1PSQA

Structure of a probable thiol peroxidase from streptococcus pneumoniae
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
163
structure length
163
Chain Sequence
b'MVTFLGNPVSFTGKQLQVGDKALDFSLTTTDLSKKSLADFDGKKKVLSVVPSIDTGICSTQTRRFNEELAGLDNTVVLTVSMDLPFAQKRWCGAEGLDNAIMLSDYFDHSFGRDYALLINEWHLLARAVFVLDTDNTIRYVEYVDNINSEPNFEAAIAAAKAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable thiol peroxidase
publication title Structure of a probable thiol peroxidase from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Oxidoreductase
total genus 48
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2003-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1psqA00
2LQOA 5H5QA 7GSSA 3UEMA 1ZZYA 5IOWA 2L5LA 2N5BA 4OWYA 1M99A 2DJ1A 4TVEA 2E2GA 1AC1A 2JL4A 4PGTA 4ILFA 4IELA 2MYGA 2CA8A 1MTCA 3GRXA 4GSSA 3EE2A 2DSAA 1V57A 2JZRA 2LRCA 4ZXGA 2H6ZA 5D8IA 2H1GA 3SBCA 2V32A 4E8EA 4RQRA 5CNWA 3KJYA 1A24A 1FOVA 3H79A 3TKRA 1YY7A 2GZPA 3UBLA 2OA7A 2WRTA 3S9FA 4GXZA 5ECIB 1TP9A 1GUHA 1MDIA 1T00A 2CVDA 4TOPA 4V1Ap 5DALA 3TKSC 3FYGA 2NDOA 6GSTA 3LQ7A 4OCEA 1YF0A 1PA3A 4MH2A 2H6XA 3D4TA 1DUGA 3TOTA 1EWXA 2F8FA 2OE3A 4MPFA 4DSQA 3LWAA 5F0GA 3M9KA 4FO5A 1JLVA 4BA7A 3BCKA 1DE1A 4I6XA 5F8BA 4JZQA 1YEPA 1LU4A 3BBYA 5IMDA 1Z5YE 1SKSB 4IP6A 3HVSA 3QAGA 3CTGA 2O87A 2YN1A 1ACVA 1FO5A 3VFIA 1J0FA 3IK9A 4WXTA 1MEKA 3GA4A 2PN8A 1Z6NA 4AGSA 2WFCA 4TXOB 2VCXA 4EDZA 2LJAA 4F03A 1S3AA 1TRUA 4EVMA 1NHOA 3KH7A 1X9MB 2H6YA 1BAYA 3VWWA 2VM2A 2NBSA 1QXHA 1XW9A 4MA9A 4OCFA 3ZREA 1ZCPA 2V6KA 4HEA2 2M80A 1Y6EA 3PINA 2JU5A 3KMOA 4BVYA 1PD21 2HZEA 4FYCA 4PNFA 1ZL9A 2QGVA 1BQ7A 1GUMA 1JHBA 5G31A 1TU7A 1SENA 5CAXA 1YQ1A 4EL1A 4KDYA 2K8SA 3HD5A 4MPGA 3LSZA 4GQFA 4PQ1A 3KD0A 1M9AA 3GSTA 4F0CA 5LNKe 4Q5NA 4IJIA 1ERTA 3L4NA 4POLA 3P7XA 2X8GA 4L5LA 1SYXA 3ERFA 1ZYQB 2DIZA 3VWUA 2BJXA 2O7KA 4L0UA 5DALB 3IRAA 2BMXA 1ZMAA 4X0XA 2GDRA 1SL2B 1W4VA 2YZUA 2GVPA 2B6MA 1M0UA 2WB9A 2IIYA 2XPEA 3FEUA 2LNTA 2LV3A 1BX9A 5JWQB 3FR3A 1LJRA 5D9VA 3GN3A 1HNBA 1AQWA 2A4VA 1SJZA 1NHYA 1SK2A 2M46A 3I69A 4GSNA 4O32A 2EIRA 1T1VA 1S3DA 3N5OA 3F3QA 3TRPA 4XS4A 4GWRA 2HSYA 2HLSA 3HJPA 5INYA 5B6NA 2VO4A 1KEBA 3APQA 2KP2A 3CRTA 1N2AA 1ML6A 3D4MA 2E2MA 3G9BA 3GHAA 4JR4A 2LNSA 4IN0A 3DYRA 1QUWA 3VK9A 3ZL5A 3EINA 2V2GA 1QFNA 1PGTA 3EC3A 1QQ2A 2B5YA 2DLXA 2PWJA 1NW2A 3Q74A 2L4QA 3HYPA 1AAZA 2ZNMA 3F8UA 1V58A 1URMA 5IMAA 2HZEB 3VLNA 4I2TA 2RIIA 1V9WA 4JR6A 4YQVA 2K8VA 4ZB9A 4O7HA 4GTUA 2B7KA 5HFIA 4E8HA 3CSHA 2WULA 4IVFA 4LLRA 3FZ4A 4HU7A 4ISDA 4ZIJA 2YCDA 4FYUA 3GIXA 4YAPA 5DQYA 4MP4A 3GX8A 1KTEA 2PVQA 3UVTA 3G7YA 2HYXA 2VCWA 2JADA 3TJFA 5CO3A 1SL1B 1I9DA 5G5FA 4YAVA 1SKRB 4GCIA 3EU3A 2VL2A 4KB3A 3CRUA 4EDYA 2VOCA 5COHA 2A2SA 1U3IA 5ECSA 2HI7A 1TKDB 4D73A 3GX0A 2H76A 3DVXA 2KOKA 5CREA 1ABAA 4OO5A 2VL9A 5D9TA 2OBIA 2YNXA 5IMZA 4ACSA 1T8EB 4ML1A 2PMTA 1K3LA 2KLXA 2ZUPA 1A2MA 1TOFA 4K7IA 2H0HA 3V1WA 5C00A 5IIZA 1M7TA 20GSA 1ON4A 4KDUA 4IBPA 3KM6A 2WCIA 1K0BA 4NAXA 4MABA 4XRAA 1R7HA 4OMVA 1QGVA 4XS4B 3I6AA 4BVXA 2C1YA 2VD1A 3ZITA 1UN2A 2LTKA 2LQQA 3GMFA 3EYTA 2FY6A 4JU5A 2H1BA 2V41A 2CZ3A 5DAKA 2LS5A 2IFQA 12GSA 3F63A 3VPTA 1BG5A 4NMUA 2R3XA 2TIRA 4POKA 4Q5QA 4WETA 3O76A 3U6VA 3KTLA 1TK5B 3FRCA 2H1AA 1XOAA 3KMNA 1WWJA 3FR6A 5EPFA 1XWBA 3QFAC 2F51A 3KGKA 2PGTA 4JBBA 3LXZA 1WOUA 1R5PA 2P31A 3ZLPA 5IM9A 1G7EA 4ECIA 3TKSA 1C72A 2GZZA 1XWCA 1AQXA 1TRSA 1GL8A 1U87A 4MCUA 1OAZA 2YV7A 2GGTA 1B48A 4F0BA 1B4QA 1U88A 4MLYA 1K3YA 3A2WA 1ZOFA 3ZVJA 4L0WA 2XC2A 3WGXA 3RBTA 4TRXA 3UAPA 5IMFA 5GAPD 5ABRA 5IQYA 1PKWA 1EZKA 3TCOA 1EV9A 2QKEA 4D73B 5AIVA 2YJHA 5ECLB 2VCVA 5AIXA 1O7UA 2KHPA 2FLSA 1HQOA 1F37A 1YKCA 3KEBA 4EC0A 4TR1A 1Y25A 2VL2C 5IPGA 5D93A 2XBQA 3LORA 3DKSA 4PQIA 1Z7PA 1UA5A 3IA1A 3G7JA 3LEFA 5D96A 3UVHA 1WIKA 1QMVA 3IBHA 2YWNA 3I9V2 2WGRA 3RPNA 2MBTA 2GT5A 1GWCA 1TDIA 3ZTLA 5DVBA 5J4UA 3QDNA 6GSVA 3QD9A 3GSSA 4YQMA 1TK0B 5DJLA 4HZ4A 4PNGA 1K0DA 4K2DA 2G0FA 2X8HA 1XPVA 3D22A 2AB6A 4KA0A 1GTBA 4I8BA 2KP1A 3DRNA 5A4VA 3TJJA 5JCUA 2CV4A 6GSXA 4MZBA 4CHSA 5DAKB 1F6MC 2I1UA 2L6DA 2IFQB 5EVOA 2L5OA 2GT6A 1MD3A 1ZYEA 4WR5A 5G2ZA 3OR5A 4P3YB 3HZ4A 3H1NA 1XVQA 3TOUA 4K8MA 1YF1A 1USBA 2L4CA 4ID0A 2H19A 5CYYA 5C04A 1XWAA 1PN9A 3FKFA 1M9BA 1DBYA 2A2RA 2JACA 2LJRA 2ES7A 5DJMA 1ILOA 3ZIVA 6GSSA 1YJ6A 3TRQA 2AJQB 4EF0A 4TR3A 4OFNA 1X0RA 2VLUA 3MWHA 2B3SA 4L8EA 5DCHA 4NV5A 5CRWA 2DJJA 4Q5FA 1K0MA 3HKRA 3WGDA 1O85A 1FVJA 1B9YC 3UL3A 1YKAA 2C0GA 3A5WA 4ECCA 4PXOA 1OC9B 4HJ2A 3DXBA 5D9WA 2FUG2 5ECPB 1SU9A 1Q98A 1XZOA 2YJ7A 4BPYA 3Q6OA 5JWRB 1FVKA 8GSSA 4TR1B 2BTOT 3ISOA 3G7IA 3LFLA 5H5RA 1FB0A 1THXA 2MMOA 1HYUA 1XWGA 1JZDA 1X9SB 2LEGA 4KCEA 2I4AA 3EURA 3D0ZA 1DE2A 4DSRA 1SD9A 5J9CA 5ECMB 2WJUA 3F9UA 2H8LA 3IDVA 4K9ZA 4KDXA 2PERA 1HNCA 1UC7A 4F82A 5LCZA 2FA4A 3QPMA 2JSYA 3VPQA 3CYNA 1H4OA 2K6VA 2V6OA 2PUKC 1RW1A 3MSZA 2P0GA 2NVLA 1A2LA 2NTOA 4PUFC 2H30A 3QAVA 1XBSA 3TUEA 2RUEA 2R6KA 2FWEA 1BEDA 3MAKA 1KBNA 3PGTA 5DBQA 1N8JA 3IV4A 2GQLA 5ID2B 3MNGA 1J9BA 2GS3A 5IMCA 1WPIA 3D5JA 2OKAA 1FW1A 4G9HA 1MDJA 5KN2A 1R4WA 1Z3EA 5IPHA 1GSYA 2AHEA 3RHCA 5HR1A 4MF6A 3N9JA 2IMFA 4PUAA 1GNEA 2Z9SA 3DVWA 2VCTA 5B8AA 3UOMA 2FNOA 2HT9A 1SK0A 1GSEA 2FWFA 4GRFA 4ZILA 1UVZA 1SD8A 2F3MA 4WBJA 3VWVA 4N0ZA 5F06A 4MMMA 3GH9A 5CP1A 3IAM2 4MDCA 1JFUA 1AXDA 2OADA 2F8AA 2HXKA 3C1SA 1EEJA 3WD6A 1G0TA 1GNWA 5GAND 2WZ9A 3L9VA 5B7CA 10GSA 3TJGA 2VLTA 3EU4A 2R4VA 1TRWA 2N5FA 3QR6A 4IGJA 4IJ3A 2GLRA 4IP1A 3GYKA 3GFKA 3GH6A 1F9MA 3HVVA 3APSA 1GSUA 4HQZA 1XOBA 1ST9A 2H0IA 3FZ5A 1ERUA 1AQVA 4LMVA 4OFTA 2H70A 13GSA 2IMIA 4WR4A 2MMZA 1XXUA 5FWGA 19GSA 4MF7A 1NSWA 3TDGA 1O81A 2OE0A 3UJ1A 2B5EA 3DWVA 1J08A 1DSBA 4LL1B 5J3RA 1Z7RA 3F6DA 1IYIA 1YDKA 1KNGA 2I3YA 3P8WA 2K18A 4MJBA 4FH8A 4AJ7A 3F4TA 3D6IA 16GSA 3W8SA 4OO4A 4RQXA 3HZ8A 4XIHA 4Z7XA 4MK3A 4GLTA 4L5OA 1T4YA 3HHVA 1CQHA 1JLWA 5AISA 1K0AA 3KTBA 2RM6A 3GKNA 3TJBA 5KN3A 1EOHA 4PURA 1O8XA 4KSMA 1K0NA 2HRNA 3WGEA 1PMTA 5J41A 2YP6A 5IMVA 4QQ7A 4RI7A 2I9HA 4YH2A 1GLQA 2NPBA 1TI1A 2D2ZA 3PH9A 4XS1A 1HD2A 1XFLA 1OVNA 4IQ1A 3LXTA 5ELAA 3F4SA 2O8VB 2OE1A 5HR3A 2P5QA 4HU9A 5KEJA 1V40A 2JZTA 4XCSA 1A2JA 1G7OA 1K0OA 2VIMA 2C0EA 1EV4A 4IS0A 5D9XA 3ZVJD 5CRHA 6GSWA 2PU9C 3DIEA 1I5GA 2AYTA 1B8XA 1M2DA 1K3OA 1GTAA 4J57E 3A2VA 4AF2A 4KAEA 1M2BA 4MZWA 1EP7A 1VF1A 2R2JA 3DMLA 3F3RA 1FHEA 1U6TA 3L9SA 3ED3A 3DEXA 4FIWA 3HY2A 4K6XA 3I43A 2DJKA 1EP8A 5HR0A 18GSA 3GV1A 3HJMA 3GKXA 3L9UA 1OC8A 5E59A 5EL8A 4IKHA 3KIJA 1T3BA 1WE0A 5CRGA 2MMNA 4PQHA 2PBJA 2QSIA 4XTSA 1EGRA 1FG4A 2X8CA 3BJ5A 5A4WA 3QMXA 3ZRDA 1QK8A 3M8NA 4ML6A 3TKSE 3US3A 2OJLA 4AJ6A 2C4JA 1ZGNA 4IQAA 1SKWB 2DMMA 1W89A 3W6GA 2E0QA 2FA8A 2L57A 4MH3A 4NHZA 2GSTA 4EUYA 4ZBBA 3CMIA 4RUVA 3KZQA 1X5EA 3GNJA 4K7NA 3BD2A 5EY6A 3CSIA 1HNAA 2YWOA 4ZL9A 3J7Yk 4I97A 2AAWA 5IO0A 3AY8A 3H8QA 1GTIA 1CQGA 2IL3A 1PX7A 5GSSA 4DVCA 2L59A 4XHMA 4X1UA 5FT3A 4GSTA 3EVIA 2VD0A 3RAZA 2CX3A 3IR4A 1EEMA 2R5GA 2C8UA 2YV9A 3VI7A 5DDLA 2CT6A 4HDEA 1OC9A 3ERGA 1OYJA 1TI3A 2C80A 3BCIA 4LL4B 2B1KA 4I5QA 1RK4A 5ECRB 2DMLA 3KP8A 4DSSA 2GSSA 1A0RP 1B4PA 3KXOA 3QOUA 4TN8A 1GULA 4ZL8A 1VRSD 2OBKA 1JZRA 1OC3A 1O73A 1RQMA 1A23A 3A2XA 2HZFA 1X9WB 1PRXA 4TR0A 4HI7A 3EMXA 4MF5A 4N11A 5JCGA 4N0VA 3CXGA 2FWGA 17GSA 3M0FA 3TJKA 2ON7A 5ELGA 2XPDA 2FHEA 3ZZXA 1VF4A 3IC4A 4JRRA 3IE3A 2HSHA 3VWXA 5ID2A 3ZMLA 2C3QA 4KE3A 1MD4A 2H72A 1Z6MA 3C1RA 1TTZA 3WT1A 4RI6A 2J9HA 1FAAA 3IXRA 4BWQA 2HNLA 4HUAA 1R26A 4QL9A 1S3CA 1SYRA 4WBRD 1SK1A 3ZMKA 2DIYA 1OE8A 2FWHA 1K0CA 2PPTA 2YWMA 1PQNA 4ZB6A 4J56E 1VF2A 5F07A 2IMDA 4HOJA 1BYEA 3TRXA 1A8YA 1T7PB 4F9ZA 4V2LA 2VL3A 5HFGA 5IO2A 3O6TA 1TK8B 3ZYWA 4I2UA 3GKMA 4AJ8A 2B1LA 1BJXA 4O5RA 4EO3A 4TXVA 5J9BA 1IYHA 2O85A 2XHFA 1O8WA 2R37A 2RLIA 1YEXA 3MDKA 1OKTA 1A0FA 2DC5A 4K7OA 1SL0B 4WKWA 2M72A 3QAWA 1TW9A 2DBCA 3LGCA 1SJIA 3FHKA 4DSSB 5GZZB 2GZYA 2H75A 1JZWA 6GSUA 1A8LA 4KH7A 2LUSA 2K9FA 3O3TA 4Q5RA 5ECKB 2IPAA 3ZIJA 5B6MA 2IWTA 4OFMA 4HZ2A 2OACA 1AUCA 2EC4A 3F4RA 4K1FA 3IPZA 2VCQA 2CQ9A 5FHIA 2H01A 3SWLA 1XWKA 2P5RA 2CVBA 3C7MA 1FB6A 3P2AA 1WMJA 4ZBDA 2H66A 2B5XA 4LA1A 2KUCA 4G10A 2I81A 1XVWA 3TB2A 2GSQA 5F05A 4V2MA 1XW6A 3D21A 1MDKA 3VURA 2MBSA 3GURA 1ERWA 4ZB8A 1Q4JA 4WEYA 3DD3A 1WJKA 2WS2A 4KSOA 5ECHB 5KN0A 4N10A 5E4WA 5G5EA 4YQUA 4NV2A 2IJYA 4ULXA 3LJRA 1SJ6A 2X64A 2H71A 1AW9A 2E7PA 3H4KA 4ECJA 2O89A 4H86A 2LKUA 3FR9A 3R2QA 1OKDA 2ALBA 4G19A 1GSFA 5ECOB 4JEDA 2VUPA 3RDWA 2ON5A 3GL3A 2TRCP 4KW6A 1EOGA 2WDUA 2H1DA 3ZFLA 1GTUA 1WP0A 2H73A 1YZXA 3IHQA 3IK7A 4ECBA 2IMEA 3VI5A 2HFDA 4O92A 5ENUA 5GSTA 3FZAA 1TJDA 1V98A 4G2EA 4KNDA 2B7JA 1X5DA 1M2AA 2MZCA 3CSJA 2CAIA 2XBIA 2LJKA 5IOXA 3BOAA 4J2FA 5D73A 2VM1A 4BL7A 1GUKA 3TKPA 2JZSA 1GRXA 2CVKA 1OE7A 4IW9A 2FCHA 2F9SA 2J23A 1XW5A 2ZCTA 3U5RE 4NWYA 2FGXA 2C0FA 4CW9A 5L71A 3KP9A 1Z9HA 2AUVA 2YPMA 3UBKA 2CZ2A 3FY7A 5CRDA 4PX1A 3GTUA 5G1LA 5DCGA 5G1KA 3WYWA 4WF5A 2YZHA 2GSRA 2GQKA 4HJMA 22GSA 1TXXA 1E2YA 3JCML 3E9JB 2H74A 3RHBA 1AIUA 3Q18A 4XRDA 1E6BA 1TU8A 2REMA 3H93A 4CDOA 5HFKA 2X99A 2EIQA 3L0HA 2VLVA 5LD0A 2DJ2A 4NHWA 1U3AA 3IAS2 1O6JA 3C71A 4POBA 3E0UA 3NIVA 3HCZA 4ZBAA 4MJCA 3CBUA 1NM3A 1X5CA 2V1MA 3ME8A 5A5KA 3QFBC 4XS6A 2IMKA 4NXIA 14GSA 2YOIA 4GF0A 2HRFA 3UARA 1JZOA 1F3AA 3FK8A 4KCAA 2L6CA 11GSA 4F2IA 3NOFA 5HR2A 1G6YA 1ERVA 2RM5A 4KGIA 2HE3A 3ZFBA 3TGZA 6GSYA 3Q19A 5B8BA 3GL5A 3C8EA 4MJAA 3TKQA 3FW2A 3LYPA 4HS1A 3RPPA 3CTFA 3HA9A 1GSQA 3NZNA 4K0NA 1PKZA 3M3MA 1WRYA 1PL1A 2C3NA 1GSDA 4FYBA 9GSSA 4OD7A 1G6WA 4MJEA 5DQSA 5JWOB 4X43A 3WT2A 2AV4A 1VF3A 4NPBA 2C0DA 3E3EA 3P90A 3GTUB 3HXSA 3HJOA 4K0GA 1THOA 4V2NA 3KH9A 3LYKA 1GLPA 3W8JA 3PR8A 4IHUA 4MZCA 1B9XC 1GP1A 3ERWA 1XCCA 1VGLA 2GQMA 2IN3A 5ECQB 5AN1A 2CAQA 3GKKA 3F0IA 5J5NA 3ME7A 4LMWA 2VCZA 4KX4A 3UIWA 2PVOC 3HVXA 5JCWA 1LBKA 5G30A 2GTUA 3EWLA 5KN1A 2JSZA 5H5SA 1PL2A 3DGQA 1H75A 3HDCA 4TKYA 4V1Ag 1V2AA 4EE0A 1PSQA 3KCMA 4POMA 3M1GA 3L78A 2DJ3A 4JE1A 4GQCA 4HQSA 4DEJA 2LSTA 2EIOA 2LRTA 5ECNB 1EGOA 2YANA 1T4ZA 3F6FA 4TW5A 1F3BA 2C3TA 2FD3A 5HQPA 3K8NA 3LG6A 4N30A 1GSSA 5A4UA 3J7Yb 2RUFA 2G2QA 3C73A 2DJ0A 3EMPA 4TR4A 1R5AA 4KUNA 1TRVA 3QCPA 2MMAA 2LRNA 1F2EA 4QL7A 3GUSA 3IOSA 2H0GA 4BWSA 3FZ9A 2QC7A 3M9JA 3UMAA 2CX4A 3APOA 4EXJA 4EKZA 1PX6A 1GH2A 2VAFA 2YWIA 1XIYA 3A3TA 2N5AA 4WF4A 5AGYA 4TXOA 2TRXA 4ZL7A
chains in the Genus database with same CATH superfamily
2LQOA 5H5QA 7GSSA 3UEMA 1ZZYA 5IOWA 2L5LA 4BVXB 2N5BA 4OWYA 1M99A 4G0KA 2DJ1A 4TVEA 2E2GA 1AC1A 2JL4A 2HSMA 4PGTA 4K5SA 4ILFA 4IELA 2MYGA 2CA8A 1MTCA 3GRXA 4GSSA 3EE2A 2DSAA 1V57A 2JZRA 2LRCA 2QA1A 4ZXGA 2H6ZA 5D8IA 2H1GA 3SBCA 2V32A 4E8EA 4RQRA 5CNWA 3KJYA 1A24A 1FOVA 3H79A 3TKRA 1YY7A 2GZPA 3UBLA 2OA7A 2WRTA 3S9FA 4GXZA 5ECIB 1TP9A 1GUHA 1MDIA 1T00A 2CVDA 4TOPA 4V1Ap 5DALA 3TKSC 3FYGA 2NDOA 6GSTA 3LQ7A 4OCEA 1YF0A 1PA3A 3R3EA 4MH2A 2H6XA 3D4TA 1DUGA 3TOTA 1EWXA 2F8FA 2OE3A 4MPFA 4DSQA 3LWAA 5F0GA 3M9KA 4FO5A 1JLVA 4BA7A 3BCKA 1DE1A 4I6XA 5F8BA 4JZQA 1YEPA 1LU4A 3BBYA 5IMDA 1Z5YE 1SKSB 4IP6A 3HVSA 3QAGA 3CTGA 2O87A 2YN1A 1ACVA 1FO5A 3VFIA 1J0FA 4EIQA 3IK9A 4WXTA 1MEKA 3GA4A 2PN8A 1Z6NA 4AGSA 2WFCA 4TXOB 2VCXA 4EDZA 2LJAA 4F03A 1S3AA 1TRUA 4EVMA 1NHOA 3KH7A 1X9MB 2H6YA 1BAYA 3VWWA 2VM2A 4FQUA 2NBSA 1QXHA 1XW9A 4MA9A 4OCFA 3ZREA 1ZCPA 2V6KA 4HEA2 2M80A 1Y6EA 3PINA 2JU5A 3KMOA 4BVYA 1PD21 2HZEA 4FYCA 4PNFA 1ZL9A 2QGVA 1BQ7A 1GUMA 1JHBA 5G31A 1TU7A 1SENA 2R0PA 5CAXA 1YQ1A 4EL1A 4KDYA 2R0CA 2K8SA 3HD5A 4MPGA 3LSZA 4GQFA 4PQ1A 3KD0A 1M9AA 3GSTA 4F0CA 5LNKe 4Q5NA 4IJIA 1ERTA 3L4NA 4POLA 3P7XA 2X8GA 4L5LA 1SYXA 3ERFA 1ZYQB 2DIZA 3VWUA 2BJXA 2O7KA 4L0UA 5DALB 3IRAA 2BMXA 1ZMAA 4X0XA 2GDRA 1SL2B 1W4VA 2YZUA 2GVPA 2B6MA 1M0UA 2WB9A 2IIYA 2XPEA 3FEUA 2LNTA 2LV3A 1BX9A 5JWQB 3FR3A 1LJRA 5D9VA 3GN3A 1HNBA 1AQWA 2A4VA 1SJZA 1NHYA 1SK2A 2M46A 3I69A 4GSNA 4O32A 4K5RA 2EIRA 1T1VA 1S3DA 3N5OA 3F3QA 3TRPA 4XS4A 4GWRA 2HSYA 2HLSA 3HJPA 5INYA 5B6NA 2VO4A 1KEBA 3APQA 2KP2A 3CRTA 1N2AA 1ML6A 3D4MA 2E2MA 3G9BA 3GHAA 4JR4A 2HRAA 2LNSA 4IN0A 3DYRA 1QUWA 3VK9A 3ZL5A 3EINA 1S3RA 2V2GA 1QFNA 1PGTA 3EC3A 1QQ2A 2B5YA 2DLXA 2PWJA 1NW2A 3Q74A 2L4QA 3HYPA 1AAZA 2ZNMA 3F8UA 1V58A 4BVYB 1URMA 5IMAA 2HZEB 3VLNA 4I2TA 2RIIA 1V9WA 4JR6A 4PTSA 4YQVA 2K8VA 4ZB9A 4O7HA 4GTUA 2B7KA 5HFIA 4E8HA 3CSHA 2WULA 4IVFA 4LLRA 3CQFA 3FZ4A 4HU7A 4ISDA 4ZIJA 2YCDA 4FYUA 3GIXA 1XG8A 4YAPA 5DQYA 4MP4A 3GX8A 1KTEA 2PVQA 3UVTA 3G7YA 2HYXA 2VCWA 2JADA 3TJFA 5CO3A 1SL1B 1I9DA 5G5FA 4YAVA 1SKRB 4GCIA 3EU3A 2VL2A 4KB3A 3CRUA 4EDYA 2VOCA 5COHA 2A2SA 1U3IA 2UZ8A 5ECSA 2HI7A 1TKDB 4D73A 3GX0A 2H76A 3DVXA 2KOKA 5CREA 1ABAA 4OO5A 2VL9A 5D9TA 2OBIA 2YNXA 3A5IA 5IMZA 4ACSA 1T8EB 4ML1A 2PMTA 1K3LA 2KLXA 2ZUPA 1A2MA 2A2PA 1TOFA 4K7IA 2H0HA 3V1WA 5C00A 5IIZA 4O5UA 1M7TA 3HVNA 20GSA 1ON4A 4KDUA 4IBPA 3KM6A 2WCIA 1K0BA 4NAXA 4MABA 4XRAA 1R7HA 4OMVA 1QGVA 4XS4B 3I6AA 4BVXA 2C1YA 2VD1A 3ZITA 1UN2A 2LTKA 2LQQA 3GMFA 3EYTA 2FY6A 4JU5A 2H1BA 2V41A 2CZ3A 5DAKA 2LS5A 2IFQA 12GSA 3F63A 3VPTA 1BG5A 4NMUA 2R3XA 2TIRA 4POKA 4Q5QA 4WETA 3O76A 3U6VA 3KTLA 1TK5B 3FRCA 4BIKA 2H1AA 1XOAA 3KMNA 4G0IA 1WWJA 3FR6A 5EPFA 1XWBA 3QFAC 2F51A 3KGKA 2PGTA 4JBBA 3LXZA 1WOUA 4O5QA 1R5PA 2P31A 3ZLPA 5IM9A 1G7EA 4ECIA 3TKSA 1C72A 2GZZA 1XWCA 1AQXA 1TRSA 1GL8A 1U87A 4MCUA 1OAZA 2YV7A 2GGTA 1B48A 4F0BA 1B4QA 1U88A 4MLYA 1K3YA 3A2WA 1ZOFA 3ZVJA 4L0WA 2XC2A 3WGXA 3RBTA 4TRXA 3UAPA 5IMFA 5GAPD 5ABRA 5IQYA 1PKWA 1EZKA 3TCOA 4Z2UA 1EV9A 2QKEA 4D73B 5AIVA 2YJHA 5ECLB 2VCVA 5AIXA 1O7UA 2KHPA 2FLSA 1HQOA 1F37A 1YKCA 3KEBA 4EC0A 4TR1A 1Y25A 2VL2C 5IPGA 5D93A 2XBQA 4A5PA 3LORA 3DKSA 4PQIA 1Z7PA 1UA5A 3IA1A 3G7JA 3LEFA 5D96A 3UVHA 1WIKA 1QMVA 3IBHA 2YWNA 3I9V2 2WGRA 3RPNA 2MBTA 2GT5A 1GWCA 1TDIA 3ZTLA 5DVBA 5J4UA 3QDNA 6GSVA 3QD9A 3GSSA 4YQMA 1TK0B 5DJLA 4HZ4A 4PNGA 1K0DA 4K2DA 2G0FA 2X8HA 1XPVA 3D22A 2AB6A 4KA0A 1GTBA 4I8BA 2KP1A 3DRNA 5A4VA 3TJJA 5JCUA 2CV4A 6GSXA 4MZBA 4CHSA 5DAKB 1F6MC 2I1UA 2L6DA 2IFQB 5EVOA 2L5OA 2GT6A 1MD3A 1ZYEA 4WR5A 5G2ZA 3OR5A 4P3YB 3HZ4A 3H1NA 1XVQA 3TOUA 4K8MA 1YF1A 1USBA 2L4CA 4ID0A 2H19A 5CYYA 5C04A 1XWAA 1PN9A 3FKFA 1M9BA 1DBYA 2A2RA 2JACA 2LJRA 2ES7A 5DJMA 1ILOA 3ZIVA 6GSSA 1YJ6A 3TRQA 2AJQB 3EPTA 4EF0A 4TR3A 4OFNA 1X0RA 2VLUA 3MWHA 2B3SA 4ICYA 4L8EA 5DCHA 4NV5A 5CRWA 2DJJA 4Q5FA 1K0MA 3HKRA 3WGDA 1O85A 1FVJA 1B9YC 3UL3A 1YKAA 2C0GA 3A5WA 4ECCA 4PXOA 1OC9B 4HJ2A 3DXBA 5D9WA 2FUG2 5ECPB 1SU9A 1Q98A 1XZOA 2YJ7A 4BPYA 3Q6OA 5JWRB 1FVKA 8GSSA 4TR1B 2BTOT 3ISOA 3G7IA 3LFLA 5H5RA 1FB0A 1THXA 2MMOA 1HYUA 1XWGA 1JZDA 1X9SB 2LEGA 4KCEA 2I4AA 3EURA 3D0ZA 1DE2A 4DSRA 1SD9A 5J9CA 5ECMB 2WJUA 3F9UA 2H8LA 3IDVA 4K9ZA 4MNNA 4KDXA 2PERA 1HNCA 1UC7A 4F82A 5LCZA 2FA4A 3QPMA 2JSYA 4YKGA 3VPQA 3CYNA 1H4OA 2K6VA 2V6OA 2PUKC 1RW1A 3MSZA 2P0GA 2NVLA 1A2LA 2NTOA 4PUFC 2H30A 3QAVA 1XBSA 3TUEA 2RUEA 2R6KA 2FWEA 1BEDA 3MAKA 1KBNA 3PGTA 5DBQA 1N8JA 3IV4A 2GQLA 5ID2B 3MNGA 1J9BA 2GS3A 5IMCA 1WPIA 3D5JA 2OKAA 1FW1A 4G9HA 1MDJA 5KN2A 1R4WA 1Z3EA 5IPHA 1GSYA 2AHEA 3RHCA 5HR1A 4MF6A 3N9JA 2IMFA 4PUAA 1GNEA 2Z9SA 3DVWA 2VCTA 5B8AA 3UOMA 2FNOA 2HT9A 1SK0A 1GSEA 2FWFA 4GRFA 4ZILA 1UVZA 1SD8A 2F3MA 4WBJA 3VWVA 4N0ZA 5F06A 4MMMA 3GH9A 5CP1A 3IAM2 4MDCA 1JFUA 1AXDA 2OADA 2F8AA 2HXKA 3C1SA 1EEJA 3WD6A 1G0TA 1GNWA 5GAND 2WZ9A 3L9VA 5B7CA 10GSA 3TJGA 2VLTA 3EU4A 2R4VA 1TRWA 2N5FA 3QR6A 4IGJA 4IJ3A 2GLRA 4IP1A 3GYKA 3GFKA 3GH6A 1F9MA 3HVVA 4CY8A 3APSA 1GSUA 4HQZA 1XOBA 1ST9A 2H0IA 3FZ5A 1ERUA 1AQVA 4LMVA 4OFTA 2H70A 13GSA 2IMIA 4WR4A 2MMZA 1XXUA 5FWGA 19GSA 4MF7A 1NSWA 3TDGA 1O81A 2OE0A 3UJ1A 2B5EA 3DWVA 1J08A 1DSBA 4LL1B 5J3RA 1Z7RA 3F6DA 1IYIA 1YDKA 3IC8A 1KNGA 2I3YA 3P8WA 2K18A 4MJBA 4FH8A 4AJ7A 3F4TA 3D6IA 16GSA 3W8SA 4OO4A 1ZYPA 4RQXA 3HZ8A 4XIHA 4Z7XA 4MK3A 4GLTA 4L5OA 1T4YA 3HHVA 1CQHA 1JLWA 4X4JA 5AISA 1K0AA 3KTBA 2RM6A 3GKNA 3TJBA 5KN3A 1EOHA 4PURA 1O8XA 4KSMA 1K0NA 2HRNA 3WGEA 1PMTA 5J41A 2YP6A 5IMVA 4QQ7A 4RI7A 2I9HA 4YH2A 1GLQA 2NPBA 1TI1A 2D2ZA 3PH9A 4XS1A 1HD2A 1XFLA 1OVNA 4IQ1A 3LXTA 5ELAA 3F4SA 2O8VB 2OE1A 5HR3A 2P5QA 4HU9A 5KEJA 1V40A 2JZTA 4XCSA 1A2JA 1G7OA 1K0OA 2VIMA 4G0LA 2C0EA 2QA2A 1EV4A 4IS0A 5D9XA 3ZVJD 5CRHA 6GSWA 2PU9C 3DIEA 1I5GA 2AYTA 1B8XA 1M2DA 1K3OA 1GTAA 4J57E 3A2VA 4AF2A 4KAEA 1M2BA 4MZWA 1EP7A 1VF1A 2R2JA 3DMLA 3F3RA 1FHEA 5BRTA 1U6TA 3L9SA 3ED3A 3DEXA 4FIWA 3HY2A 4K6XA 3I43A 2DJKA 1EP8A 5HR0A 18GSA 1M3JA 3GV1A 3HJMA 3GKXA 3L9UA 1OC8A 5E59A 5EL8A 3MIXA 3KIJA 4IKHA 1T3BA 1WE0A 5CRGA 2MMNA 4PQHA 2PBJA 2QSIA 4XTSA 1EGRA 3IHGA 1FG4A 2X8CA 4Z2TA 3BJ5A 5A4WA 3QMXA 3ZRDA 1QK8A 3M8NA 4ML6A 3TKSE 3US3A 2OJLA 4AJ6A 2C4JA 1ZGNA 4IQAA 1SKWB 2DMMA 1W89A 3W6GA 2E0QA 2FA8A 2L57A 4MH3A 4NHZA 2GSTA 4EUYA 4ZBBA 3CMIA 4RUVA 3KZQA 1X5EA 3GNJA 4K7NA 3BD2A 5EY6A 3CSIA 1HNAA 2YWOA 4ZL9A 3J7Yk 4I97A 2AAWA 4HSCX 5IO0A 3AY8A 3H8QA 1GTIA 1CQGA 4KF9A 2IL3A 1PX7A 5GSSA 4DVCA 2L59A 4XHMA 1PFOA 4X1UA 5FT3A 4GSTA 1PN0A 3EVIA 2VD0A 3RAZA 2CX3A 3IR4A 1EEMA 2R5GA 2C8UA 2YV9A 3VI7A 5DDLA 2CT6A 4HDEA 1OC9A 3ERGA 1OYJA 1TI3A 2DKIA 2C80A 3BCIA 4LL4B 2B1KA 4I5QA 1RK4A 5ECRB 2DMLA 3KP8A 4DSSA 2GSSA 1A0RP 1B4PA 5BMUA 3KXOA 3QOUA 4TN8A 1GULA 4ZL8A 1VRSD 2OBKA 1JZRA 1OC3A 1O73A 1RQMA 1A23A 3A2XA 2HZFA 1X9WB 1PRXA 4TR0A 4HI7A 3EMXA 4MF5A 4N11A 5JCGA 4N0VA 3CXGA 2FWGA 17GSA 3M0FA 2DKHA 3TJKA 2ON7A 5ELGA 2XPDA 2FHEA 3ZZXA 1VF4A 3IC4A 4JRRA 3IE3A 2HSHA 3VWXA 5ID2A 3ZMLA 2C3QA 4KE3A 1MD4A 2H72A 1FOHA 1Z6MA 3C1RA 1TTZA 3WT1A 4RI6A 2J9HA 1FAAA 3IXRA 4BWQA 2HNLA 4HUAA 1R26A 4QL9A 1S3CA 1SYRA 4WBRD 1SK1A 3ZMKA 2DIYA 1ZYNA 1OE8A 2FWHA 1K0CA 2PPTA 2YWMA 1PQNA 4ZB6A 4J56E 1VF2A 5F07A 2IMDA 4HOJA 1BYEA 3TRXA 1A8YA 1T7PB 4F9ZA 4V2LA 2VL3A 5HFGA 5IO2A 3O6TA 1M3IA 1TK8B 3ZYWA 4I2UA 3GKMA 4AJ8A 2B1LA 1BJXA 4O5RA 4EO3A 4TXVA 3LW9A 5J9BA 1IYHA 2O85A 2XHFA 1O8WA 2R0GA 2R37A 2RLIA 1YEXA 3MDKA 1OKTA 1A0FA 2DC5A 4K7OA 1SL0B 4WKWA 2M72A 3QAWA 1TW9A 2DBCA 3LGCA 1SJIA 3FHKA 4DSSB 5GZZB 2GZYA 2H75A 1JZWA 6GSUA 1A8LA 4KH7A 2LUSA 2K9FA 3O3TA 4Q5RA 5ECKB 2IPAA 3ZIJA 5B6MA 2IWTA 4OFMA 4HZ2A 2OACA 1AUCA 2EC4A 3PPUA 3F4RA 4K1FA 3IPZA 2VCQA 2CQ9A 4USSA 5FHIA 2H01A 3SWLA 1XWKA 2P5RA 2CVBA 3C7MA 1FB6A 3P2AA 1WMJA 4ZBDA 2H66A 2B5XA 4LA1A 2KUCA 4G10A 2I81A 1XVWA 3TB2A 2GSQA 5F05A 4V2MA 1XW6A 3D21A 1MDKA 3VURA 2MBSA 3GURA 1ERWA 4ZB8A 1Q4JA 4WEYA 3DD3A 1WJKA 2WS2A 4KSOA 5ECHB 5KN0A 4N10A 5E4WA 5G5EA 4YKFA 4YQUA 4NV2A 2IJYA 4ULXA 3LJRA 1SJ6A 2X64A 2H71A 1AW9A 2E7PA 3H4KA 4ECJA 2O89A 4H86A 2LKUA 3FR9A 3R2QA 1OKDA 2ALBA 4G19A 1GSFA 5ECOB 4JEDA 2VUPA 3RDWA 2ON5A 3GL3A 2TRCP 4KW6A 1EOGA 2WDUA 2H1DA 3ZFLA 1GTUA 1WP0A 2H73A 1YZXA 3IHQA 3IK7A 4ECBA 2IMEA 3VI5A 2HFDA 4O92A 5ENUA 5GSTA 3FZAA 1TJDA 1V98A 4G2EA 4KNDA 2B7JA 1X5DA 1M2AA 2MZCA 3CSJA 2CAIA 2XBIA 2LJKA 4Z2RA 5IOXA 3BOAA 2HRKA 4J2FA 5D73A 2VM1A 4BL7A 4EIPA 1GUKA 3TKPA 2JZSA 1GRXA 2CVKA 1OE7A 4IW9A 2FCHA 2F9SA 2J23A 1XW5A 2ZCTA 3U5RE 4NWYA 2FGXA 2C0FA 4CW9A 5L71A 3KP9A 1Z9HA 2AUVA 2YPMA 3UBKA 2CZ2A 3FY7A 5CRDA 4PX1A 3GTUA 5G1LA 5DCGA 5G1KA 3WYWA 4WF5A 2YZHA 2GSRA 2GQKA 4HJMA 22GSA 1TXXA 1E2YA 3JCML 3E9JB 2H74A 3RHBA 1AIUA 3Q18A 4XRDA 1E6BA 1TU8A 2REMA 3H93A 4CDOA 5HFKA 2X99A 2EIQA 3L0HA 2VLVA 5LD0A 2DJ2A 4NHWA 2X4AA 1U3AA 3IAS2 1O6JA 3C71A 4POBA 3E0UA 3NIVA 3HCZA 4ZBAA 4MJCA 3CBUA 1NM3A 1X5CA 2V1MA 3ME8A 5A5KA 3QFBC 4XS6A 2IMKA 4NXIA 14GSA 2YOIA 4GF0A 2HRFA 3UARA 1JZOA 1F3AA 2X49A 3MYDA 3FK8A 4KCAA 2L6CA 11GSA 4F2IA 3NOFA 5HR2A 4CY6A 1G6YA 1ERVA 2RM5A 4KGIA 2HE3A 3ZFBA 3TGZA 6GSYA 3Q19A 4BL7B 5B8BA 3GL5A 3C8EA 4MJAA 3TKQA 3FW2A 3LYPA 4HS1A 3RPPA 3CTFA 3HA9A 1GSQA 3NZNA 4K0NA 1PKZA 3M3MA 1WRYA 5KOXA 1PL1A 2C3NA 1GSDA 4FYBA 9GSSA 4OD7A 1G6WA 4MJEA 5DQSA 5JWOB 4X43A 3WT2A 2AV4A 1VF3A 4NPBA 2C0DA 3E3EA 3P90A 3GTUB 3HXSA 3HJOA 4K0GA 4V2NA 1THOA 2A4HA 3KH9A 3LYKA 1GLPA 3W8JA 3PR8A 4IHUA 4MZCA 3FMWA 1B9XC 1GP1A 3ERWA 1XCCA 1VGLA 2GQMA 2IN3A 5ECQB 5AN1A 2CAQA 3GKKA 3F0IA 5J5NA 3ME7A 4LMWA 2VCZA 4KX4A 3UIWA 2PVOC 3HVXA 5JCWA 1LBKA 5G30A 2GTUA 3EWLA 5KN1A 2JSZA 5H5SA 5KOWA 1PL2A 3DGQA 1H75A 3HDCA 4TKYA 4V1Ag 1V2AA 4K2XA 4EE0A 1PSQA 3KCMA 4POMA 3M1GA 3L78A 2DJ3A 4JE1A 4GQCA 4HQSA 4DEJA 2LSTA 2EIOA 2LRTA 5ECNB 1EGOA 2YANA 1T4ZA 3F6FA 4TW5A 1F3BA 2C3TA 2FD3A 5HQPA 3K8NA 3LG6A 4N30A 1GSSA 5A4UA 3J7Yb 2RUFA 2G2QA 3C73A 2DJ0A 3EMPA 4TR4A 1R5AA 4KUNA 1TRVA 3QCPA 2MMAA 2LRNA 1F2EA 4QL7A 3GUSA 3IOSA 2H0GA 4BWSA 3FZ9A 2QC7A 3M9JA 3UMAA 2CX4A 3APOA 4EXJA 4EKZA 1PX6A 1GH2A 2VAFA 2YWIA 1XIYA 3A3TA 2N5AA 4WF4A 5AGYA 4TXOA 2TRXA 4ZL7A
chains in the Genus database with same CATH topology
2LQOA 5H5QA 7GSSA 3UEMA 1ZZYA 5IOWA 2L5LA 4BVXB 2N5BA 4OWYA 1M99A 4G0KA 2DJ1A 4TVEA 2E2GA 1AC1A 2JL4A 2HSMA 4PGTA 4K5SA 4ILFA 4IELA 2MYGA 2CA8A 1MTCA 3GRXA 4GSSA 3EE2A 2DSAA 1V57A 2JZRA 2LRCA 2QA1A 4ZXGA 2H6ZA 5D8IA 2H1GA 3SBCA 2V32A 4E8EA 4RQRA 5CNWA 3KJYA 1A24A 1FOVA 3H79A 3TKRA 1YY7A 2GZPA 3UBLA 2OA7A 2WRTA 3S9FA 4GXZA 5ECIB 1TP9A 1GUHA 1MDIA 1T00A 2CVDA 4TOPA 4V1Ap 5DALA 3TKSC 3FYGA 2NDOA 6GSTA 3LQ7A 4OCEA 1YF0A 1PA3A 3R3EA 4MH2A 2H6XA 3D4TA 1DUGA 3TOTA 1EWXA 2F8FA 2OE3A 4MPFA 4DSQA 3LWAA 5F0GA 3M9KA 4FO5A 1JLVA 4BA7A 3BCKA 1DE1A 4I6XA 5F8BA 4JZQA 1YEPA 1LU4A 3BBYA 5IMDA 1Z5YE 1SKSB 4IP6A 3HVSA 3QAGA 3CTGA 2O87A 2YN1A 1ACVA 1FO5A 3VFIA 1J0FA 4EIQA 3IK9A 4WXTA 1MEKA 3GA4A 2PN8A 1Z6NA 4AGSA 2WFCA 4TXOB 2VCXA 4EDZA 2LJAA 4F03A 1S3AA 1TRUA 4EVMA 1NHOA 3KH7A 1X9MB 2H6YA 1BAYA 3VWWA 2VM2A 4FQUA 2NBSA 1QXHA 1XW9A 4MA9A 4OCFA 3ZREA 1ZCPA 2V6KA 4HEA2 2M80A 1Y6EA 3PINA 2JU5A 3KMOA 4BVYA 1PD21 2HZEA 4FYCA 4PNFA 1ZL9A 2QGVA 1BQ7A 1GUMA 1JHBA 5G31A 1TU7A 1SENA 2R0PA 5CAXA 1YQ1A 4EL1A 4KDYA 2R0CA 2K8SA 3HD5A 4MPGA 3LSZA 4GQFA 4PQ1A 3KD0A 1M9AA 3GSTA 4F0CA 5LNKe 4Q5NA 4IJIA 1ERTA 3L4NA 4POLA 3P7XA 2X8GA 4L5LA 1SYXA 3ERFA 1ZYQB 2DIZA 3VWUA 2BJXA 2O7KA 4L0UA 5DALB 3IRAA 2BMXA 1ZMAA 4X0XA 2GDRA 1SL2B 1W4VA 2YZUA 2GVPA 2B6MA 1M0UA 2WB9A 2IIYA 2XPEA 3FEUA 2LNTA 2LV3A 1BX9A 5JWQB 3FR3A 1LJRA 5D9VA 3GN3A 1HNBA 1AQWA 2A4VA 1SJZA 1NHYA 1SK2A 2M46A 3I69A 4GSNA 4O32A 4K5RA 2EIRA 1T1VA 1S3DA 3N5OA 3F3QA 3TRPA 4XS4A 4GWRA 2HSYA 2HLSA 3HJPA 5INYA 5B6NA 2VO4A 1KEBA 3APQA 2KP2A 3CRTA 1N2AA 1ML6A 3D4MA 2E2MA 3G9BA 3GHAA 4JR4A 2HRAA 2LNSA 4IN0A 3DYRA 1QUWA 3VK9A 3ZL5A 3EINA 2V2GA 1QFNA 1PGTA 3EC3A 1QQ2A 2B5YA 2DLXA 2PWJA 1NW2A 3Q74A 2L4QA 3HYPA 1AAZA 2ZNMA 3F8UA 1V58A 4BVYB 1URMA 5IMAA 2HZEB 3VLNA 4I2TA 2RIIA 1V9WA 4JR6A 4PTSA 4YQVA 2K8VA 4ZB9A 4O7HA 4GTUA 2B7KA 5HFIA 4E8HA 3CSHA 2WULA 4IVFA 4LLRA 3FZ4A 4HU7A 4ISDA 4ZIJA 2YCDA 4FYUA 3GIXA 4YAPA 5DQYA 4MP4A 3GX8A 1KTEA 2PVQA 3UVTA 3G7YA 2HYXA 2VCWA 2JADA 3TJFA 5CO3A 1SL1B 1I9DA 5G5FA 4YAVA 1SKRB 4GCIA 3EU3A 2VL2A 4KB3A 3CRUA 4EDYA 2VOCA 5COHA 2A2SA 1U3IA 2UZ8A 5ECSA 2HI7A 1TKDB 4D73A 3GX0A 2H76A 3DVXA 2KOKA 5CREA 1ABAA 4OO5A 2VL9A 5D9TA 2OBIA 2YNXA 3A5IA 5IMZA 4ACSA 1T8EB 4ML1A 2PMTA 1K3LA 2KLXA 2ZUPA 1A2MA 2A2PA 1TOFA 4K7IA 2H0HA 3V1WA 5C00A 5IIZA 4O5UA 1M7TA 20GSA 1ON4A 4KDUA 4IBPA 3KM6A 2WCIA 1K0BA 4NAXA 4MABA 4XRAA 1R7HA 4OMVA 1QGVA 4XS4B 3I6AA 4BVXA 2C1YA 2VD1A 3ZITA 1UN2A 2LTKA 2LQQA 3GMFA 3EYTA 2FY6A 4JU5A 2H1BA 2V41A 2CZ3A 5DAKA 2LS5A 2IFQA 12GSA 3F63A 3VPTA 1BG5A 4NMUA 2R3XA 2TIRA 4POKA 4Q5QA 4WETA 3O76A 3U6VA 3KTLA 1TK5B 3FRCA 2H1AA 1XOAA 3KMNA 4G0IA 1WWJA 3FR6A 5EPFA 1XWBA 3QFAC 2F51A 3KGKA 2PGTA 4JBBA 3LXZA 1WOUA 4O5QA 1R5PA 2P31A 3ZLPA 5IM9A 1G7EA 4ECIA 3TKSA 1C72A 2GZZA 1XWCA 1AQXA 1TRSA 1GL8A 1U87A 4MCUA 1OAZA 2YV7A 2GGTA 1B48A 4F0BA 1B4QA 1U88A 4MLYA 1K3YA 3A2WA 1ZOFA 3ZVJA 4L0WA 2XC2A 3WGXA 3RBTA 4TRXA 3UAPA 5IMFA 5GAPD 5ABRA 5IQYA 1PKWA 1EZKA 3TCOA 4Z2UA 1EV9A 2QKEA 4D73B 5AIVA 2YJHA 5ECLB 2VCVA 5AIXA 1O7UA 2KHPA 2FLSA 1HQOA 1F37A 1YKCA 3KEBA 4EC0A 4TR1A 1Y25A 2VL2C 5IPGA 5D93A 2XBQA 4A5PA 3LORA 3DKSA 4PQIA 1Z7PA 1UA5A 3IA1A 3G7JA 3LEFA 5D96A 3UVHA 1WIKA 1QMVA 3IBHA 2YWNA 3I9V2 2WGRA 3RPNA 2MBTA 2GT5A 1GWCA 1TDIA 3ZTLA 5DVBA 5J4UA 3QDNA 6GSVA 3QD9A 3GSSA 4YQMA 1TK0B 5DJLA 4HZ4A 4PNGA 1K0DA 4K2DA 2G0FA 2X8HA 1XPVA 3D22A 2AB6A 4KA0A 1GTBA 4I8BA 2KP1A 3DRNA 5A4VA 3TJJA 5JCUA 2CV4A 6GSXA 4MZBA 4CHSA 5DAKB 1F6MC 2I1UA 2L6DA 2IFQB 5EVOA 2L5OA 2GT6A 1MD3A 1ZYEA 4WR5A 5G2ZA 3OR5A 4P3YB 3HZ4A 3H1NA 1XVQA 3TOUA 4K8MA 1YF1A 1USBA 2L4CA 4ID0A 2H19A 5CYYA 5C04A 1XWAA 1PN9A 3FKFA 1M9BA 1DBYA 2A2RA 2JACA 2LJRA 2ES7A 5DJMA 1ILOA 3ZIVA 6GSSA 1YJ6A 3TRQA 2AJQB 3EPTA 4EF0A 4TR3A 4OFNA 1X0RA 2VLUA 3MWHA 2B3SA 4ICYA 4L8EA 5DCHA 4NV5A 5CRWA 2DJJA 4Q5FA 1K0MA 3HKRA 3WGDA 1O85A 1FVJA 1B9YC 3UL3A 1YKAA 2C0GA 3A5WA 4ECCA 4PXOA 1OC9B 4HJ2A 3DXBA 5D9WA 2FUG2 5ECPB 1SU9A 1Q98A 1XZOA 2YJ7A 4BPYA 3Q6OA 5JWRB 1FVKA 8GSSA 4TR1B 2BTOT 3ISOA 3G7IA 3LFLA 5H5RA 1FB0A 1THXA 2MMOA 1HYUA 1XWGA 1JZDA 1X9SB 2LEGA 4KCEA 2I4AA 3EURA 3D0ZA 1DE2A 4DSRA 1SD9A 5J9CA 5ECMB 2WJUA 3F9UA 2H8LA 3IDVA 4K9ZA 4MNNA 4KDXA 2PERA 1HNCA 1UC7A 4F82A 5LCZA 2FA4A 3QPMA 2JSYA 4YKGA 3VPQA 3CYNA 1H4OA 2K6VA 2V6OA 2PUKC 1RW1A 3MSZA 2P0GA 2NVLA 1A2LA 2NTOA 4PUFC 2H30A 3QAVA 1XBSA 3TUEA 2RUEA 2R6KA 2FWEA 1BEDA 3MAKA 1KBNA 3PGTA 5DBQA 1N8JA 3IV4A 2GQLA 5ID2B 3MNGA 1J9BA 2GS3A 5IMCA 1WPIA 3D5JA 2OKAA 1FW1A 4G9HA 1MDJA 5KN2A 1R4WA 1Z3EA 5IPHA 1GSYA 2AHEA 3RHCA 5HR1A 4MF6A 3N9JA 2IMFA 4PUAA 1GNEA 2Z9SA 3DVWA 2VCTA 5B8AA 3UOMA 2FNOA 2HT9A 1SK0A 1GSEA 2FWFA 4GRFA 4ZILA 1UVZA 1SD8A 2F3MA 4WBJA 3VWVA 4N0ZA 5F06A 4MMMA 3GH9A 5CP1A 3IAM2 4MDCA 1JFUA 1AXDA 2OADA 2F8AA 2HXKA 3C1SA 1EEJA 3WD6A 1G0TA 1GNWA 5GAND 2WZ9A 3L9VA 5B7CA 10GSA 3TJGA 2VLTA 3EU4A 2R4VA 1TRWA 2N5FA 3QR6A 4IGJA 4IJ3A 2GLRA 4IP1A 3GYKA 3GFKA 3GH6A 1F9MA 3HVVA 4CY8A 3APSA 1GSUA 4HQZA 1XOBA 1ST9A 2H0IA 3FZ5A 1ERUA 1AQVA 4LMVA 4OFTA 2H70A 13GSA 2IMIA 4WR4A 2MMZA 1XXUA 5FWGA 19GSA 4MF7A 1NSWA 3TDGA 1O81A 2OE0A 3UJ1A 2B5EA 3DWVA 1J08A 1DSBA 4LL1B 5J3RA 1Z7RA 3F6DA 1IYIA 1YDKA 3IC8A 1KNGA 2I3YA 3P8WA 2K18A 4MJBA 4FH8A 4AJ7A 3F4TA 3D6IA 16GSA 3W8SA 4OO4A 1ZYPA 4RQXA 3HZ8A 4XIHA 4Z7XA 4MK3A 4GLTA 4L5OA 1T4YA 3HHVA 1CQHA 1JLWA 4X4JA 5AISA 1K0AA 3KTBA 2RM6A 3GKNA 3TJBA 5KN3A 1EOHA 4PURA 1O8XA 4KSMA 1K0NA 2HRNA 3WGEA 1PMTA 5J41A 2YP6A 5IMVA 4QQ7A 4RI7A 2I9HA 4YH2A 1GLQA 2NPBA 1TI1A 2D2ZA 3PH9A 4XS1A 1HD2A 1XFLA 1OVNA 4IQ1A 3LXTA 5ELAA 3F4SA 2O8VB 2OE1A 5HR3A 2P5QA 4HU9A 5KEJA 1V40A 2JZTA 4XCSA 1A2JA 1G7OA 1K0OA 2VIMA 4G0LA 2C0EA 2QA2A 1EV4A 4IS0A 5D9XA 3ZVJD 5CRHA 6GSWA 2PU9C 3DIEA 1I5GA 2AYTA 1B8XA 1M2DA 1K3OA 1GTAA 4J57E 3A2VA 4AF2A 4KAEA 1M2BA 4MZWA 1EP7A 1VF1A 2R2JA 3DMLA 3F3RA 1FHEA 5BRTA 1U6TA 3L9SA 3ED3A 3DEXA 4FIWA 3HY2A 4K6XA 3I43A 2DJKA 1EP8A 5HR0A 18GSA 3GV1A 3HJMA 3GKXA 3L9UA 1OC8A 5E59A 5EL8A 3MIXA 3KIJA 4IKHA 1T3BA 1WE0A 5CRGA 2MMNA 4PQHA 2PBJA 2QSIA 4XTSA 1EGRA 3IHGA 1FG4A 2X8CA 4Z2TA 3BJ5A 5A4WA 3QMXA 3ZRDA 1QK8A 3M8NA 4ML6A 3TKSE 3US3A 2OJLA 4AJ6A 2C4JA 1ZGNA 4IQAA 1SKWB 2DMMA 1W89A 3W6GA 2E0QA 2FA8A 2L57A 4MH3A 4NHZA 2GSTA 4EUYA 4ZBBA 3CMIA 4RUVA 3KZQA 1X5EA 3GNJA 4K7NA 3BD2A 5EY6A 3CSIA 1HNAA 2YWOA 4ZL9A 3J7Yk 4I97A 2AAWA 5IO0A 3AY8A 3H8QA 1GTIA 1CQGA 4KF9A 2IL3A 1PX7A 5GSSA 4DVCA 2L59A 4XHMA 4X1UA 5FT3A 4GSTA 1PN0A 3EVIA 2VD0A 3RAZA 2CX3A 3IR4A 1EEMA 2R5GA 2C8UA 2YV9A 3VI7A 5DDLA 2CT6A 4HDEA 1OC9A 3ERGA 1OYJA 1TI3A 2DKIA 2C80A 3BCIA 4LL4B 2B1KA 4I5QA 1RK4A 5ECRB 2DMLA 3KP8A 4DSSA 2GSSA 1A0RP 1B4PA 5BMUA 3KXOA 3QOUA 4TN8A 1GULA 4ZL8A 1VRSD 2OBKA 1JZRA 1OC3A 1O73A 1RQMA 1A23A 3A2XA 2HZFA 1X9WB 1PRXA 4TR0A 4HI7A 3EMXA 4MF5A 4N11A 5JCGA 4N0VA 3CXGA 2FWGA 17GSA 3M0FA 2DKHA 3TJKA 2ON7A 5ELGA 2XPDA 2FHEA 3ZZXA 1VF4A 3IC4A 4JRRA 3IE3A 2HSHA 3VWXA 5ID2A 3ZMLA 2C3QA 4KE3A 1MD4A 2H72A 1FOHA 1Z6MA 3C1RA 1TTZA 3WT1A 4RI6A 2J9HA 1FAAA 3IXRA 4BWQA 2HNLA 4HUAA 1R26A 4QL9A 1S3CA 1SYRA 4WBRD 1SK1A 3ZMKA 2DIYA 1ZYNA 1OE8A 2FWHA 1K0CA 2PPTA 2YWMA 1PQNA 4ZB6A 4J56E 1VF2A 5F07A 2IMDA 4HOJA 1BYEA 3TRXA 1A8YA 1T7PB 4F9ZA 4V2LA 2VL3A 5HFGA 5IO2A 3O6TA 1TK8B 3ZYWA 4I2UA 3GKMA 4AJ8A 2B1LA 1BJXA 4O5RA 4EO3A 4TXVA 3LW9A 5J9BA 1IYHA 2O85A 2XHFA 1O8WA 2R0GA 2R37A 2RLIA 1YEXA 3MDKA 1OKTA 1A0FA 2DC5A 4K7OA 1SL0B 4WKWA 2M72A 3QAWA 1TW9A 2DBCA 3LGCA 1SJIA 3FHKA 4DSSB 5GZZB 2GZYA 2H75A 1JZWA 6GSUA 1A8LA 4KH7A 2LUSA 2K9FA 3O3TA 4Q5RA 5ECKB 2IPAA 3ZIJA 5B6MA 2IWTA 4OFMA 4HZ2A 2OACA 1AUCA 2EC4A 3PPUA 3F4RA 4K1FA 3IPZA 2VCQA 2CQ9A 4USSA 5FHIA 2H01A 3SWLA 1XWKA 2P5RA 2CVBA 3C7MA 1FB6A 3P2AA 1WMJA 4ZBDA 2H66A 2B5XA 4LA1A 2KUCA 4G10A 2I81A 1XVWA 3TB2A 2GSQA 5F05A 4V2MA 1XW6A 3D21A 1MDKA 3VURA 2MBSA 3GURA 1ERWA 4ZB8A 1Q4JA 4WEYA 3DD3A 1WJKA 2WS2A 4KSOA 5ECHB 5KN0A 4N10A 5E4WA 5G5EA 4YKFA 4YQUA 4NV2A 2IJYA 4ULXA 3LJRA 1SJ6A 2X64A 2H71A 1AW9A 2E7PA 3H4KA 4ECJA 2O89A 4H86A 2LKUA 3FR9A 3R2QA 1OKDA 2ALBA 4G19A 1GSFA 5ECOB 4JEDA 2VUPA 3RDWA 2ON5A 3GL3A 2TRCP 4KW6A 1EOGA 2WDUA 2H1DA 3ZFLA 1GTUA 1WP0A 2H73A 1YZXA 3IHQA 3IK7A 4ECBA 2IMEA 3VI5A 2HFDA 4O92A 5ENUA 5GSTA 3FZAA 1TJDA 1V98A 4G2EA 4KNDA 2B7JA 1X5DA 1M2AA 2MZCA 3CSJA 2CAIA 2XBIA 2LJKA 4Z2RA 5IOXA 3BOAA 2HRKA 4J2FA 5D73A 2VM1A 4BL7A 4EIPA 1GUKA 3TKPA 2JZSA 1GRXA 2CVKA 1OE7A 4IW9A 2FCHA 2F9SA 2J23A 1XW5A 2ZCTA 3U5RE 4NWYA 2FGXA 2C0FA 4CW9A 5L71A 3KP9A 1Z9HA 2AUVA 2YPMA 3UBKA 2CZ2A 3FY7A 5CRDA 4PX1A 3GTUA 5G1LA 5DCGA 5G1KA 3WYWA 4WF5A 2YZHA 2GSRA 2GQKA 4HJMA 22GSA 1TXXA 1E2YA 3JCML 3E9JB 2H74A 3RHBA 1AIUA 3Q18A 4XRDA 1E6BA 1TU8A 2REMA 3H93A 4CDOA 5HFKA 2X99A 2EIQA 3L0HA 2VLVA 5LD0A 2DJ2A 4NHWA 2X4AA 1U3AA 3IAS2 1O6JA 3C71A 4POBA 3E0UA 3NIVA 3HCZA 4ZBAA 4MJCA 3CBUA 1NM3A 1X5CA 2V1MA 3ME8A 5A5KA 3QFBC 4XS6A 2IMKA 4NXIA 14GSA 2YOIA 4GF0A 2HRFA 3UARA 1JZOA 1F3AA 2X49A 3MYDA 3FK8A 4KCAA 2L6CA 11GSA 4F2IA 3NOFA 5HR2A 4CY6A 1G6YA 1ERVA 2RM5A 4KGIA 2HE3A 3ZFBA 3TGZA 6GSYA 3Q19A 4BL7B 5B8BA 3GL5A 3C8EA 4MJAA 3TKQA 3FW2A 3LYPA 4HS1A 3RPPA 3CTFA 3HA9A 1GSQA 3NZNA 4K0NA 1PKZA 3M3MA 1WRYA 5KOXA 1PL1A 2C3NA 1GSDA 4FYBA 9GSSA 4OD7A 1G6WA 4MJEA 5DQSA 5JWOB 4X43A 3WT2A 2AV4A 1VF3A 4NPBA 2C0DA 3E3EA 3P90A 3GTUB 3HXSA 3HJOA 4K0GA 4V2NA 1THOA 2A4HA 3KH9A 3LYKA 1GLPA 3W8JA 3PR8A 4IHUA 4MZCA 3FMWA 1B9XC 1GP1A 3ERWA 1XCCA 1VGLA 2GQMA 2IN3A 5ECQB 5AN1A 2CAQA 3GKKA 3F0IA 5J5NA 3ME7A 4LMWA 2VCZA 4KX4A 3UIWA 2PVOC 3HVXA 5JCWA 1LBKA 5G30A 2GTUA 3EWLA 5KN1A 2JSZA 5H5SA 5KOWA 1PL2A 3DGQA 1H75A 3HDCA 4TKYA 4V1Ag 1V2AA 4K2XA 4EE0A 1PSQA 3KCMA 4POMA 3M1GA 3L78A 2DJ3A 4JE1A 4GQCA 4HQSA 4DEJA 2LSTA 2EIOA 2LRTA 5ECNB 1EGOA 2YANA 1T4ZA 3F6FA 4TW5A 1F3BA 2C3TA 2FD3A 5HQPA 3K8NA 3LG6A 4N30A 1GSSA 5A4UA 3J7Yb 2RUFA 2G2QA 3C73A 2DJ0A 3EMPA 4TR4A 1R5AA 4KUNA 1TRVA 3QCPA 2MMAA 2LRNA 1F2EA 4QL7A 3GUSA 3IOSA 2H0GA 4BWSA 3FZ9A 2QC7A 3M9JA 3UMAA 2CX4A 3APOA 4EXJA 4EKZA 1PX6A 1GH2A 2VAFA 2YWIA 1XIYA 3A3TA 2N5AA 4WF4A 5AGYA 4TXOA 2TRXA 4ZL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQO A;  5H5Q A;  7GSS A;  3UEM A;  1ZZY A;  5IOW A;  2L5L A;  2N5B A;  4OWY A;  1M99 A;  2DJ1 A;  4TVE A;  2E2G A;  1AC1 A;  2JL4 A;  4PGT A;  4ILF A;  4IEL A;  2MYG A;  2CA8 A;  1MTC A;  3GRX A;  4GSS A;  3EE2 A;  2DSA A;  1V57 A;  2JZR A;  2LRC A;  4ZXG A;  2H6Z A;  5D8I A;  2H1G A;  3SBC A;  2V32 A;  4E8E A;  4RQR A;  5CNW A;  3KJY A;  1A24 A;  1FOV A;  3H79 A;  3TKR A;  1YY7 A;  2GZP A;  3UBL A;  2OA7 A;  2WRT A;  3S9F A;  4GXZ A;  5ECI B;  1TP9 A;  1GUH A;  1MDI A;  1T00 A;  2CVD A;  4TOP A;  4V1A p;  5DAL A;  3TKS C;  3FYG A;  2NDO A;  6GST A;  3LQ7 A;  4OCE A;  1YF0 A;  1PA3 A;  4MH2 A;  2H6X A;  3D4T A;  1DUG A;  3TOT A;  1EWX A;  2F8F A;  2OE3 A;  4MPF A;  4DSQ A;  3LWA A;  5F0G A;  3M9K A;  4FO5 A;  1JLV A;  4BA7 A;  3BCK A;  1DE1 A;  4I6X A;  5F8B A;  4JZQ A;  1YEP A;  1LU4 A;  3BBY A;  5IMD A;  1Z5Y E;  1SKS B;  4IP6 A;  3HVS A;  3QAG A;  3CTG A;  2O87 A;  2YN1 A;  1ACV A;  1FO5 A;  3VFI A;  1J0F A;  3IK9 A;  4WXT A;  1MEK A;  3GA4 A;  2PN8 A;  1Z6N A;  4AGS A;  2WFC A;  4TXO B;  2VCX A;  4EDZ A;  2LJA A;  4F03 A;  1S3A A;  1TRU A;  4EVM A;  1NHO A;  3KH7 A;  1X9M B;  2H6Y A;  1BAY A;  3VWW A;  2VM2 A;  2NBS A;  1QXH A;  1XW9 A;  4MA9 A;  4OCF A;  3ZRE A;  1ZCP A;  2V6K A;  4HEA 2;  2M80 A;  1Y6E A;  3PIN A;  2JU5 A;  3KMO A;  4BVY A;  1PD2 1;  2HZE A;  4FYC A;  4PNF A;  1ZL9 A;  2QGV A;  1BQ7 A;  1GUM A;  1JHB A;  5G31 A;  1TU7 A;  1SEN A;  5CAX A;  1YQ1 A;  4EL1 A;  4KDY A;  2K8S A;  3HD5 A;  4MPG A;  3LSZ A;  4GQF A;  4PQ1 A;  3KD0 A;  1M9A A;  3GST A;  4F0C A;  5LNK e;  4Q5N A;  4IJI A;  1ERT A;  3L4N A;  4POL A;  3P7X A;  2X8G A;  4L5L A;  1SYX A;  3ERF A;  1ZYQ B;  2DIZ A;  3VWU A;  2BJX A;  2O7K A;  4L0U A;  5DAL B;  3IRA A;  2BMX A;  1ZMA A;  4X0X A;  2GDR A;  1SL2 B;  1W4V A;  2YZU A;  2GVP A;  2B6M A;  1M0U A;  2WB9 A;  2IIY A;  2XPE A;  3FEU A;  2LNT A;  2LV3 A;  1BX9 A;  5JWQ B;  3FR3 A;  1LJR A;  5D9V A;  3GN3 A;  1HNB A;  1AQW A;  2A4V A;  1SJZ A;  1NHY A;  1SK2 A;  2M46 A;  3I69 A;  4GSN A;  4O32 A;  2EIR A;  1T1V A;  1S3D A;  3N5O A;  3F3Q A;  3TRP A;  4XS4 A;  4GWR A;  2HSY A;  2HLS A;  3HJP A;  5INY A;  5B6N A;  2VO4 A;  1KEB A;  3APQ A;  2KP2 A;  3CRT A;  1N2A A;  1ML6 A;  3D4M A;  2E2M A;  3G9B A;  3GHA A;  4JR4 A;  2LNS A;  4IN0 A;  3DYR A;  1QUW A;  3VK9 A;  3ZL5 A;  3EIN A;  2V2G A;  1QFN A;  1PGT A;  3EC3 A;  1QQ2 A;  2B5Y A;  2DLX A;  2PWJ A;  1NW2 A;  3Q74 A;  2L4Q A;  3HYP A;  1AAZ A;  2ZNM A;  3F8U A;  1V58 A;  1URM A;  5IMA A;  2HZE B;  3VLN A;  4I2T A;  2RII A;  1V9W A;  4JR6 A;  4YQV A;  2K8V A;  4ZB9 A;  4O7H A;  4GTU A;  2B7K A;  5HFI A;  4E8H A;  3CSH A;  2WUL A;  4IVF A;  4LLR A;  3FZ4 A;  4HU7 A;  4ISD A;  4ZIJ A;  2YCD A;  4FYU A;  3GIX A;  4YAP A;  5DQY A;  4MP4 A;  3GX8 A;  1KTE A;  2PVQ A;  3UVT A;  3G7Y A;  2HYX A;  2VCW A;  2JAD A;  3TJF A;  5CO3 A;  1SL1 B;  1I9D A;  5G5F A;  4YAV A;  1SKR B;  4GCI A;  3EU3 A;  2VL2 A;  4KB3 A;  3CRU A;  4EDY A;  2VOC A;  5COH A;  2A2S A;  1U3I A;  5ECS A;  2HI7 A;  1TKD B;  4D73 A;  3GX0 A;  2H76 A;  3DVX A;  2KOK A;  5CRE A;  1ABA A;  4OO5 A;  2VL9 A;  5D9T A;  2OBI A;  2YNX A;  5IMZ A;  4ACS A;  1T8E B;  4ML1 A;  2PMT A;  1K3L A;  2KLX A;  2ZUP A;  1A2M A;  1TOF A;  4K7I A;  2H0H A;  3V1W A;  5C00 A;  5IIZ A;  1M7T A;  20GS A;  1ON4 A;  4KDU A;  4IBP A;  3KM6 A;  2WCI A;  1K0B A;  4NAX A;  4MAB A;  4XRA A;  1R7H A;  4OMV A;  1QGV A;  4XS4 B;  3I6A A;  4BVX A;  2C1Y A;  2VD1 A;  3ZIT A;  1UN2 A;  2LTK A;  2LQQ A;  3GMF A;  3EYT A;  2FY6 A;  4JU5 A;  2H1B A;  2V41 A;  2CZ3 A;  5DAK A;  2LS5 A;  2IFQ A;  12GS A;  3F63 A;  3VPT A;  1BG5 A;  4NMU A;  2R3X A;  2TIR A;  4POK A;  4Q5Q A;  4WET A;  3O76 A;  3U6V A;  3KTL A;  1TK5 B;  3FRC A;  2H1A A;  1XOA A;  3KMN A;  1WWJ A;  3FR6 A;  5EPF A;  1XWB A;  3QFA C;  2F51 A;  3KGK A;  2PGT A;  4JBB A;  3LXZ A;  1WOU A;  1R5P A;  2P31 A;  3ZLP A;  5IM9 A;  1G7E A;  4ECI A;  3TKS A;  1C72 A;  2GZZ A;  1XWC A;  1AQX A;  1TRS A;  1GL8 A;  1U87 A;  4MCU A;  1OAZ A;  2YV7 A;  2GGT A;  1B48 A;  4F0B A;  1B4Q A;  1U88 A;  4MLY A;  1K3Y A;  3A2W A;  1ZOF A;  3ZVJ A;  4L0W A;  2XC2 A;  3WGX A;  3RBT A;  4TRX A;  3UAP A;  5IMF A;  5GAP D;  5ABR A;  5IQY A;  1PKW A;  1EZK A;  3TCO A;  1EV9 A;  2QKE A;  4D73 B;  5AIV A;  2YJH A;  5ECL B;  2VCV A;  5AIX A;  1O7U A;  2KHP A;  2FLS A;  1HQO A;  1F37 A;  1YKC A;  3KEB A;  4EC0 A;  4TR1 A;  1Y25 A;  2VL2 C;  5IPG A;  5D93 A;  2XBQ A;  3LOR A;  3DKS A;  4PQI A;  1Z7P A;  1UA5 A;  3IA1 A;  3G7J A;  3LEF A;  5D96 A;  3UVH A;  1WIK A;  1QMV A;  3IBH A;  2YWN A;  3I9V 2;  2WGR A;  3RPN A;  2MBT A;  2GT5 A;  1GWC A;  1TDI A;  3ZTL A;  5DVB A;  5J4U A;  3QDN A;  6GSV A;  3QD9 A;  3GSS A;  4YQM A;  1TK0 B;  5DJL A;  4HZ4 A;  4PNG A;  1K0D A;  4K2D A;  2G0F A;  2X8H A;  1XPV A;  3D22 A;  2AB6 A;  4KA0 A;  1GTB A;  4I8B A;  2KP1 A;  3DRN A;  5A4V A;  3TJJ A;  5JCU A;  2CV4 A;  6GSX A;  4MZB A;  4CHS A;  5DAK B;  1F6M C;  2I1U A;  2L6D A;  2IFQ B;  5EVO A;  2L5O A;  2GT6 A;  1MD3 A;  1ZYE A;  4WR5 A;  5G2Z A;  3OR5 A;  4P3Y B;  3HZ4 A;  3H1N A;  1XVQ A;  3TOU A;  4K8M A;  1YF1 A;  1USB A;  2L4C A;  4ID0 A;  2H19 A;  5CYY A;  5C04 A;  1XWA A;  1PN9 A;  3FKF A;  1M9B A;  1DBY A;  2A2R A;  2JAC A;  2LJR A;  2ES7 A;  5DJM A;  1ILO A;  3ZIV A;  6GSS A;  1YJ6 A;  3TRQ A;  2AJQ B;  4EF0 A;  4TR3 A;  4OFN A;  1X0R A;  2VLU A;  3MWH A;  2B3S A;  4L8E A;  5DCH A;  4NV5 A;  5CRW A;  2DJJ A;  4Q5F A;  1K0M A;  3HKR A;  3WGD A;  1O85 A;  1FVJ A;  1B9Y C;  3UL3 A;  1YKA A;  2C0G A;  3A5W A;  4ECC A;  4PXO A;  1OC9 B;  4HJ2 A;  3DXB A;  5D9W A;  2FUG 2;  5ECP B;  1SU9 A;  1Q98 A;  1XZO A;  2YJ7 A;  4BPY A;  3Q6O A;  5JWR B;  1FVK A;  8GSS A;  4TR1 B;  2BTO T;  3ISO A;  3G7I A;  3LFL A;  5H5R A;  1FB0 A;  1THX A;  2MMO A;  1HYU A;  1XWG A;  1JZD A;  1X9S B;  2LEG A;  4KCE A;  2I4A A;  3EUR A;  3D0Z A;  1DE2 A;  4DSR A;  1SD9 A;  5J9C A;  5ECM B;  2WJU A;  3F9U A;  2H8L A;  3IDV A;  4K9Z A;  4KDX A;  2PER A;  1HNC A;  1UC7 A;  4F82 A;  5LCZ A;  2FA4 A;  3QPM A;  2JSY A;  3VPQ A;  3CYN A;  1H4O A;  2K6V A;  2V6O A;  2PUK C;  1RW1 A;  3MSZ A;  2P0G A;  2NVL A;  1A2L A;  2NTO A;  4PUF C;  2H30 A;  3QAV A;  1XBS A;  3TUE A;  2RUE A;  2R6K A;  2FWE A;  1BED A;  3MAK A;  1KBN A;  3PGT A;  5DBQ A;  1N8J A;  3IV4 A;  2GQL A;  5ID2 B;  3MNG A;  1J9B A;  2GS3 A;  5IMC A;  1WPI A;  3D5J A;  2OKA A;  1FW1 A;  4G9H A;  1MDJ A;  5KN2 A;  1R4W A;  1Z3E A;  5IPH A;  1GSY A;  2AHE A;  3RHC A;  5HR1 A;  4MF6 A;  3N9J A;  2IMF A;  4PUA A;  1GNE A;  2Z9S A;  3DVW A;  2VCT A;  5B8A A;  3UOM A;  2FNO A;  2HT9 A;  1SK0 A;  1GSE A;  2FWF A;  4GRF A;  4ZIL A;  1UVZ A;  1SD8 A;  2F3M A;  4WBJ A;  3VWV A;  4N0Z A;  5F06 A;  4MMM A;  3GH9 A;  5CP1 A;  3IAM 2;  4MDC A;  1JFU A;  1AXD A;  2OAD A;  2F8A A;  2HXK A;  3C1S A;  1EEJ A;  3WD6 A;  1G0T A;  1GNW A;  5GAN D;  2WZ9 A;  3L9V A;  5B7C A;  10GS A;  3TJG A;  2VLT A;  3EU4 A;  2R4V A;  1TRW A;  2N5F A;  3QR6 A;  4IGJ A;  4IJ3 A;  2GLR A;  4IP1 A;  3GYK A;  3GFK A;  3GH6 A;  1F9M A;  3HVV A;  3APS A;  1GSU A;  4HQZ A;  1XOB A;  1ST9 A;  2H0I A;  3FZ5 A;  1ERU A;  1AQV A;  4LMV A;  4OFT A;  2H70 A;  13GS A;  2IMI A;  4WR4 A;  2MMZ A;  1XXU A;  5FWG A;  19GS A;  4MF7 A;  1NSW A;  3TDG A;  1O81 A;  2OE0 A;  3UJ1 A;  2B5E A;  3DWV A;  1J08 A;  1DSB A;  4LL1 B;  5J3R A;  1Z7R A;  3F6D A;  1IYI A;  1YDK A;  1KNG A;  2I3Y A;  3P8W A;  2K18 A;  4MJB A;  4FH8 A;  4AJ7 A;  3F4T A;  3D6I A;  16GS A;  3W8S A;  4OO4 A;  4RQX A;  3HZ8 A;  4XIH A;  4Z7X A;  4MK3 A;  4GLT A;  4L5O A;  1T4Y A;  3HHV A;  1CQH A;  1JLW A;  5AIS A;  1K0A A;  3KTB A;  2RM6 A;  3GKN A;  3TJB A;  5KN3 A;  1EOH A;  4PUR A;  1O8X A;  4KSM A;  1K0N A;  2HRN A;  3WGE A;  1PMT A;  5J41 A;  2YP6 A;  5IMV A;  4QQ7 A;  4RI7 A;  2I9H A;  4YH2 A;  1GLQ A;  2NPB A;  1TI1 A;  2D2Z A;  3PH9 A;  4XS1 A;  1HD2 A;  1XFL A;  1OVN A;  4IQ1 A;  3LXT A;  5ELA A;  3F4S A;  2O8V B;  2OE1 A;  5HR3 A;  2P5Q A;  4HU9 A;  5KEJ A;  1V40 A;  2JZT A;  4XCS A;  1A2J A;  1G7O A;  1K0O A;  2VIM A;  2C0E A;  1EV4 A;  4IS0 A;  5D9X A;  3ZVJ D;  5CRH A;  6GSW A;  2PU9 C;  3DIE A;  1I5G A;  2AYT A;  1B8X A;  1M2D A;  1K3O A;  1GTA A;  4J57 E;  3A2V A;  4AF2 A;  4KAE A;  1M2B A;  4MZW A;  1EP7 A;  1VF1 A;  2R2J A;  3DML A;  3F3R A;  1FHE A;  1U6T A;  3L9S A;  3ED3 A;  3DEX A;  4FIW A;  3HY2 A;  4K6X A;  3I43 A;  2DJK A;  1EP8 A;  5HR0 A;  18GS A;  3GV1 A;  3HJM A;  3GKX A;  3L9U A;  1OC8 A;  5E59 A;  5EL8 A;  4IKH A;  3KIJ A;  1T3B A;  1WE0 A;  5CRG A;  2MMN A;  4PQH A;  2PBJ A;  2QSI A;  4XTS A;  1EGR A;  1FG4 A;  2X8C A;  3BJ5 A;  5A4W A;  3QMX A;  3ZRD A;  1QK8 A;  3M8N A;  4ML6 A;  3TKS E;  3US3 A;  2OJL A;  4AJ6 A;  2C4J A;  1ZGN A;  4IQA A;  1SKW B;  2DMM A;  1W89 A;  3W6G A;  2E0Q A;  2FA8 A;  2L57 A;  4MH3 A;  4NHZ A;  2GST A;  4EUY A;  4ZBB A;  3CMI A;  4RUV A;  3KZQ A;  1X5E A;  3GNJ A;  4K7N A;  3BD2 A;  5EY6 A;  3CSI A;  1HNA A;  2YWO A;  4ZL9 A;  3J7Y k;  4I97 A;  2AAW A;  5IO0 A;  3AY8 A;  3H8Q A;  1GTI A;  1CQG A;  2IL3 A;  1PX7 A;  5GSS A;  4DVC A;  2L59 A;  4XHM A;  4X1U A;  5FT3 A;  4GST A;  3EVI A;  2VD0 A;  3RAZ A;  2CX3 A;  3IR4 A;  1EEM A;  2R5G A;  2C8U A;  2YV9 A;  3VI7 A;  5DDL A;  2CT6 A;  4HDE A;  1OC9 A;  3ERG A;  1OYJ A;  1TI3 A;  2C80 A;  3BCI A;  4LL4 B;  2B1K A;  4I5Q A;  1RK4 A;  5ECR B;  2DML A;  3KP8 A;  4DSS A;  2GSS A;  1A0R P;  1B4P A;  3KXO A;  3QOU A;  4TN8 A;  1GUL A;  4ZL8 A;  1VRS D;  2OBK A;  1JZR A;  1OC3 A;  1O73 A;  1RQM A;  1A23 A;  3A2X A;  2HZF A;  1X9W B;  1PRX A;  4TR0 A;  4HI7 A;  3EMX A;  4MF5 A;  4N11 A;  5JCG A;  4N0V A;  3CXG A;  2FWG A;  17GS A;  3M0F A;  3TJK A;  2ON7 A;  5ELG A;  2XPD A;  2FHE A;  3ZZX A;  1VF4 A;  3IC4 A;  4JRR A;  3IE3 A;  2HSH A;  3VWX A;  5ID2 A;  3ZML A;  2C3Q A;  4KE3 A;  1MD4 A;  2H72 A;  1Z6M A;  3C1R A;  1TTZ A;  3WT1 A;  4RI6 A;  2J9H A;  1FAA A;  3IXR A;  4BWQ A;  2HNL A;  4HUA A;  1R26 A;  4QL9 A;  1S3C A;  1SYR A;  4WBR D;  1SK1 A;  3ZMK A;  2DIY A;  1OE8 A;  2FWH A;  1K0C A;  2PPT A;  2YWM A;  1PQN A;  4ZB6 A;  4J56 E;  1VF2 A;  5F07 A;  2IMD A;  4HOJ A;  1BYE A;  3TRX A;  1A8Y A;  1T7P B;  4F9Z A;  4V2L A;  2VL3 A;  5HFG A;  5IO2 A;  3O6T A;  1TK8 B;  3ZYW A;  4I2U A;  3GKM A;  4AJ8 A;  2B1L A;  1BJX A;  4O5R A;  4EO3 A;  4TXV A;  5J9B A;  1IYH A;  2O85 A;  2XHF A;  1O8W A;  2R37 A;  2RLI A;  1YEX A;  3MDK A;  1OKT A;  1A0F A;  2DC5 A;  4K7O A;  1SL0 B;  4WKW A;  2M72 A;  3QAW A;  1TW9 A;  2DBC A;  3LGC A;  1SJI A;  3FHK A;  4DSS B;  5GZZ B;  2GZY A;  2H75 A;  1JZW A;  6GSU A;  1A8L A;  4KH7 A;  2LUS A;  2K9F A;  3O3T A;  4Q5R A;  5ECK B;  2IPA A;  3ZIJ A;  5B6M A;  2IWT A;  4OFM A;  4HZ2 A;  2OAC A;  1AUC A;  2EC4 A;  3F4R A;  4K1F A;  3IPZ A;  2VCQ A;  2CQ9 A;  5FHI A;  2H01 A;  3SWL A;  1XWK A;  2P5R A;  2CVB A;  3C7M A;  1FB6 A;  3P2A A;  1WMJ A;  4ZBD A;  2H66 A;  2B5X A;  4LA1 A;  2KUC A;  4G10 A;  2I81 A;  1XVW A;  3TB2 A;  2GSQ A;  5F05 A;  4V2M A;  1XW6 A;  3D21 A;  1MDK A;  3VUR A;  2MBS A;  3GUR A;  1ERW A;  4ZB8 A;  1Q4J A;  4WEY A;  3DD3 A;  1WJK A;  2WS2 A;  4KSO A;  5ECH B;  5KN0 A;  4N10 A;  5E4W A;  5G5E A;  4YQU A;  4NV2 A;  2IJY A;  4ULX A;  3LJR A;  1SJ6 A;  2X64 A;  2H71 A;  1AW9 A;  2E7P A;  3H4K A;  4ECJ A;  2O89 A;  4H86 A;  2LKU A;  3FR9 A;  3R2Q A;  1OKD A;  2ALB A;  4G19 A;  1GSF A;  5ECO B;  4JED A;  2VUP A;  3RDW A;  2ON5 A;  3GL3 A;  2TRC P;  4KW6 A;  1EOG A;  2WDU A;  2H1D A;  3ZFL A;  1GTU A;  1WP0 A;  2H73 A;  1YZX A;  3IHQ A;  3IK7 A;  4ECB A;  2IME A;  3VI5 A;  2HFD A;  4O92 A;  5ENU A;  5GST A;  3FZA A;  1TJD A;  1V98 A;  4G2E A;  4KND A;  2B7J A;  1X5D A;  1M2A A;  2MZC A;  3CSJ A;  2CAI A;  2XBI A;  2LJK A;  5IOX A;  3BOA A;  4J2F A;  5D73 A;  2VM1 A;  4BL7 A;  1GUK A;  3TKP A;  2JZS A;  1GRX A;  2CVK A;  1OE7 A;  4IW9 A;  2FCH A;  2F9S A;  2J23 A;  1XW5 A;  2ZCT A;  3U5R E;  4NWY A;  2FGX A;  2C0F A;  4CW9 A;  5L71 A;  3KP9 A;  1Z9H A;  2AUV A;  2YPM A;  3UBK A;  2CZ2 A;  3FY7 A;  5CRD A;  4PX1 A;  3GTU A;  5G1L A;  5DCG A;  5G1K A;  3WYW A;  4WF5 A;  2YZH A;  2GSR A;  2GQK A;  4HJM A;  22GS A;  1TXX A;  1E2Y A;  3JCM L;  3E9J B;  2H74 A;  3RHB A;  1AIU A;  3Q18 A;  4XRD A;  1E6B A;  1TU8 A;  2REM A;  3H93 A;  4CDO A;  5HFK A;  2X99 A;  2EIQ A;  3L0H A;  2VLV A;  5LD0 A;  2DJ2 A;  4NHW A;  1U3A A;  3IAS 2;  1O6J A;  3C71 A;  4POB A;  3E0U A;  3NIV A;  3HCZ A;  4ZBA A;  4MJC A;  3CBU A;  1NM3 A;  1X5C A;  2V1M A;  3ME8 A;  5A5K A;  3QFB C;  4XS6 A;  2IMK A;  4NXI A;  14GS A;  2YOI A;  4GF0 A;  2HRF A;  3UAR A;  1JZO A;  1F3A A;  3FK8 A;  4KCA A;  2L6C A;  11GS A;  4F2I A;  3NOF A;  5HR2 A;  1G6Y A;  1ERV A;  2RM5 A;  4KGI A;  2HE3 A;  3ZFB A;  3TGZ A;  6GSY A;  3Q19 A;  5B8B A;  3GL5 A;  3C8E A;  4MJA A;  3TKQ A;  3FW2 A;  3LYP A;  4HS1 A;  3RPP A;  3CTF A;  3HA9 A;  1GSQ A;  3NZN A;  4K0N A;  1PKZ A;  3M3M A;  1WRY A;  1PL1 A;  2C3N A;  1GSD A;  4FYB A;  9GSS A;  4OD7 A;  1G6W A;  4MJE A;  5DQS A;  5JWO B;  4X43 A;  3WT2 A;  2AV4 A;  1VF3 A;  4NPB A;  2C0D A;  3E3E A;  3P90 A;  3GTU B;  3HXS A;  3HJO A;  4K0G A;  1THO A;  4V2N A;  3KH9 A;  3LYK A;  1GLP A;  3W8J A;  3PR8 A;  4IHU A;  4MZC A;  1B9X C;  1GP1 A;  3ERW A;  1XCC A;  1VGL A;  2GQM A;  2IN3 A;  5ECQ B;  5AN1 A;  2CAQ A;  3GKK A;  3F0I A;  5J5N A;  3ME7 A;  4LMW A;  2VCZ A;  4KX4 A;  3UIW A;  2PVO C;  3HVX A;  5JCW A;  1LBK A;  5G30 A;  2GTU A;  3EWL A;  5KN1 A;  2JSZ A;  5H5S A;  1PL2 A;  3DGQ A;  1H75 A;  3HDC A;  4TKY A;  4V1A g;  1V2A A;  4EE0 A;  1PSQ A;  3KCM A;  4POM A;  3M1G A;  3L78 A;  2DJ3 A;  4JE1 A;  4GQC A;  4HQS A;  4DEJ A;  2LST A;  2EIO A;  2LRT A;  5ECN B;  1EGO A;  2YAN A;  1T4Z A;  3F6F A;  4TW5 A;  1F3B A;  2C3T A;  2FD3 A;  5HQP A;  3K8N A;  3LG6 A;  4N30 A;  1GSS A;  5A4U A;  3J7Y b;  2RUF A;  2G2Q A;  3C73 A;  2DJ0 A;  3EMP A;  4TR4 A;  1R5A A;  4KUN A;  1TRV A;  3QCP A;  2MMA A;  2LRN A;  1F2E A;  4QL7 A;  3GUS A;  3IOS A;  2H0G A;  4BWS A;  3FZ9 A;  2QC7 A;  3M9J A;  3UMA A;  2CX4 A;  3APO A;  4EXJ A;  4EKZ A;  1PX6 A;  1GH2 A;  2VAF A;  2YWI A;  1XIY A;  3A3T A;  2N5A A;  4WF4 A;  5AGY A;  4TXO A;  2TRX A;  4ZL7 A; 
#chains in the Genus database with same CATH topology
 2LQO A;  5H5Q A;  7GSS A;  3UEM A;  1ZZY A;  5IOW A;  2L5L A;  4BVX B;  2N5B A;  4OWY A;  1M99 A;  4G0K A;  2DJ1 A;  4TVE A;  2E2G A;  1AC1 A;  2JL4 A;  2HSM A;  4PGT A;  4K5S A;  4ILF A;  4IEL A;  2MYG A;  2CA8 A;  1MTC A;  3GRX A;  4GSS A;  3EE2 A;  2DSA A;  1V57 A;  2JZR A;  2LRC A;  2QA1 A;  4ZXG A;  2H6Z A;  5D8I A;  2H1G A;  3SBC A;  2V32 A;  4E8E A;  4RQR A;  5CNW A;  3KJY A;  1A24 A;  1FOV A;  3H79 A;  3TKR A;  1YY7 A;  2GZP A;  3UBL A;  2OA7 A;  2WRT A;  3S9F A;  4GXZ A;  5ECI B;  1TP9 A;  1GUH A;  1MDI A;  1T00 A;  2CVD A;  4TOP A;  4V1A p;  5DAL A;  3TKS C;  3FYG A;  2NDO A;  6GST A;  3LQ7 A;  4OCE A;  1YF0 A;  1PA3 A;  3R3E A;  4MH2 A;  2H6X A;  3D4T A;  1DUG A;  3TOT A;  1EWX A;  2F8F A;  2OE3 A;  4MPF A;  4DSQ A;  3LWA A;  5F0G A;  3M9K A;  4FO5 A;  1JLV A;  4BA7 A;  3BCK A;  1DE1 A;  4I6X A;  5F8B A;  4JZQ A;  1YEP A;  1LU4 A;  3BBY A;  5IMD A;  1Z5Y E;  1SKS B;  4IP6 A;  3HVS A;  3QAG A;  3CTG A;  2O87 A;  2YN1 A;  1ACV A;  1FO5 A;  3VFI A;  1J0F A;  4EIQ A;  3IK9 A;  4WXT A;  1MEK A;  3GA4 A;  2PN8 A;  1Z6N A;  4AGS A;  2WFC A;  4TXO B;  2VCX A;  4EDZ A;  2LJA A;  4F03 A;  1S3A A;  1TRU A;  4EVM A;  1NHO A;  3KH7 A;  1X9M B;  2H6Y A;  1BAY A;  3VWW A;  2VM2 A;  4FQU A;  2NBS A;  1QXH A;  1XW9 A;  4MA9 A;  4OCF A;  3ZRE A;  1ZCP A;  2V6K A;  4HEA 2;  2M80 A;  1Y6E A;  3PIN A;  2JU5 A;  3KMO A;  4BVY A;  1PD2 1;  2HZE A;  4FYC A;  4PNF A;  1ZL9 A;  2QGV A;  1BQ7 A;  1GUM A;  1JHB A;  5G31 A;  1TU7 A;  1SEN A;  2R0P A;  5CAX A;  1YQ1 A;  4EL1 A;  4KDY A;  2R0C A;  2K8S A;  3HD5 A;  4MPG A;  3LSZ A;  4GQF A;  4PQ1 A;  3KD0 A;  1M9A A;  3GST A;  4F0C A;  5LNK e;  4Q5N A;  4IJI A;  1ERT A;  3L4N A;  4POL A;  3P7X A;  2X8G A;  4L5L A;  1SYX A;  3ERF A;  1ZYQ B;  2DIZ A;  3VWU A;  2BJX A;  2O7K A;  4L0U A;  5DAL B;  3IRA A;  2BMX A;  1ZMA A;  4X0X A;  2GDR A;  1SL2 B;  1W4V A;  2YZU A;  2GVP A;  2B6M A;  1M0U A;  2WB9 A;  2IIY A;  2XPE A;  3FEU A;  2LNT A;  2LV3 A;  1BX9 A;  5JWQ B;  3FR3 A;  1LJR A;  5D9V A;  3GN3 A;  1HNB A;  1AQW A;  2A4V A;  1SJZ A;  1NHY A;  1SK2 A;  2M46 A;  3I69 A;  4GSN A;  4O32 A;  4K5R A;  2EIR A;  1T1V A;  1S3D A;  3N5O A;  3F3Q A;  3TRP A;  4XS4 A;  4GWR A;  2HSY A;  2HLS A;  3HJP A;  5INY A;  5B6N A;  2VO4 A;  1KEB A;  3APQ A;  2KP2 A;  3CRT A;  1N2A A;  1ML6 A;  3D4M A;  2E2M A;  3G9B A;  3GHA A;  4JR4 A;  2HRA A;  2LNS A;  4IN0 A;  3DYR A;  1QUW A;  3VK9 A;  3ZL5 A;  3EIN A;  1S3R A;  2V2G A;  1QFN A;  1PGT A;  3EC3 A;  1QQ2 A;  2B5Y A;  2DLX A;  2PWJ A;  1NW2 A;  3Q74 A;  2L4Q A;  3HYP A;  1AAZ A;  2ZNM A;  3F8U A;  1V58 A;  4BVY B;  1URM A;  5IMA A;  2HZE B;  3VLN A;  4I2T A;  2RII A;  1V9W A;  4JR6 A;  4PTS A;  4YQV A;  2K8V A;  4ZB9 A;  4O7H A;  4GTU A;  2B7K A;  5HFI A;  4E8H A;  3CSH A;  2WUL A;  4IVF A;  4LLR A;  3CQF A;  3FZ4 A;  4HU7 A;  4ISD A;  4ZIJ A;  2YCD A;  4FYU A;  3GIX A;  1XG8 A;  4YAP A;  5DQY A;  4MP4 A;  3GX8 A;  1KTE A;  2PVQ A;  3UVT A;  3G7Y A;  2HYX A;  2VCW A;  2JAD A;  3TJF A;  5CO3 A;  1SL1 B;  1I9D A;  5G5F A;  4YAV A;  1SKR B;  4GCI A;  3EU3 A;  2VL2 A;  4KB3 A;  3CRU A;  4EDY A;  2VOC A;  5COH A;  2A2S A;  1U3I A;  2UZ8 A;  5ECS A;  2HI7 A;  1TKD B;  4D73 A;  3GX0 A;  2H76 A;  3DVX A;  2KOK A;  5CRE A;  1ABA A;  4OO5 A;  2VL9 A;  5D9T A;  2OBI A;  2YNX A;  3A5I A;  5IMZ A;  4ACS A;  1T8E B;  4ML1 A;  2PMT A;  1K3L A;  2KLX A;  2ZUP A;  1A2M A;  2A2P A;  1TOF A;  4K7I A;  2H0H A;  3V1W A;  5C00 A;  5IIZ A;  4O5U A;  1M7T A;  3HVN A;  20GS A;  1ON4 A;  4KDU A;  4IBP A;  3KM6 A;  2WCI A;  1K0B A;  4NAX A;  4MAB A;  4XRA A;  1R7H A;  4OMV A;  1QGV A;  4XS4 B;  3I6A A;  4BVX A;  2C1Y A;  2VD1 A;  3ZIT A;  1UN2 A;  2LTK A;  2LQQ A;  3GMF A;  3EYT A;  2FY6 A;  4JU5 A;  2H1B A;  2V41 A;  2CZ3 A;  5DAK A;  2LS5 A;  2IFQ A;  12GS A;  3F63 A;  3VPT A;  1BG5 A;  4NMU A;  2R3X A;  2TIR A;  4POK A;  4Q5Q A;  4WET A;  3O76 A;  3U6V A;  3KTL A;  1TK5 B;  3FRC A;  4BIK A;  2H1A A;  1XOA A;  3KMN A;  4G0I A;  1WWJ A;  3FR6 A;  5EPF A;  1XWB A;  3QFA C;  2F51 A;  3KGK A;  2PGT A;  4JBB A;  3LXZ A;  1WOU A;  4O5Q A;  1R5P A;  2P31 A;  3ZLP A;  5IM9 A;  1G7E A;  4ECI A;  3TKS A;  1C72 A;  2GZZ A;  1XWC A;  1AQX A;  1TRS A;  1GL8 A;  1U87 A;  4MCU A;  1OAZ A;  2YV7 A;  2GGT A;  1B48 A;  4F0B A;  1B4Q A;  1U88 A;  4MLY A;  1K3Y A;  3A2W A;  1ZOF A;  3ZVJ A;  4L0W A;  2XC2 A;  3WGX A;  3RBT A;  4TRX A;  3UAP A;  5IMF A;  5GAP D;  5ABR A;  5IQY A;  1PKW A;  1EZK A;  3TCO A;  4Z2U A;  1EV9 A;  2QKE A;  4D73 B;  5AIV A;  2YJH A;  5ECL B;  2VCV A;  5AIX A;  1O7U A;  2KHP A;  2FLS A;  1HQO A;  1F37 A;  1YKC A;  3KEB A;  4EC0 A;  4TR1 A;  1Y25 A;  2VL2 C;  5IPG A;  5D93 A;  2XBQ A;  4A5P A;  3LOR A;  3DKS A;  4PQI A;  1Z7P A;  1UA5 A;  3IA1 A;  3G7J A;  3LEF A;  5D96 A;  3UVH A;  1WIK A;  1QMV A;  3IBH A;  2YWN A;  3I9V 2;  2WGR A;  3RPN A;  2MBT A;  2GT5 A;  1GWC A;  1TDI A;  3ZTL A;  5DVB A;  5J4U A;  3QDN A;  6GSV A;  3QD9 A;  3GSS A;  4YQM A;  1TK0 B;  5DJL A;  4HZ4 A;  4PNG A;  1K0D A;  4K2D A;  2G0F A;  2X8H A;  1XPV A;  3D22 A;  2AB6 A;  4KA0 A;  1GTB A;  4I8B A;  2KP1 A;  3DRN A;  5A4V A;  3TJJ A;  5JCU A;  2CV4 A;  6GSX A;  4MZB A;  4CHS A;  5DAK B;  1F6M C;  2I1U A;  2L6D A;  2IFQ B;  5EVO A;  2L5O A;  2GT6 A;  1MD3 A;  1ZYE A;  4WR5 A;  5G2Z A;  3OR5 A;  4P3Y B;  3HZ4 A;  3H1N A;  1XVQ A;  3TOU A;  4K8M A;  1YF1 A;  1USB A;  2L4C A;  4ID0 A;  2H19 A;  5CYY A;  5C04 A;  1XWA A;  1PN9 A;  3FKF A;  1M9B A;  1DBY A;  2A2R A;  2JAC A;  2LJR A;  2ES7 A;  5DJM A;  1ILO A;  3ZIV A;  6GSS A;  1YJ6 A;  3TRQ A;  2AJQ B;  3EPT A;  4EF0 A;  4TR3 A;  4OFN A;  1X0R A;  2VLU A;  3MWH A;  2B3S A;  4ICY A;  4L8E A;  5DCH A;  4NV5 A;  5CRW A;  2DJJ A;  4Q5F A;  1K0M A;  3HKR A;  3WGD A;  1O85 A;  1FVJ A;  1B9Y C;  3UL3 A;  1YKA A;  2C0G A;  3A5W A;  4ECC A;  4PXO A;  1OC9 B;  4HJ2 A;  3DXB A;  5D9W A;  2FUG 2;  5ECP B;  1SU9 A;  1Q98 A;  1XZO A;  2YJ7 A;  4BPY A;  3Q6O A;  5JWR B;  1FVK A;  8GSS A;  4TR1 B;  2BTO T;  3ISO A;  3G7I A;  3LFL A;  5H5R A;  1FB0 A;  1THX A;  2MMO A;  1HYU A;  1XWG A;  1JZD A;  1X9S B;  2LEG A;  4KCE A;  2I4A A;  3EUR A;  3D0Z A;  1DE2 A;  4DSR A;  1SD9 A;  5J9C A;  5ECM B;  2WJU A;  3F9U A;  2H8L A;  3IDV A;  4K9Z A;  4MNN A;  4KDX A;  2PER A;  1HNC A;  1UC7 A;  4F82 A;  5LCZ A;  2FA4 A;  3QPM A;  2JSY A;  4YKG A;  3VPQ A;  3CYN A;  1H4O A;  2K6V A;  2V6O A;  2PUK C;  1RW1 A;  3MSZ A;  2P0G A;  2NVL A;  1A2L A;  2NTO A;  4PUF C;  2H30 A;  3QAV A;  1XBS A;  3TUE A;  2RUE A;  2R6K A;  2FWE A;  1BED A;  3MAK A;  1KBN A;  3PGT A;  5DBQ A;  1N8J A;  3IV4 A;  2GQL A;  5ID2 B;  3MNG A;  1J9B A;  2GS3 A;  5IMC A;  1WPI A;  3D5J A;  2OKA A;  1FW1 A;  4G9H A;  1MDJ A;  5KN2 A;  1R4W A;  1Z3E A;  5IPH A;  1GSY A;  2AHE A;  3RHC A;  5HR1 A;  4MF6 A;  3N9J A;  2IMF A;  4PUA A;  1GNE A;  2Z9S A;  3DVW A;  2VCT A;  5B8A A;  3UOM A;  2FNO A;  2HT9 A;  1SK0 A;  1GSE A;  2FWF A;  4GRF A;  4ZIL A;  1UVZ A;  1SD8 A;  2F3M A;  4WBJ A;  3VWV A;  4N0Z A;  5F06 A;  4MMM A;  3GH9 A;  5CP1 A;  3IAM 2;  4MDC A;  1JFU A;  1AXD A;  2OAD A;  2F8A A;  2HXK A;  3C1S A;  1EEJ A;  3WD6 A;  1G0T A;  1GNW A;  5GAN D;  2WZ9 A;  3L9V A;  5B7C A;  10GS A;  3TJG A;  2VLT A;  3EU4 A;  2R4V A;  1TRW A;  2N5F A;  3QR6 A;  4IGJ A;  4IJ3 A;  2GLR A;  4IP1 A;  3GYK A;  3GFK A;  3GH6 A;  1F9M A;  3HVV A;  4CY8 A;  3APS A;  1GSU A;  4HQZ A;  1XOB A;  1ST9 A;  2H0I A;  3FZ5 A;  1ERU A;  1AQV A;  4LMV A;  4OFT A;  2H70 A;  13GS A;  2IMI A;  4WR4 A;  2MMZ A;  1XXU A;  5FWG A;  19GS A;  4MF7 A;  1NSW A;  3TDG A;  1O81 A;  2OE0 A;  3UJ1 A;  2B5E A;  3DWV A;  1J08 A;  1DSB A;  4LL1 B;  5J3R A;  1Z7R A;  3F6D A;  1IYI A;  1YDK A;  3IC8 A;  1KNG A;  2I3Y A;  3P8W A;  2K18 A;  4MJB A;  4FH8 A;  4AJ7 A;  3F4T A;  3D6I A;  16GS A;  3W8S A;  4OO4 A;  1ZYP A;  4RQX A;  3HZ8 A;  4XIH A;  4Z7X A;  4MK3 A;  4GLT A;  4L5O A;  1T4Y A;  3HHV A;  1CQH A;  1JLW A;  4X4J A;  5AIS A;  1K0A A;  3KTB A;  2RM6 A;  3GKN A;  3TJB A;  5KN3 A;  1EOH A;  4PUR A;  1O8X A;  4KSM A;  1K0N A;  2HRN A;  3WGE A;  1PMT A;  5J41 A;  2YP6 A;  5IMV A;  4QQ7 A;  4RI7 A;  2I9H A;  4YH2 A;  1GLQ A;  2NPB A;  1TI1 A;  2D2Z A;  3PH9 A;  4XS1 A;  1HD2 A;  1XFL A;  1OVN A;  4IQ1 A;  3LXT A;  5ELA A;  3F4S A;  2O8V B;  2OE1 A;  5HR3 A;  2P5Q A;  4HU9 A;  5KEJ A;  1V40 A;  2JZT A;  4XCS A;  1A2J A;  1G7O A;  1K0O A;  2VIM A;  4G0L A;  2C0E A;  2QA2 A;  1EV4 A;  4IS0 A;  5D9X A;  3ZVJ D;  5CRH A;  6GSW A;  2PU9 C;  3DIE A;  1I5G A;  2AYT A;  1B8X A;  1M2D A;  1K3O A;  1GTA A;  4J57 E;  3A2V A;  4AF2 A;  4KAE A;  1M2B A;  4MZW A;  1EP7 A;  1VF1 A;  2R2J A;  3DML A;  3F3R A;  1FHE A;  5BRT A;  1U6T A;  3L9S A;  3ED3 A;  3DEX A;  4FIW A;  3HY2 A;  4K6X A;  3I43 A;  2DJK A;  1EP8 A;  5HR0 A;  18GS A;  1M3J A;  3GV1 A;  3HJM A;  3GKX A;  3L9U A;  1OC8 A;  5E59 A;  5EL8 A;  3MIX A;  3KIJ A;  4IKH A;  1T3B A;  1WE0 A;  5CRG A;  2MMN A;  4PQH A;  2PBJ A;  2QSI A;  4XTS A;  1EGR A;  3IHG A;  1FG4 A;  2X8C A;  4Z2T A;  3BJ5 A;  5A4W A;  3QMX A;  3ZRD A;  1QK8 A;  3M8N A;  4ML6 A;  3TKS E;  3US3 A;  2OJL A;  4AJ6 A;  2C4J A;  1ZGN A;  4IQA A;  1SKW B;  2DMM A;  1W89 A;  3W6G A;  2E0Q A;  2FA8 A;  2L57 A;  4MH3 A;  4NHZ A;  2GST A;  4EUY A;  4ZBB A;  3CMI A;  4RUV A;  3KZQ A;  1X5E A;  3GNJ A;  4K7N A;  3BD2 A;  5EY6 A;  3CSI A;  1HNA A;  2YWO A;  4ZL9 A;  3J7Y k;  4I97 A;  2AAW A;  4HSC X;  5IO0 A;  3AY8 A;  3H8Q A;  1GTI A;  1CQG A;  4KF9 A;  2IL3 A;  1PX7 A;  5GSS A;  4DVC A;  2L59 A;  4XHM A;  1PFO A;  4X1U A;  5FT3 A;  4GST A;  1PN0 A;  3EVI A;  2VD0 A;  3RAZ A;  2CX3 A;  3IR4 A;  1EEM A;  2R5G A;  2C8U A;  2YV9 A;  3VI7 A;  5DDL A;  2CT6 A;  4HDE A;  1OC9 A;  3ERG A;  1OYJ A;  1TI3 A;  2DKI A;  2C80 A;  3BCI A;  4LL4 B;  2B1K A;  4I5Q A;  1RK4 A;  5ECR B;  2DML A;  3KP8 A;  4DSS A;  2GSS A;  1A0R P;  1B4P A;  5BMU A;  3KXO A;  3QOU A;  4TN8 A;  1GUL A;  4ZL8 A;  1VRS D;  2OBK A;  1JZR A;  1OC3 A;  1O73 A;  1RQM A;  1A23 A;  3A2X A;  2HZF A;  1X9W B;  1PRX A;  4TR0 A;  4HI7 A;  3EMX A;  4MF5 A;  4N11 A;  5JCG A;  4N0V A;  3CXG A;  2FWG A;  17GS A;  3M0F A;  2DKH A;  3TJK A;  2ON7 A;  5ELG A;  2XPD A;  2FHE A;  3ZZX A;  1VF4 A;  3IC4 A;  4JRR A;  3IE3 A;  2HSH A;  3VWX A;  5ID2 A;  3ZML A;  2C3Q A;  4KE3 A;  1MD4 A;  2H72 A;  1FOH A;  1Z6M A;  3C1R A;  1TTZ A;  3WT1 A;  4RI6 A;  2J9H A;  1FAA A;  3IXR A;  4BWQ A;  2HNL A;  4HUA A;  1R26 A;  4QL9 A;  1S3C A;  1SYR A;  4WBR D;  1SK1 A;  3ZMK A;  2DIY A;  1ZYN A;  1OE8 A;  2FWH A;  1K0C A;  2PPT A;  2YWM A;  1PQN A;  4ZB6 A;  4J56 E;  1VF2 A;  5F07 A;  2IMD A;  4HOJ A;  1BYE A;  3TRX A;  1A8Y A;  1T7P B;  4F9Z A;  4V2L A;  2VL3 A;  5HFG A;  5IO2 A;  3O6T A;  1M3I A;  1TK8 B;  3ZYW A;  4I2U A;  3GKM A;  4AJ8 A;  2B1L A;  1BJX A;  4O5R A;  4EO3 A;  4TXV A;  3LW9 A;  5J9B A;  1IYH A;  2O85 A;  2XHF A;  1O8W A;  2R0G A;  2R37 A;  2RLI A;  1YEX A;  3MDK A;  1OKT A;  1A0F A;  2DC5 A;  4K7O A;  1SL0 B;  4WKW A;  2M72 A;  3QAW A;  1TW9 A;  2DBC A;  3LGC A;  1SJI A;  3FHK A;  4DSS B;  5GZZ B;  2GZY A;  2H75 A;  1JZW A;  6GSU A;  1A8L A;  4KH7 A;  2LUS A;  2K9F A;  3O3T A;  4Q5R A;  5ECK B;  2IPA A;  3ZIJ A;  5B6M A;  2IWT A;  4OFM A;  4HZ2 A;  2OAC A;  1AUC A;  2EC4 A;  3PPU A;  3F4R A;  4K1F A;  3IPZ A;  2VCQ A;  2CQ9 A;  4USS A;  5FHI A;  2H01 A;  3SWL A;  1XWK A;  2P5R A;  2CVB A;  3C7M A;  1FB6 A;  3P2A A;  1WMJ A;  4ZBD A;  2H66 A;  2B5X A;  4LA1 A;  2KUC A;  4G10 A;  2I81 A;  1XVW A;  3TB2 A;  2GSQ A;  5F05 A;  4V2M A;  1XW6 A;  3D21 A;  1MDK A;  3VUR A;  2MBS A;  3GUR A;  1ERW A;  4ZB8 A;  1Q4J A;  4WEY A;  3DD3 A;  1WJK A;  2WS2 A;  4KSO A;  5ECH B;  5KN0 A;  4N10 A;  5E4W A;  5G5E A;  4YKF A;  4YQU A;  4NV2 A;  2IJY A;  4ULX A;  3LJR A;  1SJ6 A;  2X64 A;  2H71 A;  1AW9 A;  2E7P A;  3H4K A;  4ECJ A;  2O89 A;  4H86 A;  2LKU A;  3FR9 A;  3R2Q A;  1OKD A;  2ALB A;  4G19 A;  1GSF A;  5ECO B;  4JED A;  2VUP A;  3RDW A;  2ON5 A;  3GL3 A;  2TRC P;  4KW6 A;  1EOG A;  2WDU A;  2H1D A;  3ZFL A;  1GTU A;  1WP0 A;  2H73 A;  1YZX A;  3IHQ A;  3IK7 A;  4ECB A;  2IME A;  3VI5 A;  2HFD A;  4O92 A;  5ENU A;  5GST A;  3FZA A;  1TJD A;  1V98 A;  4G2E A;  4KND A;  2B7J A;  1X5D A;  1M2A A;  2MZC A;  3CSJ A;  2CAI A;  2XBI A;  2LJK A;  4Z2R A;  5IOX A;  3BOA A;  2HRK A;  4J2F A;  5D73 A;  2VM1 A;  4BL7 A;  4EIP A;  1GUK A;  3TKP A;  2JZS A;  1GRX A;  2CVK A;  1OE7 A;  4IW9 A;  2FCH A;  2F9S A;  2J23 A;  1XW5 A;  2ZCT A;  3U5R E;  4NWY A;  2FGX A;  2C0F A;  4CW9 A;  5L71 A;  3KP9 A;  1Z9H A;  2AUV A;  2YPM A;  3UBK A;  2CZ2 A;  3FY7 A;  5CRD A;  4PX1 A;  3GTU A;  5G1L A;  5DCG A;  5G1K A;  3WYW A;  4WF5 A;  2YZH A;  2GSR A;  2GQK A;  4HJM A;  22GS A;  1TXX A;  1E2Y A;  3JCM L;  3E9J B;  2H74 A;  3RHB A;  1AIU A;  3Q18 A;  4XRD A;  1E6B A;  1TU8 A;  2REM A;  3H93 A;  4CDO A;  5HFK A;  2X99 A;  2EIQ A;  3L0H A;  2VLV A;  5LD0 A;  2DJ2 A;  4NHW A;  2X4A A;  1U3A A;  3IAS 2;  1O6J A;  3C71 A;  4POB A;  3E0U A;  3NIV A;  3HCZ A;  4ZBA A;  4MJC A;  3CBU A;  1NM3 A;  1X5C A;  2V1M A;  3ME8 A;  5A5K A;  3QFB C;  4XS6 A;  2IMK A;  4NXI A;  14GS A;  2YOI A;  4GF0 A;  2HRF A;  3UAR A;  1JZO A;  1F3A A;  2X49 A;  3MYD A;  3FK8 A;  4KCA A;  2L6C A;  11GS A;  4F2I A;  3NOF A;  5HR2 A;  4CY6 A;  1G6Y A;  1ERV A;  2RM5 A;  4KGI A;  2HE3 A;  3ZFB A;  3TGZ A;  6GSY A;  3Q19 A;  4BL7 B;  5B8B A;  3GL5 A;  3C8E A;  4MJA A;  3TKQ A;  3FW2 A;  3LYP A;  4HS1 A;  3RPP A;  3CTF A;  3HA9 A;  1GSQ A;  3NZN A;  4K0N A;  1PKZ A;  3M3M A;  1WRY A;  5KOX A;  1PL1 A;  2C3N A;  1GSD A;  4FYB A;  9GSS A;  4OD7 A;  1G6W A;  4MJE A;  5DQS A;  5JWO B;  4X43 A;  3WT2 A;  2AV4 A;  1VF3 A;  4NPB A;  2C0D A;  3E3E A;  3P90 A;  3GTU B;  3HXS A;  3HJO A;  4K0G A;  4V2N A;  1THO A;  2A4H A;  3KH9 A;  3LYK A;  1GLP A;  3W8J A;  3PR8 A;  4IHU A;  4MZC A;  3FMW A;  1B9X C;  1GP1 A;  3ERW A;  1XCC A;  1VGL A;  2GQM A;  2IN3 A;  5ECQ B;  5AN1 A;  2CAQ A;  3GKK A;  3F0I A;  5J5N A;  3ME7 A;  4LMW A;  2VCZ A;  4KX4 A;  3UIW A;  2PVO C;  3HVX A;  5JCW A;  1LBK A;  5G30 A;  2GTU A;  3EWL A;  5KN1 A;  2JSZ A;  5H5S A;  5KOW A;  1PL2 A;  3DGQ A;  1H75 A;  3HDC A;  4TKY A;  4V1A g;  1V2A A;  4K2X A;  4EE0 A;  1PSQ A;  3KCM A;  4POM A;  3M1G A;  3L78 A;  2DJ3 A;  4JE1 A;  4GQC A;  4HQS A;  4DEJ A;  2LST A;  2EIO A;  2LRT A;  5ECN B;  1EGO A;  2YAN A;  1T4Z A;  3F6F A;  4TW5 A;  1F3B A;  2C3T A;  2FD3 A;  5HQP A;  3K8N A;  3LG6 A;  4N30 A;  1GSS A;  5A4U A;  3J7Y b;  2RUF A;  2G2Q A;  3C73 A;  2DJ0 A;  3EMP A;  4TR4 A;  1R5A A;  4KUN A;  1TRV A;  3QCP A;  2MMA A;  2LRN A;  1F2E A;  4QL7 A;  3GUS A;  3IOS A;  2H0G A;  4BWS A;  3FZ9 A;  2QC7 A;  3M9J A;  3UMA A;  2CX4 A;  3APO A;  4EXJ A;  4EKZ A;  1PX6 A;  1GH2 A;  2VAF A;  2YWI A;  1XIY A;  3A3T A;  2N5A A;  4WF4 A;  5AGY A;  4TXO A;  2TRX A;  4ZL7 A; 
#chains in the Genus database with same CATH homology
 2LQO A;  5H5Q A;  7GSS A;  3UEM A;  1ZZY A;  5IOW A;  2L5L A;  4BVX B;  2N5B A;  4OWY A;  1M99 A;  4G0K A;  2DJ1 A;  4TVE A;  2E2G A;  1AC1 A;  2JL4 A;  2HSM A;  4PGT A;  4K5S A;  4ILF A;  4IEL A;  2MYG A;  2CA8 A;  1MTC A;  3GRX A;  4GSS A;  3EE2 A;  2DSA A;  1V57 A;  2JZR A;  2LRC A;  2QA1 A;  4ZXG A;  2H6Z A;  5D8I A;  2H1G A;  3SBC A;  2V32 A;  4E8E A;  4RQR A;  5CNW A;  3KJY A;  1A24 A;  1FOV A;  3H79 A;  3TKR A;  1YY7 A;  2GZP A;  3UBL A;  2OA7 A;  2WRT A;  3S9F A;  4GXZ A;  5ECI B;  1TP9 A;  1GUH A;  1MDI A;  1T00 A;  2CVD A;  4TOP A;  4V1A p;  5DAL A;  3TKS C;  3FYG A;  2NDO A;  6GST A;  3LQ7 A;  4OCE A;  1YF0 A;  1PA3 A;  3R3E A;  4MH2 A;  2H6X A;  3D4T A;  1DUG A;  3TOT A;  1EWX A;  2F8F A;  2OE3 A;  4MPF A;  4DSQ A;  3LWA A;  5F0G A;  3M9K A;  4FO5 A;  1JLV A;  4BA7 A;  3BCK A;  1DE1 A;  4I6X A;  5F8B A;  4JZQ A;  1YEP A;  1LU4 A;  3BBY A;  5IMD A;  1Z5Y E;  1SKS B;  4IP6 A;  3HVS A;  3QAG A;  3CTG A;  2O87 A;  2YN1 A;  1ACV A;  1FO5 A;  3VFI A;  1J0F A;  4EIQ A;  3IK9 A;  4WXT A;  1MEK A;  3GA4 A;  2PN8 A;  1Z6N A;  4AGS A;  2WFC A;  4TXO B;  2VCX A;  4EDZ A;  2LJA A;  4F03 A;  1S3A A;  1TRU A;  4EVM A;  1NHO A;  3KH7 A;  1X9M B;  2H6Y A;  1BAY A;  3VWW A;  2VM2 A;  4FQU A;  2NBS A;  1QXH A;  1XW9 A;  4MA9 A;  4OCF A;  3ZRE A;  1ZCP A;  2V6K A;  4HEA 2;  2M80 A;  1Y6E A;  3PIN A;  2JU5 A;  3KMO A;  4BVY A;  1PD2 1;  2HZE A;  4FYC A;  4PNF A;  1ZL9 A;  2QGV A;  1BQ7 A;  1GUM A;  1JHB A;  5G31 A;  1TU7 A;  1SEN A;  2R0P A;  5CAX A;  1YQ1 A;  4EL1 A;  4KDY A;  2R0C A;  2K8S A;  3HD5 A;  4MPG A;  3LSZ A;  4GQF A;  4PQ1 A;  3KD0 A;  1M9A A;  3GST A;  4F0C A;  5LNK e;  4Q5N A;  4IJI A;  1ERT A;  3L4N A;  4POL A;  3P7X A;  2X8G A;  4L5L A;  1SYX A;  3ERF A;  1ZYQ B;  2DIZ A;  3VWU A;  2BJX A;  2O7K A;  4L0U A;  5DAL B;  3IRA A;  2BMX A;  1ZMA A;  4X0X A;  2GDR A;  1SL2 B;  1W4V A;  2YZU A;  2GVP A;  2B6M A;  1M0U A;  2WB9 A;  2IIY A;  2XPE A;  3FEU A;  2LNT A;  2LV3 A;  1BX9 A;  5JWQ B;  3FR3 A;  1LJR A;  5D9V A;  3GN3 A;  1HNB A;  1AQW A;  2A4V A;  1SJZ A;  1NHY A;  1SK2 A;  2M46 A;  3I69 A;  4GSN A;  4O32 A;  4K5R A;  2EIR A;  1T1V A;  1S3D A;  3N5O A;  3F3Q A;  3TRP A;  4XS4 A;  4GWR A;  2HSY A;  2HLS A;  3HJP A;  5INY A;  5B6N A;  2VO4 A;  1KEB A;  3APQ A;  2KP2 A;  3CRT A;  1N2A A;  1ML6 A;  3D4M A;  2E2M A;  3G9B A;  3GHA A;  4JR4 A;  2HRA A;  2LNS A;  4IN0 A;  3DYR A;  1QUW A;  3VK9 A;  3ZL5 A;  3EIN A;  2V2G A;  1QFN A;  1PGT A;  3EC3 A;  1QQ2 A;  2B5Y A;  2DLX A;  2PWJ A;  1NW2 A;  3Q74 A;  2L4Q A;  3HYP A;  1AAZ A;  2ZNM A;  3F8U A;  1V58 A;  4BVY B;  1URM A;  5IMA A;  2HZE B;  3VLN A;  4I2T A;  2RII A;  1V9W A;  4JR6 A;  4PTS A;  4YQV A;  2K8V A;  4ZB9 A;  4O7H A;  4GTU A;  2B7K A;  5HFI A;  4E8H A;  3CSH A;  2WUL A;  4IVF A;  4LLR A;  3FZ4 A;  4HU7 A;  4ISD A;  4ZIJ A;  2YCD A;  4FYU A;  3GIX A;  4YAP A;  5DQY A;  4MP4 A;  3GX8 A;  1KTE A;  2PVQ A;  3UVT A;  3G7Y A;  2HYX A;  2VCW A;  2JAD A;  3TJF A;  5CO3 A;  1SL1 B;  1I9D A;  5G5F A;  4YAV A;  1SKR B;  4GCI A;  3EU3 A;  2VL2 A;  4KB3 A;  3CRU A;  4EDY A;  2VOC A;  5COH A;  2A2S A;  1U3I A;  2UZ8 A;  5ECS A;  2HI7 A;  1TKD B;  4D73 A;  3GX0 A;  2H76 A;  3DVX A;  2KOK A;  5CRE A;  1ABA A;  4OO5 A;  2VL9 A;  5D9T A;  2OBI A;  2YNX A;  3A5I A;  5IMZ A;  4ACS A;  1T8E B;  4ML1 A;  2PMT A;  1K3L A;  2KLX A;  2ZUP A;  1A2M A;  2A2P A;  1TOF A;  4K7I A;  2H0H A;  3V1W A;  5C00 A;  5IIZ A;  4O5U A;  1M7T A;  20GS A;  1ON4 A;  4KDU A;  4IBP A;  3KM6 A;  2WCI A;  1K0B A;  4NAX A;  4MAB A;  4XRA A;  1R7H A;  4OMV A;  1QGV A;  4XS4 B;  3I6A A;  4BVX A;  2C1Y A;  2VD1 A;  3ZIT A;  1UN2 A;  2LTK A;  2LQQ A;  3GMF A;  3EYT A;  2FY6 A;  4JU5 A;  2H1B A;  2V41 A;  2CZ3 A;  5DAK A;  2LS5 A;  2IFQ A;  12GS A;  3F63 A;  3VPT A;  1BG5 A;  4NMU A;  2R3X A;  2TIR A;  4POK A;  4Q5Q A;  4WET A;  3O76 A;  3U6V A;  3KTL A;  1TK5 B;  3FRC A;  2H1A A;  1XOA A;  3KMN A;  4G0I A;  1WWJ A;  3FR6 A;  5EPF A;  1XWB A;  3QFA C;  2F51 A;  3KGK A;  2PGT A;  4JBB A;  3LXZ A;  1WOU A;  4O5Q A;  1R5P A;  2P31 A;  3ZLP A;  5IM9 A;  1G7E A;  4ECI A;  3TKS A;  1C72 A;  2GZZ A;  1XWC A;  1AQX A;  1TRS A;  1GL8 A;  1U87 A;  4MCU A;  1OAZ A;  2YV7 A;  2GGT A;  1B48 A;  4F0B A;  1B4Q A;  1U88 A;  4MLY A;  1K3Y A;  3A2W A;  1ZOF A;  3ZVJ A;  4L0W A;  2XC2 A;  3WGX A;  3RBT A;  4TRX A;  3UAP A;  5IMF A;  5GAP D;  5ABR A;  5IQY A;  1PKW A;  1EZK A;  3TCO A;  4Z2U A;  1EV9 A;  2QKE A;  4D73 B;  5AIV A;  2YJH A;  5ECL B;  2VCV A;  5AIX A;  1O7U A;  2KHP A;  2FLS A;  1HQO A;  1F37 A;  1YKC A;  3KEB A;  4EC0 A;  4TR1 A;  1Y25 A;  2VL2 C;  5IPG A;  5D93 A;  2XBQ A;  4A5P A;  3LOR A;  3DKS A;  4PQI A;  1Z7P A;  1UA5 A;  3IA1 A;  3G7J A;  3LEF A;  5D96 A;  3UVH A;  1WIK A;  1QMV A;  3IBH A;  2YWN A;  3I9V 2;  2WGR A;  3RPN A;  2MBT A;  2GT5 A;  1GWC A;  1TDI A;  3ZTL A;  5DVB A;  5J4U A;  3QDN A;  6GSV A;  3QD9 A;  3GSS A;  4YQM A;  1TK0 B;  5DJL A;  4HZ4 A;  4PNG A;  1K0D A;  4K2D A;  2G0F A;  2X8H A;  1XPV A;  3D22 A;  2AB6 A;  4KA0 A;  1GTB A;  4I8B A;  2KP1 A;  3DRN A;  5A4V A;  3TJJ A;  5JCU A;  2CV4 A;  6GSX A;  4MZB A;  4CHS A;  5DAK B;  1F6M C;  2I1U A;  2L6D A;  2IFQ B;  5EVO A;  2L5O A;  2GT6 A;  1MD3 A;  1ZYE A;  4WR5 A;  5G2Z A;  3OR5 A;  4P3Y B;  3HZ4 A;  3H1N A;  1XVQ A;  3TOU A;  4K8M A;  1YF1 A;  1USB A;  2L4C A;  4ID0 A;  2H19 A;  5CYY A;  5C04 A;  1XWA A;  1PN9 A;  3FKF A;  1M9B A;  1DBY A;  2A2R A;  2JAC A;  2LJR A;  2ES7 A;  5DJM A;  1ILO A;  3ZIV A;  6GSS A;  1YJ6 A;  3TRQ A;  2AJQ B;  3EPT A;  4EF0 A;  4TR3 A;  4OFN A;  1X0R A;  2VLU A;  3MWH A;  2B3S A;  4ICY A;  4L8E A;  5DCH A;  4NV5 A;  5CRW A;  2DJJ A;  4Q5F A;  1K0M A;  3HKR A;  3WGD A;  1O85 A;  1FVJ A;  1B9Y C;  3UL3 A;  1YKA A;  2C0G A;  3A5W A;  4ECC A;  4PXO A;  1OC9 B;  4HJ2 A;  3DXB A;  5D9W A;  2FUG 2;  5ECP B;  1SU9 A;  1Q98 A;  1XZO A;  2YJ7 A;  4BPY A;  3Q6O A;  5JWR B;  1FVK A;  8GSS A;  4TR1 B;  2BTO T;  3ISO A;  3G7I A;  3LFL A;  5H5R A;  1FB0 A;  1THX A;  2MMO A;  1HYU A;  1XWG A;  1JZD A;  1X9S B;  2LEG A;  4KCE A;  2I4A A;  3EUR A;  3D0Z A;  1DE2 A;  4DSR A;  1SD9 A;  5J9C A;  5ECM B;  2WJU A;  3F9U A;  2H8L A;  3IDV A;  4K9Z A;  4MNN A;  4KDX A;  2PER A;  1HNC A;  1UC7 A;  4F82 A;  5LCZ A;  2FA4 A;  3QPM A;  2JSY A;  4YKG A;  3VPQ A;  3CYN A;  1H4O A;  2K6V A;  2V6O A;  2PUK C;  1RW1 A;  3MSZ A;  2P0G A;  2NVL A;  1A2L A;  2NTO A;  4PUF C;  2H30 A;  3QAV A;  1XBS A;  3TUE A;  2RUE A;  2R6K A;  2FWE A;  1BED A;  3MAK A;  1KBN A;  3PGT A;  5DBQ A;  1N8J A;  3IV4 A;  2GQL A;  5ID2 B;  3MNG A;  1J9B A;  2GS3 A;  5IMC A;  1WPI A;  3D5J A;  2OKA A;  1FW1 A;  4G9H A;  1MDJ A;  5KN2 A;  1R4W A;  1Z3E A;  5IPH A;  1GSY A;  2AHE A;  3RHC A;  5HR1 A;  4MF6 A;  3N9J A;  2IMF A;  4PUA A;  1GNE A;  2Z9S A;  3DVW A;  2VCT A;  5B8A A;  3UOM A;  2FNO A;  2HT9 A;  1SK0 A;  1GSE A;  2FWF A;  4GRF A;  4ZIL A;  1UVZ A;  1SD8 A;  2F3M A;  4WBJ A;  3VWV A;  4N0Z A;  5F06 A;  4MMM A;  3GH9 A;  5CP1 A;  3IAM 2;  4MDC A;  1JFU A;  1AXD A;  2OAD A;  2F8A A;  2HXK A;  3C1S A;  1EEJ A;  3WD6 A;  1G0T A;  1GNW A;  5GAN D;  2WZ9 A;  3L9V A;  5B7C A;  10GS A;  3TJG A;  2VLT A;  3EU4 A;  2R4V A;  1TRW A;  2N5F A;  3QR6 A;  4IGJ A;  4IJ3 A;  2GLR A;  4IP1 A;  3GYK A;  3GFK A;  3GH6 A;  1F9M A;  3HVV A;  4CY8 A;  3APS A;  1GSU A;  4HQZ A;  1XOB A;  1ST9 A;  2H0I A;  3FZ5 A;  1ERU A;  1AQV A;  4LMV A;  4OFT A;  2H70 A;  13GS A;  2IMI A;  4WR4 A;  2MMZ A;  1XXU A;  5FWG A;  19GS A;  4MF7 A;  1NSW A;  3TDG A;  1O81 A;  2OE0 A;  3UJ1 A;  2B5E A;  3DWV A;  1J08 A;  1DSB A;  4LL1 B;  5J3R A;  1Z7R A;  3F6D A;  1IYI A;  1YDK A;  3IC8 A;  1KNG A;  2I3Y A;  3P8W A;  2K18 A;  4MJB A;  4FH8 A;  4AJ7 A;  3F4T A;  3D6I A;  16GS A;  3W8S A;  4OO4 A;  1ZYP A;  4RQX A;  3HZ8 A;  4XIH A;  4Z7X A;  4MK3 A;  4GLT A;  4L5O A;  1T4Y A;  3HHV A;  1CQH A;  1JLW A;  4X4J A;  5AIS A;  1K0A A;  3KTB A;  2RM6 A;  3GKN A;  3TJB A;  5KN3 A;  1EOH A;  4PUR A;  1O8X A;  4KSM A;  1K0N A;  2HRN A;  3WGE A;  1PMT A;  5J41 A;  2YP6 A;  5IMV A;  4QQ7 A;  4RI7 A;  2I9H A;  4YH2 A;  1GLQ A;  2NPB A;  1TI1 A;  2D2Z A;  3PH9 A;  4XS1 A;  1HD2 A;  1XFL A;  1OVN A;  4IQ1 A;  3LXT A;  5ELA A;  3F4S A;  2O8V B;  2OE1 A;  5HR3 A;  2P5Q A;  4HU9 A;  5KEJ A;  1V40 A;  2JZT A;  4XCS A;  1A2J A;  1G7O A;  1K0O A;  2VIM A;  4G0L A;  2C0E A;  2QA2 A;  1EV4 A;  4IS0 A;  5D9X A;  3ZVJ D;  5CRH A;  6GSW A;  2PU9 C;  3DIE A;  1I5G A;  2AYT A;  1B8X A;  1M2D A;  1K3O A;  1GTA A;  4J57 E;  3A2V A;  4AF2 A;  4KAE A;  1M2B A;  4MZW A;  1EP7 A;  1VF1 A;  2R2J A;  3DML A;  3F3R A;  1FHE A;  5BRT A;  1U6T A;  3L9S A;  3ED3 A;  3DEX A;  4FIW A;  3HY2 A;  4K6X A;  3I43 A;  2DJK A;  1EP8 A;  5HR0 A;  18GS A;  3GV1 A;  3HJM A;  3GKX A;  3L9U A;  1OC8 A;  5E59 A;  5EL8 A;  3MIX A;  3KIJ A;  4IKH A;  1T3B A;  1WE0 A;  5CRG A;  2MMN A;  4PQH A;  2PBJ A;  2QSI A;  4XTS A;  1EGR A;  3IHG A;  1FG4 A;  2X8C A;  4Z2T A;  3BJ5 A;  5A4W A;  3QMX A;  3ZRD A;  1QK8 A;  3M8N A;  4ML6 A;  3TKS E;  3US3 A;  2OJL A;  4AJ6 A;  2C4J A;  1ZGN A;  4IQA A;  1SKW B;  2DMM A;  1W89 A;  3W6G A;  2E0Q A;  2FA8 A;  2L57 A;  4MH3 A;  4NHZ A;  2GST A;  4EUY A;  4ZBB A;  3CMI A;  4RUV A;  3KZQ A;  1X5E A;  3GNJ A;  4K7N A;  3BD2 A;  5EY6 A;  3CSI A;  1HNA A;  2YWO A;  4ZL9 A;  3J7Y k;  4I97 A;  2AAW A;  5IO0 A;  3AY8 A;  3H8Q A;  1GTI A;  1CQG A;  4KF9 A;  2IL3 A;  1PX7 A;  5GSS A;  4DVC A;  2L59 A;  4XHM A;  4X1U A;  5FT3 A;  4GST A;  1PN0 A;  3EVI A;  2VD0 A;  3RAZ A;  2CX3 A;  3IR4 A;  1EEM A;  2R5G A;  2C8U A;  2YV9 A;  3VI7 A;  5DDL A;  2CT6 A;  4HDE A;  1OC9 A;  3ERG A;  1OYJ A;  1TI3 A;  2DKI A;  2C80 A;  3BCI A;  4LL4 B;  2B1K A;  4I5Q A;  1RK4 A;  5ECR B;  2DML A;  3KP8 A;  4DSS A;  2GSS A;  1A0R P;  1B4P A;  5BMU A;  3KXO A;  3QOU A;  4TN8 A;  1GUL A;  4ZL8 A;  1VRS D;  2OBK A;  1JZR A;  1OC3 A;  1O73 A;  1RQM A;  1A23 A;  3A2X A;  2HZF A;  1X9W B;  1PRX A;  4TR0 A;  4HI7 A;  3EMX A;  4MF5 A;  4N11 A;  5JCG A;  4N0V A;  3CXG A;  2FWG A;  17GS A;  3M0F A;  2DKH A;  3TJK A;  2ON7 A;  5ELG A;  2XPD A;  2FHE A;  3ZZX A;  1VF4 A;  3IC4 A;  4JRR A;  3IE3 A;  2HSH A;  3VWX A;  5ID2 A;  3ZML A;  2C3Q A;  4KE3 A;  1MD4 A;  2H72 A;  1FOH A;  1Z6M A;  3C1R A;  1TTZ A;  3WT1 A;  4RI6 A;  2J9H A;  1FAA A;  3IXR A;  4BWQ A;  2HNL A;  4HUA A;  1R26 A;  4QL9 A;  1S3C A;  1SYR A;  4WBR D;  1SK1 A;  3ZMK A;  2DIY A;  1ZYN A;  1OE8 A;  2FWH A;  1K0C A;  2PPT A;  2YWM A;  1PQN A;  4ZB6 A;  4J56 E;  1VF2 A;  5F07 A;  2IMD A;  4HOJ A;  1BYE A;  3TRX A;  1A8Y A;  1T7P B;  4F9Z A;  4V2L A;  2VL3 A;  5HFG A;  5IO2 A;  3O6T A;  1TK8 B;  3ZYW A;  4I2U A;  3GKM A;  4AJ8 A;  2B1L A;  1BJX A;  4O5R A;  4EO3 A;  4TXV A;  3LW9 A;  5J9B A;  1IYH A;  2O85 A;  2XHF A;  1O8W A;  2R0G A;  2R37 A;  2RLI A;  1YEX A;  3MDK A;  1OKT A;  1A0F A;  2DC5 A;  4K7O A;  1SL0 B;  4WKW A;  2M72 A;  3QAW A;  1TW9 A;  2DBC A;  3LGC A;  1SJI A;  3FHK A;  4DSS B;  5GZZ B;  2GZY A;  2H75 A;  1JZW A;  6GSU A;  1A8L A;  4KH7 A;  2LUS A;  2K9F A;  3O3T A;  4Q5R A;  5ECK B;  2IPA A;  3ZIJ A;  5B6M A;  2IWT A;  4OFM A;  4HZ2 A;  2OAC A;  1AUC A;  2EC4 A;  3PPU A;  3F4R A;  4K1F A;  3IPZ A;  2VCQ A;  2CQ9 A;  4USS A;  5FHI A;  2H01 A;  3SWL A;  1XWK A;  2P5R A;  2CVB A;  3C7M A;  1FB6 A;  3P2A A;  1WMJ A;  4ZBD A;  2H66 A;  2B5X A;  4LA1 A;  2KUC A;  4G10 A;  2I81 A;  1XVW A;  3TB2 A;  2GSQ A;  5F05 A;  4V2M A;  1XW6 A;  3D21 A;  1MDK A;  3VUR A;  2MBS A;  3GUR A;  1ERW A;  4ZB8 A;  1Q4J A;  4WEY A;  3DD3 A;  1WJK A;  2WS2 A;  4KSO A;  5ECH B;  5KN0 A;  4N10 A;  5E4W A;  5G5E A;  4YKF A;  4YQU A;  4NV2 A;  2IJY A;  4ULX A;  3LJR A;  1SJ6 A;  2X64 A;  2H71 A;  1AW9 A;  2E7P A;  3H4K A;  4ECJ A;  2O89 A;  4H86 A;  2LKU A;  3FR9 A;  3R2Q A;  1OKD A;  2ALB A;  4G19 A;  1GSF A;  5ECO B;  4JED A;  2VUP A;  3RDW A;  2ON5 A;  3GL3 A;  2TRC P;  4KW6 A;  1EOG A;  2WDU A;  2H1D A;  3ZFL A;  1GTU A;  1WP0 A;  2H73 A;  1YZX A;  3IHQ A;  3IK7 A;  4ECB A;  2IME A;  3VI5 A;  2HFD A;  4O92 A;  5ENU A;  5GST A;  3FZA A;  1TJD A;  1V98 A;  4G2E A;  4KND A;  2B7J A;  1X5D A;  1M2A A;  2MZC A;  3CSJ A;  2CAI A;  2XBI A;  2LJK A;  4Z2R A;  5IOX A;  3BOA A;  2HRK A;  4J2F A;  5D73 A;  2VM1 A;  4BL7 A;  4EIP A;  1GUK A;  3TKP A;  2JZS A;  1GRX A;  2CVK A;  1OE7 A;  4IW9 A;  2FCH A;  2F9S A;  2J23 A;  1XW5 A;  2ZCT A;  3U5R E;  4NWY A;  2FGX A;  2C0F A;  4CW9 A;  5L71 A;  3KP9 A;  1Z9H A;  2AUV A;  2YPM A;  3UBK A;  2CZ2 A;  3FY7 A;  5CRD A;  4PX1 A;  3GTU A;  5G1L A;  5DCG A;  5G1K A;  3WYW A;  4WF5 A;  2YZH A;  2GSR A;  2GQK A;  4HJM A;  22GS A;  1TXX A;  1E2Y A;  3JCM L;  3E9J B;  2H74 A;  3RHB A;  1AIU A;  3Q18 A;  4XRD A;  1E6B A;  1TU8 A;  2REM A;  3H93 A;  4CDO A;  5HFK A;  2X99 A;  2EIQ A;  3L0H A;  2VLV A;  5LD0 A;  2DJ2 A;  4NHW A;  2X4A A;  1U3A A;  3IAS 2;  1O6J A;  3C71 A;  4POB A;  3E0U A;  3NIV A;  3HCZ A;  4ZBA A;  4MJC A;  3CBU A;  1NM3 A;  1X5C A;  2V1M A;  3ME8 A;  5A5K A;  3QFB C;  4XS6 A;  2IMK A;  4NXI A;  14GS A;  2YOI A;  4GF0 A;  2HRF A;  3UAR A;  1JZO A;  1F3A A;  2X49 A;  3MYD A;  3FK8 A;  4KCA A;  2L6C A;  11GS A;  4F2I A;  3NOF A;  5HR2 A;  4CY6 A;  1G6Y A;  1ERV A;  2RM5 A;  4KGI A;  2HE3 A;  3ZFB A;  3TGZ A;  6GSY A;  3Q19 A;  4BL7 B;  5B8B A;  3GL5 A;  3C8E A;  4MJA A;  3TKQ A;  3FW2 A;  3LYP A;  4HS1 A;  3RPP A;  3CTF A;  3HA9 A;  1GSQ A;  3NZN A;  4K0N A;  1PKZ A;  3M3M A;  1WRY A;  5KOX A;  1PL1 A;  2C3N A;  1GSD A;  4FYB A;  9GSS A;  4OD7 A;  1G6W A;  4MJE A;  5DQS A;  5JWO B;  4X43 A;  3WT2 A;  2AV4 A;  1VF3 A;  4NPB A;  2C0D A;  3E3E A;  3P90 A;  3GTU B;  3HXS A;  3HJO A;  4K0G A;  4V2N A;  1THO A;  2A4H A;  3KH9 A;  3LYK A;  1GLP A;  3W8J A;  3PR8 A;  4IHU A;  4MZC A;  3FMW A;  1B9X C;  1GP1 A;  3ERW A;  1XCC A;  1VGL A;  2GQM A;  2IN3 A;  5ECQ B;  5AN1 A;  2CAQ A;  3GKK A;  3F0I A;  5J5N A;  3ME7 A;  4LMW A;  2VCZ A;  4KX4 A;  3UIW A;  2PVO C;  3HVX A;  5JCW A;  1LBK A;  5G30 A;  2GTU A;  3EWL A;  5KN1 A;  2JSZ A;  5H5S A;  5KOW A;  1PL2 A;  3DGQ A;  1H75 A;  3HDC A;  4TKY A;  4V1A g;  1V2A A;  4K2X A;  4EE0 A;  1PSQ A;  3KCM A;  4POM A;  3M1G A;  3L78 A;  2DJ3 A;  4JE1 A;  4GQC A;  4HQS A;  4DEJ A;  2LST A;  2EIO A;  2LRT A;  5ECN B;  1EGO A;  2YAN A;  1T4Z A;  3F6F A;  4TW5 A;  1F3B A;  2C3T A;  2FD3 A;  5HQP A;  3K8N A;  3LG6 A;  4N30 A;  1GSS A;  5A4U A;  3J7Y b;  2RUF A;  2G2Q A;  3C73 A;  2DJ0 A;  3EMP A;  4TR4 A;  1R5A A;  4KUN A;  1TRV A;  3QCP A;  2MMA A;  2LRN A;  1F2E A;  4QL7 A;  3GUS A;  3IOS A;  2H0G A;  4BWS A;  3FZ9 A;  2QC7 A;  3M9J A;  3UMA A;  2CX4 A;  3APO A;  4EXJ A;  4EKZ A;  1PX6 A;  1GH2 A;  2VAF A;  2YWI A;  1XIY A;  3A3T A;  2N5A A;  4WF4 A;  5AGY A;  4TXO A;  2TRX A;  4ZL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...