1PTSA

Crystal structure and ligand binding studies of a screened peptide complexed with streptavidin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
119
Chain Sequence
b'AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPAGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Crystal structure and ligand-binding studies of a screened peptide complexed with streptavidin.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin-binding protein/peptide
total genus 27
structure length 119
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 1992-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1ptsA00
1NQMA 1SWGA 4Z2VA 1VWDB 1SRGA 1IJ8A 4GJSA 2IZKA 3WZPA 4GDAA 1VWQB 1RXJA 1LDOA 2Y3EA 5F2BA 1HQQA 3RDOA 1KFFA 2GH7A 1HY2A 1SWHA 1VWKB 4Z28A 1VWNB 3WYQA 2IZDB 1SWFA 1VWJB 4JHQA 1N9YA 4BX5B 1VWGB 1STSB 2RTRB 5CSEA 1I9HA 1SWSA 1AVEA 2F01A 1Y55X 1RAVA 3VHIA 1VWOB 1SWPA 1KL3A 3WZOA 3WYPA 1SWTA 2RTCB 1LUQA 1MEPA 4GJVA 1SWKA 3WZNA 1VWRB 3RY2A 2MF6A 5K67A 1LCWA 1WBIA 1SWLA 1RXKA 2C4IA 2IZHB 2ZSCA 3MG5A 1VWIB 1SWNA 1Y52X 2OFBA 1SLDB 3VHHA 4Z27A 4CPHA 4I60A 2RTBB 3RDXA 1SWDA 1SWEA 5JD2A 5B5FA 1SLGB 4Y59A 1LCZA 1VYOA 4CPHB 4BCSA 2RTIB 2RTMA 1VWLB 3RDQA 4BJ8A 2IZFB 2IZIA 1SLEB 4JO6A 4GGRA 4BX5A 3PK2A 2OF9A 4BBOA 2UYWA 4DNEA 3T6FA 4Z6JA 4Y5DA 3MM0A 3T2XA 1STRB 3RDUA 1VWEB 2AVIA 1SWOA 1SWJA 5IRUA 2C1QA 5CHKA 1VWFB 1KL4A 1Y53X 1KL5A 1SWAA 1VWPB 1PTSA 1VWCB 2IZJA 1NDJA 4CPIA 2RTHB 2IZCB 3T2WA 1RSTB 4BX7B 1MM9A 1AVDA 2G5LA 5IRWA 1VWHB 2A5CA 3RY1A 1VWBB 5K68A 1DF8A 3SZIA 3WZQA 1MK5A 1SRIA 3RDMA 3X00A 3VHMA 2FHNX 4BX6B 1SRHA 3RE6A 2RTNB 4OKAA 1RXHA 4YVBA 3SZJA 1HXZA 2JGSA 2RTAA 1SWCA 1SRJA 2IZLB 1SWBA 2RTJA 3T6LA 4GD9A 1N9MA 1N43A 3RDSA 1SRFA 5L3YA 1N7YA 2RTOB 2RTPB 4GGZA 4U46A 2IZEB 4Z2PA 2RTKA 1VWMB 2A8GA 1NBXA 1HXLA 2IZBA 4GGTA 2RTGB 4EKVA 1SWUA 2CAMA 2RTFB 2OF8A 1NC9A 5IRAA 3SZHA 4Z2OA 2RTEB 2A5BA 4CPFA 3RE5A 2IZGB 1NQNA 3VGWA 1SREA 1MOYA 2QCBA 4BX7A 2BC3A 1RSUB 3EW2A 2OFAA 1LCVA 4IRWA 2RTLA 1SWRA 3FDCA 1SWQA 2FHLA 2Y32A 4CPEA 5B5GA 1LDQA 2C1SA 2WPUA 2Y3FA 1SLFB 3EW1A 2UZ2A 4JNJA 1STPA 1VWAB 2RTDB 1LELA 4BX6A 1N4JA 2RTQB 2IZAA
chains in the Genus database with same CATH superfamily
4TKBA 1SWGA 2AF5A 2X32A 3L4RA 1VWDB 2PY1A 3QKGA 4U8UO 3UEUA 1E06A 1X8PA 1VWQB 1RXJA 1LDOA 1YUPA 3OD9A 2KTDA 3FA6A 3WYQA 1SWHA 1KZXA 3WJGA 1SWFA 4I3CA 5FENA 1YWCA 5B2AO 3WOVA 4BX5B 2ACOA 1VWGB 4A8ZA 3JSQA 2QOMA 2P8GA 2QMIA 5IO6A 4NLJA 4RUNA 3OE3A 2VFCA 1RLBE 2F01A 2CZTA 4DQ3A 3TF6A 1Y55X 1YWBA 1JJXA 4LKPA 3VHIA 2OL6O 3O19A 1I06A 1DZKA 3APWA 1SWPA 4GE1A 3PECA 3WZOA 2CBSA 3ZW1B 5B29A 2FGSA 5JR8A 3B2KA 3NBXX 1MEPA 3HOLA 4QYNA 3FEPA 1KOIA 2R56A 3TZSA 5IXGA 1PBOA 1TXLA 4ON1A 5HCDC 1IKEA 4I3DA 4O3ZA 4AZQA 3FEKA 4O4SA 3PH5A 1YWAA 4ZGFA 4M7MA 2LFOA 1FTPA 2GJ5A 2OFBA 4HWMA 3O2YA 1EI5A 2RTBB 1AELA 1GKAB 3U0DA 1SLGB 4AW8A 2MJIA 3GAQA 4ARHA 1JIWI 4BCSA 2RTIB 1JMZA 1B0OA 4HPCA 1P6PA 1AB0A 4Y0SA 4WBKA 1ICNA 4D6BA 1BJ7A 3ZW0A 3PK2A 1ZNEA 2CBRA 2RA6A 4DNEA 4EFGA 2G8CO 2BT9A 4WFUA 1GGLA 2KTSA 3T2XA 1STRB 5LJBA 2KT4B 4YKOA 2AT0X 3HPEA 3WJCA 2Q39A 5IRUA 1KQWA 3G7XA 2OYBO 1HMRA 1YP7A 1VWPB 5BYPA 2LKKA 1NDJA 2CM9A 2G79A 3VG3A 4CPIA 2AT6X 3T2WA 4IB6A 4BX7B 4N7CA 3KZAA 4BQUA 1YP6A 1BSQA 3EBWA 2A5CA 2QO4A 1BSOA 2X4MA 3HWEA 5D45A 5B11O 1A3YA 1CBQA 2WR6A 2DJFA 1JJJA 5H9LA 4IB7A 3BX7A 3RDMA 5HTDA 3STNA 4MEEA 2NNDA 2WWPA 3X00A 1AVGI 1QY0A 5HBSA 3RE6A 2W2BA 3RKGA 3STKA 1VPRA 1G7NA 1O1UA 5IO7A 3KVNA 1ZNKA 4QQ1A 2AH7X 1HXZA 2JGSA 5D4AA 1B56A 1JYDA 1KT6A 4Y0PA 3UEWA 1BLRA 4GD9A 2GTFX 3BS2A 4FQBB 1Y0GA 2OL8O 2F09A 4GDZA 4A1HA 1HBPA 3I0AA 2R74A 1A18A 4Z2PA 3CMPA 4QNIA 2RTKA 1R0UA 1VWMB 1NBXA 2Q9SA 2OY1O 3ELXA 2IFBA 3NPOA 4HPBA 2L67A 4EKVA 1IIUA 1RBPA 4YBUA 1U18A 2HYSA 2CAMA 1A57A 4EEJA 2OF8A 1AQBA 3P24A 4QGXA 4ZHHA 2RTEB 1UYNX 3ZW2A 4CV7A 1DZJA 1SXYA 1MOYA 3BDRA 3LTWA 4ORYA 1DV9A 4EXZA 4R0BA 4YH0A 4L3RA 1JYJA 3S5VA 2GC9A 1VYFA 1SWQA 4ZR2A 2A13A 2C1SA 2MO5A 3MBTA 4NNTA 1JMXA 2Y3FA 4CSBA 4GUZA 1SLFB 1LFOA 5BVTA 2E4JA 1STPA 3BRNA 2ANSA 2RTDB 1FJ1E 2AT3X 4YFRA 4BX6A 3FELA 2XSTA 4GNWA 4ORRA 3BSZE 2JU8A 1IJ8A 4O3XB 3WZPA 1GX3A 1LNMA 1K3BA 3JS1A 1HQQA 4XMCA 2G78A 1KFFA 2RCQA 1HY2A 1VWKB 2K23A 3C76X 1VWNB 4HPAA 2IZDB 4AZOA 4QGVA 1ADLA 2JN3A 5HAEA 5D47A 3Q6LA 1LIFA 5HZ6A 3WJBA 1STSB 3FMZA 4BVMA 1I9HA 2X34A 1AVEA 2K62A 2BSZA 2X8FA 3EYCA 2X45A 1JBHA 2LBVA 5KICA 2N93A 1ERXA 5H9NA 4ZJ0A 2OY7A 1KL3A 4AZMA 1SWTA 2RTCB 3RWXA 1LUQA 1PM1X 3WZNA 1EW3A 4CDCA 4YKMA 3RZYA 4MVEA 3RY2A 5EPQA 5HZ5A 4CDDA 1D2UA 1PMPA 2KW1A 1QQSA 1WBIA 2O62A 3EC5A 1U17A 3VG7A 1O1VA 2DJGA 1I04A 1JJUA 1VWIB 1SWNA 1OBQA 2HLVA 2ZSCA 4XMDA 3PPTA 3S5XA 5CE4A 4U3QA 1SLDB 1W4TA 3VHHA 4CPHA 4Z27A 1SA8A 1JQPA 2FS6A 2Q4NA 4QZTA 1SWEA 2AMMX 4KIIA 1E02A 2ZAIA 4HPDA 4QRLA 4B55A 1ZNLA 3VE2A 1KT4A 1MVGA 3D9WA 3Q34A 1I05A 4MVKA 4PSQA 4MIRA 4MVIA 5EZ2A 2IZFB 4CK4A 3VG6A 4D6AA 4O3YA 4JO6A 1LKEA 4NYQA 3PH6A 2FT9A 3VU1A 4BX5A 3ZI8A 3FA9A 3P6FA 3NR3A 3BY0A 4Y5DA 3I17A 5H9KA 3O22A 1Z24A 2GTLM 4I9SA 3RDUA 4ZGUA 2AVIA 3KFIA 1T68X 1SXUA 1T8VA 3JQOA 2C1QA 4IABA 4OS3A 3BLGA 4XMHA 1KL4A 1Y53X 4OS0A 3ZW1A 3NP1A 4I6SA 2BS6A 4M6SA 4XMGA 2FRSA 2IZJA 4LZVA 5CYBA 1BBPA 3RSWA 4A1YA 5L8NA 3DTQA 5AJCA 1QABE 2G5LA 5AEOA 3NX1A 2X55A 3P6DA 3CWKA 1VWHB 3D96A 1ZRYA 4GRJA 5HA1A 3EBKA 2A0AA 3SZIA 2GTLO 3KFHA 1Y9TA 2CM4A 4GK9A 1MK5A 1GKAA 3VHMA 1GT3A 1SRHA 1X8QA 4ODDA 4PJ2A 5LJEA 3APVA 3PP6A 1IFBA 5AJBA 4CDFA 2AT5X 4YVBA 1HQPA 1SWCA 1HBQA 3HOEA 5D48A 2FKJA 1SRFA 4AZNA 3OBLA 1LICA 2PI3O 3MVFA 4TKHA 3BU1A 1XCAA 4NYRA 4QZUA 3D95A 3B2HA 5F58A 1CBSA 1HXLA 4FBVA 5LKEA 2OY5O 4BOEA 2W2FA 1ZNGA 3PQUA 2AL0X 4IB8A 4L1NA 4XMEA 5F6ZA 3P02A 1NC9A 1ALBA 5IRAA 2JU3A 3NQKA 3SZHA 3HWFA 4Z2OA 1H91A 2OFMX 3P6CA 3VPJE 3ZUIA 2I5ZO 1G5WA 1NQNA 4XMFA 4Y0QA 3HK1A 4BX7A 1MUPA 4ZH6A 3EW2A 1BM5A 1EPBA 3OJYC 3FW5A 2RN4A 4AZRA 4RUUA 3WJDA 2Y32A 2NNEA 2RQ0A 2WPUA 5H9AA 1SXWA 1MX7A 4LQZA 3WBGA 3LV4A 4JNJA 4GH7A 4YBPA 3C77X 1N0SA 3ZWEA 1Y9LA 3FR2A 4KC8A 4KT5A 3STMX 4I3BA 1FELA 3WXQA 2IZAA 1NQMA 4Z2VA 4MISA 5L8OA 1SRGA 2QM9A 3ELZA 2RCTA 1GM6A 2IZKA 2HZQA 4GJSA 1XKIA 4GDAA 2Y3EA 2G7BA 1QFTA 4YFPA 5F2BA 3LHNA 2OVEA 2FWVA 3FLLA 5FQ7E 3RDOA 4EDEA 2GH7A 4Z28A 5LJDA 1VWJB 3TGCA 3HWGA 1N9YA 1I78A 4ALOA 4ML7B 2RTRB 1DFVA 1ERBA 4N7DA 5CSEA 4AZPA 1TVQA 1IKJA 3UEVA 1L6MA 4ZHCA 3B2IA 4ZHDA 2WQ9A 1E5PA 1EPAA 3APUA 1MDCA 1SY1A 4DQ4A 4TQ2A 3HTYA 5HZQA 5HCCC 3RBYA 2L5PA 2MHDA 3EM0A 4O3WA 3NADA 5C0NA 2Q2MA 4ZCBA 1VWRB 5BVQA 3S26A 5K67A 1LCWA 4O4XA 1EIIA 2JW1A 3N91A 1IFCA 1KT7A 2IZHB 2YMSA 3MG5A 4O9SA 3UEXA 1UYOX 3NX2A 1I4UA 2W2AA 2WEXA 1BRPA 1NGLA 2X46A 3CQRA 2EU7X 3FA7A 4I60A 3AKNA 4IAWA 3RDXA 1SWDA 5EDCA 5KHPA 1KQXA 2XKLA 3CKGA 3FIDA 5DG4A 5JD2A 4CPHB 5B5FA 4Y0RA 2VFBA 2RTMA 1VWLB 2AKQA 4GU8A 4BJ8A 1KXOA 4GETA 3WJFA 5B27A 1LIDA 2IZIA 1SLEB 2FLJA 5LJHA 3FR5A 2POAA 3VG5A 4Z6JA 1SY0A 4BGFA 1EXSA 2X8SA 1DZMA 4NLIA 1PBYA 1EUOA 1VWEB 2BLGA 3F9DA 5CHKA 1TOWA 2FKGA 4WHIA 3ZQ3A 2CZUA 1DF3A 1S2PA 2WSJA 1PTSA 1OEJA 4ORWA 1NP4A 2KD2A 2JU7A 4NP1A 4OEMA 1LPJA 1RSTB 2ACPX 4IB9A 1FDQA 5F7GA 4U8UM 4YCEA 1KGLA 5H8TA 2FR2A 1VWBB 5K68A 1ZNDA 3H3IA 1BEBA 4QGWA 1CBIA 3WZQA 1W5RA 2OL7A 1DC9A 1SRIA 1LF7A 2Z4IA 4O49A 1O8VA 2FHNX 1GT1A 1HN2A 5DPQA 3NQ9A 1QFVA 1YWDA 2OFRX 2LBAA 2GTLN 4OKAA 3P6EA 1X89A 3PDFA 2HNXA 1OBUA 1QWDA 4O4UA 3SZJA 2NNQA 2RTAA 4ES7A 1FENA 1SRJA 1SWBA 1UREA 3F8AA 2L9CA 4YCHA 2X8TA 1N9MA 1N43A 5HA0A 5HCEC 3T6LA 1N7YA 4ORUA 2RTPB 4TNNA 5FQ6E 4FBRA 1UZ2X 3P6GA 3HWDA 2IZBA 4ZHGA 3PQSA 1K24A 1SWUA 1GT5A 2RD7C 2HKDA 1HMSA 1EALA 2RTFB 1OPBA 4UU3A 1T0VA 1LIBA 4A60A 3CKFA 4CPFA 5EEEA 4NV7A 5LKFA 4GZVA 2QCBA 1VYGA 1RSUB 2F73A 4AYHA 4TKJA 2ALLX 1D3SA 4O4OA 4QAEA 4QYPA 4ALBA 4IRWA 1X8UA 1SWRA 2A2GA 2OY8A 3CQNA 3PEDA 4ZH9A 1ACDA 3FIQA 3FR4A 4DCBA 5B5GA 4I95A 3CBCA 5EDBA 2ASNX 4C5PA 2OVSA 2NP1A 3EW1A 5AQ6A 3IFBA 1OPAA 1G85A 1B4MA 1LELA 4KCAA 5B3MO 1N4JA 3SLJA 3QQ2A 1OEEA 4U9CA 1EIOA 2MM3A 4OMXA 2WUTA 1B8EA 2X56A 3AKMA 2FS7A 2WQAE 1ZNHA 3CBSA 3TGAA 3TGBA 4IMNA 2QO5A 3APXA 4JHQA 4YDBA 4IBAA 3AEHA 3ZW0B 1BSYA 4TLJA 3B2JA 3FA8A 4INNA 4NW4A 1KT3A 1SWSA 2JOZA 4I9RA 5LJGA 1LIEA 3IA8A 1RAVA 1ICMA 1A2DA 1ML7A 1VWOB 1BRQA 2L68A 2Q2PA 2YG2A 3WJEA 3WYPA 4EQAC 3K3LA 4GJVA 1SWKA 3F6ZB 5EEDA 2R73A 2MF6A 1SXXA 2OZQA 4YGZA 1SWLA 4OS8A 1RXKA 2C4IA 2I5VO 1OSPO 1Y52X 1KZWA 2ZAGA 3KQ0A 3T1DA 1G74A 2FTBA 5F6BA 2HZRA 3E3CA 1SY3A 3B2LA 5HWZA 4Y59A 1LCZA 1VYOA 4NV8A 3V8UA 3P6HA 3SOTA 4COTA 5IO5A 5FAZA 3D4RA 4ZHFA 1X8OA 3RDQA 1X8NA 4UU2A 1BWYA 1IW2A 1FEMA 3KFFA 4GGRA 1KT5A 2OF9A 1EQDA 2QOSC 2UYWA 1QY1A 5D8JA 4BBOA 5BVSA 3T6FA 1JZUA 3SLTA 3FYFA 3MM0A 2DM5A 3FENA 4IAXA 3UAQA 3AUMO 4KH8A 3VG2A 4ZFXA 5B10O 1SMPI 1SWOA 1GT4A 1SWJA 1PEEA 1VWFB 1HMTA 4LZUA 3C78X 1KL5A 3BU9A 1SWAA 3SAOA 1S7DA 1VWCB 5F1EA 1QG5A 2IZCB 2RTHB 3MX7A 5FFHA 2VDFA 1MM9A 1AVDA 1QY2A 5HZ9A 3U03A 5IRWA 1GXAA 3U9PC 1W6FA 3RY1A 1U0XA 5HZ8A 2BHVA 1DF8A 2A2UA 2LA7A 4TJZA 3EMMA 5K06A 3BX8A 2FR3A 4OMWA 4LKTA 5LJKA 3VE1A 2MWHA 3FW4A 4ID2A 3VG4A 4BX6B 1JV4A 1MX8A 1GX9A 4WFVA 2LB6A 3WVMA 2RTNB 4FBOA 1CJ5A 2JMBA 2Z4HA 2M4LA 4ORXA 1RXHA 1GX8A 2RTJA 3SLOA 5HTEA 4YFQA 2IZLB 2QO6A 4K19A 3DSZA 1NP1A 5L3YA 1YIVA 4JGLA 3RDSA 1OBPA 2RTOB 4GGZA 4U46A 5FQ8E 2IZEB 1TW4A 1WUBA 4IMOA 1TOUA 2OVAA 2AT8X 4ORSA 4GGTA 4OELA 2OVDA 2RTGB 4U8UN 2BS5A 2A3FX 1E2TA 3KFGA 1CRBA 4YDAA 5KIDA 4GKCA 2A5BA 3RE5A 1CBRA 2IZGB 4FGIB 4YMYA 3VGWA 1SREA 1SY2A 2HMBA 4HFOA 1E00A 2BC3A 1OEKA 3ZUOA 3ZZVA 2OFAA 1LCVA 1X71A 3S60A 2RTLA 5LJCA 4NNSA 3FDCA 4KC7A 1DZPA 2FHLA 2WEWA 5L8IA 4CPEA 1LDQA 4YGHA 3CR6A 4GNYA 2UZ2A 3NQ3A 1VWAB 4MVLA 4YGGA 1S44A 3D97A 4CDEA 2A8GA 3GE2A 2RTQB 1FE3A
chains in the Genus database with same CATH topology
1NQMA 1SWGA 4Z2VA 1VWDB 1SRGA 1IJ8A 4GJSA 2IZKA 3WZPA 4GDAA 1VWQB 1RXJA 1LDOA 2Y3EA 5F2BA 1HQQA 3RDOA 1KFFA 2GH7A 1HY2A 1SWHA 1VWKB 4Z28A 1VWNB 3WYQA 2IZDB 1SWFA 1VWJB 4JHQA 1N9YA 4BX5B 1VWGB 1STSB 2RTRB 5CSEA 1I9HA 1SWSA 1AVEA 2F01A 1Y55X 1RAVA 3VHIA 1VWOB 1SWPA 1KL3A 3WZOA 3WYPA 1SWTA 2RTCB 1LUQA 1MEPA 4GJVA 1SWKA 3WZNA 1VWRB 3RY2A 2MF6A 5K67A 1LCWA 1WBIA 1SWLA 1RXKA 2C4IA 2IZHB 2ZSCA 3MG5A 1VWIB 1SWNA 1Y52X 2OFBA 1SLDB 3VHHA 4Z27A 4CPHA 4I60A 2RTBB 3RDXA 1SWDA 1SWEA 5JD2A 5B5FA 1SLGB 4Y59A 1LCZA 1VYOA 4CPHB 4BCSA 2RTIB 2RTMA 1VWLB 3RDQA 4BJ8A 2IZFB 2IZIA 1SLEB 4JO6A 4GGRA 4BX5A 3PK2A 2OF9A 4BBOA 2UYWA 4DNEA 3T6FA 4Z6JA 4Y5DA 3MM0A 3T2XA 1STRB 3RDUA 1VWEB 2AVIA 1SWOA 1SWJA 5IRUA 2C1QA 5CHKA 1VWFB 1KL4A 1Y53X 1KL5A 1SWAA 1VWPB 1PTSA 1VWCB 2IZJA 1NDJA 4CPIA 2RTHB 2IZCB 3T2WA 1RSTB 4BX7B 1MM9A 1AVDA 2G5LA 5IRWA 1VWHB 2A5CA 3RY1A 1VWBB 5K68A 1DF8A 3SZIA 3WZQA 1MK5A 1SRIA 3RDMA 3X00A 3VHMA 2FHNX 4BX6B 1SRHA 3RE6A 2RTNB 4OKAA 1RXHA 4YVBA 3SZJA 1HXZA 2JGSA 2RTAA 1SWCA 1SRJA 2IZLB 1SWBA 2RTJA 3T6LA 4GD9A 1N9MA 1N43A 3RDSA 1SRFA 5L3YA 1N7YA 2RTOB 2RTPB 4GGZA 4U46A 2IZEB 4Z2PA 2RTKA 1VWMB 2A8GA 1NBXA 1HXLA 2IZBA 4GGTA 2RTGB 4EKVA 1SWUA 2CAMA 2RTFB 2OF8A 1NC9A 5IRAA 3SZHA 4Z2OA 2RTEB 2A5BA 4CPFA 3RE5A 2IZGB 1NQNA 3VGWA 1SREA 1MOYA 2QCBA 4BX7A 2BC3A 1RSUB 3EW2A 2OFAA 1LCVA 4IRWA 2RTLA 1SWRA 3FDCA 1SWQA 2FHLA 2Y32A 4CPEA 5B5GA 1LDQA 2C1SA 2WPUA 2Y3FA 1SLFB 3EW1A 2UZ2A 4JNJA 1STPA 1VWAB 2RTDB 1LELA 4BX6A 1N4JA 2RTQB 2IZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NQM A;  1SWG A;  4Z2V A;  1VWD B;  1SRG A;  1IJ8 A;  4GJS A;  2IZK A;  3WZP A;  4GDA A;  1VWQ B;  1RXJ A;  1LDO A;  2Y3E A;  5F2B A;  1HQQ A;  3RDO A;  1KFF A;  2GH7 A;  1HY2 A;  1SWH A;  1VWK B;  4Z28 A;  1VWN B;  3WYQ A;  2IZD B;  1SWF A;  1VWJ B;  4JHQ A;  1N9Y A;  4BX5 B;  1VWG B;  1STS B;  2RTR B;  5CSE A;  1I9H A;  1SWS A;  1AVE A;  2F01 A;  1Y55 X;  1RAV A;  3VHI A;  1VWO B;  1SWP A;  1KL3 A;  3WZO A;  3WYP A;  1SWT A;  2RTC B;  1LUQ A;  1MEP A;  4GJV A;  1SWK A;  3WZN A;  1VWR B;  3RY2 A;  2MF6 A;  5K67 A;  1LCW A;  1WBI A;  1SWL A;  1RXK A;  2C4I A;  2IZH B;  2ZSC A;  3MG5 A;  1VWI B;  1SWN A;  1Y52 X;  2OFB A;  1SLD B;  3VHH A;  4Z27 A;  4CPH A;  4I60 A;  2RTB B;  3RDX A;  1SWD A;  1SWE A;  5JD2 A;  5B5F A;  1SLG B;  4Y59 A;  1LCZ A;  1VYO A;  4CPH B;  4BCS A;  2RTI B;  2RTM A;  1VWL B;  3RDQ A;  4BJ8 A;  2IZF B;  2IZI A;  1SLE B;  4JO6 A;  4GGR A;  4BX5 A;  3PK2 A;  2OF9 A;  4BBO A;  2UYW A;  4DNE A;  3T6F A;  4Z6J A;  4Y5D A;  3MM0 A;  3T2X A;  1STR B;  3RDU A;  1VWE B;  2AVI A;  1SWO A;  1SWJ A;  5IRU A;  2C1Q A;  5CHK A;  1VWF B;  1KL4 A;  1Y53 X;  1KL5 A;  1SWA A;  1VWP B;  1PTS A;  1VWC B;  2IZJ A;  1NDJ A;  4CPI A;  2RTH B;  2IZC B;  3T2W A;  1RST B;  4BX7 B;  1MM9 A;  1AVD A;  2G5L A;  5IRW A;  1VWH B;  2A5C A;  3RY1 A;  1VWB B;  5K68 A;  1DF8 A;  3SZI A;  3WZQ A;  1MK5 A;  1SRI A;  3RDM A;  3X00 A;  3VHM A;  2FHN X;  4BX6 B;  1SRH A;  3RE6 A;  2RTN B;  4OKA A;  1RXH A;  4YVB A;  3SZJ A;  1HXZ A;  2JGS A;  2RTA A;  1SWC A;  1SRJ A;  2IZL B;  1SWB A;  2RTJ A;  3T6L A;  4GD9 A;  1N9M A;  1N43 A;  3RDS A;  1SRF A;  5L3Y A;  1N7Y A;  2RTO B;  2RTP B;  4GGZ A;  4U46 A;  2IZE B;  4Z2P A;  2RTK A;  1VWM B;  2A8G A;  1NBX A;  1HXL A;  2IZB A;  4GGT A;  2RTG B;  4EKV A;  1SWU A;  2CAM A;  2RTF B;  2OF8 A;  1NC9 A;  5IRA A;  3SZH A;  4Z2O A;  2RTE B;  2A5B A;  4CPF A;  3RE5 A;  2IZG B;  1NQN A;  3VGW A;  1SRE A;  1MOY A;  2QCB A;  4BX7 A;  2BC3 A;  1RSU B;  3EW2 A;  2OFA A;  1LCV A;  4IRW A;  2RTL A;  1SWR A;  3FDC A;  1SWQ A;  2FHL A;  2Y32 A;  4CPE A;  5B5G A;  1LDQ A;  2C1S A;  2WPU A;  2Y3F A;  1SLF B;  3EW1 A;  2UZ2 A;  4JNJ A;  1STP A;  1VWA B;  2RTD B;  1LEL A;  4BX6 A;  1N4J A;  2RTQ B;  2IZA A; 
#chains in the Genus database with same CATH topology
 4TKB A;  1SWG A;  2AF5 A;  2X32 A;  3L4R A;  1VWD B;  2PY1 A;  3QKG A;  4U8U O;  3UEU A;  1E06 A;  1X8P A;  1VWQ B;  1RXJ A;  1LDO A;  1YUP A;  3OD9 A;  2KTD A;  3FA6 A;  3WYQ A;  1SWH A;  1KZX A;  3WJG A;  1SWF A;  4I3C A;  5FEN A;  1YWC A;  5B2A O;  3WOV A;  4BX5 B;  2ACO A;  1VWG B;  4A8Z A;  3JSQ A;  2QOM A;  2P8G A;  2QMI A;  5IO6 A;  4NLJ A;  4RUN A;  3OE3 A;  2VFC A;  1RLB E;  2F01 A;  2CZT A;  4DQ3 A;  3TF6 A;  1Y55 X;  1YWB A;  1JJX A;  4LKP A;  3VHI A;  2OL6 O;  3O19 A;  1I06 A;  1DZK A;  3APW A;  1SWP A;  4GE1 A;  3PEC A;  3WZO A;  2CBS A;  3ZW1 B;  5B29 A;  2FGS A;  5JR8 A;  3B2K A;  3NBX X;  1MEP A;  3HOL A;  4QYN A;  3FEP A;  1KOI A;  2R56 A;  3TZS A;  5IXG A;  1PBO A;  1TXL A;  4ON1 A;  5HCD C;  1IKE A;  4I3D A;  4O3Z A;  4AZQ A;  3FEK A;  4O4S A;  3PH5 A;  1YWA A;  4ZGF A;  4M7M A;  2LFO A;  1FTP A;  2GJ5 A;  2OFB A;  4HWM A;  3O2Y A;  1EI5 A;  2RTB B;  1AEL A;  1GKA B;  3U0D A;  1SLG B;  4AW8 A;  2MJI A;  3GAQ A;  4ARH A;  1JIW I;  4BCS A;  2RTI B;  1JMZ A;  1B0O A;  4HPC A;  1P6P A;  1AB0 A;  4Y0S A;  4WBK A;  1ICN A;  4D6B A;  1BJ7 A;  3ZW0 A;  3PK2 A;  1ZNE A;  2CBR A;  2RA6 A;  4DNE A;  4EFG A;  2G8C O;  2BT9 A;  4WFU A;  1GGL A;  2KTS A;  3T2X A;  1STR B;  5LJB A;  2KT4 B;  4YKO A;  2AT0 X;  3HPE A;  3WJC A;  2Q39 A;  5IRU A;  1KQW A;  3G7X A;  2OYB O;  1HMR A;  1YP7 A;  1VWP B;  5BYP A;  2LKK A;  1NDJ A;  2CM9 A;  2G79 A;  3VG3 A;  4CPI A;  2AT6 X;  3T2W A;  4IB6 A;  4BX7 B;  4N7C A;  3KZA A;  4BQU A;  1YP6 A;  1BSQ A;  3EBW A;  2A5C A;  2QO4 A;  1BSO A;  2X4M A;  3HWE A;  5D45 A;  5B11 O;  1A3Y A;  1CBQ A;  2WR6 A;  2DJF A;  1JJJ A;  5H9L A;  4IB7 A;  3BX7 A;  3RDM A;  5HTD A;  3STN A;  4MEE A;  2NND A;  2WWP A;  3X00 A;  1AVG I;  1QY0 A;  5HBS A;  3RE6 A;  2W2B A;  3RKG A;  3STK A;  1VPR A;  1G7N A;  1O1U A;  5IO7 A;  3KVN A;  1ZNK A;  4QQ1 A;  2AH7 X;  1HXZ A;  2JGS A;  5D4A A;  1B56 A;  1JYD A;  1KT6 A;  4Y0P A;  3UEW A;  1BLR A;  4GD9 A;  2GTF X;  3BS2 A;  4FQB B;  1Y0G A;  2OL8 O;  2F09 A;  4GDZ A;  4A1H A;  1HBP A;  3I0A A;  2R74 A;  1A18 A;  4Z2P A;  3CMP A;  4QNI A;  2RTK A;  1R0U A;  1VWM B;  1NBX A;  2Q9S A;  2OY1 O;  3ELX A;  2IFB A;  3NPO A;  4HPB A;  2L67 A;  4EKV A;  1IIU A;  1RBP A;  4YBU A;  1U18 A;  2HYS A;  2CAM A;  1A57 A;  4EEJ A;  2OF8 A;  1AQB A;  3P24 A;  4QGX A;  4ZHH A;  2RTE B;  1UYN X;  3ZW2 A;  4CV7 A;  1DZJ A;  1SXY A;  1MOY A;  3BDR A;  3LTW A;  4ORY A;  1DV9 A;  4EXZ A;  4R0B A;  4YH0 A;  4L3R A;  1JYJ A;  3S5V A;  2GC9 A;  1VYF A;  1SWQ A;  4ZR2 A;  2A13 A;  2C1S A;  2MO5 A;  3MBT A;  4NNT A;  1JMX A;  2Y3F A;  4CSB A;  4GUZ A;  1SLF B;  1LFO A;  5BVT A;  2E4J A;  1STP A;  3BRN A;  2ANS A;  2RTD B;  1FJ1 E;  2AT3 X;  4YFR A;  4BX6 A;  3FEL A;  2XST A;  4GNW A;  4ORR A;  3BSZ E;  2JU8 A;  1IJ8 A;  4O3X B;  3WZP A;  1GX3 A;  1LNM A;  1K3B A;  3JS1 A;  1HQQ A;  4XMC A;  2G78 A;  1KFF A;  2RCQ A;  1HY2 A;  1VWK B;  2K23 A;  3C76 X;  1VWN B;  4HPA A;  2IZD B;  4AZO A;  4QGV A;  1ADL A;  2JN3 A;  5HAE A;  5D47 A;  3Q6L A;  1LIF A;  5HZ6 A;  3WJB A;  1STS B;  3FMZ A;  4BVM A;  1I9H A;  2X34 A;  1AVE A;  2K62 A;  2BSZ A;  2X8F A;  3EYC A;  2X45 A;  1JBH A;  2LBV A;  5KIC A;  2N93 A;  1ERX A;  5H9N A;  4ZJ0 A;  2OY7 A;  1KL3 A;  4AZM A;  1SWT A;  2RTC B;  3RWX A;  1LUQ A;  1PM1 X;  3WZN A;  1EW3 A;  4CDC A;  4YKM A;  3RZY A;  4MVE A;  3RY2 A;  5EPQ A;  5HZ5 A;  4CDD A;  1D2U A;  1PMP A;  2KW1 A;  1QQS A;  1WBI A;  2O62 A;  3EC5 A;  1U17 A;  3VG7 A;  1O1V A;  2DJG A;  1I04 A;  1JJU A;  1VWI B;  1SWN A;  1OBQ A;  2HLV A;  2ZSC A;  4XMD A;  3PPT A;  3S5X A;  5CE4 A;  4U3Q A;  1SLD B;  1W4T A;  3VHH A;  4CPH A;  4Z27 A;  1SA8 A;  1JQP A;  2FS6 A;  2Q4N A;  4QZT A;  1SWE A;  2AMM X;  4KII A;  1E02 A;  2ZAI A;  4HPD A;  4QRL A;  4B55 A;  1ZNL A;  3VE2 A;  1KT4 A;  1MVG A;  3D9W A;  3Q34 A;  1I05 A;  4MVK A;  4PSQ A;  4MIR A;  4MVI A;  5EZ2 A;  2IZF B;  4CK4 A;  3VG6 A;  4D6A A;  4O3Y A;  4JO6 A;  1LKE A;  4NYQ A;  3PH6 A;  2FT9 A;  3VU1 A;  4BX5 A;  3ZI8 A;  3FA9 A;  3P6F A;  3NR3 A;  3BY0 A;  4Y5D A;  3I17 A;  5H9K A;  3O22 A;  1Z24 A;  2GTL M;  4I9S A;  3RDU A;  4ZGU A;  2AVI A;  3KFI A;  1T68 X;  1SXU A;  1T8V A;  3JQO A;  2C1Q A;  4IAB A;  4OS3 A;  3BLG A;  4XMH A;  1KL4 A;  1Y53 X;  4OS0 A;  3ZW1 A;  3NP1 A;  4I6S A;  2BS6 A;  4M6S A;  4XMG A;  2FRS A;  2IZJ A;  4LZV A;  5CYB A;  1BBP A;  3RSW A;  4A1Y A;  5L8N A;  3DTQ A;  5AJC A;  1QAB E;  2G5L A;  5AEO A;  3NX1 A;  2X55 A;  3P6D A;  3CWK A;  1VWH B;  3D96 A;  1ZRY A;  4GRJ A;  5HA1 A;  3EBK A;  2A0A A;  3SZI A;  2GTL O;  3KFH A;  1Y9T A;  2CM4 A;  4GK9 A;  1MK5 A;  1GKA A;  3VHM A;  1GT3 A;  1SRH A;  1X8Q A;  4ODD A;  4PJ2 A;  5LJE A;  3APV A;  3PP6 A;  1IFB A;  5AJB A;  4CDF A;  2AT5 X;  4YVB A;  1HQP A;  1SWC A;  1HBQ A;  3HOE A;  5D48 A;  2FKJ A;  1SRF A;  4AZN A;  3OBL A;  1LIC A;  2PI3 O;  3MVF A;  4TKH A;  3BU1 A;  1XCA A;  4NYR A;  4QZU A;  3D95 A;  3B2H A;  5F58 A;  1CBS A;  1HXL A;  4FBV A;  5LKE A;  2OY5 O;  4BOE A;  2W2F A;  1ZNG A;  3PQU A;  2AL0 X;  4IB8 A;  4L1N A;  4XME A;  5F6Z A;  3P02 A;  1NC9 A;  1ALB A;  5IRA A;  2JU3 A;  3NQK A;  3SZH A;  3HWF A;  4Z2O A;  1H91 A;  2OFM X;  3P6C A;  3VPJ E;  3ZUI A;  2I5Z O;  1G5W A;  1NQN A;  4XMF A;  4Y0Q A;  3HK1 A;  4BX7 A;  1MUP A;  4ZH6 A;  3EW2 A;  1BM5 A;  1EPB A;  3OJY C;  3FW5 A;  2RN4 A;  4AZR A;  4RUU A;  3WJD A;  2Y32 A;  2NNE A;  2RQ0 A;  2WPU A;  5H9A A;  1SXW A;  1MX7 A;  4LQZ A;  3WBG A;  3LV4 A;  4JNJ A;  4GH7 A;  4YBP A;  3C77 X;  1N0S A;  3ZWE A;  1Y9L A;  3FR2 A;  4KC8 A;  4KT5 A;  3STM X;  4I3B A;  1FEL A;  3WXQ A;  2IZA A;  1NQM A;  4Z2V A;  4MIS A;  5L8O A;  1SRG A;  2QM9 A;  3ELZ A;  2RCT A;  1GM6 A;  2IZK A;  2HZQ A;  4GJS A;  1XKI A;  4GDA A;  2Y3E A;  2G7B A;  1QFT A;  4YFP A;  5F2B A;  3LHN A;  2OVE A;  2FWV A;  3FLL A;  5FQ7 E;  3RDO A;  4EDE A;  2GH7 A;  4Z28 A;  5LJD A;  1VWJ B;  3TGC A;  3HWG A;  1N9Y A;  1I78 A;  4ALO A;  4ML7 B;  2RTR B;  1DFV A;  1ERB A;  4N7D A;  5CSE A;  4AZP A;  1TVQ A;  1IKJ A;  3UEV A;  1L6M A;  4ZHC A;  3B2I A;  4ZHD A;  2WQ9 A;  1E5P A;  1EPA A;  3APU A;  1MDC A;  1SY1 A;  4DQ4 A;  4TQ2 A;  3HTY A;  5HZQ A;  5HCC C;  3RBY A;  2L5P A;  2MHD A;  3EM0 A;  4O3W A;  3NAD A;  5C0N A;  2Q2M A;  4ZCB A;  1VWR B;  5BVQ A;  3S26 A;  5K67 A;  1LCW A;  4O4X A;  1EII A;  2JW1 A;  3N91 A;  1IFC A;  1KT7 A;  2IZH B;  2YMS A;  3MG5 A;  4O9S A;  3UEX A;  1UYO X;  3NX2 A;  1I4U A;  2W2A A;  2WEX A;  1BRP A;  1NGL A;  2X46 A;  3CQR A;  2EU7 X;  3FA7 A;  4I60 A;  3AKN A;  4IAW A;  3RDX A;  1SWD A;  5EDC A;  5KHP A;  1KQX A;  2XKL A;  3CKG A;  3FID A;  5DG4 A;  5JD2 A;  4CPH B;  5B5F A;  4Y0R A;  2VFB A;  2RTM A;  1VWL B;  2AKQ A;  4GU8 A;  4BJ8 A;  1KXO A;  4GET A;  3WJF A;  5B27 A;  1LID A;  2IZI A;  1SLE B;  2FLJ A;  5LJH A;  3FR5 A;  2POA A;  3VG5 A;  4Z6J A;  1SY0 A;  4BGF A;  1EXS A;  2X8S A;  1DZM A;  4NLI A;  1PBY A;  1EUO A;  1VWE B;  2BLG A;  3F9D A;  5CHK A;  1TOW A;  2FKG A;  4WHI A;  3ZQ3 A;  2CZU A;  1DF3 A;  1S2P A;  2WSJ A;  1PTS A;  1OEJ A;  4ORW A;  1NP4 A;  2KD2 A;  2JU7 A;  4NP1 A;  4OEM A;  1LPJ A;  1RST B;  2ACP X;  4IB9 A;  1FDQ A;  5F7G A;  4U8U M;  4YCE A;  1KGL A;  5H8T A;  2FR2 A;  1VWB B;  5K68 A;  1ZND A;  3H3I A;  1BEB A;  4QGW A;  1CBI A;  3WZQ A;  1W5R A;  2OL7 A;  1DC9 A;  1SRI A;  1LF7 A;  2Z4I A;  4O49 A;  1O8V A;  2FHN X;  1GT1 A;  1HN2 A;  5DPQ A;  3NQ9 A;  1QFV A;  1YWD A;  2OFR X;  2LBA A;  2GTL N;  4OKA A;  3P6E A;  1X89 A;  3PDF A;  2HNX A;  1OBU A;  1QWD A;  4O4U A;  3SZJ A;  2NNQ A;  2RTA A;  4ES7 A;  1FEN A;  1SRJ A;  1SWB A;  1URE A;  3F8A A;  2L9C A;  4YCH A;  2X8T A;  1N9M A;  1N43 A;  5HA0 A;  5HCE C;  3T6L A;  1N7Y A;  4ORU A;  2RTP B;  4TNN A;  5FQ6 E;  4FBR A;  1UZ2 X;  3P6G A;  3HWD A;  2IZB A;  4ZHG A;  3PQS A;  1K24 A;  1SWU A;  1GT5 A;  2RD7 C;  2HKD A;  1HMS A;  1EAL A;  2RTF B;  1OPB A;  4UU3 A;  1T0V A;  1LIB A;  4A60 A;  3CKF A;  4CPF A;  5EEE A;  4NV7 A;  5LKF A;  4GZV A;  2QCB A;  1VYG A;  1RSU B;  2F73 A;  4AYH A;  4TKJ A;  2ALL X;  1D3S A;  4O4O A;  4QAE A;  4QYP A;  4ALB A;  4IRW A;  1X8U A;  1SWR A;  2A2G A;  2OY8 A;  3CQN A;  3PED A;  4ZH9 A;  1ACD A;  3FIQ A;  3FR4 A;  4DCB A;  5B5G A;  4I95 A;  3CBC A;  5EDB A;  2ASN X;  4C5P A;  2OVS A;  2NP1 A;  3EW1 A;  5AQ6 A;  3IFB A;  1OPA A;  1G85 A;  1B4M A;  1LEL A;  4KCA A;  5B3M O;  1N4J A;  3SLJ A;  3QQ2 A;  1OEE A;  4U9C A;  1EIO A;  2MM3 A;  4OMX A;  2WUT A;  1B8E A;  2X56 A;  3AKM A;  2FS7 A;  2WQA E;  1ZNH A;  3CBS A;  3TGA A;  3TGB A;  4IMN A;  2QO5 A;  3APX A;  4JHQ A;  4YDB A;  4IBA A;  3AEH A;  3ZW0 B;  1BSY A;  4TLJ A;  3B2J A;  3FA8 A;  4INN A;  4NW4 A;  1KT3 A;  1SWS A;  2JOZ A;  4I9R A;  5LJG A;  1LIE A;  3IA8 A;  1RAV A;  1ICM A;  1A2D A;  1ML7 A;  1VWO B;  1BRQ A;  2L68 A;  2Q2P A;  2YG2 A;  3WJE A;  3WYP A;  4EQA C;  3K3L A;  4GJV A;  1SWK A;  3F6Z B;  5EED A;  2R73 A;  2MF6 A;  1SXX A;  2OZQ A;  4YGZ A;  1SWL A;  4OS8 A;  1RXK A;  2C4I A;  2I5V O;  1OSP O;  1Y52 X;  1KZW A;  2ZAG A;  3KQ0 A;  3T1D A;  1G74 A;  2FTB A;  5F6B A;  2HZR A;  3E3C A;  1SY3 A;  3B2L A;  5HWZ A;  4Y59 A;  1LCZ A;  1VYO A;  4NV8 A;  3V8U A;  3P6H A;  3SOT A;  4COT A;  5IO5 A;  5FAZ A;  3D4R A;  4ZHF A;  1X8O A;  3RDQ A;  1X8N A;  4UU2 A;  1BWY A;  1IW2 A;  1FEM A;  3KFF A;  4GGR A;  1KT5 A;  2OF9 A;  1EQD A;  2QOS C;  2UYW A;  1QY1 A;  5D8J A;  4BBO A;  5BVS A;  3T6F A;  1JZU A;  3SLT A;  3FYF A;  3MM0 A;  2DM5 A;  3FEN A;  4IAX A;  3UAQ A;  3AUM O;  4KH8 A;  3VG2 A;  4ZFX A;  5B10 O;  1SMP I;  1SWO A;  1GT4 A;  1SWJ A;  1PEE A;  1VWF B;  1HMT A;  4LZU A;  3C78 X;  1KL5 A;  3BU9 A;  1SWA A;  3SAO A;  1S7D A;  1VWC B;  5F1E A;  1QG5 A;  2IZC B;  2RTH B;  3MX7 A;  5FFH A;  2VDF A;  1MM9 A;  1AVD A;  1QY2 A;  5HZ9 A;  3U03 A;  5IRW A;  1GXA A;  3U9P C;  1W6F A;  3RY1 A;  1U0X A;  5HZ8 A;  2BHV A;  1DF8 A;  2A2U A;  2LA7 A;  4TJZ A;  3EMM A;  5K06 A;  3BX8 A;  2FR3 A;  4OMW A;  4LKT A;  5LJK A;  3VE1 A;  2MWH A;  3FW4 A;  4ID2 A;  3VG4 A;  4BX6 B;  1JV4 A;  1MX8 A;  1GX9 A;  4WFV A;  2LB6 A;  3WVM A;  2RTN B;  4FBO A;  1CJ5 A;  2JMB A;  2Z4H A;  2M4L A;  4ORX A;  1RXH A;  1GX8 A;  2RTJ A;  3SLO A;  5HTE A;  4YFQ A;  2IZL B;  2QO6 A;  4K19 A;  3DSZ A;  1NP1 A;  5L3Y A;  1YIV A;  4JGL A;  3RDS A;  1OBP A;  2RTO B;  4GGZ A;  4U46 A;  5FQ8 E;  2IZE B;  1TW4 A;  1WUB A;  4IMO A;  1TOU A;  2OVA A;  2AT8 X;  4ORS A;  4GGT A;  4OEL A;  2OVD A;  2RTG B;  4U8U N;  2BS5 A;  2A3F X;  1E2T A;  3KFG A;  1CRB A;  4YDA A;  5KID A;  4GKC A;  2A5B A;  3RE5 A;  1CBR A;  2IZG B;  4FGI B;  4YMY A;  3VGW A;  1SRE A;  1SY2 A;  2HMB A;  4HFO A;  1E00 A;  2BC3 A;  1OEK A;  3ZUO A;  3ZZV A;  2OFA A;  1LCV A;  1X71 A;  3S60 A;  2RTL A;  5LJC A;  4NNS A;  3FDC A;  4KC7 A;  1DZP A;  2FHL A;  2WEW A;  5L8I A;  4CPE A;  1LDQ A;  4YGH A;  3CR6 A;  4GNY A;  2UZ2 A;  3NQ3 A;  1VWA B;  4MVL A;  4YGG A;  1S44 A;  3D97 A;  4CDE A;  2A8G A;  3GE2 A;  2RTQ B;  1FE3 A; 
#chains in the Genus database with same CATH homology
 1NQM A;  1SWG A;  4Z2V A;  1VWD B;  1SRG A;  1IJ8 A;  4GJS A;  2IZK A;  3WZP A;  4GDA A;  1VWQ B;  1RXJ A;  1LDO A;  2Y3E A;  5F2B A;  1HQQ A;  3RDO A;  1KFF A;  2GH7 A;  1HY2 A;  1SWH A;  1VWK B;  4Z28 A;  1VWN B;  3WYQ A;  2IZD B;  1SWF A;  1VWJ B;  4JHQ A;  1N9Y A;  4BX5 B;  1VWG B;  1STS B;  2RTR B;  5CSE A;  1I9H A;  1SWS A;  1AVE A;  2F01 A;  1Y55 X;  1RAV A;  3VHI A;  1VWO B;  1SWP A;  1KL3 A;  3WZO A;  3WYP A;  1SWT A;  2RTC B;  1LUQ A;  1MEP A;  4GJV A;  1SWK A;  3WZN A;  1VWR B;  3RY2 A;  2MF6 A;  5K67 A;  1LCW A;  1WBI A;  1SWL A;  1RXK A;  2C4I A;  2IZH B;  2ZSC A;  3MG5 A;  1VWI B;  1SWN A;  1Y52 X;  2OFB A;  1SLD B;  3VHH A;  4Z27 A;  4CPH A;  4I60 A;  2RTB B;  3RDX A;  1SWD A;  1SWE A;  5JD2 A;  5B5F A;  1SLG B;  4Y59 A;  1LCZ A;  1VYO A;  4CPH B;  4BCS A;  2RTI B;  2RTM A;  1VWL B;  3RDQ A;  4BJ8 A;  2IZF B;  2IZI A;  1SLE B;  4JO6 A;  4GGR A;  4BX5 A;  3PK2 A;  2OF9 A;  4BBO A;  2UYW A;  4DNE A;  3T6F A;  4Z6J A;  4Y5D A;  3MM0 A;  3T2X A;  1STR B;  3RDU A;  1VWE B;  2AVI A;  1SWO A;  1SWJ A;  5IRU A;  2C1Q A;  5CHK A;  1VWF B;  1KL4 A;  1Y53 X;  1KL5 A;  1SWA A;  1VWP B;  1PTS A;  1VWC B;  2IZJ A;  1NDJ A;  4CPI A;  2RTH B;  2IZC B;  3T2W A;  1RST B;  4BX7 B;  1MM9 A;  1AVD A;  2G5L A;  5IRW A;  1VWH B;  2A5C A;  3RY1 A;  1VWB B;  5K68 A;  1DF8 A;  3SZI A;  3WZQ A;  1MK5 A;  1SRI A;  3RDM A;  3X00 A;  3VHM A;  2FHN X;  4BX6 B;  1SRH A;  3RE6 A;  2RTN B;  4OKA A;  1RXH A;  4YVB A;  3SZJ A;  1HXZ A;  2JGS A;  2RTA A;  1SWC A;  1SRJ A;  2IZL B;  1SWB A;  2RTJ A;  3T6L A;  4GD9 A;  1N9M A;  1N43 A;  3RDS A;  1SRF A;  5L3Y A;  1N7Y A;  2RTO B;  2RTP B;  4GGZ A;  4U46 A;  2IZE B;  4Z2P A;  2RTK A;  1VWM B;  2A8G A;  1NBX A;  1HXL A;  2IZB A;  4GGT A;  2RTG B;  4EKV A;  1SWU A;  2CAM A;  2RTF B;  2OF8 A;  1NC9 A;  5IRA A;  3SZH A;  4Z2O A;  2RTE B;  2A5B A;  4CPF A;  3RE5 A;  2IZG B;  1NQN A;  3VGW A;  1SRE A;  1MOY A;  2QCB A;  4BX7 A;  2BC3 A;  1RSU B;  3EW2 A;  2OFA A;  1LCV A;  4IRW A;  2RTL A;  1SWR A;  3FDC A;  1SWQ A;  2FHL A;  2Y32 A;  4CPE A;  5B5G A;  1LDQ A;  2C1S A;  2WPU A;  2Y3F A;  1SLF B;  3EW1 A;  2UZ2 A;  4JNJ A;  1STP A;  1VWA B;  2RTD B;  1LEL A;  4BX6 A;  1N4J A;  2RTQ B;  2IZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...