VL2C 1ZMAA 5KOXA 2DKIA 1TP9A 4ZBAA 1PN9A 5IMVA 3QOUA 1K0CA 1NW2A 1B8XA 2AYTA 2RUFA 3MSZA 3TOUA 2C3NA 1TI1A 2H19A 4BWSA 2VCTA 2HYXA 2OE0A 4HQSA 3BD2A 5HFGA 5C00A 3J7Yk 4DSSB 5F05A 1O85A 3LSZA 1RW1A 5L71A 3A2VA 3G7YA 4WR4A 5IMZA 4G0KA 2EIOA 2O7KA 3IAM2 5AIVA 1F6MC 2VLUA 3PPUA 2FWEA 4MJCA 3LYKA 1THOA 4HJMA 1K0DA 4KE3A 2QA2A 2R5GA 3G9BA 1DE2A 1PA3A 4BL7A 2A4HA 1K0OA 3FK8A 4OFTA 2H1AA 4YH2A 5J9BA 1R5PA 1YF1A 5E59A 4EIPA 2LJRA 4NPBA 2YWNA 4LL1B 4PQIA 5DDLA 3DKSA 2HNLA 2PPTA 2DJJA 17GSA 5DAKB 4Z2RA 3R3EA 3Q19A 4IS0A 4WBRD 2GSTA 5D9XA 4ZBBA 3GSTA 1GUHA 3FZAA 3F3RA 2F8AA 3G7IA 1AXDA 3LGCA 1FOVA 1XW9A 1JHBA 1G0TA 2KLXA 3MNGA 4Q5QA 3IOSA 1GTUA 2DBCA 5F06A 2X8HA 1J08A 2PWJA 4ZL7A 4JEDA 1YJ6A 5ECSA 1NSWA 1PKZA 4HQZA 4BVYA 1JZOA 2QKEA 2DLXA 4KCAA 4YQVA 1KTEA 2AHEA 5ECRB 3BBYA 12GSA 1M99A 4N30A 3LQ7A 2YZHA 2FY6A 4ECCA 2DJ0A 1RK4A 5ECMB 1YEPA 13GSA 2FA4A 3HA9A 4LL4B 2O87A 1UC7A 1MDJA 6GSSA 2H66A 2R2JA 1SK0A 3FHKA 1UN2A 2K18A 2PVOC 3R2QA 2B3SA 5HR0A 2FNOA 2MMZA 5E4WA 2LQQA 1YKAA 3BOAA 5AIXA 3PINA 4V2MA 4PUFC 2X8CA 5IMCA 4HUAA 5ECPB 1JZWA 3TKSC 1MD4A 1MDIA 3RPPA 1XFLA 5B7CA 1GTIA 4Q5FA 2NPBA 2R4VA 1VF4A 3HVVA 4O5UA 2FWGA 2FD3A 4ULXA 3KD0A 4DEJA 2LUSA 5DBQA 3IC4A 5IMAA 2GSSA 5H5RA 1FG4A 3FMWA 5CP1A 2IMEA 3US3A 2HT9A 4D73A 3MIXA 4HZ4A 1G6YA 1ABAA 1X0RA 3M9JA 2DC5A 3FR9A 3UIWA 1XWBA 5CRWA 4EKZA 2BJXA 4OWYA 2C8UA 2B5YA 3GMFA 1O81A 4ICYA 2P0GA 3DVXA 3EVIA 11GSA 2VCZA 4TR0A 4IW9A 3L4NA 2H30A 3F4SA 2HZEA 1OE7A 5HFKA 2H6ZA 4LMVA 2B5EA 3W6GA 5IM9A 1OC9B 1GTAA 2IWTA 3VWUA 1M2AA 5G1KA 2GQKA 2OE3A 2DJ3A 3M8NA 2WJUA 3ZFLA 1GNEA 4Q5RA 3IA1A 5J41A 3EC3A 3ZTLA 3MDKA 5ENUA 3VPQA 2J9HA 1F3BA 4KB3A 1TW9A 3W8JA 4EXJA 2V32A 1EEMA 2E0QA 4CW9A 3ME8A 3BCIA 3NOFA 3W8SA 2XPEA 2C0DA 4LMWA 5FHIA 1QMVA 1XW6A 1ML6A 1LU4A 4O92A 4RI6A 4TR1B 1TOFA 3QDNA 5KN0A 1PKWA 1U87A 5LD0A 2H6XA 2IN3A 1JLWA 4OFMA 5IIZA 5JWRB 3GHAA 4L8EA 1FVKA 2ZUPA 3DMLA 1ZYPA 2KUCA 5IMDA 4BVXA 5DQSA 2LQOA 2K8VA 1OC3A 5CRHA 2WS2A 4K2DA 1MTCA 5ELGA 3LYPA 1XBSA 1SL0B 4Z7XA 2VAFA 4ZL8A 2B1KA 5CRDA 4GLTA 3L9VA 3TJKA 4PNFA 2H6YA 1TRWA 2L5LA 5DVBA 3LG6A 5H5SA 5G30A 4KA0A 4WR5A 1M9BA 3UEMA 2IIYA 4PUAA 1YY7A 3HCZA 1T8EB 2C0GA 3A2WA 5JCUA 3JCML 2HRFA 3S9FA 5IQYA 1KEBA 2C1YA 4NHZA 4EC0A 5CAXA 5D9WA 5DQYA 4WEYA 2NVLA 5IO0A 2DIYA 4GWRA 1N8JA 4PTSA 1XWKA 3M1GA 3GNJA 4A5PA 3FR3A 1GH2A 1SYXA 1IYHA 2TRCP 5ECOB 4MDCA 1O73A 4Z2UA 2PERA 4K5RA 3CTGA 4RUVA 2GZZA 6GSVA 2AJQB 4KDYA 3GL3A 3EURA 2KOKA 4QL9A 4WBJA 3GKMA 2GLRA 3WGEA 8GSSA 1X5EA 7GSSA 4POBA 1T1VA 1H4OA 3L78A 3KH7A 5DCGA 3H8QA 3Q6OA 5ID2A 5EVOA 4G9HA 2GGTA 4G0IA 4NAXA 4BWQA 3EYTA 2ZNMA 1K0NA 4RI7A 4OMVA 5INYA 4XS1A 5D93A 2YPMA 1O8XA 2PN8A 3HJPA 3LEFA 3GKXA 3F4TA 1EP7A 4MA9A 3C73A 4TXVA 4KF9A 3EMPA 3O3TA 4HU7A 2DSAA 1QQ2A 3N5OA 1MD3A 3GKNA 2YJHA 3QPMA 4KUNA 2IMKA 1TTZA 1XWGA 4EE0A 2HXKA 1DSBA 2FUG2 1UVZA 3GSSA 5FWGA 2GZPA 3ZVJA 1FAAA 1SENA 2V6KA 2UZ8A 3TJGA 3C8EA 4FYBA 1BG5A 3ZITA 2GT5A 4TW5A 3UBLA 5J9CA 5F0GA 5F8BA 3HHVA 1TRSA 1U3AA 5AGYA 2JSZA 3J7Yb 2GQMA 1W89A 3GYKA 4I8BA 5KN1A 6GSUA 2CZ3A 2P5QA 2C4JA 2H76A 1ON4A 4IGJA 4ZBDA 5G1LA 1BQ7A 3TJFA 1A8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJY A;  4ZB9 A;  3RHB A;  4OO5 A;  1DBY A;  2O8V B;  3WD6 A;  2QGV A;  2VL3 A;  3OR5 A;  1R7H A;  4ZL9 A;  4I6X A;  2H1D A;  3MWH A;  1WIK A;  3D0Z A;  2K6V A;  2V2G A;  4TN8 A;  1EGR A;  2IFQ A;  2PBJ A;  4WXT A;  3IRA A;  2JZR A;  3FW2 A;  1PL2 A;  1Z7R A;  2B5X A;  2LNS A;  5G31 A;  4O7H A;  4PX1 A;  3GTU A;  3CBU A;  1TK8 B;  3IHQ A;  4FO5 A;  4HI7 A;  1ACV A;  2F9S A;  1SJI A;  4NHW A;  4E8E A;  4IEL A;  3GIX A;  3D6I A;  1FB0 A;  1AC1 A;  2CZ2 A;  5ECN B;  5DAL B;  2D2Z A;  3UOM A;  2PU9 C;  4PNG A;  1SD8 A;  4KH7 A;  1QFN A;  2MMA A;  4MJA A;  3L9S A;  1M0U A;  3KZQ A;  3RBT A;  1ZOF A;  1YF0 A;  1EZK A;  3KP9 A;  1SL1 B;  4K7O A;  4OCF A;  3TJB A;  1A8L A;  3QFB C;  2NDO A;  2RUE A;  1JFU A;  1QXH A;  2WZ9 A;  3TRQ A;  3VLN A;  3E9J B;  2VCV A;  1XZO A;  3VWV A;  4JE1 A;  3GX8 A;  2VLT A;  4AF2 A;  2TIR A;  1PSQ A;  2M72 A;  2YZU A;  3KGK A;  4QL7 A;  2DJK A;  2GT6 A;  1PX7 A;  2DJ1 A;  2ON7 A;  2H1G A;  4TXO A;  5J4U A;  3U5R E;  1A2M A;  3F0I A;  2I4A A;  1M2D A;  5HFI A;  1PGT A;  1EP8 A;  3LJR A;  4ML1 A;  3VK9 A;  3I43 A;  2CVK A;  1A23 A;  10GS A;  1BAY A;  2VD1 A;  2VM2 A;  3TKQ A;  2VLV A;  4GTU A;  1MEK A;  3RPN A;  2E2M A;  4ILF A;  3FYG A;  2DIZ A;  2ZCT A;  4N0Z A;  5CO3 A;  1T4Z A;  3KEB A;  4YQM A;  1THX A;  3TGZ A;  4XS4 A;  1SJ6 A;  5ECQ B;  3PGT A;  1MDK A;  1GSY A;  5DCH A;  3TJJ A;  6GST A;  1QK8 A;  1CQG A;  3UBK A;  1VF2 A;  1I5G A;  6GSW A;  2GSQ A;  3IV4 A;  2VCQ A;  3H4K A;  4FIW A;  2FWF A;  2K8S A;  2JSY A;  4MAB A;  1C72 A;  2P5R A;  4KSO A;  4WKW A;  1GUM A;  2B6M A;  1XOA A;  2LV3 A;  5DJL A;  1QUW A;  3HJM A;  4AGS A;  2CVB A;  4XHM A;  4E8H A;  1XIY A;  4F0B A;  4NV5 A;  2PGT A;  3GV1 A;  3KIJ A;  2AV4 A;  2AB6 A;  2ON5 A;  4JR6 A;  3GRX A;  5JCG A;  3C1R A;  1V57 A;  2V1M A;  3CSJ A;  2RII A;  2X8G A;  1YDK A;  1LBK A;  2C0F A;  2HRN A;  6GSY A;  2YJ7 A;  2F3M A;  5J5N A;  1ERT A;  3I9V 2;  4ML6 A;  4IBP A;  5A4W A;  4J56 E;  2QSI A;  1V40 A;  4HU9 A;  2HE3 A;  3ZL5 A;  1USB A;  1GSD A;  3FR6 A;  4F2I A;  2JZS A;  3GUR A;  1XOB A;  1Z9H A;  1UA5 A;  3LXZ A;  3CSH A;  4TR3 A;  3P7X A;  1GP1 A;  3GH9 A;  3A3T A;  4CHS A;  1Y6E A;  4MZB A;  4YAP A;  3NZN A;  3TKR A;  3WT1 A;  2CVD A;  2CX3 A;  1PX6 A;  2E7P A;  5A4U A;  4NWY A;  1B9X C;  4ECJ A;  4IVF A;  1Z6N A;  3AY8 A;  2TRX A;  4XRA A;  3K8N A;  1K3L A;  2FGX A;  4MK3 A;  3VWW A;  4PXO A;  3HY2 A;  4H86 A;  2N5A A;  4F0C A;  3KXO A;  4K0N A;  4KW6 A;  5CNW A;  2LS5 A;  1OAZ A;  3QD9 A;  3VI7 A;  3CXG A;  1G7O A;  5GSS A;  2OE1 A;  3ZMK A;  4IP1 A;  4IQA A;  3CMI A;  5A5K A;  2VL9 A;  1WE0 A;  2CV4 A;  4MH3 A;  2EC4 A;  4DSS A;  3KP8 A;  4ACS A;  1WJK A;  3PH9 A;  2JAC A;  1OKT A;  2WGR A;  3DWV A;  3APO A;  2RLI A;  1RQM A;  2HLS A;  1TI3 A;  2I9H A;  3DEX A;  2AAW A;  3HJO A;  3KTL A;  5B6M A;  4HDE A;  1EOH A;  3D4T A;  2RM5 A;  1U88 A;  5EY6 A;  3HKR A;  4TR4 A;  1V9W A;  2FHE A;  4GCI A;  1SYR A;  2ES7 A;  2O89 A;  4KX4 A;  16GS A;  2A2S A;  5EL8 A;  2H71 A;  5ECH B;  2LKU A;  3ISO A;  2VOC A;  2V41 A;  3GL5 A;  1TDI A;  1K3Y A;  2N5F A;  1ZZY A;  5DAK A;  3GUS A;  2IPA A;  4G2E A;  1SK1 A;  3QAG A;  3IXR A;  3WT2 A;  1AUC A;  1O8W A;  2ALB A;  3FZ4 A;  1DE1 A;  3RDW A;  4J57 E;  1Z7P A;  1X5C A;  2L4Q A;  1FVJ A;  2GZY A;  4GQC A;  1NHO A;  1T00 A;  1CQH A;  1URM A;  4F03 A;  4F9Z A;  2L57 A;  4NXI A;  2LRC A;  2OJL A;  1S3D A;  1BX9 A;  2MBT A;  3N9J A;  1XWC A;  2L5O A;  1GRX A;  1U6T A;  3M3M A;  4I2T A;  2GSR A;  1PL1 A;  3QR6 A;  1AQX A;  3GFK A;  4XS4 B;  22GS A;  2XHF A;  2CAI A;  4J2F A;  2G2Q A;  1HYU A;  3ZZX A;  3LOR A;  4CDO A;  2LJA A;  3ERF A;  2VIM A;  2AUV A;  1SD9 A;  1A2J A;  2A4V A;  3L0H A;  4I97 A;  2VCX A;  3ZVJ D;  2OAD A;  2H0I A;  2L59 A;  1ZYE A;  3VFI A;  5HR3 A;  1BYE A;  1K3O A;  4X1U A;  3DXB A;  5IOW A;  1XWA A;  4GXZ A;  3ZFB A;  2LRN A;  4JR4 A;  3P2A A;  4L0W A;  1TKD B;  1M9A A;  19GS A;  1PRX A;  2JAD A;  4POL A;  5AN1 A;  4TOP A;  3HXS A;  2XC2 A;  1XPV A;  3O6T A;  2CX4 A;  5IPG A;  2NBS A;  4O32 A;  1E6B A;  3ZIJ A;  4MZC A;  2YAN A;  1F9M A;  1X5D A;  4K7I A;  3C1S A;  20GS A;  2GQL A;  4FYU A;  4JBB A;  5B6N A;  4ZIL A;  1F3A A;  1R26 A;  3HDC A;  5IMF A;  3LXT A;  5GAP D;  4KCE A;  3TDG A;  2C0E A;  4QQ7 A;  5EPF A;  5CRG A;  3UVT A;  4GF0 A;  1XXU A;  4FYC A;  2NTO A;  2B7K A;  1G7E A;  4V2L A;  3G7J A;  1ILO A;  4EDZ A;  2GVP A;  2C3T A;  3GN3 A;  1TRV A;  3Q18 A;  1WPI A;  2R3X A;  3BCK A;  2OKA A;  3ZLP A;  4V2N A;  1J0F A;  4I5Q A;  2YV7 A;  4MMM A;  3V1W A;  2Z9S A;  4D73 B;  1EV9 A;  4IP6 A;  1N2A A;  5G5E A;  14GS A;  1EWX A;  1GWC A;  3HVS A;  1U3I A;  4ISD A;  1F2E A;  3IK9 A;  2KP2 A;  3FZ9 A;  1B4Q A;  1SU9 A;  4K7N A;  3EE2 A;  2H0G A;  4PQ1 A;  4Q5N A;  1SK2 A;  1G6W A;  3F3Q A;  1GSQ A;  1OC9 A;  3UJ1 A;  2HZE B;  3ERG A;  4ECB A;  5JWQ B;  3F63 A;  1NM3 A;  3DGQ A;  4TVE A;  5KN2 A;  1FO5 A;  1TK5 B;  4MPG A;  3M0F A;  3D22 A;  5D9T A;  3CRU A;  3L9U A;  1R4W A;  3VI5 A;  1S3C A;  1HNB A;  2H1B A;  3KM6 A;  3NIV A;  4XCS A;  3TUE A;  5DJM A;  5C04 A;  2YP6 A;  1IYI A;  3VPT A;  2IL3 A;  3UAR A;  3EMX A;  2M46 A;  4XS6 A;  3TKP A;  2YWI A;  4TR1 A;  2L6D A;  2YCD A;  5GAN D;  4LLR A;  6GSX A;  1A0R P;  1EGO A;  4FH8 A;  3APQ A;  4HJ2 A;  5G5F A;  2YOI A;  2I1U A;  2HSY A;  4ZIJ A;  3FEU A;  3DVW A;  1ERW A;  3E3E A;  4OO4 A;  4MPF A;  5D9V A;  2DJ2 A;  3VWX A;  2WB9 A;  1V2A A;  5FT3 A;  3A5W A;  3UL3 A;  3KMN A;  4DSR A;  1PD2 1;  3HYP A;  1PMT A;  3UVH A;  4KGI A;  5ECI B;  5JWO B;  5AIS A;  2VO4 A;  3TCO A;  4YAV A;  2WFC A;  3F9U A;  1V58 A;  2LTK A;  1WWJ A;  2KHP A;  1SJZ A;  3GA4 A;  1HQO A;  2LNT A;  1Z5Y E;  3I6A A;  3F6D A;  4KND A;  1WRY A;  4RQR A;  1GSS A;  1FB6 A;  2WUL A;  4OFN A;  3HZ8 A;  2XBI A;  2M80 A;  2H74 A;  1EEJ A;  2P31 A;  2RM6 A;  2N5B A;  2E2G A;  1Q98 A;  3TRX A;  3I69 A;  3H79 A;  1Z6M A;  5H5Q A;  2CAQ A;  1OKD A;  1YQ1 A;  3F6F A;  2MMO A;  3DD3 A;  3QMX A;  3ZIV A;  1AAZ A;  3U6V A;  1LJR A;  2EIR A;  2CA8 A;  3CSI A;  2OBI A;  1K0M A;  1BED A;  1DUG A;  1EOG A;  4POK A;  1R5A A;  2X64 A;  3CTF A;  3KMO A;  3IR4 A;  4NMU A;  3TB2 A;  1HNA A;  1SKW B;  2VUP A;  1GSU A;  4MF7 A;  4V1A p;  4JU5 A;  4MH2 A;  4N11 A;  1OYJ A;  2H73 A;  3D4M A;  1AQV A;  3F8U A;  1ZGN A;  1B48 A;  1TU7 A;  2G0F A;  1VF3 A;  2LST A;  5ID2 B;  2MZC A;  1H75 A;  4L5L A;  3P90 A;  4IJ3 A;  1W4V A;  2L6C A;  3HVX A;  2QC7 A;  2F8F A;  1TU8 A;  2FA8 A;  5D8I A;  4ZXG A;  3C7M A;  4V1A g;  2HSH A;  2O85 A;  1GLQ A;  2WDU A;  2REM A;  4MP4 A;  1ZL9 A;  1I9D A;  3H1N A;  3KCM A;  5GZZ B;  2WRT A;  1T4Y A;  2OA7 A;  4KSM A;  3ME7 A;  1XVQ A;  4G10 A;  4BPY A;  2YN1 A;  3IBH A;  1WP0 A;  3UAP A;  4OD7 A;  1XVW A;  3RAZ A;  2IMI A;  4MF6 A;  4TRX A;  1FW1 A;  3DIE A;  3WYW A;  4HOJ A;  3SBC A;  1ST9 A;  1GL8 A;  2PMT A;  3APS A;  1TJD A;  3A2X A;  3HZ4 A;  2I81 A;  2C3Q A;  1BJX A;  1O6J A;  1E2Y A;  4KDU A;  3WGD A;  5B8B A;  4EVM A;  1T3B A;  3BJ5 A;  2XPD A;  2DML A;  1WMJ A;  3FZ5 A;  4LA1 A;  4GQF A;  3LWA A;  1M2B A;  3DYR A;  3ZML A;  1ERU A;  4K6X A;  3TKS E;  1WOU A;  5G2Z A;  2H01 A;  4MJE A;  3D5J A;  5HR2 A;  1XCC A;  2XBQ A;  3KH9 A;  4DSQ A;  4HEA 2;  3FRC A;  3ZYW A;  4JRR A;  3ERW A;  5D73 A;  2IFQ B;  2VL2 A;  2F51 A;  2WCI A;  4EDY A;  4OCE A;  5J3R A;  2MBS A;  3TRP A;  2JU5 A;  1SKR B;  3GTU B;  1X9S B;  1SL2 B;  2KP1 A;  1B9Y C;  4N10 A;  3SWL A;  1A2L A;  3IK7 A;  4MJB A;  4ZB6 A;  1X9M B;  2J23 A;  2VD0 A;  3QFA C;  1VRS D;  5HR1 A;  1XW5 A;  4XTS A;  2H72 A;  5DAL A;  2IMD A;  4MCU A;  2JZT A;  2LJK A;  1FHE A;  3Q74 A;  4P3Y B;  1EV4 A;  3VUR A;  5D96 A;  4ECI A;  2R37 A;  3WGX A;  1ZYQ B;  3ZRE A;  3PR8 A;  1K0A A;  4WF5 A;  5HQP A;  2GDR A;  2BTO T;  5KN3 A;  4PQH A;  3QAV A;  2FCH A;  4WF4 A;  4X43 A;  1TRU A;  1KBN A;  3CRT A;  4K9Z A;  3IE3 A;  3D21 A;  3RHC A;  2R6K A;  4NV2 A;  5CYY A;  2L4C A;  4GSS A;  1YEX A;  4X0X A;  4GST A;  2B1L A;  2MMN A;  2CT6 A;  1B4P A;  3C71 A;  3DRN A;  4G19 A;  4TXO B;  2YNX A;  3F4R A;  4WET A;  2I3Y A;  3M9K A;  1TK0 B;  4XRD A;  4IQ1 A;  5LCZ A;  1QGV A;  2DMM A;  4XIH A;  4AJ8 A;  1F37 A;  2JL4 A;  1OC8 A;  4HZ2 A;  1GTB A;  3GX0 A;  1HNC A;  1JLV A;  1J9B A;  4KAE A;  2IMF A;  1M7T A;  3IAS 2;  4EO3 A;  3HD5 A;  4K0G A;  2HZF A;  1A24 A;  2H0H A;  3ED3 A;  4IHU A;  4L5O A;  4DVC A;  4GSN A;  5IPH A;  4EF0 A;  3IPZ A;  1Z3E A;  1GUL A;  5GST A;  1GLP A;  1OE8 A;  2H75 A;  1TXX A;  1KNG A;  1S3A A;  4ID0 A;  1O7U A;  1K0B A;  4L0U A;  4K8M A;  3ZRD A;  2YWO A;  4AJ7 A;  5ABR A;  1AIU A;  4K1F A;  4PUR A;  1OVN A;  2H70 A;  3TOT A;  5B8A A;  3FY7 A;  1ERV A;  4ZB8 A;  1PQN A;  4MF5 A;  1JZR A;  3QAW A;  3CYN A;  1GSE A;  5ECL B;  4N0V A;  4TKY A;  4GRF A;  2FLS A;  2PVQ A;  4PGT A;  9GSS A;  1YZX A;  1JZD A;  1GNW A;  2YV9 A;  5COH A;  3QCP A;  2H8L A;  3GH6 A;  5JCW A;  3H93 A;  4IJI A;  1HD2 A;  3EWL A;  3KTB A;  5ECK B;  4JZQ A;  4EUY A;  4O5R A;  2HFD A;  5KEJ A;  1GUK A;  1ZCP A;  2V6O A;  1V98 A;  1SKS B;  1VF1 A;  3KJY A;  4I2U A;  2VCW A;  4KDX A;  5F07 A;  3EU3 A;  4MLY A;  2CQ9 A;  5IO2 A;  4POM A;  2B7J A;  2GTU A;  2X99 A;  4EL1 A;  1VGL A;  2A2R A;  3FKF A;  3GKK A;  3O76 A;  5ELA A;  3E0U A;  4AJ6 A;  3TKS A;  1GSF A;  1Q4J A;  1T7P B;  2LRT A;  2C80 A;  3UMA A;  5IOX A;  2EIQ A;  3IDV A;  2OBK A;  18GS A;  2YWM A;  2FWH A;  2OAC A;  2LEG A;  2GS3 A;  1A0F A;  1AW9 A;  2PUK C;  3P8W A;  4IN0 A;  2K9F A;  3EIN A;  1Y25 A;  3EU4 A;  3MAK A;  1AQW A;  4HS1 A;  5A4V A;  4F82 A;  2VM1 A;  4BA7 A;  1X9W B;  4IKH A;  5CRE A;  2HI7 A;  4RQX A;  1YKC A;  2BMX A;  1NHY A;  3LFL A;  4MZW A;  4YQU A;  5LNK e;  2MYG A;  2VL2 C;  1ZMA A;  1TP9 A;  4ZBA A;  1PN9 A;  5IMV A;  3QOU A;  1K0C A;  1NW2 A;  1B8X A;  2AYT A;  2RUF A;  3MSZ A;  3TOU A;  2C3N A;  1TI1 A;  2H19 A;  4BWS A;  2VCT A;  2HYX A;  2OE0 A;  4HQS A;  3BD2 A;  5HFG A;  5C00 A;  3J7Y k;  4DSS B;  5F05 A;  1O85 A;  3LSZ A;  1RW1 A;  5L71 A;  3A2V A;  3G7Y A;  4WR4 A;  5IMZ A;  2EIO A;  2O7K A;  3IAM 2;  5AIV A;  1F6M C;  2VLU A;  2FWE A;  4MJC A;  3LYK A;  1THO A;  4HJM A;  1K0D A;  4KE3 A;  2R5G A;  3G9B A;  1DE2 A;  1PA3 A;  4BL7 A;  1K0O A;  3FK8 A;  4OFT A;  2H1A A;  4YH2 A;  5J9B A;  1R5P A;  1YF1 A;  5E59 A;  2LJR A;  4NPB A;  2YWN A;  4LL1 B;  4PQI A;  5DDL A;  3DKS A;  2HNL A;  2PPT A;  2DJJ A;  17GS A;  5DAK B;  3Q19 A;  4IS0 A;  4WBR D;  2GST A;  5D9X A;  4ZBB A;  3GST A;  1GUH A;  3FZA A;  3F3R A;  2F8A A;  3G7I A;  1AXD A;  3LGC A;  1FOV A;  1XW9 A;  1JHB A;  1G0T A;  2KLX A;  3MNG A;  4Q5Q A;  3IOS A;  1GTU A;  2DBC A;  5F06 A;  2X8H A;  1J08 A;  2PWJ A;  4ZL7 A;  4JED A;  1YJ6 A;  5ECS A;  1NSW A;  1PKZ A;  4HQZ A;  4BVY A;  1JZO A;  2QKE A;  2DLX A;  4KCA A;  4YQV A;  1KTE A;  2AHE A;  5ECR B;  3BBY A;  12GS A;  1M99 A;  4N30 A;  3LQ7 A;  2YZH A;  2FY6 A;  4ECC A;  2DJ0 A;  1RK4 A;  5ECM B;  1YEP A;  13GS A;  2FA4 A;  3HA9 A;  4LL4 B;  2O87 A;  1UC7 A;  1MDJ A;  6GSS A;  2H66 A;  2R2J A;  1SK0 A;  3FHK A;  1UN2 A;  2K18 A;  2PVO C;  3R2Q A;  2B3S A;  5HR0 A;  2FNO A;  2MMZ A;  5E4W A;  2LQQ A;  1YKA A;  3BOA A;  5AIX A;  3PIN A;  4V2M A;  4PUF C;  2X8C A;  5IMC A;  4HUA A;  5ECP B;  1JZW A;  3TKS C;  1MD4 A;  1MDI A;  3RPP A;  1XFL A;  5B7C A;  1GTI A;  4Q5F A;  2NPB A;  2R4V A;  1VF4 A;  3HVV A;  2FWG A;  2FD3 A;  4ULX A;  3KD0 A;  4DEJ A;  2LUS A;  5DBQ A;  3IC4 A;  5IMA A;  2GSS A;  5H5R A;  1FG4 A;  5CP1 A;  2IME A;  3US3 A;  2HT9 A;  4D73 A;  4HZ4 A;  1G6Y A;  1ABA A;  1X0R A;  3M9J A;  2DC5 A;  3FR9 A;  3UIW A;  1XWB A;  5CRW A;  4EKZ A;  2BJX A;  4OWY A;  2C8U A;  2B5Y A;  3GMF A;  1O81 A;  2P0G A;  3DVX A;  3EVI A;  11GS A;  2VCZ A;  4TR0 A;  4IW9 A;  3L4N A;  2H30 A;  3F4S A;  2HZE A;  1OE7 A;  5HFK A;  2H6Z A;  4LMV A;  2B5E A;  3W6G A;  5IM9 A;  1OC9 B;  1GTA A;  2IWT A;  3VWU A;  1M2A A;  5G1K A;  2GQK A;  2OE3 A;  2DJ3 A;  3M8N A;  2WJU A;  3ZFL A;  1GNE A;  4Q5R A;  3IA1 A;  5J41 A;  3EC3 A;  3ZTL A;  3MDK A;  5ENU A;  3VPQ A;  2J9H A;  1F3B A;  4KB3 A;  1TW9 A;  3W8J A;  4EXJ A;  2V32 A;  1EEM A;  2E0Q A;  4CW9 A;  3ME8 A;  3BCI A;  3NOF A;  3W8S A;  2XPE A;  2C0D A;  4LMW A;  5FHI A;  1QMV A;  1XW6 A;  1ML6 A;  1LU4 A;  4O92 A;  4RI6 A;  4TR1 B;  1TOF A;  3QDN A;  5KN0 A;  1PKW A;  1U87 A;  5LD0 A;  2H6X A;  2IN3 A;  1JLW A;  4OFM A;  5IIZ A;  5JWR B;  3GHA A;  4L8E A;  1FVK A;  2ZUP A;  3DML A;  2KUC A;  5IMD A;  4BVX A;  5DQS A;  2LQO A;  2K8V A;  1OC3 A;  5CRH A;  2WS2 A;  4K2D A;  1MTC A;  5ELG A;  3LYP A;  1XBS A;  1SL0 B;  4Z7X A;  2VAF A;  4ZL8 A;  2B1K A;  5CRD A;  4GLT A;  3L9V A;  3TJK A;  4PNF A;  2H6Y A;  1TRW A;  2L5L A;  5DVB A;  3LG6 A;  5H5S A;  5G30 A;  4KA0 A;  4WR5 A;  1M9B A;  3UEM A;  2IIY A;  4PUA A;  1YY7 A;  3HCZ A;  1T8E B;  2C0G A;  3A2W A;  5JCU A;  3JCM L;  2HRF A;  3S9F A;  5IQY A;  1KEB A;  2C1Y A;  4NHZ A;  4EC0 A;  5CAX A;  5D9W A;  5DQY A;  4WEY A;  2NVL A;  5IO0 A;  2DIY A;  4GWR A;  1N8J A;  1XWK A;  3M1G A;  3GNJ A;  3FR3 A;  1GH2 A;  1SYX A;  1IYH A;  2TRC P;  5ECO B;  4MDC A;  1O73 A;  2PER A;  3CTG A;  4RUV A;  2GZZ A;  6GSV A;  2AJQ B;  4KDY A;  3GL3 A;  3EUR A;  2KOK A;  4QL9 A;  4WBJ A;  3GKM A;  2GLR A;  3WGE A;  8GSS A;  1X5E A;  7GSS A;  4POB A;  1T1V A;  1H4O A;  3L78 A;  3KH7 A;  5DCG A;  3H8Q A;  3Q6O A;  5ID2 A;  5EVO A;  4G9H A;  2GGT A;  4NAX A;  4BWQ A;  3EYT A;  2ZNM A;  1K0N A;  4RI7 A;  4OMV A;  5INY A;  4XS1 A;  5D93 A;  2YPM A;  1O8X A;  2PN8 A;  3HJP A;  3LEF A;  3GKX A;  3F4T A;  1EP7 A;  4MA9 A;  3C73 A;  4TXV A;  3EMP A;  3O3T A;  4HU7 A;  2DSA A;  1QQ2 A;  3N5O A;  1MD3 A;  3GKN A;  2YJH A;  3QPM A;  4KUN A;  2IMK A;  1TTZ A;  1XWG A;  4EE0 A;  2HXK A;  1DSB A;  2FUG 2;  1UVZ A;  3GSS A;  5FWG A;  2GZP A;  3ZVJ A;  1FAA A;  1SEN A;  2V6K A;  3TJG A;  3C8E A;  4FYB A;  1BG5 A;  3ZIT A;  2GT5 A;  4TW5 A;  3UBL A;  5J9C A;  5F0G A;  5F8B A;  3HHV A;  1TRS A;  1U3A A;  5AGY A;  2JSZ A;  3J7Y b;  2GQM A;  1W89 A;  3GYK A;  4I8B A;  5KN1 A;  6GSU A;  2CZ3 A;  2P5Q A;  2C4J A;  2H76 A;  1ON4 A;  4IGJ A;  4ZBD A;  5G1L A;  1BQ7 A;  3TJF A;  1A8Y A; 
#chains in the Genus database with same CATH topology
 2IJY A;  4ZB9 A;  3RHB A;  4EIQ A;  4OO5 A;  1DBY A;  2O8V B;  3WD6 A;  2QGV A;  2VL3 A;  3OR5 A;  1R7H A;  4ZL9 A;  4I6X A;  2H1D A;  3MWH A;  1WIK A;  3D0Z A;  2K6V A;  2V2G A;  4TN8 A;  1EGR A;  2IFQ A;  2PBJ A;  4WXT A;  5KOW A;  3IRA A;  2JZR A;  3FW2 A;  1PL2 A;  1Z7R A;  2B5X A;  2LNS A;  5G31 A;  2R0C A;  4O7H A;  4PX1 A;  3GTU A;  3CBU A;  3HVN A;  1TK8 B;  3IHQ A;  4FO5 A;  4HI7 A;  1ACV A;  2F9S A;  1SJI A;  4NHW A;  4E8E A;  4IEL A;  3GIX A;  2HRK A;  3D6I A;  1FB0 A;  1AC1 A;  2CZ2 A;  5ECN B;  5DAL B;  2D2Z A;  3UOM A;  2PU9 C;  4PNG A;  1SD8 A;  4KH7 A;  1QFN A;  2MMA A;  4MJA A;  3L9S A;  1M0U A;  3KZQ A;  3RBT A;  1ZOF A;  1YF0 A;  1EZK A;  3KP9 A;  1SL1 B;  4Z2T A;  4K7O A;  4OCF A;  3TJB A;  1A8L A;  3QFB C;  2NDO A;  2RUE A;  1JFU A;  1QXH A;  2WZ9 A;  3TRQ A;  3VLN A;  3E9J B;  2VCV A;  1XZO A;  3VWV A;  4JE1 A;  3GX8 A;  2VLT A;  4AF2 A;  2TIR A;  1PSQ A;  2M72 A;  2YZU A;  3KGK A;  4QL7 A;  2DJK A;  2GT6 A;  1PX7 A;  2DJ1 A;  2ON7 A;  2H1G A;  4TXO A;  5J4U A;  3U5R E;  1A2M A;  3F0I A;  2I4A A;  1M2D A;  5HFI A;  1PGT A;  1EP8 A;  3LJR A;  4ML1 A;  3VK9 A;  1M3J A;  3I43 A;  2CVK A;  1A23 A;  10GS A;  1BAY A;  2VD1 A;  1S3R A;  2VM2 A;  3TKQ A;  2VLV A;  4GTU A;  1MEK A;  3RPN A;  2E2M A;  4ILF A;  3FYG A;  2DIZ A;  2ZCT A;  4N0Z A;  5CO3 A;  1T4Z A;  3KEB A;  3IHG A;  4YQM A;  1THX A;  3TGZ A;  4XS4 A;  1SJ6 A;  5ECQ B;  3PGT A;  1MDK A;  1GSY A;  5DCH A;  1ZYN A;  3TJJ A;  6GST A;  1QK8 A;  1CQG A;  3UBK A;  1VF2 A;  1I5G A;  6GSW A;  2GSQ A;  3IV4 A;  2VCQ A;  3H4K A;  4FIW A;  2FWF A;  2K8S A;  2JSY A;  4MAB A;  1C72 A;  2P5R A;  4KSO A;  4WKW A;  1GUM A;  2B6M A;  3IC8 A;  1XOA A;  2LV3 A;  5DJL A;  1QUW A;  3HJM A;  4AGS A;  2CVB A;  4XHM A;  4E8H A;  1XIY A;  4F0B A;  4NV5 A;  2PGT A;  3GV1 A;  3KIJ A;  2AV4 A;  2AB6 A;  2ON5 A;  4JR6 A;  3GRX A;  4USS A;  5JCG A;  2X49 A;  3C1R A;  1V57 A;  2V1M A;  3CSJ A;  2RII A;  2X8G A;  4CY6 A;  1YDK A;  1LBK A;  2C0F A;  2HRN A;  6GSY A;  2YJ7 A;  2F3M A;  5J5N A;  1ERT A;  3I9V 2;  4ML6 A;  4IBP A;  5A4W A;  4J56 E;  2QSI A;  1V40 A;  4HU9 A;  2HE3 A;  3ZL5 A;  1USB A;  1GSD A;  3FR6 A;  4F2I A;  2JZS A;  3GUR A;  1XOB A;  1Z9H A;  1UA5 A;  3LXZ A;  3CSH A;  4TR3 A;  3P7X A;  1GP1 A;  3GH9 A;  3A3T A;  4CHS A;  1Y6E A;  4MZB A;  4YAP A;  3NZN A;  3TKR A;  3WT1 A;  2CVD A;  2CX3 A;  1PX6 A;  2E7P A;  5A4U A;  4NWY A;  1B9X C;  4ECJ A;  4IVF A;  1Z6N A;  3AY8 A;  2TRX A;  2R0P A;  4XRA A;  3K8N A;  1M3I A;  1K3L A;  2FGX A;  4MK3 A;  3VWW A;  4PXO A;  3HY2 A;  4H86 A;  2N5A A;  4F0C A;  3KXO A;  4K0N A;  5BMU A;  4KW6 A;  5CNW A;  2LS5 A;  1OAZ A;  3QD9 A;  3VI7 A;  3CXG A;  1G7O A;  5GSS A;  2OE1 A;  3ZMK A;  4IP1 A;  4IQA A;  3CMI A;  5A5K A;  2VL9 A;  4G0L A;  1WE0 A;  2CV4 A;  4MH3 A;  2EC4 A;  2HSM A;  4DSS A;  3KP8 A;  4ACS A;  1WJK A;  3PH9 A;  2JAC A;  1OKT A;  2WGR A;  3DWV A;  3APO A;  2RLI A;  1RQM A;  2HLS A;  1TI3 A;  2I9H A;  3DEX A;  2AAW A;  3HJO A;  3KTL A;  5B6M A;  4HDE A;  1EOH A;  3D4T A;  2RM5 A;  1U88 A;  5EY6 A;  3HKR A;  4TR4 A;  1V9W A;  2FHE A;  4GCI A;  1SYR A;  4BL7 B;  2ES7 A;  2O89 A;  4KX4 A;  16GS A;  2A2S A;  5EL8 A;  2H71 A;  5ECH B;  2LKU A;  3ISO A;  2VOC A;  2V41 A;  3GL5 A;  1TDI A;  4CY8 A;  1K3Y A;  5BRT A;  2N5F A;  1ZZY A;  5DAK A;  3GUS A;  2IPA A;  4G2E A;  1SK1 A;  3QAG A;  3IXR A;  3WT2 A;  1AUC A;  1O8W A;  2ALB A;  3FZ4 A;  1DE1 A;  3RDW A;  4J57 E;  1Z7P A;  1X5C A;  2L4Q A;  1FVJ A;  2GZY A;  4GQC A;  1NHO A;  1T00 A;  1CQH A;  1URM A;  4F03 A;  4YKF A;  4F9Z A;  2L57 A;  4NXI A;  2LRC A;  2OJL A;  1S3D A;  1BX9 A;  2MBT A;  3N9J A;  1XWC A;  2L5O A;  1GRX A;  1U6T A;  3M3M A;  4I2T A;  2GSR A;  1PL1 A;  3QR6 A;  1AQX A;  3GFK A;  4XS4 B;  22GS A;  2XHF A;  2CAI A;  4J2F A;  2G2Q A;  1HYU A;  3ZZX A;  3LOR A;  4CDO A;  2LJA A;  3ERF A;  2VIM A;  2AUV A;  1SD9 A;  1A2J A;  2A4V A;  3L0H A;  4I97 A;  2HRA A;  2VCX A;  4BVY B;  3ZVJ D;  2OAD A;  4O5Q A;  2H0I A;  2L59 A;  1ZYE A;  3VFI A;  5HR3 A;  1BYE A;  1K3O A;  4X1U A;  3DXB A;  5IOW A;  1XWA A;  4GXZ A;  3ZFB A;  2LRN A;  4JR4 A;  3P2A A;  4L0W A;  1TKD B;  1M9A A;  19GS A;  1PRX A;  2JAD A;  4POL A;  5AN1 A;  4TOP A;  3HXS A;  2XC2 A;  1XPV A;  3O6T A;  2CX4 A;  5IPG A;  2NBS A;  4O32 A;  1E6B A;  3ZIJ A;  4MZC A;  2YAN A;  1F9M A;  1X5D A;  4K7I A;  3C1S A;  20GS A;  2GQL A;  4K2X A;  4FYU A;  4JBB A;  5B6N A;  4ZIL A;  1F3A A;  1R26 A;  3HDC A;  5IMF A;  3LXT A;  5GAP D;  4KCE A;  3TDG A;  2C0E A;  4QQ7 A;  5EPF A;  5CRG A;  3UVT A;  4GF0 A;  1XXU A;  4FYC A;  2NTO A;  2B7K A;  1G7E A;  4V2L A;  3G7J A;  2QA1 A;  1ILO A;  4EDZ A;  2GVP A;  2C3T A;  3GN3 A;  1TRV A;  3Q18 A;  1WPI A;  2R3X A;  3BCK A;  2OKA A;  3ZLP A;  4V2N A;  1J0F A;  4I5Q A;  2YV7 A;  4MMM A;  3V1W A;  2Z9S A;  4D73 B;  1EV9 A;  4IP6 A;  1N2A A;  5G5E A;  14GS A;  1EWX A;  1GWC A;  3HVS A;  1U3I A;  4ISD A;  4K5S A;  1F2E A;  3IK9 A;  2KP2 A;  3FZ9 A;  2A2P A;  1B4Q A;  1SU9 A;  4K7N A;  3EE2 A;  2H0G A;  4PQ1 A;  4Q5N A;  1SK2 A;  1G6W A;  3F3Q A;  1GSQ A;  1OC9 A;  3UJ1 A;  2HZE B;  3ERG A;  4ECB A;  2X4A A;  5JWQ B;  3F63 A;  1NM3 A;  3DGQ A;  4TVE A;  5KN2 A;  1FO5 A;  1TK5 B;  4MPG A;  3M0F A;  3D22 A;  5D9T A;  3CRU A;  3L9U A;  1R4W A;  3VI5 A;  1S3C A;  1HNB A;  2H1B A;  3KM6 A;  3NIV A;  4XCS A;  3TUE A;  5DJM A;  5C04 A;  2YP6 A;  1IYI A;  3VPT A;  2IL3 A;  3UAR A;  3EMX A;  2M46 A;  4XS6 A;  3TKP A;  2YWI A;  4TR1 A;  2L6D A;  2YCD A;  5GAN D;  4LLR A;  6GSX A;  1A0R P;  1EGO A;  1PN0 A;  4FH8 A;  3APQ A;  4HJ2 A;  5G5F A;  2YOI A;  2I1U A;  2HSY A;  4ZIJ A;  3FEU A;  3DVW A;  1ERW A;  3E3E A;  4OO4 A;  4MPF A;  5D9V A;  4BVX B;  2DJ2 A;  3VWX A;  2WB9 A;  1V2A A;  5FT3 A;  3A5W A;  3UL3 A;  3KMN A;  4DSR A;  1PD2 1;  3HYP A;  1PMT A;  3UVH A;  4KGI A;  5ECI B;  5JWO B;  5AIS A;  2VO4 A;  3TCO A;  4YAV A;  2WFC A;  3F9U A;  1V58 A;  2LTK A;  1XG8 A;  1WWJ A;  2KHP A;  1SJZ A;  3GA4 A;  1HQO A;  2LNT A;  1Z5Y E;  3I6A A;  3F6D A;  4KND A;  1WRY A;  3LW9 A;  4RQR A;  1GSS A;  1FB6 A;  2WUL A;  4OFN A;  3HZ8 A;  2XBI A;  2M80 A;  2H74 A;  1EEJ A;  2P31 A;  2RM6 A;  2N5B A;  2E2G A;  1Q98 A;  3TRX A;  3I69 A;  3H79 A;  1Z6M A;  5H5Q A;  2CAQ A;  1OKD A;  1YQ1 A;  3F6F A;  2MMO A;  3DD3 A;  3QMX A;  3ZIV A;  1AAZ A;  3U6V A;  1LJR A;  2EIR A;  2CA8 A;  3CSI A;  2OBI A;  1K0M A;  1BED A;  1DUG A;  1EOG A;  4POK A;  1R5A A;  2X64 A;  3CTF A;  3KMO A;  3IR4 A;  4NMU A;  3TB2 A;  1HNA A;  1SKW B;  2VUP A;  1GSU A;  4MF7 A;  4V1A p;  4JU5 A;  4MH2 A;  4N11 A;  1OYJ A;  2H73 A;  3D4M A;  1AQV A;  3F8U A;  1FOH A;  1ZGN A;  1B48 A;  1TU7 A;  2G0F A;  1VF3 A;  2LST A;  5ID2 B;  2MZC A;  1H75 A;  4L5L A;  3P90 A;  4IJ3 A;  1W4V A;  2L6C A;  3HVX A;  2QC7 A;  2F8F A;  1TU8 A;  2FA8 A;  5D8I A;  3EPT A;  4ZXG A;  4FQU A;  3C7M A;  4V1A g;  2HSH A;  2O85 A;  1GLQ A;  2WDU A;  2REM A;  4MP4 A;  1ZL9 A;  1I9D A;  3H1N A;  3KCM A;  5GZZ B;  2WRT A;  1T4Y A;  2OA7 A;  4KSM A;  3ME7 A;  1XVQ A;  4G10 A;  4BPY A;  2YN1 A;  3IBH A;  1WP0 A;  3UAP A;  4OD7 A;  1XVW A;  3RAZ A;  2IMI A;  4MF6 A;  4TRX A;  1FW1 A;  3DIE A;  3WYW A;  4HOJ A;  3SBC A;  1ST9 A;  1GL8 A;  2PMT A;  3APS A;  1TJD A;  3A2X A;  3HZ4 A;  2I81 A;  2C3Q A;  1BJX A;  1O6J A;  1E2Y A;  4KDU A;  3WGD A;  5B8B A;  4EVM A;  1T3B A;  3BJ5 A;  2XPD A;  2DML A;  1WMJ A;  3FZ5 A;  4LA1 A;  4GQF A;  3A5I A;  3LWA A;  1M2B A;  3DYR A;  3ZML A;  1ERU A;  4K6X A;  3TKS E;  1WOU A;  5G2Z A;  2H01 A;  4MJE A;  3D5J A;  5HR2 A;  1XCC A;  2XBQ A;  3KH9 A;  4DSQ A;  4HEA 2;  3FRC A;  3ZYW A;  4JRR A;  3ERW A;  2IFQ B;  2VL2 A;  5D73 A;  2F51 A;  2WCI A;  4EDY A;  4OCE A;  5J3R A;  2MBS A;  3TRP A;  2JU5 A;  4X4J A;  1SKR B;  3GTU B;  1X9S B;  1SL2 B;  2KP1 A;  1B9Y C;  4N10 A;  3SWL A;  1A2L A;  3IK7 A;  4MJB A;  4ZB6 A;  1X9M B;  2J23 A;  2VD0 A;  3QFA C;  1VRS D;  5HR1 A;  1XW5 A;  4XTS A;  2H72 A;  5DAL A;  2IMD A;  4MCU A;  2JZT A;  2LJK A;  1FHE A;  3Q74 A;  4YKG A;  4P3Y B;  1EV4 A;  3VUR A;  5D96 A;  4ECI A;  2R37 A;  3WGX A;  1ZYQ B;  3ZRE A;  3PR8 A;  1K0A A;  4WF5 A;  5HQP A;  2GDR A;  2BTO T;  5KN3 A;  4PQH A;  3QAV A;  2FCH A;  4WF4 A;  4X43 A;  1TRU A;  1KBN A;  3CRT A;  4K9Z A;  3IE3 A;  3D21 A;  3RHC A;  2R6K A;  4NV2 A;  5CYY A;  2L4C A;  4GSS A;  2R0G A;  1YEX A;  4X0X A;  4GST A;  2B1L A;  2MMN A;  2CT6 A;  1B4P A;  3C71 A;  3DRN A;  4G19 A;  4TXO B;  2YNX A;  3F4R A;  4WET A;  2I3Y A;  3M9K A;  1TK0 B;  4XRD A;  4IQ1 A;  5LCZ A;  1QGV A;  3MYD A;  2DMM A;  4XIH A;  4AJ8 A;  1F37 A;  2JL4 A;  1OC8 A;  4HZ2 A;  1GTB A;  3GX0 A;  1HNC A;  1JLV A;  1J9B A;  4KAE A;  2IMF A;  1M7T A;  3IAS 2;  4EO3 A;  3HD5 A;  4K0G A;  2HZF A;  1A24 A;  2H0H A;  3ED3 A;  4IHU A;  4L5O A;  4DVC A;  4GSN A;  5IPH A;  4EF0 A;  3IPZ A;  1Z3E A;  1GUL A;  5GST A;  1GLP A;  1OE8 A;  2H75 A;  1TXX A;  1KNG A;  1S3A A;  4ID0 A;  1O7U A;  1K0B A;  4L0U A;  4K8M A;  3ZRD A;  2YWO A;  4AJ7 A;  5ABR A;  1AIU A;  4K1F A;  4PUR A;  1OVN A;  2H70 A;  3TOT A;  5B8A A;  3FY7 A;  1ERV A;  4ZB8 A;  1PQN A;  4MF5 A;  1JZR A;  3QAW A;  3CYN A;  1GSE A;  5ECL B;  4N0V A;  4TKY A;  4MNN A;  4GRF A;  2FLS A;  2PVQ A;  4PGT A;  9GSS A;  1YZX A;  1JZD A;  1GNW A;  2YV9 A;  5COH A;  3QCP A;  2H8L A;  3GH6 A;  5JCW A;  3H93 A;  4IJI A;  1HD2 A;  3EWL A;  3KTB A;  5ECK B;  4JZQ A;  4EUY A;  4O5R A;  2HFD A;  5KEJ A;  1GUK A;  1ZCP A;  2V6O A;  1V98 A;  1SKS B;  1VF1 A;  3KJY A;  4I2U A;  2VCW A;  4KDX A;  5F07 A;  3EU3 A;  4MLY A;  2CQ9 A;  5IO2 A;  4POM A;  4HSC X;  2B7J A;  2GTU A;  2X99 A;  4EL1 A;  1VGL A;  2A2R A;  3FKF A;  3GKK A;  3O76 A;  2DKH A;  5ELA A;  3E0U A;  4AJ6 A;  3TKS A;  1GSF A;  1Q4J A;  1T7P B;  2LRT A;  2C80 A;  3UMA A;  5IOX A;  2EIQ A;  3IDV A;  2OBK A;  18GS A;  2YWM A;  2FWH A;  2OAC A;  2LEG A;  2GS3 A;  1A0F A;  1AW9 A;  2PUK C;  3P8W A;  4IN0 A;  2K9F A;  3EIN A;  1Y25 A;  3EU4 A;  3MAK A;  1AQW A;  4HS1 A;  5A4V A;  4F82 A;  2VM1 A;  4BA7 A;  1X9W B;  4IKH A;  5CRE A;  2HI7 A;  4RQX A;  1YKC A;  2BMX A;  1NHY A;  3LFL A;  4MZW A;  4YQU A;  5LNK e;  2MYG A;  2VL2 C;  1ZMA A;  5KOX A;  2DKI A;  1TP9 A;  4ZBA A;  1PN9 A;  5IMV A;  3QOU A;  1K0C A;  1NW2 A;  1B8X A;  2AYT A;  2RUF A;  3MSZ A;  3TOU A;  2C3N A;  1TI1 A;  2H19 A;  4BWS A;  2VCT A;  2HYX A;  2OE0 A;  4HQS A;  3BD2 A;  5HFG A;  5C00 A;  3J7Y k;  4DSS B;  5F05 A;  1O85 A;  3LSZ A;  1RW1 A;  5L71 A;  3A2V A;  3G7Y A;  4WR4 A;  5IMZ A;  4G0K A;  2EIO A;  2O7K A;  3IAM 2;  5AIV A;  1F6M C;  2VLU A;  3PPU A;  2FWE A;  4MJC A;  3LYK A;  1THO A;  4HJM A;  1K0D A;  1PFO A;  4KE3 A;  2QA2 A;  2R5G A;  3G9B A;  1DE2 A;  1PA3 A;  4BL7 A;  2A4H A;  1K0O A;  3FK8 A;  4OFT A;  2H1A A;  4YH2 A;  5J9B A;  1R5P A;  1YF1 A;  5E59 A;  4EIP A;  2LJR A;  4NPB A;  2YWN A;  4LL1 B;  4PQI A;  5DDL A;  3DKS A;  2HNL A;  2PPT A;  2DJJ A;  17GS A;  5DAK B;  4Z2R A;  3R3E A;  3Q19 A;  4IS0 A;  4WBR D;  2GST A;  5D9X A;  4ZBB A;  3GST A;  1GUH A;  3FZA A;  3F3R A;  2F8A A;  3G7I A;  1AXD A;  3LGC A;  1FOV A;  1XW9 A;  1JHB A;  1G0T A;  2KLX A;  3CQF A;  3MNG A;  4Q5Q A;  3IOS A;  1GTU A;  2DBC A;  5F06 A;  2X8H A;  1J08 A;  2PWJ A;  4ZL7 A;  4JED A;  1YJ6 A;  5ECS A;  1NSW A;  1PKZ A;  4HQZ A;  4BVY A;  1JZO A;  2QKE A;  2DLX A;  4KCA A;  4YQV A;  1KTE A;  2AHE A;  5ECR B;  3BBY A;  12GS A;  1M99 A;  4N30 A;  3LQ7 A;  2YZH A;  2FY6 A;  4ECC A;  2DJ0 A;  1RK4 A;  5ECM B;  1YEP A;  13GS A;  2FA4 A;  3HA9 A;  4LL4 B;  2O87 A;  1UC7 A;  1MDJ A;  6GSS A;  2H66 A;  2R2J A;  1SK0 A;  3FHK A;  1UN2 A;  2K18 A;  2PVO C;  3R2Q A;  2B3S A;  5HR0 A;  2FNO A;  2MMZ A;  5E4W A;  2LQQ A;  1YKA A;  3BOA A;  5AIX A;  3PIN A;  4V2M A;  4PUF C;  2X8C A;  5IMC A;  4HUA A;  5ECP B;  1JZW A;  3TKS C;  1MD4 A;  1MDI A;  3RPP A;  1XFL A;  5B7C A;  1GTI A;  4Q5F A;  2NPB A;  2R4V A;  1VF4 A;  3HVV A;  4O5U A;  2FWG A;  2FD3 A;  4ULX A;  3KD0 A;  4DEJ A;  2LUS A;  5DBQ A;  3IC4 A;  5IMA A;  2GSS A;  5H5R A;  1FG4 A;  3FMW A;  5CP1 A;  2IME A;  3US3 A;  2HT9 A;  4D73 A;  3MIX A;  4HZ4 A;  1G6Y A;  1ABA A;  1X0R A;  3M9J A;  2DC5 A;  3FR9 A;  3UIW A;  1XWB A;  5CRW A;  4EKZ A;  2BJX A;  4OWY A;  2C8U A;  2B5Y A;  3GMF A;  1O81 A;  4ICY A;  2P0G A;  3DVX A;  3EVI A;  11GS A;  2VCZ A;  4TR0 A;  4IW9 A;  3L4N A;  2H30 A;  3F4S A;  2HZE A;  1OE7 A;  5HFK A;  2H6Z A;  4LMV A;  2B5E A;  3W6G A;  5IM9 A;  1OC9 B;  1GTA A;  2IWT A;  3VWU A;  1M2A A;  5G1K A;  2GQK A;  2OE3 A;  2DJ3 A;  3M8N A;  2WJU A;  3ZFL A;  1GNE A;  4Q5R A;  3IA1 A;  5J41 A;  3EC3 A;  3ZTL A;  3MDK A;  5ENU A;  3VPQ A;  2J9H A;  1F3B A;  4KB3 A;  1TW9 A;  3W8J A;  4EXJ A;  2V32 A;  1EEM A;  2E0Q A;  4CW9 A;  3ME8 A;  3BCI A;  3NOF A;  3W8S A;  2XPE A;  2C0D A;  4LMW A;  5FHI A;  1QMV A;  1XW6 A;  1ML6 A;  1LU4 A;  4O92 A;  4RI6 A;  4TR1 B;  1TOF A;  3QDN A;  5KN0 A;  1PKW A;  1U87 A;  5LD0 A;  2H6X A;  2IN3 A;  1JLW A;  4OFM A;  5IIZ A;  5JWR B;  3GHA A;  4L8E A;  1FVK A;  2ZUP A;  3DML A;  1ZYP A;  2KUC A;  5IMD A;  4BVX A;  5DQS A;  2LQO A;  2K8V A;  1OC3 A;  5CRH A;  2WS2 A;  4K2D A;  1MTC A;  5ELG A;  3LYP A;  1XBS A;  1SL0 B;  4Z7X A;  2VAF A;  4ZL8 A;  2B1K A;  5CRD A;  4GLT A;  3L9V A;  3TJK A;  4PNF A;  2H6Y A;  1TRW A;  2L5L A;  5DVB A;  3LG6 A;  5H5S A;  5G30 A;  4KA0 A;  4WR5 A;  1M9B A;  3UEM A;  2IIY A;  4PUA A;  1YY7 A;  3HCZ A;  1T8E B;  2C0G A;  3A2W A;  5JCU A;  3JCM L;  2HRF A;  3S9F A;  5IQY A;  1KEB A;  4BIK A;  2C1Y A;  4NHZ A;  4EC0 A;  5CAX A;  5D9W A;  5DQY A;  4WEY A;  2NVL A;  5IO0 A;  2DIY A;  4GWR A;  1N8J A;  4PTS A;  1XWK A;  3M1G A;  3GNJ A;  4A5P A;  3FR3 A;  1GH2 A;  1SYX A;  1IYH A;  2TRC P;  5ECO B;  4MDC A;  1O73 A;  4Z2U A;  2PER A;  4K5R A;  3CTG A;  4RUV A;  2GZZ A;  6GSV A;  2AJQ B;  4KDY A;  3GL3 A;  3EUR A;  2KOK A;  4QL9 A;  4WBJ A;  3GKM A;  2GLR A;  3WGE A;  8GSS A;  1X5E A;  7GSS A;  4POB A;  1T1V A;  1H4O A;  3L78 A;  3KH7 A;  5DCG A;  3H8Q A;  3Q6O A;  5ID2 A;  5EVO A;  4G9H A;  2GGT A;  4G0I A;  4NAX A;  4BWQ A;  3EYT A;  2ZNM A;  1K0N A;  4RI7 A;  4OMV A;  5INY A;  4XS1 A;  5D93 A;  2YPM A;  1O8X A;  2PN8 A;  3HJP A;  3LEF A;  3GKX A;  3F4T A;  1EP7 A;  4MA9 A;  3C73 A;  4TXV A;  4KF9 A;  3EMP A;  3O3T A;  4HU7 A;  2DSA A;  1QQ2 A;  3N5O A;  1MD3 A;  3GKN A;  2YJH A;  3QPM A;  4KUN A;  2IMK A;  1TTZ A;  1XWG A;  4EE0 A;  2HXK A;  1DSB A;  2FUG 2;  1UVZ A;  3GSS A;  5FWG A;  2GZP A;  3ZVJ A;  1FAA A;  1SEN A;  2V6K A;  2UZ8 A;  3TJG A;  3C8E A;  4FYB A;  1BG5 A;  3ZIT A;  2GT5 A;  4TW5 A;  3UBL A;  5J9C A;  5F0G A;  5F8B A;  3HHV A;  1TRS A;  1U3A A;  5AGY A;  2JSZ A;  3J7Y b;  2GQM A;  1W89 A;  3GYK A;  4I8B A;  5KN1 A;  6GSU A;  2CZ3 A;  2P5Q A;  2C4J A;  2H76 A;  1ON4 A;  4IGJ A;  4ZBD A;  5G1L A;  1BQ7 A;  3TJF A;  1A8Y A; 
#chains in the Genus database with same CATH homology
 2IJY A;  4ZB9 A;  3RHB A;  4EIQ A;  4OO5 A;  1DBY A;  2O8V B;  3WD6 A;  2QGV A;  2VL3 A;  3OR5 A;  1R7H A;  4ZL9 A;  4I6X A;  2H1D A;  3MWH A;  1WIK A;  3D0Z A;  2K6V A;  2V2G A;  4TN8 A;  1EGR A;  2IFQ A;  2PBJ A;  4WXT A;  5KOW A;  3IRA A;  2JZR A;  3FW2 A;  1PL2 A;  1Z7R A;  2B5X A;  2LNS A;  5G31 A;  2R0C A;  4O7H A;  4PX1 A;  3GTU A;  3CBU A;  1TK8 B;  3IHQ A;  4FO5 A;  4HI7 A;  1ACV A;  2F9S A;  1SJI A;  4NHW A;  4E8E A;  4IEL A;  3GIX A;  2HRK A;  3D6I A;  1FB0 A;  1AC1 A;  2CZ2 A;  5ECN B;  5DAL B;  2D2Z A;  3UOM A;  2PU9 C;  4PNG A;  1SD8 A;  4KH7 A;  1QFN A;  2MMA A;  4MJA A;  3L9S A;  1M0U A;  3KZQ A;  3RBT A;  1ZOF A;  1YF0 A;  1EZK A;  3KP9 A;  1SL1 B;  4Z2T A;  4K7O A;  4OCF A;  3TJB A;  1A8L A;  3QFB C;  2NDO A;  2RUE A;  1JFU A;  1QXH A;  2WZ9 A;  3TRQ A;  3VLN A;  3E9J B;  2VCV A;  1XZO A;  3VWV A;  4JE1 A;  3GX8 A;  2VLT A;  4AF2 A;  2TIR A;  1PSQ A;  2M72 A;  2YZU A;  3KGK A;  4QL7 A;  2DJK A;  2GT6 A;  1PX7 A;  2DJ1 A;  2ON7 A;  2H1G A;  4TXO A;  5J4U A;  3U5R E;  1A2M A;  3F0I A;  2I4A A;  1M2D A;  5HFI A;  1PGT A;  1EP8 A;  3LJR A;  4ML1 A;  3VK9 A;  3I43 A;  2CVK A;  1A23 A;  10GS A;  1BAY A;  2VD1 A;  2VM2 A;  3TKQ A;  2VLV A;  4GTU A;  1MEK A;  3RPN A;  2E2M A;  4ILF A;  3FYG A;  2DIZ A;  2ZCT A;  4N0Z A;  5CO3 A;  1T4Z A;  3KEB A;  3IHG A;  4YQM A;  1THX A;  3TGZ A;  4XS4 A;  1SJ6 A;  5ECQ B;  3PGT A;  1MDK A;  1GSY A;  5DCH A;  1ZYN A;  3TJJ A;  6GST A;  1QK8 A;  1CQG A;  3UBK A;  1VF2 A;  1I5G A;  6GSW A;  2GSQ A;  3IV4 A;  2VCQ A;  3H4K A;  4FIW A;  2FWF A;  2K8S A;  2JSY A;  4MAB A;  1C72 A;  2P5R A;  4KSO A;  4WKW A;  1GUM A;  2B6M A;  3IC8 A;  1XOA A;  2LV3 A;  5DJL A;  1QUW A;  3HJM A;  4AGS A;  2CVB A;  4XHM A;  4E8H A;  1XIY A;  4F0B A;  4NV5 A;  2PGT A;  3GV1 A;  3KIJ A;  2AV4 A;  2AB6 A;  2ON5 A;  4JR6 A;  3GRX A;  4USS A;  5JCG A;  2X49 A;  3C1R A;  1V57 A;  2V1M A;  3CSJ A;  2RII A;  2X8G A;  4CY6 A;  1YDK A;  1LBK A;  2C0F A;  2HRN A;  6GSY A;  2YJ7 A;  2F3M A;  5J5N A;  1ERT A;  3I9V 2;  4ML6 A;  4IBP A;  5A4W A;  4J56 E;  2QSI A;  1V40 A;  4HU9 A;  2HE3 A;  3ZL5 A;  1USB A;  1GSD A;  3FR6 A;  4F2I A;  2JZS A;  3GUR A;  1XOB A;  1Z9H A;  1UA5 A;  3LXZ A;  3CSH A;  4TR3 A;  3P7X A;  1GP1 A;  3GH9 A;  3A3T A;  4CHS A;  1Y6E A;  4MZB A;  4YAP A;  3NZN A;  3TKR A;  3WT1 A;  2CVD A;  2CX3 A;  1PX6 A;  2E7P A;  5A4U A;  4NWY A;  1B9X C;  4ECJ A;  4IVF A;  1Z6N A;  3AY8 A;  2TRX A;  2R0P A;  4XRA A;  3K8N A;  1K3L A;  2FGX A;  4MK3 A;  3VWW A;  4PXO A;  3HY2 A;  4H86 A;  2N5A A;  4F0C A;  3KXO A;  4K0N A;  5BMU A;  4KW6 A;  5CNW A;  2LS5 A;  1OAZ A;  3QD9 A;  3VI7 A;  3CXG A;  1G7O A;  5GSS A;  2OE1 A;  3ZMK A;  4IP1 A;  4IQA A;  3CMI A;  5A5K A;  2VL9 A;  4G0L A;  1WE0 A;  2CV4 A;  4MH3 A;  2EC4 A;  2HSM A;  4DSS A;  3KP8 A;  4ACS A;  1WJK A;  3PH9 A;  2JAC A;  1OKT A;  2WGR A;  3DWV A;  3APO A;  2RLI A;  1RQM A;  2HLS A;  1TI3 A;  2I9H A;  3DEX A;  2AAW A;  3HJO A;  3KTL A;  5B6M A;  4HDE A;  1EOH A;  3D4T A;  2RM5 A;  1U88 A;  5EY6 A;  3HKR A;  4TR4 A;  1V9W A;  2FHE A;  4GCI A;  1SYR A;  4BL7 B;  2ES7 A;  2O89 A;  4KX4 A;  16GS A;  2A2S A;  5EL8 A;  2H71 A;  5ECH B;  2LKU A;  3ISO A;  2VOC A;  2V41 A;  3GL5 A;  1TDI A;  4CY8 A;  1K3Y A;  5BRT A;  2N5F A;  1ZZY A;  5DAK A;  3GUS A;  2IPA A;  4G2E A;  1SK1 A;  3QAG A;  3IXR A;  3WT2 A;  1AUC A;  1O8W A;  2ALB A;  3FZ4 A;  1DE1 A;  3RDW A;  4J57 E;  1Z7P A;  1X5C A;  2L4Q A;  1FVJ A;  2GZY A;  4GQC A;  1NHO A;  1T00 A;  1CQH A;  1URM A;  4F03 A;  4YKF A;  4F9Z A;  2L57 A;  4NXI A;  2LRC A;  2OJL A;  1S3D A;  1BX9 A;  2MBT A;  3N9J A;  1XWC A;  2L5O A;  1GRX A;  1U6T A;  3M3M A;  4I2T A;  2GSR A;  1PL1 A;  3QR6 A;  1AQX A;  3GFK A;  4XS4 B;  22GS A;  2XHF A;  2CAI A;  4J2F A;  2G2Q A;  1HYU A;  3ZZX A;  3LOR A;  4CDO A;  2LJA A;  3ERF A;  2VIM A;  2AUV A;  1SD9 A;  1A2J A;  2A4V A;  3L0H A;  4I97 A;  2HRA A;  2VCX A;  4BVY B;  3ZVJ D;  2OAD A;  4O5Q A;  2H0I A;  2L59 A;  1ZYE A;  3VFI A;  5HR3 A;  1BYE A;  1K3O A;  4X1U A;  3DXB A;  5IOW A;  1XWA A;  4GXZ A;  3ZFB A;  2LRN A;  4JR4 A;  3P2A A;  4L0W A;  1TKD B;  1M9A A;  19GS A;  1PRX A;  2JAD A;  4POL A;  5AN1 A;  4TOP A;  3HXS A;  2XC2 A;  1XPV A;  3O6T A;  2CX4 A;  5IPG A;  2NBS A;  4O32 A;  1E6B A;  3ZIJ A;  4MZC A;  2YAN A;  1F9M A;  1X5D A;  4K7I A;  3C1S A;  20GS A;  2GQL A;  4K2X A;  4FYU A;  4JBB A;  5B6N A;  4ZIL A;  1F3A A;  1R26 A;  3HDC A;  5IMF A;  3LXT A;  5GAP D;  4KCE A;  3TDG A;  2C0E A;  4QQ7 A;  5EPF A;  5CRG A;  3UVT A;  4GF0 A;  1XXU A;  4FYC A;  2NTO A;  2B7K A;  1G7E A;  4V2L A;  3G7J A;  2QA1 A;  1ILO A;  4EDZ A;  2GVP A;  2C3T A;  3GN3 A;  1TRV A;  3Q18 A;  1WPI A;  2R3X A;  3BCK A;  2OKA A;  3ZLP A;  4V2N A;  1J0F A;  4I5Q A;  2YV7 A;  4MMM A;  3V1W A;  2Z9S A;  4D73 B;  1EV9 A;  4IP6 A;  1N2A A;  5G5E A;  14GS A;  1EWX A;  1GWC A;  3HVS A;  1U3I A;  4ISD A;  4K5S A;  1F2E A;  3IK9 A;  2KP2 A;  3FZ9 A;  2A2P A;  1B4Q A;  1SU9 A;  4K7N A;  3EE2 A;  2H0G A;  4PQ1 A;  4Q5N A;  1SK2 A;  1G6W A;  3F3Q A;  1GSQ A;  1OC9 A;  3UJ1 A;  2HZE B;  3ERG A;  4ECB A;  2X4A A;  5JWQ B;  3F63 A;  1NM3 A;  3DGQ A;  4TVE A;  5KN2 A;  1FO5 A;  1TK5 B;  4MPG A;  3M0F A;  3D22 A;  5D9T A;  3CRU A;  3L9U A;  1R4W A;  3VI5 A;  1S3C A;  1HNB A;  2H1B A;  3KM6 A;  3NIV A;  4XCS A;  3TUE A;  5DJM A;  5C04 A;  2YP6 A;  1IYI A;  3VPT A;  2IL3 A;  3UAR A;  3EMX A;  2M46 A;  4XS6 A;  3TKP A;  2YWI A;  4TR1 A;  2L6D A;  2YCD A;  5GAN D;  4LLR A;  6GSX A;  1A0R P;  1EGO A;  1PN0 A;  4FH8 A;  3APQ A;  4HJ2 A;  5G5F A;  2YOI A;  2I1U A;  2HSY A;  4ZIJ A;  3FEU A;  3DVW A;  1ERW A;  3E3E A;  4OO4 A;  4MPF A;  5D9V A;  4BVX B;  2DJ2 A;  3VWX A;  2WB9 A;  1V2A A;  5FT3 A;  3A5W A;  3UL3 A;  3KMN A;  4DSR A;  1PD2 1;  3HYP A;  1PMT A;  3UVH A;  4KGI A;  5ECI B;  5JWO B;  5AIS A;  2VO4 A;  3TCO A;  4YAV A;  2WFC A;  3F9U A;  1V58 A;  2LTK A;  1WWJ A;  2KHP A;  1SJZ A;  3GA4 A;  1HQO A;  2LNT A;  1Z5Y E;  3I6A A;  3F6D A;  4KND A;  1WRY A;  3LW9 A;  4RQR A;  1GSS A;  1FB6 A;  2WUL A;  4OFN A;  3HZ8 A;  2XBI A;  2M80 A;  2H74 A;  1EEJ A;  2P31 A;  2RM6 A;  2N5B A;  2E2G A;  1Q98 A;  3TRX A;  3I69 A;  3H79 A;  1Z6M A;  5H5Q A;  2CAQ A;  1OKD A;  1YQ1 A;  3F6F A;  2MMO A;  3DD3 A;  3QMX A;  3ZIV A;  1AAZ A;  3U6V A;  1LJR A;  2EIR A;  2CA8 A;  3CSI A;  2OBI A;  1K0M A;  1BED A;  1DUG A;  1EOG A;  4POK A;  1R5A A;  2X64 A;  3CTF A;  3KMO A;  3IR4 A;  4NMU A;  3TB2 A;  1HNA A;  1SKW B;  2VUP A;  1GSU A;  4MF7 A;  4V1A p;  4JU5 A;  4MH2 A;  4N11 A;  1OYJ A;  2H73 A;  3D4M A;  1AQV A;  3F8U A;  1FOH A;  1ZGN A;  1B48 A;  1TU7 A;  2G0F A;  1VF3 A;  2LST A;  5ID2 B;  2MZC A;  1H75 A;  4L5L A;  3P90 A;  4IJ3 A;  1W4V A;  2L6C A;  3HVX A;  2QC7 A;  2F8F A;  1TU8 A;  2FA8 A;  5D8I A;  3EPT A;  4ZXG A;  4FQU A;  3C7M A;  4V1A g;  2HSH A;  2O85 A;  1GLQ A;  2WDU A;  2REM A;  4MP4 A;  1ZL9 A;  1I9D A;  3H1N A;  3KCM A;  5GZZ B;  2WRT A;  1T4Y A;  2OA7 A;  4KSM A;  3ME7 A;  1XVQ A;  4G10 A;  4BPY A;  2YN1 A;  3IBH A;  1WP0 A;  3UAP A;  4OD7 A;  1XVW A;  3RAZ A;  2IMI A;  4MF6 A;  4TRX A;  1FW1 A;  3DIE A;  3WYW A;  4HOJ A;  3SBC A;  1ST9 A;  1GL8 A;  2PMT A;  3APS A;  1TJD A;  3A2X A;  3HZ4 A;  2I81 A;  2C3Q A;  1BJX A;  1O6J A;  1E2Y A;  4KDU A;  3WGD A;  5B8B A;  4EVM A;  1T3B A;  3BJ5 A;  2XPD A;  2DML A;  1WMJ A;  3FZ5 A;  4LA1 A;  4GQF A;  3A5I A;  3LWA A;  1M2B A;  3DYR A;  3ZML A;  1ERU A;  4K6X A;  3TKS E;  1WOU A;  5G2Z A;  2H01 A;  4MJE A;  3D5J A;  5HR2 A;  1XCC A;  2XBQ A;  3KH9 A;  4DSQ A;  4HEA 2;  3FRC A;  3ZYW A;  4JRR A;  3ERW A;  5D73 A;  2IFQ B;  2VL2 A;  2F51 A;  2WCI A;  4EDY A;  4OCE A;  5J3R A;  2MBS A;  3TRP A;  2JU5 A;  4X4J A;  1SKR B;  3GTU B;  1X9S B;  1SL2 B;  2KP1 A;  1B9Y C;  4N10 A;  3SWL A;  1A2L A;  3IK7 A;  4MJB A;  4ZB6 A;  1X9M B;  2J23 A;  2VD0 A;  3QFA C;  1VRS D;  5HR1 A;  1XW5 A;  4XTS A;  2H72 A;  5DAL A;  2IMD A;  4MCU A;  2JZT A;  2LJK A;  1FHE A;  3Q74 A;  4YKG A;  4P3Y B;  1EV4 A;  3VUR A;  5D96 A;  4ECI A;  2R37 A;  3WGX A;  1ZYQ B;  3ZRE A;  3PR8 A;  1K0A A;  4WF5 A;  5HQP A;  2GDR A;  2BTO T;  5KN3 A;  4PQH A;  3QAV A;  2FCH A;  4WF4 A;  4X43 A;  1TRU A;  1KBN A;  3CRT A;  4K9Z A;  3IE3 A;  3D21 A;  3RHC A;  2R6K A;  4NV2 A;  5CYY A;  2L4C A;  4GSS A;  2R0G A;  1YEX A;  4X0X A;  4GST A;  2B1L A;  2MMN A;  2CT6 A;  1B4P A;  3C71 A;  3DRN A;  4G19 A;  4TXO B;  2YNX A;  3F4R A;  4WET A;  2I3Y A;  3M9K A;  1TK0 B;  4XRD A;  4IQ1 A;  5LCZ A;  1QGV A;  3MYD A;  2DMM A;  4XIH A;  4AJ8 A;  1F37 A;  2JL4 A;  1OC8 A;  4HZ2 A;  1GTB A;  3GX0 A;  1HNC A;  1JLV A;  1J9B A;  4KAE A;  2IMF A;  1M7T A;  3IAS 2;  4EO3 A;  3HD5 A;  4K0G A;  2HZF A;  1A24 A;  2H0H A;  3ED3 A;  4IHU A;  4L5O A;  4DVC A;  4GSN A;  5IPH A;  4EF0 A;  3IPZ A;  1Z3E A;  1GUL A;  5GST A;  1GLP A;  1OE8 A;  2H75 A;  1TXX A;  1KNG A;  1S3A A;  4ID0 A;  1O7U A;  1K0B A;  4L0U A;  4K8M A;  3ZRD A;  2YWO A;  4AJ7 A;  5ABR A;  1AIU A;  4K1F A;  4PUR A;  1OVN A;  2H70 A;  3TOT A;  5B8A A;  3FY7 A;  1ERV A;  4ZB8 A;  1PQN A;  4MF5 A;  1JZR A;  3QAW A;  3CYN A;  1GSE A;  5ECL B;  4N0V A;  4TKY A;  4MNN A;  4GRF A;  2FLS A;  2PVQ A;  4PGT A;  9GSS A;  1YZX A;  1JZD A;  1GNW A;  2YV9 A;  5COH A;  3QCP A;  2H8L A;  3GH6 A;  5JCW A;  3H93 A;  4IJI A;  1HD2 A;  3EWL A;  3KTB A;  5ECK B;  4JZQ A;  4EUY A;  4O5R A;  2HFD A;  5KEJ A;  1GUK A;  1ZCP A;  2V6O A;  1V98 A;  1SKS B;  1VF1 A;  3KJY A;  4I2U A;  2VCW A;  4KDX A;  5F07 A;  3EU3 A;  4MLY A;  2CQ9 A;  5IO2 A;  4POM A;  2B7J A;  2GTU A;  2X99 A;  4EL1 A;  1VGL A;  2A2R A;  3FKF A;  3GKK A;  3O76 A;  2DKH A;  5ELA A;  3E0U A;  4AJ6 A;  3TKS A;  1GSF A;  1Q4J A;  1T7P B;  2LRT A;  2C80 A;  3UMA A;  5IOX A;  2EIQ A;  3IDV A;  2OBK A;  18GS A;  2YWM A;  2FWH A;  2OAC A;  2LEG A;  2GS3 A;  1A0F A;  1AW9 A;  2PUK C;  3P8W A;  4IN0 A;  2K9F A;  3EIN A;  1Y25 A;  3EU4 A;  3MAK A;  1AQW A;  4HS1 A;  5A4V A;  4F82 A;  2VM1 A;  4BA7 A;  1X9W B;  4IKH A;  5CRE A;  2HI7 A;  4RQX A;  1YKC A;  2BMX A;  1NHY A;  3LFL A;  4MZW A;  4YQU A;  5LNK e;  2MYG A;  2VL2 C;  1ZMA A;  5KOX A;  2DKI A;  1TP9 A;  4ZBA A;  1PN9 A;  5IMV A;  3QOU A;  1K0C A;  1NW2 A;  1B8X A;  2AYT A;  2RUF A;  3MSZ A;  3TOU A;  2C3N A;  1TI1 A;  2H19 A;  4BWS A;  2VCT A;  2HYX A;  2OE0 A;  4HQS A;  3BD2 A;  5HFG A;  5C00 A;  3J7Y k;  4DSS B;  5F05 A;  1O85 A;  3LSZ A;  1RW1 A;  5L71 A;  3A2V A;  3G7Y A;  4WR4 A;  5IMZ A;  4G0K A;  2EIO A;  2O7K A;  3IAM 2;  5AIV A;  1F6M C;  2VLU A;  3PPU A;  2FWE A;  4MJC A;  3LYK A;  1THO A;  4HJM A;  1K0D A;  4KE3 A;  2QA2 A;  2R5G A;  3G9B A;  1DE2 A;  1PA3 A;  4BL7 A;  2A4H A;  1K0O A;  3FK8 A;  4OFT A;  2H1A A;  4YH2 A;  5J9B A;  1R5P A;  1YF1 A;  5E59 A;  4EIP A;  2LJR A;  4NPB A;  2YWN A;  4LL1 B;  4PQI A;  5DDL A;  3DKS A;  2HNL A;  2PPT A;  2DJJ A;  17GS A;  5DAK B;  4Z2R A;  3R3E A;  3Q19 A;  4IS0 A;  4WBR D;  2GST A;  5D9X A;  4ZBB A;  3GST A;  1GUH A;  3FZA A;  3F3R A;  2F8A A;  3G7I A;  1AXD A;  3LGC A;  1FOV A;  1XW9 A;  1JHB A;  1G0T A;  2KLX A;  3MNG A;  4Q5Q A;  3IOS A;  1GTU A;  2DBC A;  5F06 A;  2X8H A;  1J08 A;  2PWJ A;  4ZL7 A;  4JED A;  1YJ6 A;  5ECS A;  1NSW A;  1PKZ A;  4HQZ A;  4BVY A;  1JZO A;  2QKE A;  2DLX A;  4KCA A;  4YQV A;  1KTE A;  2AHE A;  5ECR B;  3BBY A;  12GS A;  1M99 A;  4N30 A;  3LQ7 A;  2YZH A;  2FY6 A;  4ECC A;  2DJ0 A;  1RK4 A;  5ECM B;  1YEP A;  13GS A;  2FA4 A;  3HA9 A;  4LL4 B;  2O87 A;  1UC7 A;  1MDJ A;  6GSS A;  2H66 A;  2R2J A;  1SK0 A;  3FHK A;  1UN2 A;  2K18 A;  2PVO C;  3R2Q A;  2B3S A;  5HR0 A;  2FNO A;  2MMZ A;  5E4W A;  2LQQ A;  1YKA A;  3BOA A;  5AIX A;  3PIN A;  4V2M A;  4PUF C;  2X8C A;  5IMC A;  4HUA A;  5ECP B;  1JZW A;  3TKS C;  1MD4 A;  1MDI A;  3RPP A;  1XFL A;  5B7C A;  1GTI A;  4Q5F A;  2NPB A;  2R4V A;  1VF4 A;  3HVV A;  4O5U A;  2FWG A;  2FD3 A;  4ULX A;  3KD0 A;  4DEJ A;  2LUS A;  5DBQ A;  3IC4 A;  5IMA A;  2GSS A;  5H5R A;  1FG4 A;  3FMW A;  5CP1 A;  2IME A;  3US3 A;  2HT9 A;  4D73 A;  3MIX A;  4HZ4 A;  1G6Y A;  1ABA A;  1X0R A;  3M9J A;  2DC5 A;  3FR9 A;  3UIW A;  1XWB A;  5CRW A;  4EKZ A;  2BJX A;  4OWY A;  2C8U A;  2B5Y A;  3GMF A;  1O81 A;  4ICY A;  2P0G A;  3DVX A;  3EVI A;  11GS A;  2VCZ A;  4TR0 A;  4IW9 A;  3L4N A;  2H30 A;  3F4S A;  2HZE A;  1OE7 A;  5HFK A;  2H6Z A;  4LMV A;  2B5E A;  3W6G A;  5IM9 A;  1OC9 B;  1GTA A;  2IWT A;  3VWU A;  1M2A A;  5G1K A;  2GQK A;  2OE3 A;  2DJ3 A;  3M8N A;  2WJU A;  3ZFL A;  1GNE A;  4Q5R A;  3IA1 A;  5J41 A;  3EC3 A;  3ZTL A;  3MDK A;  5ENU A;  3VPQ A;  2J9H A;  1F3B A;  4KB3 A;  1TW9 A;  3W8J A;  4EXJ A;  2V32 A;  1EEM A;  2E0Q A;  4CW9 A;  3ME8 A;  3BCI A;  3NOF A;  3W8S A;  2XPE A;  2C0D A;  4LMW A;  5FHI A;  1QMV A;  1XW6 A;  1ML6 A;  1LU4 A;  4O92 A;  4RI6 A;  4TR1 B;  1TOF A;  3QDN A;  5KN0 A;  1PKW A;  1U87 A;  5LD0 A;  2H6X A;  2IN3 A;  1JLW A;  4OFM A;  5IIZ A;  5JWR B;  3GHA A;  4L8E A;  1FVK A;  2ZUP A;  3DML A;  1ZYP A;  2KUC A;  5IMD A;  4BVX A;  5DQS A;  2LQO A;  2K8V A;  1OC3 A;  5CRH A;  2WS2 A;  4K2D A;  1MTC A;  5ELG A;  3LYP A;  1XBS A;  1SL0 B;  4Z7X A;  2VAF A;  4ZL8 A;  2B1K A;  5CRD A;  4GLT A;  3L9V A;  3TJK A;  4PNF A;  2H6Y A;  1TRW A;  2L5L A;  5DVB A;  3LG6 A;  5H5S A;  5G30 A;  4KA0 A;  4WR5 A;  1M9B A;  3UEM A;  2IIY A;  4PUA A;  1YY7 A;  3HCZ A;  1T8E B;  2C0G A;  3A2W A;  5JCU A;  3JCM L;  2HRF A;  3S9F A;  5IQY A;  1KEB A;  2C1Y A;  4NHZ A;  4EC0 A;  5CAX A;  5D9W A;  5DQY A;  4WEY A;  2NVL A;  5IO0 A;  2DIY A;  4GWR A;  1N8J A;  4PTS A;  1XWK A;  3M1G A;  3GNJ A;  4A5P A;  3FR3 A;  1GH2 A;  1SYX A;  1IYH A;  2TRC P;  5ECO B;  4MDC A;  1O73 A;  4Z2U A;  2PER A;  4K5R A;  3CTG A;  4RUV A;  2GZZ A;  6GSV A;  2AJQ B;  4KDY A;  3GL3 A;  3EUR A;  2KOK A;  4QL9 A;  4WBJ A;  3GKM A;  2GLR A;  3WGE A;  8GSS A;  1X5E A;  7GSS A;  4POB A;  1T1V A;  1H4O A;  3L78 A;  3KH7 A;  5DCG A;  3H8Q A;  3Q6O A;  5ID2 A;  5EVO A;  4G9H A;  2GGT A;  4G0I A;  4NAX A;  4BWQ A;  3EYT A;  2ZNM A;  1K0N A;  4RI7 A;  4OMV A;  5INY A;  4XS1 A;  5D93 A;  2YPM A;  1O8X A;  2PN8 A;  3HJP A;  3LEF A;  3GKX A;  3F4T A;  1EP7 A;  4MA9 A;  3C73 A;  4TXV A;  4KF9 A;  3EMP A;  3O3T A;  4HU7 A;  2DSA A;  1QQ2 A;  3N5O A;  1MD3 A;  3GKN A;  2YJH A;  3QPM A;  4KUN A;  2IMK A;  1TTZ A;  1XWG A;  4EE0 A;  2HXK A;  1DSB A;  2FUG 2;  1UVZ A;  3GSS A;  5FWG A;  2GZP A;  3ZVJ A;  1FAA A;  1SEN A;  2V6K A;  2UZ8 A;  3TJG A;  3C8E A;  4FYB A;  1BG5 A;  3ZIT A;  2GT5 A;  4TW5 A;  3UBL A;  5J9C A;  5F0G A;  5F8B A;  3HHV A;  1TRS A;  1U3A A;  5AGY A;  2JSZ A;  3J7Y b;  2GQM A;  1W89 A;  3GYK A;  4I8B A;  5KN1 A;  6GSU A;  2CZ3 A;  2P5Q A;  2C4J A;  2H76 A;  1ON4 A;  4IGJ A;  4ZBD A;  5G1L A;  1BQ7 A;  3TJF A;  1A8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...