1PTHA

The structural basis of aspirin activity inferred from the crystal structure of inactivated prostaglandin h2 synthase
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
551
structure length
550
Chain Sequence
VNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structural basis of aspirin activity inferred from the crystal structure of inactivated prostaglandin H2 synthase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords PROSTAGLANDIN H2 SYNTHASE-1
total genus 183
structure length 550
sequence length 551
chains with identical sequence B
ec nomenclature ec 1.14.99.1: Prostaglandin-endoperoxide synthase.
pdb deposition date 1995-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF03098 An_peroxidase Animal haem peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.640.10 Mainly Alpha Orthogonal Bundle Myeloperoxidase, subunit C Haem peroxidase domain superfamily, animal type 1pthA02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1pthA01
2ADXA 3NTBA 4RRWA 3KL6B 2P95L 3QCWA 1DVAL 3R55A 5JVZA 5L30L 3P5BL 2I9AA 3UBAA 3TZIA 2W3KB 2WPKE 3DEMA 1ATEA 1G2LB 1TPGA 1EBVA 4LORA 4RRYA 1IQML 3ERHA 1YGCL 2PHBB 1N7DA 3SOBB 1APOA 1U8CB 2FZZL 1G1TA 3ENSA 2J2UB 4XLWA 2WG4B 1MQ6L 2J95B 2W2PE 4IG5A 2FLBL 3F6UL 2YGPA 1COUA 5COXA 2VWOL 4A7IA 3OLTA 2BOUA 3N8XA 1IQHL 3IJEB 2UWLB 4D0FA 1B9WA 2XC5L 1IP0A 5KN5C 1AUTL 1Z6CA 3V64C 1CEJA 2TGFA 4XL1A 2F9BL 1D2VC 1IOEL 1Q4GA 4QJQA 2GJMA 2P3UA 2WPJE 4CUEA 2VVVL 3TH3L 2YGOA 1HZ8A 1NFUB 4CSYA 1PGEA 2MHPA 1F0SB 4NT3A 4RRXA 4KSZA 2Y82B 4Y55A 5IKQA 1FF7A 3KK6A 3SOVA 2B7DL 1EGFA 3U7UG 2EHAA 1ATAA 4Y76B 2UWOB 3R4XA 2W2NE 2W3IB 2AYLA 2BQWA 1DNUC 1IJQA 3POYA 3NTGA 1MYPC 3TGFA 1IGXA 2P3TA 2PUMA 4Z6AL 3HPTA 3U73A 1G1RA 2QQTA 2XBYL 3SW2A 5CKNA 1LPZA 3GISX 4X8UL 4ZHAB 1XKBA 1IQKL 4X8SL 2WPME 4ZXXL 2QRBA 5HPWA 1K36A 3LTGD 2RA0L 1J9CL 3N8VA 1WHFA 3Q3KB 4C1MC 3V6QA 1N1IA 4YZUB 1KLOA 4MMXB 3KRKA 2P16L 4YT7L 3K9XA 5FDQA 4BDWA 4KVLA 2J38B 4O02B 1CCVA 1W7XL 3I6NA 1NT0A 1K37A 5JVYA 5FF1A 4Y7BB 3SXVA 3ZYJB 3ZS0C 1QFKL 4M10A 2BOKL 4Y71B 1LMJA 2Y7XB 1C5MF 2D1JB 4CUFA 5I46L 4RRZA 6COXA 2XBWL 3IITB 2VH0B 1KLIL 2BMGA 1DIYA 4Z0KB 3TGYA 1U67A 4PH9A 3ZYIB 3LTFB 2P26A 2Y38A 2P3FN 1CVUA 1NFXB 5JBBE 1PRHA 2WPLE 3KQCL 2PT3A 4E1GA 5EGMB 1G2MB 1ZAQA 2W86A 5JBAE 2Y5HL 1EQHA 3PY4A 2K2SB 3LN1A 1URKA 3NYHA 3HS6A 3ZS1C 4BTUA 5JB9E 1FSBA 2OJVA 1HRFA 1GK5A 2OYEP 3HO5A 2W2ME 4GN6A 5IKRA 2J34B 4ISHL 4HHSA 1MOXC 1F7EA 5FIWC 1NFWB 1HJ7A 1LPGA 2NPRA 3GCJA 1IQEL 2PUQL 1UZQA 1XKAL 3BXIA 4M11A 2EFBA 5JW1A 1L5GB 3M37L 3R05A 4JZEL 4ZH8B 1FJSL 1TOZA 1UZPA 2VWNL 4PNXA 1IQNL 2BQ7A 2Y80B 3MDLA 4KVKA 1D5LC 4XBMA 1D7WC 3N8ZA 4GM7A 4ZAEB 2P93L 1WHEA 4BTTA 5F1AA 1CCFA 2QPKA 2UWPB 2W26B 3KQBL 1LQDA 3N8YB 4RS0A 2K2TA 2FLGA 1HT8A 2Y81B 3CFWA 4JZFL 2XC4L 4OTYA 2KB9A 2WFXB 2P94L 3LC5B 1A3PA 1EZQB 1FFMA 2KV4A 2M74A 2I9BA 3S4FA 3TK5B 5L2YL 5L2ZL 4JYVL 3FFGL 3QF1A 1APQA 1BF9A 2WPIE 3GC1A 5IKTA 2MGRA 2WG3C 3F9PC 3BPSE 1PTHA 1EMOA 2IPSA 2VVUL 1DQBA 3HS5A 1I0UA 1UZKA 2Y7ZB 1CQEA 5E8DA 1HAFA 1ATDA 2W2QE 1CX2A 4D90A 4AQTA 3GCLA 1JV2B 1HX2A 2VJ3A 3Q7DA 4MMYB 4MMZB 1FAXL 1P0SL 1Z6EL 4FM5A 1G1SA 1F7MA 1HREA 4LMFA 1F0RB 3FNLA 1M1XB 1KLJL 1EQGA 1TLEA 1KSNB 2VWMK 4TGFA 4X8VL 3GCWE 1NQLB 1X7AL 3FAQA 1JBUL 1EPHA 1NPEB 1XDTR 2G00L 2XBXL 3M36L 2NQXA 3N8YA 1DX5I 2KL7A 4RUTA 2RNLA 3NAKA 2BOXA 1YUFA 4KVJA 4Y79B 3NT1A 2H9EL 3TK6B 4X8TL 3ZYGA 1MHLC 2BO2A 4N7AA 3KCGL 3LAQA 3OGWA 1LPKA 2E9EA 5B72A 1HT5A 3MQEA 1IQJL 2JKHL 3CA7A 1P9JA 4D0EA 3QH0A 1WU1B 2VH6B 1FE2A 2WPHE 2FD6A 4CUDA 1IQLL 1UZJA 1NZIA 1IQIL 1YUGA 1CXPC 5GH0A 5K0HB 1JL9A 3LC3B 3QL6A 2GD4A 2WYGB 1HAEA 4OEKA 4O1ZA 5KIRA 3N8WB 1EPIA 2O86A 3R5OA 1IQFL 1EMNA 4BXSA 5CISA 4MSFA 3RR3A 1ADXA 3OLUA 3F1SB 3KRQA 1DDXA 2IKCA 1CVWL 4Z0LA 3PGHA 4G1MB 3ASIA 1IVOC 3ERIA 1L3YA 3EGFA 3C9AC 1PXXA 3ELAL 3LIWB 2BZ6L 3V65B 5JBCE 1EPGA 1FAKL 1HCGB 1G1QA 1SZBA 2MGPA 1PFXL 2FLRL 3HO4A 4QYQA 3BT2A 5CKMA 1YO8A 2CJIB 4LJJA 3KQEL 3H5CB 2J94B 4NJBA 3Q9KA 2W2OE 2Z5ZA 3TBDA 1O5DL 4ISIL 4BDXA 3CS7L 2EI7B 3FBYA 3HO3A 4NA9L 4C16A 2P3FL 2WFTA 2P28B 4OTJA 1XFEA 2Q1JB 1YUKB 2RHPA 2PR3B 3N8FA 4JYUL 3BT1A 1MQ5L 1DNWC 2J4IB 2Y5FL 4NGAL 4Y7AB 5IKVA 4DL1C 1OB1C 2WYJB 5F19A 2OYUP 2DDUA 4COXA 4YT6L 1IQGL 5GLSA 3FCSB 1W8BL 2XBVL 3LN0A 3HS7A 1EPJA 1NFYB 4BXWA 2VVCK 3GCXE 3RKEA 2R5LA 2XC0L 3KQDL 5JB8E 2EI8B 1KIGL 4ZXYL 3GCKA 4HHRA 2VWLL 3R5QA 3NJPC 3QMOA 1EAIC 1V3XB 4NG9L 4BTIA 1IGZA 3N8WA 3SOQA 3NIUA 4Y6DB 1ATBA 3CENL 2Y5GL 1IOXA 4JZDL 2BQ6A 2BOHA 1RFNB 5CKQA 2EI6B
chains in the Genus database with same CATH superfamily
2ADXA 3NTBA 4RRWA 3KL6B 2P95L 3QCWA 1DVAL 3R55A 5JVZA 5L30L 3P5BL 2I9AA 4GU4A 3UBAA 3TZIA 2W3KB 2WPKE 3DEMA 1ATEA 1G2LB 1TPGA 1V1IA 1EBVA 4LORA 4RRYA 1IQML 3ERHA 1YGCL 2PHBB 1N7DA 3SOBB 1APOA 1U8CB 2FZZL 2KNIA 1G1TA 3ENSA 2J2UB 4XLWA 2WG4B 1MQ6L 2J95B 2W2PE 4IG5A 2FLBL 3F6UL 2YGPA 1COUA 5COXA 2VWOL 4A7IA 3OLTA 2BOUA 3N8XA 1IQHL 3IJEB 2UWLB 1QIUA 4D0FA 1B9WA 2XC5L 1IP0A 5KN5C 1AUTL 1Z6CA 3V64C 1CEJA 2TGFA 4XL1A 2F9BL 1D2VC 1IOEL 1Q4GA 4QJQA 2GJMA 2P3UA 2WPJE 4CUEA 2VVVL 3TH3L 2YGOA 1HZ8A 1NFUB 4CSYA 1PGEA 2MHPA 1F0SB 4NT3A 4RRXA 4KSZA 2Y82B 4Y55A 5IKQA 1FF7A 3KK6A 2H9EC 3SOVA 2B7DL 1EGFA 2YGQA 3U7UG 2EHAA 1ATAA 4Y76B 2UWOB 3R4XA 2W2NE 2W3IB 2AYLA 2BQWA 1DNUC 1IJQA 3POYA 3NTGA 1MYPC 3TGFA 1IGXA 2P3TA 2PUMA 1LK9A 4Z6AL 3HPTA 3U73A 1G1RA 2QQTA 2XBYL 3SW2A 5CKNA 1LPZA 3GISX 4X8UL 4ZHAB 1XKBA 1IQKL 4X8SL 2WPME 2WZPP 4ZXXL 2QRBA 5HPWA 4A94C 1K36A 3LTGD 2RA0L 1J9CL 3N8VA 1WHFA 3Q3KB 4C1MC 3V6QA 1N1IA 4YZUB 1KLOA 4MMXB 3KRKA 2P16L 4YT7L 3K9XA 5FDQA 4BDWA 4KVLA 2J38B 4O02B 1CCVA 1W7XL 3I6NA 1NT0A 1K37A 5JVYA 5FF1A 4Y7BB 3SXVA 3ZYJB 3ZS0C 1QFKL 4M10A 2BOKL 4Y71B 2BT7A 1LMJA 2Y7XB 1C5MF 2D1JB 4CUFA 5I46L 4RRZA 6COXA 2XBWL 3IITB 1KLIL 2VH0B 2BMGA 1DIYA 4Z0KB 3TGYA 1U67A 4PH9A 3ZYIB 3LTFB 2P26A 2Y38A 2P3FN 1CVUA 1NFXB 5JBBE 1PRHA 2WPLE 3KQCL 2PT3A 4E1GA 5EGMB 1G2MB 1ZAQA 2W86A 5JBAE 2Y5HL 1EQHA 3PY4A 2K2SB 3LN1A 1URKA 3NYHA 3HS6A 3ZS1C 4BTUA 5JB9E 1FSBA 2OJVA 1HRFA 1GK5A 2OYEP 3HO5A 2W2ME 4GN6A 5IKRA 2J34B 4ISHL 4HHSA 1MOXC 1F7EA 5FIWC 1NFWB 1HJ7A 1LPGA 2NPRA 3GCJA 1IQEL 2PUQL 1UZQA 1XKAL 3BXIA 4M11A 2EFBA 5JW1A 1L5GB 3M37L 3R05A 4JZEL 4ZH8B 1FJSL 1TOZA 1UZPA 2VWNL 3S6XA 4PNXA 1IQNL 2BQ7A 2Y80B 3MDLA 4KVKA 1D5LC 4XBMA 1D7WC 3N8ZA 4GM7A 4ZAEB 2P93L 1WHEA 4BTTA 5F1AA 1CCFA 2QPKA 2UWPB 2W26B 3KQBL 1LQDA 3N8YB 4RS0A 2K2TA 2FLGA 1HT8A 2Y81B 3CFWA 4JZFL 2XC4L 4OTYA 2KB9A 2WFXB 2P94L 3LC5B 1A3PA 1EZQB 1FFMA 2KV4A 2M74A 2I9BA 3S4FA 3TK5B 5L2YL 5L2ZL 4JYVL 3FFGL 3QF1A 1APQA 1BF9A 2WPIE 3GC1A 5IKTA 2MGRA 2WG3C 3F9PC 3BPSE 1PTHA 1EMOA 2IPSA 2VVUL 1DQBA 2VRSA 3HS5A 1I0UA 1UZKA 2Y7ZB 1CQEA 5E8DA 1HAFA 1ATDA 2W2QE 1CX2A 4D90A 4AQTA 3GCLA 1JV2B 1HX2A 2VJ3A 3Q7DA 4MMYB 4MMZB 1FAXL 1P0SL 1Z6EL 4FM5A 1G1SA 1F7MA 1HREA 4LMFA 1F0RB 3FNLA 1M1XB 1KLJL 1EQGA 1TLEA 1KSNB 2VWMK 4TGFA 4X8VL 3GCWE 1NQLB 1X7AL 3FAQA 1JBUL 1EPHA 1NPEB 1XDTR 2G00L 2XBXL 3M36L 2NQXA 3N8YA 1DX5I 2KL7A 4RUTA 2RNLA 3NAKA 2BOXA 1YUFA 4KVJA 4Y79B 3NT1A 2H9EL 3TK6B 4X8TL 3ZYGA 1MHLC 2BO2A 4N7AA 3KCGL 3LAQA 3OGWA 1LPKA 2E9EA 5B72A 1HT5A 3MQEA 2HOXA 1IQJL 2JKHL 3CA7A 1P9JA 4D0EA 3QH0A 1WU1B 2VH6B 1FE2A 2WPHE 2FD6A 4CUDA 1IQLL 1UZJA 1NZIA 1IQIL 1YUGA 1CXPC 5GH0A 5K0HB 1JL9A 3LC3B 3QL6A 2BSFA 2GD4A 2WYGB 1HAEA 4OEKA 4O1ZA 5KIRA 3N8WB 1EPIA 2O86A 3R5OA 1IQFL 1EMNA 4BXSA 5CISA 4MSFA 3RR3A 1ADXA 3OLUA 3F1SB 3KRQA 1DDXA 2IKCA 1CVWL 4Z0LA 3PGHA 4G1MB 3ASIA 1IVOC 3ERIA 1L3YA 4GU3A 3EGFA 3C9AC 1PXXA 1V1HA 3ELAL 2BZ6L 3LIWB 3V65B 1EPGA 5JBCE 2HORA 1FAKL 1HCGB 1G1QA 1SZBA 2MGPA 1PFXL 2FLRL 3HO4A 4QYQA 3BT2A 5CKMA 1YO8A 2CJIB 4LJJA 3KQEL 3H5CB 2J94B 4NJBA 3Q9KA 2W2OE 2Z5ZA 3TBDA 1O5DL 4ISIL 4BDXA 3CS7L 2EI7B 3FBYA 3HO3A 4NA9L 4C16A 2P3FL 2WFTA 2P28B 4OTJA 1XFEA 2Q1JB 1YUKB 2PR3B 2RHPA 3N8FA 4JYUL 3BT1A 1MQ5L 1DNWC 2J4IB 2Y5FL 4NGAL 4Y7AB 5IKVA 4DL1C 1OB1C 2WYJB 1KKEA 5F19A 2OYUP 2DDUA 4COXA 4YT6L 1IQGL 5GLSA 3FCSB 1W8BL 2XBVL 3LN0A 3HS7A 1EPJA 1NFYB 4BXWA 2VVCK 3GCXE 3RKEA 2R5LA 2XC0L 3KQDL 5JB8E 2EI8B 1KIGL 2JJLA 4ZXYL 3GCKA 4HHRA 2VWLL 3R5QA 3NJPC 2BT8A 3QMOA 1EAIC 1V3XB 1LMMA 4NG9L 4BTIA 1IGZA 3N8WA 3SOQA 3NIUA 4Y6DB 1ATBA 3CENL 2Y5GL 1IOXA 4JZDL 2BQ6A 2BOHA 1RFNB 5CKQA 2EI6B
chains in the Genus database with same CATH topology
2ADXA 3NTBA 4RRWA 3KL6B 2P95L 3QCWA 1DVAL 3R55A 5JVZA 5L30L 3P5BL 2I9AA 3UBAA 3TZIA 2W3KB 2WPKE 3DEMA 1ATEA 1G2LB 1TPGA 1EBVA 4LORA 4RRYA 1IQML 3ERHA 1YGCL 2PHBB 1N7DA 3SOBB 1APOA 1U8CB 2FZZL 2KNIA 1G1TA 3ENSA 2J2UB 4XLWA 2WG4B 1MQ6L 2J95B 2W2PE 4IG5A 2FLBL 3F6UL 2YGPA 1COUA 5COXA 2VWOL 4A7IA 3OLTA 2BOUA 3N8XA 1IQHL 3IJEB 2UWLB 4D0FA 1B9WA 2XC5L 1IP0A 5KN5C 1AUTL 1Z6CA 3V64C 1CEJA 2TGFA 4XL1A 2F9BL 1D2VC 1IOEL 1Q4GA 4QJQA 2GJMA 2P3UA 2WPJE 4CUEA 2VVVL 3TH3L 2YGOA 1HZ8A 1NFUB 4CSYA 1PGEA 2MHPA 1F0SB 4NT3A 4RRXA 4KSZA 2Y82B 4Y55A 5IKQA 1FF7A 3KK6A 2H9EC 3SOVA 2B7DL 1EGFA 2YGQA 3U7UG 2EHAA 1ATAA 4Y76B 2UWOB 3R4XA 2W2NE 2W3IB 2AYLA 2BQWA 1DNUC 1IJQA 3POYA 3NTGA 1MYPC 3TGFA 1IGXA 2P3TA 2PUMA 4Z6AL 3HPTA 3U73A 1G1RA 2QQTA 2XBYL 3SW2A 5CKNA 1LPZA 3GISX 4X8UL 4ZHAB 1XKBA 1IQKL 4X8SL 2WPME 2WZPP 4ZXXL 2QRBA 5HPWA 4A94C 1K36A 3LTGD 2RA0L 1J9CL 3N8VA 1WHFA 3Q3KB 4C1MC 3V6QA 1N1IA 4YZUB 1KLOA 4MMXB 3KRKA 2P16L 4YT7L 3K9XA 5FDQA 4BDWA 4KVLA 2J38B 4O02B 1CCVA 1W7XL 3I6NA 1NT0A 1K37A 5JVYA 5FF1A 4Y7BB 3SXVA 3ZYJB 3ZS0C 1QFKL 4M10A 2BOKL 4Y71B 1LMJA 2Y7XB 1C5MF 2D1JB 4CUFA 5I46L 4RRZA 6COXA 2XBWL 3IITB 1KLIL 2VH0B 2BMGA 1DIYA 4Z0KB 3TGYA 1U67A 4PH9A 3ZYIB 3LTFB 2P26A 2Y38A 2P3FN 1CVUA 1NFXB 5JBBE 1PRHA 2WPLE 3KQCL 2PT3A 4E1GA 5EGMB 1G2MB 1ZAQA 2W86A 5JBAE 2Y5HL 1EQHA 3PY4A 2K2SB 3LN1A 1URKA 3NYHA 3HS6A 3ZS1C 4BTUA 5JB9E 1FSBA 2OJVA 1HRFA 1GK5A 2OYEP 3HO5A 2W2ME 4GN6A 5IKRA 2J34B 4ISHL 4HHSA 1MOXC 1F7EA 5FIWC 1NFWB 1HJ7A 1LPGA 2NPRA 3GCJA 1IQEL 2PUQL 1UZQA 1XKAL 3BXIA 4M11A 2EFBA 5JW1A 1L5GB 3M37L 3R05A 4JZEL 4ZH8B 1FJSL 1TOZA 1UZPA 2VWNL 3S6XA 4PNXA 1IQNL 2BQ7A 2Y80B 3MDLA 4KVKA 1D5LC 4XBMA 1D7WC 3N8ZA 4GM7A 4ZAEB 2P93L 1WHEA 4BTTA 5F1AA 1CCFA 2QPKA 2UWPB 2W26B 3KQBL 1LQDA 3N8YB 4RS0A 2K2TA 2FLGA 1HT8A 2Y81B 3CFWA 4JZFL 2XC4L 4OTYA 2KB9A 2WFXB 2P94L 3LC5B 1A3PA 1EZQB 1FFMA 2KV4A 2M74A 2I9BA 3S4FA 3TK5B 5L2YL 5L2ZL 4JYVL 3FFGL 3QF1A 1APQA 1BF9A 2WPIE 3GC1A 5IKTA 2MGRA 2WG3C 3F9PC 3BPSE 1PTHA 1EMOA 2IPSA 2VVUL 1DQBA 3HS5A 1I0UA 1UZKA 2Y7ZB 1CQEA 5E8DA 1HAFA 1ATDA 2W2QE 1CX2A 4D90A 4AQTA 3GCLA 1JV2B 1HX2A 2VJ3A 3Q7DA 4MMYB 4MMZB 1FAXL 1P0SL 1Z6EL 4FM5A 1G1SA 1F7MA 1HREA 4LMFA 1F0RB 3FNLA 1M1XB 1KLJL 1EQGA 1TLEA 1KSNB 2VWMK 4TGFA 4X8VL 3GCWE 1NQLB 1X7AL 3FAQA 1JBUL 1EPHA 1NPEB 1XDTR 2G00L 2XBXL 3M36L 2NQXA 3N8YA 1DX5I 2KL7A 4RUTA 2RNLA 3NAKA 2BOXA 1YUFA 4KVJA 4Y79B 3NT1A 2H9EL 3TK6B 4X8TL 3ZYGA 1MHLC 2BO2A 4N7AA 3KCGL 3LAQA 3OGWA 1LPKA 2E9EA 5B72A 1HT5A 3MQEA 1IQJL 2JKHL 3CA7A 1P9JA 4D0EA 3QH0A 1WU1B 2VH6B 1FE2A 2WPHE 2FD6A 4CUDA 1IQLL 1UZJA 1NZIA 1IQIL 1YUGA 1CXPC 5GH0A 5K0HB 1JL9A 3LC3B 3QL6A 2GD4A 2WYGB 1HAEA 4OEKA 4O1ZA 5KIRA 3N8WB 1EPIA 2O86A 3R5OA 1IQFL 1EMNA 4BXSA 5CISA 4MSFA 3RR3A 1ADXA 3OLUA 3F1SB 3KRQA 1DDXA 2IKCA 1CVWL 4Z0LA 3PGHA 4G1MB 3ASIA 1IVOC 3ERIA 1L3YA 3EGFA 3C9AC 1PXXA 3ELAL 3LIWB 2BZ6L 3V65B 5JBCE 1EPGA 1FAKL 1HCGB 1G1QA 1SZBA 2MGPA 1PFXL 2FLRL 3HO4A 4QYQA 3BT2A 5CKMA 1YO8A 2CJIB 4LJJA 3KQEL 3H5CB 2J94B 4NJBA 3Q9KA 2W2OE 2Z5ZA 3TBDA 1O5DL 4ISIL 4BDXA 3CS7L 2EI7B 3FBYA 3HO3A 4NA9L 4C16A 2P3FL 2WFTA 2P28B 4OTJA 1XFEA 2Q1JB 1YUKB 2RHPA 2PR3B 3N8FA 4JYUL 3BT1A 1MQ5L 1DNWC 2J4IB 2Y5FL 4NGAL 4Y7AB 5IKVA 4DL1C 1OB1C 2WYJB 5F19A 2OYUP 2DDUA 4COXA 4YT6L 1IQGL 5GLSA 3FCSB 1W8BL 2XBVL 3LN0A 3HS7A 1EPJA 1NFYB 4BXWA 2VVCK 3GCXE 3RKEA 2R5LA 2XC0L 3KQDL 5JB8E 2EI8B 1KIGL 4ZXYL 3GCKA 4HHRA 2VWLL 3R5QA 3NJPC 3QMOA 1EAIC 1V3XB 1LMMA 4NG9L 4BTIA 1IGZA 3N8WA 3SOQA 3NIUA 4Y6DB 1ATBA 3CENL 2Y5GL 1IOXA 4JZDL 2BQ6A 2BOHA 1RFNB 5CKQA 2EI6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADX A;  3NTB A;  4RRW A;  3KL6 B;  2P95 L;  3QCW A;  1DVA L;  3R55 A;  5JVZ A;  5L30 L;  3P5B L;  2I9A A;  3UBA A;  3TZI A;  2W3K B;  2WPK E;  3DEM A;  1ATE A;  1G2L B;  1TPG A;  1EBV A;  4LOR A;  4RRY A;  1IQM L;  3ERH A;  1YGC L;  2PHB B;  1N7D A;  3SOB B;  1APO A;  1U8C B;  2FZZ L;  1G1T A;  3ENS A;  2J2U B;  4XLW A;  2WG4 B;  1MQ6 L;  2J95 B;  2W2P E;  4IG5 A;  2FLB L;  3F6U L;  2YGP A;  1COU A;  5COX A;  2VWO L;  4A7I A;  3OLT A;  2BOU A;  3N8X A;  1IQH L;  3IJE B;  2UWL B;  4D0F A;  1B9W A;  2XC5 L;  1IP0 A;  5KN5 C;  1AUT L;  1Z6C A;  3V64 C;  1CEJ A;  2TGF A;  4XL1 A;  2F9B L;  1D2V C;  1IOE L;  1Q4G A;  4QJQ A;  2GJM A;  2P3U A;  2WPJ E;  4CUE A;  2VVV L;  3TH3 L;  2YGO A;  1HZ8 A;  1NFU B;  4CSY A;  1PGE A;  2MHP A;  1F0S B;  4NT3 A;  4RRX A;  4KSZ A;  2Y82 B;  4Y55 A;  5IKQ A;  1FF7 A;  3KK6 A;  3SOV A;  2B7D L;  1EGF A;  3U7U G;  2EHA A;  1ATA A;  4Y76 B;  2UWO B;  3R4X A;  2W2N E;  2W3I B;  2AYL A;  2BQW A;  1DNU C;  1IJQ A;  3POY A;  3NTG A;  1MYP C;  3TGF A;  1IGX A;  2P3T A;  2PUM A;  4Z6A L;  3HPT A;  3U73 A;  1G1R A;  2QQT A;  2XBY L;  3SW2 A;  5CKN A;  1LPZ A;  3GIS X;  4X8U L;  4ZHA B;  1XKB A;  1IQK L;  4X8S L;  2WPM E;  4ZXX L;  2QRB A;  5HPW A;  1K36 A;  3LTG D;  2RA0 L;  1J9C L;  3N8V A;  1WHF A;  3Q3K B;  4C1M C;  3V6Q A;  1N1I A;  4YZU B;  1KLO A;  4MMX B;  3KRK A;  2P16 L;  4YT7 L;  3K9X A;  5FDQ A;  4BDW A;  4KVL A;  2J38 B;  4O02 B;  1CCV A;  1W7X L;  3I6N A;  1NT0 A;  1K37 A;  5JVY A;  5FF1 A;  4Y7B B;  3SXV A;  3ZYJ B;  3ZS0 C;  1QFK L;  4M10 A;  2BOK L;  4Y71 B;  1LMJ A;  2Y7X B;  1C5M F;  2D1J B;  4CUF A;  5I46 L;  4RRZ A;  6COX A;  2XBW L;  3IIT B;  2VH0 B;  1KLI L;  2BMG A;  1DIY A;  4Z0K B;  3TGY A;  1U67 A;  4PH9 A;  3ZYI B;  3LTF B;  2P26 A;  2Y38 A;  2P3F N;  1CVU A;  1NFX B;  5JBB E;  1PRH A;  2WPL E;  3KQC L;  2PT3 A;  4E1G A;  5EGM B;  1G2M B;  1ZAQ A;  2W86 A;  5JBA E;  2Y5H L;  1EQH A;  3PY4 A;  2K2S B;  3LN1 A;  1URK A;  3NYH A;  3HS6 A;  3ZS1 C;  4BTU A;  5JB9 E;  1FSB A;  2OJV A;  1HRF A;  1GK5 A;  2OYE P;  3HO5 A;  2W2M E;  4GN6 A;  5IKR A;  2J34 B;  4ISH L;  4HHS A;  1MOX C;  1F7E A;  5FIW C;  1NFW B;  1HJ7 A;  1LPG A;  2NPR A;  3GCJ A;  1IQE L;  2PUQ L;  1UZQ A;  1XKA L;  3BXI A;  4M11 A;  2EFB A;  5JW1 A;  1L5G B;  3M37 L;  3R05 A;  4JZE L;  4ZH8 B;  1FJS L;  1TOZ A;  1UZP A;  2VWN L;  4PNX A;  1IQN L;  2BQ7 A;  2Y80 B;  3MDL A;  4KVK A;  1D5L C;  4XBM A;  1D7W C;  3N8Z A;  4GM7 A;  4ZAE B;  2P93 L;  1WHE A;  4BTT A;  5F1A A;  1CCF A;  2QPK A;  2UWP B;  2W26 B;  3KQB L;  1LQD A;  3N8Y B;  4RS0 A;  2K2T A;  2FLG A;  1HT8 A;  2Y81 B;  3CFW A;  4JZF L;  2XC4 L;  4OTY A;  2KB9 A;  2WFX B;  2P94 L;  3LC5 B;  1A3P A;  1EZQ B;  1FFM A;  2KV4 A;  2M74 A;  2I9B A;  3S4F A;  3TK5 B;  5L2Y L;  5L2Z L;  4JYV L;  3FFG L;  3QF1 A;  1APQ A;  1BF9 A;  2WPI E;  3GC1 A;  5IKT A;  2MGR A;  2WG3 C;  3F9P C;  3BPS E;  1PTH A;  1EMO A;  2IPS A;  2VVU L;  1DQB A;  3HS5 A;  1I0U A;  1UZK A;  2Y7Z B;  1CQE A;  5E8D A;  1HAF A;  1ATD A;  2W2Q E;  1CX2 A;  4D90 A;  4AQT A;  3GCL A;  1JV2 B;  1HX2 A;  2VJ3 A;  3Q7D A;  4MMY B;  4MMZ B;  1FAX L;  1P0S L;  1Z6E L;  4FM5 A;  1G1S A;  1F7M A;  1HRE A;  4LMF A;  1F0R B;  3FNL A;  1M1X B;  1KLJ L;  1EQG A;  1TLE A;  1KSN B;  2VWM K;  4TGF A;  4X8V L;  3GCW E;  1NQL B;  1X7A L;  3FAQ A;  1JBU L;  1EPH A;  1NPE B;  1XDT R;  2G00 L;  2XBX L;  3M36 L;  2NQX A;  3N8Y A;  1DX5 I;  2KL7 A;  4RUT A;  2RNL A;  3NAK A;  2BOX A;  1YUF A;  4KVJ A;  4Y79 B;  3NT1 A;  2H9E L;  3TK6 B;  4X8T L;  3ZYG A;  1MHL C;  2BO2 A;  4N7A A;  3KCG L;  3LAQ A;  3OGW A;  1LPK A;  2E9E A;  5B72 A;  1HT5 A;  3MQE A;  1IQJ L;  2JKH L;  3CA7 A;  1P9J A;  4D0E A;  3QH0 A;  1WU1 B;  2VH6 B;  1FE2 A;  2WPH E;  2FD6 A;  4CUD A;  1IQL L;  1UZJ A;  1NZI A;  1IQI L;  1YUG A;  1CXP C;  5GH0 A;  5K0H B;  1JL9 A;  3LC3 B;  3QL6 A;  2GD4 A;  2WYG B;  1HAE A;  4OEK A;  4O1Z A;  5KIR A;  3N8W B;  1EPI A;  2O86 A;  3R5O A;  1IQF L;  1EMN A;  4BXS A;  5CIS A;  4MSF A;  3RR3 A;  1ADX A;  3OLU A;  3F1S B;  3KRQ A;  1DDX A;  2IKC A;  1CVW L;  4Z0L A;  3PGH A;  4G1M B;  3ASI A;  1IVO C;  3ERI A;  1L3Y A;  3EGF A;  3C9A C;  1PXX A;  3ELA L;  3LIW B;  2BZ6 L;  3V65 B;  5JBC E;  1EPG A;  1FAK L;  1HCG B;  1G1Q A;  1SZB A;  2MGP A;  1PFX L;  2FLR L;  3HO4 A;  4QYQ A;  3BT2 A;  5CKM A;  1YO8 A;  2CJI B;  4LJJ A;  3KQE L;  3H5C B;  2J94 B;  4NJB A;  3Q9K A;  2W2O E;  2Z5Z A;  3TBD A;  1O5D L;  4ISI L;  4BDX A;  3CS7 L;  2EI7 B;  3FBY A;  3HO3 A;  4NA9 L;  4C16 A;  2P3F L;  2WFT A;  2P28 B;  4OTJ A;  1XFE A;  2Q1J B;  1YUK B;  2RHP A;  2PR3 B;  3N8F A;  4JYU L;  3BT1 A;  1MQ5 L;  1DNW C;  2J4I B;  2Y5F L;  4NGA L;  4Y7A B;  5IKV A;  4DL1 C;  1OB1 C;  2WYJ B;  5F19 A;  2OYU P;  2DDU A;  4COX A;  4YT6 L;  1IQG L;  5GLS A;  3FCS B;  1W8B L;  2XBV L;  3LN0 A;  3HS7 A;  1EPJ A;  1NFY B;  4BXW A;  2VVC K;  3GCX E;  3RKE A;  2R5L A;  2XC0 L;  3KQD L;  5JB8 E;  2EI8 B;  1KIG L;  4ZXY L;  3GCK A;  4HHR A;  2VWL L;  3R5Q A;  3NJP C;  3QMO A;  1EAI C;  1V3X B;  4NG9 L;  4BTI A;  1IGZ A;  3N8W A;  3SOQ A;  3NIU A;  4Y6D B;  1ATB A;  3CEN L;  2Y5G L;  1IOX A;  4JZD L;  2BQ6 A;  2BOH A;  1RFN B;  5CKQ A;  2EI6 B; 
#chains in the Genus database with same CATH topology
 2ADX A;  3NTB A;  4RRW A;  3KL6 B;  2P95 L;  3QCW A;  1DVA L;  3R55 A;  5JVZ A;  5L30 L;  3P5B L;  2I9A A;  4GU4 A;  3UBA A;  3TZI A;  2W3K B;  2WPK E;  3DEM A;  1ATE A;  1G2L B;  1TPG A;  1V1I A;  1EBV A;  4LOR A;  4RRY A;  1IQM L;  3ERH A;  1YGC L;  2PHB B;  1N7D A;  3SOB B;  1APO A;  1U8C B;  2FZZ L;  2KNI A;  1G1T A;  3ENS A;  2J2U B;  4XLW A;  2WG4 B;  1MQ6 L;  2J95 B;  2W2P E;  4IG5 A;  2FLB L;  3F6U L;  2YGP A;  1COU A;  5COX A;  2VWO L;  4A7I A;  3OLT A;  2BOU A;  3N8X A;  1IQH L;  3IJE B;  2UWL B;  1QIU A;  4D0F A;  1B9W A;  2XC5 L;  1IP0 A;  5KN5 C;  1AUT L;  1Z6C A;  3V64 C;  1CEJ A;  2TGF A;  4XL1 A;  2F9B L;  1D2V C;  1IOE L;  1Q4G A;  4QJQ A;  2GJM A;  2P3U A;  2WPJ E;  4CUE A;  2VVV L;  3TH3 L;  2YGO A;  1HZ8 A;  1NFU B;  4CSY A;  1PGE A;  2MHP A;  1F0S B;  4NT3 A;  4RRX A;  4KSZ A;  2Y82 B;  4Y55 A;  5IKQ A;  1FF7 A;  3KK6 A;  2H9E C;  3SOV A;  2B7D L;  1EGF A;  2YGQ A;  3U7U G;  2EHA A;  1ATA A;  4Y76 B;  2UWO B;  3R4X A;  2W2N E;  2W3I B;  2AYL A;  2BQW A;  1DNU C;  1IJQ A;  3POY A;  3NTG A;  1MYP C;  3TGF A;  1IGX A;  2P3T A;  2PUM A;  1LK9 A;  4Z6A L;  3HPT A;  3U73 A;  1G1R A;  2QQT A;  2XBY L;  3SW2 A;  5CKN A;  1LPZ A;  3GIS X;  4X8U L;  4ZHA B;  1XKB A;  1IQK L;  4X8S L;  2WPM E;  2WZP P;  4ZXX L;  2QRB A;  5HPW A;  4A94 C;  1K36 A;  3LTG D;  2RA0 L;  1J9C L;  3N8V A;  1WHF A;  3Q3K B;  4C1M C;  3V6Q A;  1N1I A;  4YZU B;  1KLO A;  4MMX B;  3KRK A;  2P16 L;  4YT7 L;  3K9X A;  5FDQ A;  4BDW A;  4KVL A;  2J38 B;  4O02 B;  1CCV A;  1W7X L;  3I6N A;  1NT0 A;  1K37 A;  5JVY A;  5FF1 A;  4Y7B B;  3SXV A;  3ZYJ B;  3ZS0 C;  1QFK L;  4M10 A;  2BOK L;  4Y71 B;  2BT7 A;  1LMJ A;  2Y7X B;  1C5M F;  2D1J B;  4CUF A;  5I46 L;  4RRZ A;  6COX A;  2XBW L;  3IIT B;  1KLI L;  2VH0 B;  2BMG A;  1DIY A;  4Z0K B;  3TGY A;  1U67 A;  4PH9 A;  3ZYI B;  3LTF B;  2P26 A;  2Y38 A;  2P3F N;  1CVU A;  1NFX B;  5JBB E;  1PRH A;  2WPL E;  3KQC L;  2PT3 A;  4E1G A;  5EGM B;  1G2M B;  1ZAQ A;  2W86 A;  5JBA E;  2Y5H L;  1EQH A;  3PY4 A;  2K2S B;  3LN1 A;  1URK A;  3NYH A;  3HS6 A;  3ZS1 C;  4BTU A;  5JB9 E;  1FSB A;  2OJV A;  1HRF A;  1GK5 A;  2OYE P;  3HO5 A;  2W2M E;  4GN6 A;  5IKR A;  2J34 B;  4ISH L;  4HHS A;  1MOX C;  1F7E A;  5FIW C;  1NFW B;  1HJ7 A;  1LPG A;  2NPR A;  3GCJ A;  1IQE L;  2PUQ L;  1UZQ A;  1XKA L;  3BXI A;  4M11 A;  2EFB A;  5JW1 A;  1L5G B;  3M37 L;  3R05 A;  4JZE L;  4ZH8 B;  1FJS L;  1TOZ A;  1UZP A;  2VWN L;  3S6X A;  4PNX A;  1IQN L;  2BQ7 A;  2Y80 B;  3MDL A;  4KVK A;  1D5L C;  4XBM A;  1D7W C;  3N8Z A;  4GM7 A;  4ZAE B;  2P93 L;  1WHE A;  4BTT A;  5F1A A;  1CCF A;  2QPK A;  2UWP B;  2W26 B;  3KQB L;  1LQD A;  3N8Y B;  4RS0 A;  2K2T A;  2FLG A;  1HT8 A;  2Y81 B;  3CFW A;  4JZF L;  2XC4 L;  4OTY A;  2KB9 A;  2WFX B;  2P94 L;  3LC5 B;  1A3P A;  1EZQ B;  1FFM A;  2KV4 A;  2M74 A;  2I9B A;  3S4F A;  3TK5 B;  5L2Y L;  5L2Z L;  4JYV L;  3FFG L;  3QF1 A;  1APQ A;  1BF9 A;  2WPI E;  3GC1 A;  5IKT A;  2MGR A;  2WG3 C;  3F9P C;  3BPS E;  1PTH A;  1EMO A;  2IPS A;  2VVU L;  1DQB A;  2VRS A;  3HS5 A;  1I0U A;  1UZK A;  2Y7Z B;  1CQE A;  5E8D A;  1HAF A;  1ATD A;  2W2Q E;  1CX2 A;  4D90 A;  4AQT A;  3GCL A;  1JV2 B;  1HX2 A;  2VJ3 A;  3Q7D A;  4MMY B;  4MMZ B;  1FAX L;  1P0S L;  1Z6E L;  4FM5 A;  1G1S A;  1F7M A;  1HRE A;  4LMF A;  1F0R B;  3FNL A;  1M1X B;  1KLJ L;  1EQG A;  1TLE A;  1KSN B;  2VWM K;  4TGF A;  4X8V L;  3GCW E;  1NQL B;  1X7A L;  3FAQ A;  1JBU L;  1EPH A;  1NPE B;  1XDT R;  2G00 L;  2XBX L;  3M36 L;  2NQX A;  3N8Y A;  1DX5 I;  2KL7 A;  4RUT A;  2RNL A;  3NAK A;  2BOX A;  1YUF A;  4KVJ A;  4Y79 B;  3NT1 A;  2H9E L;  3TK6 B;  4X8T L;  3ZYG A;  1MHL C;  2BO2 A;  4N7A A;  3KCG L;  3LAQ A;  3OGW A;  1LPK A;  2E9E A;  5B72 A;  1HT5 A;  3MQE A;  2HOX A;  1IQJ L;  2JKH L;  3CA7 A;  1P9J A;  4D0E A;  3QH0 A;  1WU1 B;  2VH6 B;  1FE2 A;  2WPH E;  2FD6 A;  4CUD A;  1IQL L;  1UZJ A;  1NZI A;  1IQI L;  1YUG A;  1CXP C;  5GH0 A;  5K0H B;  1JL9 A;  3LC3 B;  3QL6 A;  2BSF A;  2GD4 A;  2WYG B;  1HAE A;  4OEK A;  4O1Z A;  5KIR A;  3N8W B;  1EPI A;  2O86 A;  3R5O A;  1IQF L;  1EMN A;  4BXS A;  5CIS A;  4MSF A;  3RR3 A;  1ADX A;  3OLU A;  3F1S B;  3KRQ A;  1DDX A;  2IKC A;  1CVW L;  4Z0L A;  3PGH A;  4G1M B;  3ASI A;  1IVO C;  3ERI A;  1L3Y A;  4GU3 A;  3EGF A;  3C9A C;  1PXX A;  1V1H A;  3ELA L;  2BZ6 L;  3LIW B;  3V65 B;  1EPG A;  5JBC E;  2HOR A;  1FAK L;  1HCG B;  1G1Q A;  1SZB A;  2MGP A;  1PFX L;  2FLR L;  3HO4 A;  4QYQ A;  3BT2 A;  5CKM A;  1YO8 A;  2CJI B;  4LJJ A;  3KQE L;  3H5C B;  2J94 B;  4NJB A;  3Q9K A;  2W2O E;  2Z5Z A;  3TBD A;  1O5D L;  4ISI L;  4BDX A;  3CS7 L;  2EI7 B;  3FBY A;  3HO3 A;  4NA9 L;  4C16 A;  2P3F L;  2WFT A;  2P28 B;  4OTJ A;  1XFE A;  2Q1J B;  1YUK B;  2PR3 B;  2RHP A;  3N8F A;  4JYU L;  3BT1 A;  1MQ5 L;  1DNW C;  2J4I B;  2Y5F L;  4NGA L;  4Y7A B;  5IKV A;  4DL1 C;  1OB1 C;  2WYJ B;  1KKE A;  5F19 A;  2OYU P;  2DDU A;  4COX A;  4YT6 L;  1IQG L;  5GLS A;  3FCS B;  1W8B L;  2XBV L;  3LN0 A;  3HS7 A;  1EPJ A;  1NFY B;  4BXW A;  2VVC K;  3GCX E;  3RKE A;  2R5L A;  2XC0 L;  3KQD L;  5JB8 E;  2EI8 B;  1KIG L;  2JJL A;  4ZXY L;  3GCK A;  4HHR A;  2VWL L;  3R5Q A;  3NJP C;  2BT8 A;  3QMO A;  1EAI C;  1V3X B;  1LMM A;  4NG9 L;  4BTI A;  1IGZ A;  3N8W A;  3SOQ A;  3NIU A;  4Y6D B;  1ATB A;  3CEN L;  2Y5G L;  1IOX A;  4JZD L;  2BQ6 A;  2BOH A;  1RFN B;  5CKQ A;  2EI6 B; 
#chains in the Genus database with same CATH homology
 2ADX A;  3NTB A;  4RRW A;  3KL6 B;  2P95 L;  3QCW A;  1DVA L;  3R55 A;  5JVZ A;  5L30 L;  3P5B L;  2I9A A;  3UBA A;  3TZI A;  2W3K B;  2WPK E;  3DEM A;  1ATE A;  1G2L B;  1TPG A;  1EBV A;  4LOR A;  4RRY A;  1IQM L;  3ERH A;  1YGC L;  2PHB B;  1N7D A;  3SOB B;  1APO A;  1U8C B;  2FZZ L;  2KNI A;  1G1T A;  3ENS A;  2J2U B;  4XLW A;  2WG4 B;  1MQ6 L;  2J95 B;  2W2P E;  4IG5 A;  2FLB L;  3F6U L;  2YGP A;  1COU A;  5COX A;  2VWO L;  4A7I A;  3OLT A;  2BOU A;  3N8X A;  1IQH L;  3IJE B;  2UWL B;  4D0F A;  1B9W A;  2XC5 L;  1IP0 A;  5KN5 C;  1AUT L;  1Z6C A;  3V64 C;  1CEJ A;  2TGF A;  4XL1 A;  2F9B L;  1D2V C;  1IOE L;  1Q4G A;  4QJQ A;  2GJM A;  2P3U A;  2WPJ E;  4CUE A;  2VVV L;  3TH3 L;  2YGO A;  1HZ8 A;  1NFU B;  4CSY A;  1PGE A;  2MHP A;  1F0S B;  4NT3 A;  4RRX A;  4KSZ A;  2Y82 B;  4Y55 A;  5IKQ A;  1FF7 A;  3KK6 A;  2H9E C;  3SOV A;  2B7D L;  1EGF A;  2YGQ A;  3U7U G;  2EHA A;  1ATA A;  4Y76 B;  2UWO B;  3R4X A;  2W2N E;  2W3I B;  2AYL A;  2BQW A;  1DNU C;  1IJQ A;  3POY A;  3NTG A;  1MYP C;  3TGF A;  1IGX A;  2P3T A;  2PUM A;  4Z6A L;  3HPT A;  3U73 A;  1G1R A;  2QQT A;  2XBY L;  3SW2 A;  5CKN A;  1LPZ A;  3GIS X;  4X8U L;  4ZHA B;  1XKB A;  1IQK L;  4X8S L;  2WPM E;  2WZP P;  4ZXX L;  2QRB A;  5HPW A;  4A94 C;  1K36 A;  3LTG D;  2RA0 L;  1J9C L;  3N8V A;  1WHF A;  3Q3K B;  4C1M C;  3V6Q A;  1N1I A;  4YZU B;  1KLO A;  4MMX B;  3KRK A;  2P16 L;  4YT7 L;  3K9X A;  5FDQ A;  4BDW A;  4KVL A;  2J38 B;  4O02 B;  1CCV A;  1W7X L;  3I6N A;  1NT0 A;  1K37 A;  5JVY A;  5FF1 A;  4Y7B B;  3SXV A;  3ZYJ B;  3ZS0 C;  1QFK L;  4M10 A;  2BOK L;  4Y71 B;  1LMJ A;  2Y7X B;  1C5M F;  2D1J B;  4CUF A;  5I46 L;  4RRZ A;  6COX A;  2XBW L;  3IIT B;  1KLI L;  2VH0 B;  2BMG A;  1DIY A;  4Z0K B;  3TGY A;  1U67 A;  4PH9 A;  3ZYI B;  3LTF B;  2P26 A;  2Y38 A;  2P3F N;  1CVU A;  1NFX B;  5JBB E;  1PRH A;  2WPL E;  3KQC L;  2PT3 A;  4E1G A;  5EGM B;  1G2M B;  1ZAQ A;  2W86 A;  5JBA E;  2Y5H L;  1EQH A;  3PY4 A;  2K2S B;  3LN1 A;  1URK A;  3NYH A;  3HS6 A;  3ZS1 C;  4BTU A;  5JB9 E;  1FSB A;  2OJV A;  1HRF A;  1GK5 A;  2OYE P;  3HO5 A;  2W2M E;  4GN6 A;  5IKR A;  2J34 B;  4ISH L;  4HHS A;  1MOX C;  1F7E A;  5FIW C;  1NFW B;  1HJ7 A;  1LPG A;  2NPR A;  3GCJ A;  1IQE L;  2PUQ L;  1UZQ A;  1XKA L;  3BXI A;  4M11 A;  2EFB A;  5JW1 A;  1L5G B;  3M37 L;  3R05 A;  4JZE L;  4ZH8 B;  1FJS L;  1TOZ A;  1UZP A;  2VWN L;  3S6X A;  4PNX A;  1IQN L;  2BQ7 A;  2Y80 B;  3MDL A;  4KVK A;  1D5L C;  4XBM A;  1D7W C;  3N8Z A;  4GM7 A;  4ZAE B;  2P93 L;  1WHE A;  4BTT A;  5F1A A;  1CCF A;  2QPK A;  2UWP B;  2W26 B;  3KQB L;  1LQD A;  3N8Y B;  4RS0 A;  2K2T A;  2FLG A;  1HT8 A;  2Y81 B;  3CFW A;  4JZF L;  2XC4 L;  4OTY A;  2KB9 A;  2WFX B;  2P94 L;  3LC5 B;  1A3P A;  1EZQ B;  1FFM A;  2KV4 A;  2M74 A;  2I9B A;  3S4F A;  3TK5 B;  5L2Y L;  5L2Z L;  4JYV L;  3FFG L;  3QF1 A;  1APQ A;  1BF9 A;  2WPI E;  3GC1 A;  5IKT A;  2MGR A;  2WG3 C;  3F9P C;  3BPS E;  1PTH A;  1EMO A;  2IPS A;  2VVU L;  1DQB A;  3HS5 A;  1I0U A;  1UZK A;  2Y7Z B;  1CQE A;  5E8D A;  1HAF A;  1ATD A;  2W2Q E;  1CX2 A;  4D90 A;  4AQT A;  3GCL A;  1JV2 B;  1HX2 A;  2VJ3 A;  3Q7D A;  4MMY B;  4MMZ B;  1FAX L;  1P0S L;  1Z6E L;  4FM5 A;  1G1S A;  1F7M A;  1HRE A;  4LMF A;  1F0R B;  3FNL A;  1M1X B;  1KLJ L;  1EQG A;  1TLE A;  1KSN B;  2VWM K;  4TGF A;  4X8V L;  3GCW E;  1NQL B;  1X7A L;  3FAQ A;  1JBU L;  1EPH A;  1NPE B;  1XDT R;  2G00 L;  2XBX L;  3M36 L;  2NQX A;  3N8Y A;  1DX5 I;  2KL7 A;  4RUT A;  2RNL A;  3NAK A;  2BOX A;  1YUF A;  4KVJ A;  4Y79 B;  3NT1 A;  2H9E L;  3TK6 B;  4X8T L;  3ZYG A;  1MHL C;  2BO2 A;  4N7A A;  3KCG L;  3LAQ A;  3OGW A;  1LPK A;  2E9E A;  5B72 A;  1HT5 A;  3MQE A;  1IQJ L;  2JKH L;  3CA7 A;  1P9J A;  4D0E A;  3QH0 A;  1WU1 B;  2VH6 B;  1FE2 A;  2WPH E;  2FD6 A;  4CUD A;  1IQL L;  1UZJ A;  1NZI A;  1IQI L;  1YUG A;  1CXP C;  5GH0 A;  5K0H B;  1JL9 A;  3LC3 B;  3QL6 A;  2GD4 A;  2WYG B;  1HAE A;  4OEK A;  4O1Z A;  5KIR A;  3N8W B;  1EPI A;  2O86 A;  3R5O A;  1IQF L;  1EMN A;  4BXS A;  5CIS A;  4MSF A;  3RR3 A;  1ADX A;  3OLU A;  3F1S B;  3KRQ A;  1DDX A;  2IKC A;  1CVW L;  4Z0L A;  3PGH A;  4G1M B;  3ASI A;  1IVO C;  3ERI A;  1L3Y A;  3EGF A;  3C9A C;  1PXX A;  3ELA L;  3LIW B;  2BZ6 L;  3V65 B;  5JBC E;  1EPG A;  1FAK L;  1HCG B;  1G1Q A;  1SZB A;  2MGP A;  1PFX L;  2FLR L;  3HO4 A;  4QYQ A;  3BT2 A;  5CKM A;  1YO8 A;  2CJI B;  4LJJ A;  3KQE L;  3H5C B;  2J94 B;  4NJB A;  3Q9K A;  2W2O E;  2Z5Z A;  3TBD A;  1O5D L;  4ISI L;  4BDX A;  3CS7 L;  2EI7 B;  3FBY A;  3HO3 A;  4NA9 L;  4C16 A;  2P3F L;  2WFT A;  2P28 B;  4OTJ A;  1XFE A;  2Q1J B;  1YUK B;  2RHP A;  2PR3 B;  3N8F A;  4JYU L;  3BT1 A;  1MQ5 L;  1DNW C;  2J4I B;  2Y5F L;  4NGA L;  4Y7A B;  5IKV A;  4DL1 C;  1OB1 C;  2WYJ B;  5F19 A;  2OYU P;  2DDU A;  4COX A;  4YT6 L;  1IQG L;  5GLS A;  3FCS B;  1W8B L;  2XBV L;  3LN0 A;  3HS7 A;  1EPJ A;  1NFY B;  4BXW A;  2VVC K;  3GCX E;  3RKE A;  2R5L A;  2XC0 L;  3KQD L;  5JB8 E;  2EI8 B;  1KIG L;  4ZXY L;  3GCK A;  4HHR A;  2VWL L;  3R5Q A;  3NJP C;  3QMO A;  1EAI C;  1V3X B;  1LMM A;  4NG9 L;  4BTI A;  1IGZ A;  3N8W A;  3SOQ A;  3NIU A;  4Y6D B;  1ATB A;  3CEN L;  2Y5G L;  1IOX A;  4JZD L;  2BQ6 A;  2BOH A;  1RFN B;  5CKQ A;  2EI6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...