1PU2A

Crystal structure of the k246r mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
371
structure length
356
Chain Sequence
MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWRGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of substrate-binding groups in the mechanism of aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase
total genus 112
structure length 356
sequence length 371
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1pu2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pu2A01
1DC6A 2VUUA 4CM6A 4I8XA 9LDBA 4XR4A 1N1GA 1HE4A 4QO8A 1WVGA 1NWHA 3BYZA 1C14A 3PWZA 3PDUA 4NDNE 3WGYA 2BI7A 4DWVA 5TT1A 2IDZA 4RQTA 4GX2A 2X7HA 4RL6A 2NTNA 4IDBA 5JNLA 1ENOA 3QLJA 1U28A 3MJVA 4TQGA 1YQDA 5EMHA 1U1IA 3C1TA 3E1KA 3B1FA 4FR5A 4NG5A 4UVIA 5IFLA 2VHXA 2Z5LA 4G81A 5GMOA 4RORA 4JIGA 4U7WA 1NVMB 1ZK2A 3CKYA 4CM1A 3CEAA 1PJCA 5JMWA 1I32A 2V7PA 1P1KA 3BMOB 1SBYA 4AJNA 2AEJA 3C24A 3WYEA 4BNVA 4EBFA 4WLUA 3QWBA 1CYDA 4GQAA 1VSVA 4XJSA 2CDBA 3U09A 4DTIA 1F06A 1XYGA 2EKPA 5AXCA 2J8ZA 2YV2A 3OECA 4BKQA 2IXAA 4QO7A 3WJAA 1Y8RB 5B12A 4Q3EA 1FDTA 4NIMA 3WX0A 3C7DB 2FP4A 5H83A 3B6ZA 2AXQA 2DUWA 4NBWA 5TC4A 4PVDA 5KJEA 4K26A 3M2TA 2AEMA 2J5RA 1Z45A 2BRUA 1GCOA 1DC4A 3EW7A 2BGKA 1VM6A 4L8VA 4ILKA 4BO4A 5JFOA 1LC3A 4KP7A 1QYXA 3QHAA 3UCEA 3JYOA 4IDFA 2VOEA 4S1VA 4PG6A 2AE1A 1O0SA 4BNHA 1A27A 1D8AA 4RF4A 1NHGA 1PQWA 4WEOA 3OQ1A 4YQZA 3BTOA 1QLHA 4ZN6A 3H7AA 2Y0EA 4FN4A 2JCVA 3SX2A 3KLPX 1JN0A 1KEPA 3IP1A 3WG9A 2YW9A 2BHLA 1LDBA 3I9MA 3LF1A 4BUCA 3FBTA 2P5UA 3CZMA 1RM3A 3U3XA 1LSSA 4GMFA 3NRCA 4AJPA 2XF8A 1WXDA 1TI7A 4J4BA 3GK3A 4KZPA 3IJRA 2BD0A 5LDGA 1VJTA 4B79A 2V6BA 1T1RA 2WMDA 2D59A 2W2KA 1ZKMA 1O5IA 1N2SA 1SOVA 4UVGA 3QVSA 1H6CA 3U4CA 2VWPA 3MWDB 4E12A 1PTJA 3JQ8A 4D0RA 5DT9A 1E3LA 1PJSA 3AWDA 4IGFA 4MDHA 1KETA 2WSBA 3KYDA 1C3VA 3ADOA 3GFGA 1CQIA 1ORRA 1YJ8A 4N5NA 3LC2O 5B37A 5C7OO 4PN3A 4CMIB 1OC4A 4W7HA 4R5HA 1Q0QA 2JD1A 3JQAA 2C7VA 1H2HA 4R1UA 3S8MA 3GLQA 1PWZA 2IODA 4NJMB 5JC8A 5THQA 1KVTA 2WJPA 1S6YA 4KTTE 3DDNA 4R5MA 2O2SA 4CMEA 5EPOA 3KYBA 1P1IA 4GX0A 1CF2O 2TMDA 3VKUA 1ENZA 3ENKA 4LW8A 3U62A 8LDHA 3QW2A 3DEYX 4II2A 4RF2A 1QR6A 1PR9A 1BXGA 3FPCA 2QYTA 1Y7TA 1GYPA 2DFDA 3JQAB 3KRTA 4IJWA 4I5DA 2PK3A 1CQJA 3GC6A 3ONEA 4W4TA 4FCCA 3ST7A 1DBVO 3BZUA 4CMIA 2EV9A 5CAEA 5ITWA 5T8KC 5IF3A 4BO6A 5BSFA 5T6BA 1CETA 4K6FA 2YJZA 2NACA 1LDMA 1XA0A 3H8VA 3TJRA 2AQIA 1VE9A 4R41A 1GEEA 1I3KA 4RZIA 4O5OA 1JDJA 3L4SO 1PL8A 2AG5A 1O9BA 1N5DA 1YDEA 3QY9A 3Q3CA 1A9YA 3JQCA 1IZ0A 2Z95A 2X1HA 3IKVA 3E9QA 3I1JA 1HDGO 1T1SA 4EUEA 2FR1A 2B83A 3JQ6A 5TJHA 4CM4B 4NBTA 3HG7A 1ZXLA 3JQBA 1XCBA 2XOXA 5L95A 1R0SA 1ENPA 2DM6A 3TQHA 3D5QA 3OMLA 2Y05A 1I3LA 4R68A 4I9NA 1UP4A 3C8MA 1ZSVA 1GY8A 4EITA 1H6BA 3JQFC 1R66A 3H6KA 2D4AA 3NTOA 1NAHA 5DBIA 1YH3A 4WLFA 3ZNQA 3RU9A 3JD0A 1P45A 1O95A 1PEDA 1C0IA 4EUFA 1BMDA 1ZNQO 5HRUA 2Y68A 2C59A 1DIGA 5DNAA 2GN8A 1T25A 4M87A 4ZU3A 1KOLA 1JU9A 1XIVA 5C37A 1NQ5A 2E6UX 3GNSA 4ND5A 5TGDA 4Z3DA 4OH1A 4TROA 1YB5A 1IHYA 2PR2A 1UDCA 1I01A 3HQ4O 2VN8A 3ONDA 4GKVA 4KUGA 1GPDG 4N7RA 4M1QA 4YJHB 1MFZA 4CL3A 3WICA 5TT0A 1XELA 4FW8A 4I5FA 4I5EA 5KCZA 3VH2A 3A9WA 5K6AA 5B1YA 2HSDA 3PYMA 2OZPA 2GASA 4I1IA 4WLVA 1WLYA 3EVNA 1KY4A 4RVFA 2OL4A 3ZU5A 4NPCA 4JCOA 3DHNA 3RWBA 2I66A 2X9NA 4BNYA 3WNQA 4DPKA 2UUOA 3D4OA 5B4UA 4CODB 1YOVB 3DAGA 2R6JA 1U5AA 2BGLA 4GSLA 1EQUA 3AU8A 5CPFA 1ZFNA 4JQCA 2NSDA 2PZJA 1D1SA 2HDHA 1LSOA 1V35A 1FDSA 1HF3A 2J5KA 3NYWA 1QKIA 3EK2A 4MVJM 1HDCA 1SEPA 4FS3A 4LRTB 4J1TA 4WOKA 2J3IA 4DRYA 3TWOA 5EERA 3WFIA 3FWZA 2C20A 1RWBA 4CV3A 3PZRA 1IUKA 3NDIA 3TN7A 4D46A 5DF1A 1L7DA 3PHHA 1VSUA 4IIUA 4LRSB 4XEHA 2PFGA 4NZ9A 1DO8A 4OAQA 2Q1WA 4WJZA 2QZ9A 4XIYA 3GVCA 4P38A 4MIOA 2DTXA 3M2PA 2DBRA 1ONOA 5IAAA 1LNQA 3RI3A 4YA6A 5JYEA 3F5SA 1B7GO 3VZPA 4BB5A 3CXRA 2AE2A 5L9AA 1LLCA 2DPHA 3D64A 4E5PA 3EUWA 3PRJA 3DHYA 3HADA 3OSUA 5CEFA 4BNGA 1I5RA 1JAXA 4BGEA 1XSEA 4NBRA 1E7QA 2H63A 3OJLA 1B3RA 4N5MA 1FDWA 1UH5A 5K0ZA 4GLOA 2YQ5A 2Q1TA 1G1AA 4GWGA 3JQGB 2QZZA 3BAZA 4A03A 5TSDA 4ZA2A 1SMKA 3C1OA 3V1UA 3WTBA 3GPIA 4EYEA 2Y99A 3QVXA 1JQBA 1ML3A 3LT2A 2G1UA 5ILGA 4CMGA 2GNAA 4DQUA 4M49A 2EXXA 3ZH2A 5JCJA 1KEUA 3GY0A 4XZ3A 4NFHA 4XQ9A 5F5LA 1H2BA 2BLLA 4Z0HO 1VKOA 3N58A 3VHRA 5COAA 4YYZA 3QWAA 4KTVE 4IM7A 1LDYA 1BTOA 3RU7A 1R0LA 1BRMA 3RUHA 3ZU2A 2JKVA 4L4RA 4IJKA 1DHRA 1HDRA 1XR3A 5J23A 3PQFA 4BNNA 4IMRA 1GADO 1HDYA 4UVHA 4R1TA 5FI5A 1UDBA 3UCXA 3F5QA 3KSDO 1XU9A 2O23A 3H4VA 3G49A 4FSHA 5C7IO 2ZB4A 3T7EA 4RPJA 4YRDA 4RPLA 2HJRA 4TZKA 1ZIDA 3F1KA 4DYDA 4D3FA 1MUUA 2DBZA 3V2HA 3WLFA 3QVWA 3VTFA 4OXKA 3UAGA 1Y5MA 2EG9A 2GF2A 4PG7A 3GRKA 1A4UA 2ZQZA 4E2XA 1DJQA 4MKXA 1F8GA 1HWYA 2XXJA 2YHUA 4W9NC 3D0OA 1R16A 4PLYA 1XG5A 3I9JA 4PRLA 3SC4A 4ID9A 3OF2A 3RQSA 1JVSA 1A7AA 3GHHA 2YDXA 3PIDA 2DQ4A 2EW2A 4E5KA 4GAEA 3H9UA 2EEZA 4D0SA 2EIHA 3HHPA 4PLPA 1K5HA 1LX6A 4Z9YA 2G76A 1UXHA 1JKFA 1O6ZA 3AUSA 3I5MA 2VRCA 2NWQA 2IZ1A 3DAFA 1EFLA 4HFRA 4ZQFA 5G0TA 3GVXA 1BDMA 3ZWNA 4BO3A 2ZJ1A 2ZB7A 4JJGA 4DL9A 4J90A 4XYEA 4OOEA 2EJVA 3F6YA 2GZ1A 1K6IA 5FWNA 5M6DA 1DLIA 3AUUA 5T64A 2DC1A 4XQCA 2W4QA 1ISIA 4YAEA 3RASA 4BNJA 5AXDA 1TT7A 4CUZA 1BW9B 2B35A 3UH1A 4BNUA 1I3MA 5GZ6A 3KHUA 3VPSA 3HSKA 2EP7A 3JTMA 2OP0A 3F4BA 3E5RA 4WLNA 1T26A 2O50A 4CV2A 5JDIC 2ET6A 4WK6A 4B4WA 4WECA 1HDOA 5JBIA 3SEFA 3WNVA 3DZHA 5TRTA 1E1MA 4FOOA 4XQGA 3ZWXA 1DIHA 1R15A 1QYDA 3NX4A 1GR0A 1M75A 1EZ4A 4GKBA 1UUFA 5A5EA 3NV9A 2PZMA 5DCWA 3ZWMA 1GV1A 3FR8A 4E31A 3PLRA 2HMWA 3X2EA 1NPTO 4BO0A 1M66A 1ISHA 4F6CA 4DA9A 4J3FA 5EESA 1JVBA 3ZHZA 5JYDA 3KZVA 4IY1A 3ZV5A 3DBHA 1MGOA 4MO2A 4FD3A 2PKQP 1ZK1A 2OHXA 1PGQA 1E3SA 1M67A 4NFSA 3LT0A 4U8GA 1X7GA 3PIIA 2Y1CA 4E4YA 4DLBA 2O7SA 3ANNA 4W9NA 4WCDA 1VI2A 2I99A 3TZQA 1UZNA 1B16A 3GZNA 4FJ2A 5BR7A 1OAAA 4U0JA 3AI2A 4CMKA 2D5CA 3FTNA 5F1OA 1B8VA 2C07A 3F46A 4EEZA 1EVYA 3FRJA 1C1XB 3QSGA 3BMQB 1PS0A 1WMBA 1WWKA 2JCYA 3GQVA 1H93A 1CWUA 1NPDA 3W8EA 3ZU3A 1MG0A 4PLZA 4G65A 1BWSA 1KVRA 1NFRA 2NU7A 1E0DA 4MPDA 5CFZA 4IDGA 5CEJA 4M89A 4I08A 2FRDA 1U4OA 5KKCA 4E2ZA 1T2CA 2F1KA 4K1LA 2XXBA 1W8DA 1ZJZA 3NEPX 2X86A 3NJ8A 1GEGA 2HRBA 4ZHSA 3OETA 4IDEA 1KVSA 3GNQA 2HK9A 3HDJA 4BO8A 3FNFA 4CV1A 3C1AA 4UVEA 1PQPA 3L0DA 3R3SA 4BS9A 4YCAA 3C3XA 3DWFA 3DZIA 2Y1OA 1X13A 1GZ4A 2C7GA 5DBFA 1V6AA 2WWRA 5HTOA 3S2FA 4IS3A 2EHDA 4UAGA 2DU8A 5K6AC 4BNXA 5A4DA 2OBNA 3E48A 1IPFA 1O89A 1UXJA 5A06A 1HETA 1SPXA 2JD0A 1EK6A 1UDAA 1T4BA 4OXYA 3ZWBA 4I9UA 4Q3CA 4DLLA 3JCZA 1NVGA 5L7YA 3FI9A 3GN1A 2GGSA 1YL6A 5JS6A 2Y1DA 3GZ4A 4XB1A 4GI2A 2GERA 3RKUA 5CHEA 4IJUA 5F3RA 2DAPA 3WIEA 2HMSA 2R00C 4JX8A 4NH4A 3H9QA 2NTJA 1TT5A 3HB4X 4RVSA 5JAMA 4A26A 3KETA 4DQXA 1HXHA 4YACA 4AJKA 1X1TA 3RJ5A 1DOHA 4OOFA 3U0BA 4EEXA 4Y8VA 5J9GA 5C7LO 3AOGA 4YXFA 2AQ8A 1YB4A 3EHEA 2QIOA 4GLLA 5G0WA 3DZJA 4LSMA 1Y8QB 2JHGA 2ZKLA 4NK4A 4NU6A 2FY8A 1YOVA 2V6FA 1F14A 3I9NA 5JO0A 3HDYA 1R4NA 4YJGB 2P68A 5I9LA 1H0KA 1ZK4A 2VOJA 4PLGA 5KVSA 2A9FA 3PI7A 2GD1O 1ADGA 1DPGA 1QYWA 1RM4A 2ZYAA 4E33A 2VZ8A 4YJDA 5KVVA 3DB2A 3M1AA 4Y6SA 3E5MA 3G1UA 3UF0A 1AGNA 2I3GA 1EUDA 3A06A 3DTYA 4R1SA 4DLAA 3GAZA 1N7GA 5FEUA 1PGJA 3WMWA 4BOYA 3BHIA 4QSMA 3ZNOA 4DPMA 1LQTA 3MCVA 1TB4A 1XLTA 3R1IA 2P4HX 3KEOA 4ND4A 2RHCA 4WCFC 1FK8A 1YQXA 1DLJA 4DIBA 1N92A 1NVTA 2FMUA 5KJ6A 5LDHA 3DMTA 3SXPA 1RPNA 2VNAA 5KOIA 1CJCA 3KM0A 4TSKA 1N7HA 3DZKA 1YBAA 2ZTVA 3I6IA 4MVJP 2QG4A 4WEQA 1U9JA 5ER9A 3UW3A 3A14A 3FNGA 2OORA 5G0SA 2P9EA 5KJ1A 2AMFA 5GZ3A 3GG2A 3MWEB 3QWHA 4DUPA 5JDCA 1A5ZA 1P33A 5A9SA 1EDOA 3VKVA 5FF9A 2P5YA 1PJTA 1J0XO 5T73A 2JCXA 2ZB8A 4KWIA 2NU9A 3BA1A 3DFUA 3I83A 5DN9A 4LMPA 4F45A 2WDZA 2EP5A 3GF4A 4EZBA 5L53A 3QV1A 1NP3A 1VLLA 2PY6A 4MVJI 3K30A 5MGBA 1KVQA 3WYCA 2V6MA 5DZSA 1GU7A 2D8AA 3FWNA 3LT1A 3PEFA 3DOOA 1WMAA 4RQUA 4B4OA 3WGZA 1D1TA 1HRDA 2QW8A 1X7DA 5KVQA 1B8PA 5L45A 4J7UA 1BXZA 2HMTA 5HA5A 3K5PA 3INTA 4R9RA 3FTPA 2I3AA 3LU1A 4OJNA 1P31A 4YBZA 1SEVA 1ZK0A 3CTMA 3W8FA 3I4FA 4FQ8A 3UICA 4AJIA 1E6UA 3BTVA 1RJWA 2QQ5A 1Y8RA 3WDSA 4NBVA 4II3A 4ZD6A 1FMCA 1KVUA 2BELA 3R3JA 1NR7A 1PGOA 2W2LA 2PNFA 1YDWA 3QE3A 1ZXBA 2PLAA 1NWCA 5T5QA 3RUDA 3WGQA 4IZHA 7MDHA 3EVTA 2D5AA 1U8FO 3INGA 1EBUA 5L4NA 1M6WA 2YQ4A 3LSYA 4XYLA 2RIRA 3LC1O 4YAGA 3GDFA 5FYDA 4DC1A 4E3ZA 4LISA 4QX6A 1PJ4A 2E37A 2ILTA 3AY6A 4ND1A 2VZ9A 3CINA 1VRWA 1BXKA 1PS9A 4J4HA 1VL6A 3AFNA 2VQ3A 2HUNA 3H9GA 3ZNNA 5HS4A 4YQYA 1DB3A 2QRJA 4J7XA 3GRPA 2O3JA 3BHJA 1GCUA 1ZUD1 3VPFA 4XWYA 5IZCC 2IRWA 3JD2A 4JP3A 4CL8A 4AJ4A 4CR7A 1Q7CA 4EJ0A 3AM3A 3D3WB 5F1KA 3KSZO 1KC1A 4F3YA 3W8DA 1OZAA 4ROSA 4E0BA 3AW9A 4CLRA 3RROA 3WQSB 1PGPA 4LMRA 4OQZA 2ZJ0A 1ISMA 3QWIA 3RJ9A 4L75A 1Z7BA 2IEBA 2VWQA 3LDHA 2PH3A 1WDKA 3P2OA 3OJFA 1I2CA 4NJOA 4YRBA 3AOEC 1YWGO 5EN4A 4WGGA 4G5HA 1M76A 5JY6A 2Q4EA 3I3OA 3QWFA 1YL7A 1EEHA 1QMGA 3X2FA 1PL6A 3BIOA 2UV8A 1LRLA 3LLSA 2Q99A 1PZGA 3L07A 4HFMA 1A7KA 1V3TA 3RUAA 3BMCA 3JQAD 3BHMA 1XGKA 5KIAA 1EQ2A 4DBVO 2H1SA 3KO8A 5AXBA 3E18A 1IPEA 3S2EA 3Q2IA 1EE2A 1YGYA 5JPIA 3ZV3A 3UHAA 4PVCA 3D4NA 1C1XA 1ISJA 1SB9A 4JNKA 5MDHA 2HMVA 2Q3EA 5TQVA 8ADHA 3ZGYA 1E3WB 2EGHA 2DUUA 4HNGA 4HADA 3ORFA 1F17A 1Y1PA 5I7EA 3K8ZA 3WXBA 2AG8A 1BGVA 4NI5A 3G1TA 1F0YA 1X14A 1YXMA 4CLOB 1YL5A 1AUPA 4OMUA 3A1NA 3H65A 4OGWA 1DC5A 1XQ1A 4PLHA 5I8WA 4BGVA 3GEGA 4ND2A 1XQ6A 4OSPA 3AU9A 2GYYA 3H3JA 4A5OA 4YDRA 1HT0A 4PLTA 2DBQA 3I9OA 4YAIA 2VHZA 2QRLA 1WPQA 1DIAA 1OC2A 3EMKA 2E49A 4MKZA 4CM4A 2DVMA 1FDUA 2AEFA 4EGFA 4MIEA 1Q1NA 1MXHA 2FPGA 5CDYA 3WMXA 1IL0A 4J91A 4TKLA 1J49A 5GZ1A 1LDGA 3H9JA 2PZKA 4XGIA 1QYCA 1QRRA 2XPCA 2HCTA 3LK7A 3DBVO 1GUFA 3ZWVA 2VHYA 2NLOA 3SJ7A 5DCYA 4MP3A 4B7CA 4BVAA 5EQFA 3PYLA 2HK8A 5A03A 3SVTA 4E5YA 1PSDA 1R12A 2B5WA 3Q1LA 3O9ZA 1WDMA 3MJTA 3PFFA 5H81A 3WWYA 3JQ7B 4AJHA 1GUZA 2I5PO 4NMHA 1YKFA 3PYXA 3OIGA 1P1RA 1FF9A 3JQDA 1OMOA 1QLJA 3WR5A 1LSJA 4IDCA 4IDDA 4UEKA 2CY0A 3D4PA 3LT4A 4PG4A 1R4NB 4O63O 1AXEA 3PGXA 1GFSA 3EY4A 2HJSA 3DBRA 4YTEA 5ILOA 5I7VA 3V1TC 2GZ3A 2W2LD 1GPJA 3OQ6A 4RF3A 5FI3A 3UOGA 2PGJA 1BDBA 1LC0A 3ANMA 3HDHA 4Q3AA 1ZEMA 4IBOA 3HN2A 4AJJA 2WD7B 2X0RA 4E6PA 1NFFA 3LF2A 5L51A 2RBEA 4ZRMA 3RIHA 3CIFA 1GAEO 3IP3A 4XGNA 2DLDA 5FFFA 2C2YA 4FFOA 4E5MA 1ONPA 3U4IA 3U9LA 2WE7A 3VDRA 1N8KA 3JYNA 1P0CA 1HZZA 2IZZA 2IXBA 2GN4A 2WYVA 4Z9FA 3W4JA 1CERA 1YBVA 5BQFA 5EL0A 1L7EA 2P91A 1P1JA 3AM5A 4R54A 4HNHA 2IE0A 2D2IA 4MIYA 4HP8A 5CDTA 1UXKA 5I7SA 1SCUA 3GEDA 3G0OA 4QT0A 4WNCA 4YAJA 4H16A 3S55A 2X6TA 5JDCC 4GGOA 4B4UA 4IXWA 2P9GA 1U4SA 3ZV6A 3OP4A 4QFDA 5F1PA 1TA4A 1AHHA 4BNKA 1I10A 5KKAA 4A7PA 3DXFA 4BNZA 4K28A 3IOYA 4D3SA 3IQDB 3STHA 4J9UE 3GVPA 1SAYA 1E7MA 1G6KA 1LDEA 2WYUA 4RVUA 2EJWA 4CUJA 2AHRA 2P4QA 5BSEA 5CDSA 1I24A 2IEDA 2O3SA 3HZZA 1ULUA 4JGBA 1GD1O 5F21A 4IUYA 4RPHA 1QYVA 4Y6PA 1Q0HA 4IIVA 5AXAA 1KBZA 2I9PA 4D79A 1HDXA 5THKA 1NBOA 2VHWA 5COQA 4CQMD 1JKJA 5TIIA 2CF5A 1CRWG 2Y93A 2VRBA 4JBHA 3TFOA 2Q2QA 1A4IA 2FZEA 3ITDA 1N9GA 3BTSA 2JAHA 1V3UA 1EFKA 1ZK3A 3JQ9C 3B20A 4GWKA 4P4GA 3UGKA 4DMLA 1HYGA 4NK5A 4L4XA 2E48A 4OQYA 5A9TA 3ZI0A 3W4IA 4N54A 4QEDA 1B3BA 4CMEC 4H15A 5JCXA 3TF5A 4K9DA 4Y67A 1P1HA 5U4QA 1YBMA 1X1EA 1EVIA 4E5NA 3PGJA 1JWBB 3TNLA 4XYMA 3E6AA 1ZW1A 3IIEA 2IZ0A 5JW6A 1PJ3A 3KTDA 4GSKA 2G5CA 2IYOA 2W90A 3OFSA 3EC7A 4IJVA 5HWSA 4FJ1A 1MX3A 1NM5A 2YDYA 1T2FA 4XDZA 1U3TA 2HRZA 1MV8A 3K6JA 3GFBA 4BHTA 3DBHB 2O3RA 3LYLA 4BGUA 1Z6ZA 3NKLA 1NQAO 3H5AA 1T2EA 2OGUA 5DULA 3HNPA 2ZTUA 2Q50A 3L4BA 4P8RA 1ZZEA 4Q39A 4HXYA 3UCFA 2D0IA 1ZEJA 3GVIA 4CJXA 4YAKA 1T4DA 2Y1EA 3VH4A 1NNUA 4ZQEA 5IXSA 4YEDA 2O3TA 3ZWCA 1PJLA 1K6XA 1Z7EA 2X5OA 4PG5A 3BTUA 3WTCA 3L9XA 4YJHA 3VC7A 3GR6A 5DP2A 1TEHA 2CVZA 2VUTA 1MA0A 1PJBA 2NVBA 1A72A 3LLVA 3ANLA 4ND3A 1T2DA 1NHWA 4YT8A 5JYAA 2B69A 4GH5A 4RGBA 2JJYA 2YV3A 3QA9A 1JLLA 3H9EO 3GZNB 3KLMX 2Z1NA 3O8QB 1I36A 4XD2A 3QIVA 1LUAA 2OUIA 3H5NA 4WNIA 5AYVA 1RM5A 3H5RA 1W4ZA 4QQRA 1G0NA 4Z3KA 3O38A 2GN6A 4BKOA 1I2BA 3EYWA 4TVBA 3WGIA 4P22A 4RDHA 3ZHYA 5TLSA 3VVCA 1E1NA 4CM3A 2J5QA 2R2GA 1PL7A 5B4VA 1S7CA 2NU6A 3WQQA 1E5QA 5A9SB 1KYQA 4QUKA 5G4KA 4W6ZA 1LLDA 4M8SA 2UYYA 5C3MA 3GUCA 3WGOA 4E32A 1MLDA 2YHIB 1ARZA 4O6VA 1TLTA 4AL4A 4MOWA 4R16A 3UVEA 2NTVA 5JLAA 3IUPA 3K31A 1A9ZA 4TKMA 5IN4A 3TL3A 1K2WA 4WPGA 2CVOA 3MZ0A 4MP6A 3WGTA 1H5QA 1CEQA 3BMNB 4WKGA 3A28A 4U6QA 3QRWA 4OO3A 4XGKA 3PJEA 4E30A 1Y9AA 2VHVA 2HAEA 5U9CA 4IS2A 1K3TA 3CPSA 2OMEA 5EJ2A 2O2YA 3MJCA 3EZLA 4IGEA 4KWHA 3RUEA 3ASVA 3NGLA 2C5AA 4OSOA 1HL3A 4PRKA 4BL5A 2JFGA 3OJ0A 5IZ4A 1E77A 1R4MA 1GUYA 5A1TA 4NBUA 4OKIA 5DBGA 1LLQA 1BXGB 2PTGA 4C4OA 1B14A 4JJFA 3OJEA 5JAZA 4JP2A 4MVJH 4H3VA 1EE9A 3FBGA 2Y1FA 4PZCA 4XA8A 4ZQBA 1AXGA 3ZWYA 1DEHA 2VT2A 1YVEI 1QORA 2YUTA 1ISGA 1CDOA 1O94A 3DZFA 3SLKA 4NU5A 4YJGA 1D3AA 3TDKA 4MKRA 1ZO8A 4J9VA 4LVCA 4FGWA 1GTMA 5COBA 4A27A 1BSVA 1V8BA 5JAIA 4CLXA 3WSVA 4E13A 3HJAA 4J1QA 3ZCXA 4JBGA 5ADHA 5ITVA 3E03A 1LDNA 2XAAA 4Q3NA 1EBFA 2H6EA 4EI2A 3ROQA 1B8UA 4EUHA 2UUPA 4XJTA 3P5SA 2DPGA 1SNYA 4P4LA 4MINA 4RVHA 1HE5A 4NR0A 4F46A 3SC6A 4BNIA 1SO8A 2B4RO 1KERA 1V0JA 4BKRA 5BNIA 3KYDB 3MTJA 1Z73A 3WGHA 1KEVA 3WS7A 2JFFA 2FR0A 5H82A 3FR7A 1X15A 3UUWA 3DAPA 4JJIA 2X9VA 1ISFA 1ZJYA 4CLHA 5A02A 1JTVA 1JKIA 4Q3BA 2GPTA 1DSSG 4YJFA 2FR8A 2I6TA 3WBBA 1QV6A 4CUKA 3LZ6A 4JBIA 1LXCA 4ALJA 4TRRA 3B1KA 1DAPA 1UZLA 3DQPA 5TNXA 3SBOA 4O59O 3RCBA 1HDZA 3JQ8B 3P19A 4OXNA 2HMUA 3GUYA 2YHIA 4FC6A 5L40A 2NQ8A 2X5KO 1E7SA 3UFXA 1GQ2A 5TJ9A 1U7HA 4HX5A 4PLFA 1H9AA 1W73A 4J43A 3F1LA 3TZHA 3VZQA 3S2GA 3K96A 4RVGA 3IKTA 2G17A 1ENYA 4C7JA 4CM8B 3ZN2A 3LQFA 4FDAA 1HEUA 5U1PA 2YYYA 3JD4A 4E21A 5T8KA 3HN7A 3OIDA 5A04A 4FFLA 3ZWWA 2JHFA 4J4TA 2AQHA 3WQRA 2G0TA 4B3HA 4FGSA 1PZFA 1DC3A 4AICA 3O8QA 1N1EA 4CR8A 3WYBA 2EWMA 1ZMOA 3OBBA 4UUOA 2QYSA 1E1LA 1P1FA 5HM8A 4R1NA 2E4AA 2ZCUA 4HUJA 3TFQA 5CDGA 3RBXA 1LRJA 1P0FA 3AY7A 1DFHA 5I9MA 4F6LA 1TXGA 2FSVA 4WLOA 3RAJA 1C0PA 4W82A 1NASA 3OA0A 3Q0EA 2OOSA 3O03A 4LK3A 1LTHR 2OBYA 1ONNA 4MVJE 3ULKA 4RF5A 2B4TO 2OO5A 4Y98A 3GDOA 2J6IA 1C0LA 5A3JA 1WP4A 2CUKA 4I9HA 2NQTA 3N74A 3OICA 4GX5A 4WE3A 3S1LA 5JYFA 4AJOA 4MVJG 1J4AA 2FPIA 4UEJA 4DIOA 3IS3A 4BO2A 3RBZA 2VTDA 4OL9A 1ZSNA 2JL1A 3IAHA 2Y66A 3ROPA 3NTQA 1PJQA 1MC4A 1SOWA 1X0XA 4R69A 2A92A 3BMOA 3RUCA 2FWMX 3GVHA 2G82A 4PGFA 5HS6A 2YV1A 2HK7A 1ADFA 3Q9NA 4GMGA 3JV7A 3F4LA 5A5FA 4DVJA 2Q2VA 3JQ9A 4CM7A 3JD1A 5ENVA 5JDIA 4HFJA 2CNBA 1G0OA 1B0AA 4RV9A 4GBJA 3PQDA 4Q3DA 1PJ2A 1LA2A 3DC2A 1MP0A 1MXFA 1ZMTA 5JCJD 3SJUA 3ICCA 5GY7A 1WZIA 1GYQA 3ASUA 5AVOA 2B4QA 2VYNA 3EGOA 5TX7A 1NX6A 4GX1A 1XWFA 1Z74A 4M54A 1W0CA 1X7HA 1GDHA 3MJSA 3TL2A 3WFJA 2EKLA 4EJ6A 3F3SA 1Q7BA 3GGPA 1DHTA 1DJNA 1U8XX 1U5CA 4BKUA 5IN5A 1Y6JA 3L9WA 3PXXA 3I4CA 4J2OA 4JXKA 2C5EA 4IDAA 4LSWA 3F47A 3E9MA 1HE2A 1NYTA 1OBFO 4RCVA 4A2CA 3V5NA 3FN4A 4WLEA 3ZDFA 3RFVA 3DL2A 1DIBA 3PHJA 4BNTA 1T2AA 1MFPA 4AJLA 1U2DA 1LJ8A 5T57A 5JSFA 1E3JA 4BNLA 4CLRB 3DOCA 3QP9A 4CM9A 3OH8A 1H9BA 4A73A 1VPDA 1Z82A 4Y6RA 3U4DA 3LC7O 4NHEA 2ZTLA 3ONFA 4R3WA 4BIIA 5G4LA 2Q1UA 1VJ0A 1U3WA 3GT0A 4DMMA 3KUXA 4ESOA 3AI1A 2HKIA 3VZSA 5L4SA 1KIFA 1P44A 3CMMA 2WD8A 3GEMA 4J16A 3OEWA 2DTEA 2X9GA 3GNTA 3GH3A 4CR6A 6ADHA 1J5PA 3PZBA 4K6CA 2X58A 2Q4BA 3ITKA 3KSUA 1PS8A 2NNLD 4ALIA 3A4VA 1R4MB 3DONA 4CQMB 4DIFA 5HBRA 4L76A 2VCYA 3U4HA 2X8LA 4TRMA 1VKNA 1U3UA 1JWAB 3ETEA 1K6JA 5CPBA 3PTZA 1DRWA 1IE3A 3GAFA 1JW9B 4FFPA 3VH3A 3FNEA 3ZW8A 3PK0A 3G3EA 2DT5A 3HDQA 5JO9A 3KEQA 3BMNA 2RAFA 5LCXA 2X4GA 3DZBA 5IG2A 3K9QO 2HLPA 1F12A 3NJ4A 1I0ZA 3PQEA 4EDFA 4GVLA 1FJHA 4GL4A 4DC0A 2J3KA 2O4UX 1ID1A 5IDQA 2WD7A 4R9SA 4YT5A 3F9IA 1GZ3A 4HFNA 1LLUA 5AOVA 3DTTA 4N5LA 2V65A 1BVUA 3TZKA 3AUTA 3BXXA 5JAQA 4PLVA 3CSDA 1KC3A 3EAGA 2AQKA 4I5GA 1B15A 4YWJA 1EVJA 1ZSYA 3E82A 1VC2A 3IDSA 3VVBA 3R0IA 1H6DA 2GR9A 3JQ7A 2HO5A 3I9LA 5DOVA 4E2YA 1YJQA 1LQUA 2CF6A 1R6DA 1HTBA 1LRKA 4KQWA 3JQGA 3P2YA 3IUSA 1XHLA 3I9KA 1YRLA 2VYND 4KMSA 3QVTA 2RH8A 4PLCA 4L9RA 3OA2A 2CVQA 2DFVA 5EINA 4KDEA 3EZYA 5BT9A 1UXGA 2X0NA 5I9NA 2R00A 5IDYA 2BFMA 3ENNA 2Y1GA 3JQEA 4TVOA 5LC1A 3U5TA 3CH6A 1UAGA 1XEAA 3L6DA 4RLHA 1BHSA 3OEYA 2CDCA 5EQDA 4MVJA 2C2XA 3NUGA 4OM8A 3LVFO 5DOZA 1R0KA 3DR3A 4KOAA 1PZHA 4IZIA 4KQXA 1NPYA 4HY3A 3WOHA 1IYZA 5CEEA 4CMCA 2PZLA 3B1JA 3PLNA 3DBLB 1ZVMA 1ADCA 3AFMA 1NQOA 2GUGA 2PKQO 2O4CA 1HZJA 2UAGA 3VH1A 3VPXA 2D1YA 3JYLA 4BQRA 5JXWA 3PWKA 1R37A 2Q45A 4OYRA 2BFAA 1E3EA 3Q9UA 5KNLA 3PPIA 2VWHA 1PR3A 4R4JA 5G4KB 2NV6A 4CLOA 3VPHA 2PGLA 1GV0A 5KJCA 4CM5A 1QSGA 3PJFA 3ZW9A 2WYWA 2BFPA 4B7UA 3COSA 3JYQA 4GVXA 1WDLA 1IB6A 1ZBQA 2Y0CA 3HFGA 2ZYGA 3NAQA 4L74A 4RO0A 4A0SA 1PIWA 2H9IA 3ZWAA 5JY1A 3HFSA 5G0VA 1HSOA 3HWRA 1LI4A 3R6DA 1DRUA 3ZU4A 3Q6IA 4G2NA 5TS3A 3ADPA 1YONA 2W8ZA 1P74A 3N7UA 3DMTC 2A35A 2RCYA 2YFQA 3AUAA 3Q11A 2CSUA 1D7OA 2X0IA 4B3JA 1QXSA 4RJTA 1Q0LA 3BMCB 4BNWA 2BMAA 1E92A 3RFXA 1U7TA 3B70A 3SLGA 1YE3A 4PG8A 1UP7A 1C1DB 5AQ1A 1IULA 4U6SA 1YS4A 5T67A 4MJLA 4WCFB 2EGGA 3NDJA 3RUIA 3NDRA 5ENDA 3HUDA 2QHXA 4BGIA 2PD3A 3ABIA 2C54A 2WM3A 1RKXA 5G2OA 2BI8A 4YB8A 4CM9D 4D44A 2NM0A 3FF4A 2BF7A 3TSCA 2PWZA 2JD2A 1WNTA 4D45A 3ZNPA 2ZTMA 4HV4A 1UZMA 5IJZA 2ZB3A 4LGVA 1E6EA 4AJ2A 3BMQA 2W98A 2RHRA 4NNJA 2X23A 4CMAA 4FB5A 1E3IA 4CQLB 1D4FA 2GSDA 5G0UA 2NUAA 5L4LA 3E9NA 4GGPA 3W6UA 2NVUB 2CFCA 4IXTA 3UN1A 1JA9A 4ONEA 3AI3A 3O4RA 4PIVA 2F00A 1AHIA 2AW5A 2NU8A 4CMBA 4D7AA 4NQZA 1EUZA 4MVJD 4AJEA 3VPGA 3AM4A 2VTEA 5CG1A 4J6FA 4MP8A 5A9RA 2ZCVA 1Q2XA 2EERA 1EUCA 3M1LA 1UXIA 3DFZA 1IOLA 4UUNA 3PDJA 4UVDA 3ICPA 4TZTA 3MJ4A 4ZJUA 4D43A 2GDZA 4IPTA 2YY7A 3NGXA 1B2LA 1NFQA 4D3DA 2BGMA 2ZATA 1P77A 2CD9A 4LN1A 4DPLA 2Q2WA 4YPOA 4Z0PA 5BSHA 2ZQYA 4WCFA 3KB6A 5BSGA 1HKUA 4Z0TA 5ICSA 1NTOA 2GLXA 3DBLA 4DBZA 3HE3A 1Z75A 3D7LA 4L73A 3MJEA 5L3ZA 2UDPA 4W99A 1AE1A 1ULSA 4XCVA 1OI7A 2VYVA 5EIOA 3M6IA 1NAIA 2PH5A 3CMCO 3K2BA 2VZ0A 1GZ6A 5KJFA 1OOEA 4INAA 4BQPA 2TMGA 1T24A 4ZVVA 2A4KA 2O3UA 4DREA 3V2GA 1OFGA 4H7PA 3TOXA 2X5JO 1IZ9A 1LEHA 5ICMA 4CLEA 3GOHA 1XDWA 3WBFA 1HYEA 3RFTA 3OQBA 2D3TA 3JD3A 4IQGA 4WASA 1KEWA 1JAYA 4EJMA 2Q1SA 3KYCB 3IL2A 2POQX 4D41A 3PHLA 2PA3A 3NTRA 5KVCA 2NVWA 4QXMA 4CLDA 4TRJA 7ADHA 5IXYA 2FSSA 1E7YA 3MOIA 2B37A 2GCGA 3O26A 4IQ0A 4BO9A 3T4EA 4X54A 1H6AA 4S3MA 1SC6A 3ROMA 4CM8A 4B7XA 3PWSA 4RZHA 2JAPA 2OP1A 4IMPA 4BB6A 4PZEA 4BMNA 1YO6A 5A3VA 1GYRA 2YZ7A 4UEOA 3EDMA 4ZRNA 2Q22A 1I2ZA 3E8XA 4UUPA 3I23A 4QTZA 1ZH8A 4ALLA 2EF1A 4YR9A 3RC1A 3G79A 3PFWO 3GGGA 5L7TA 1Q7GA 2CZCA 4L4SA 4OHUA 3GMDA 2DKNA 1L1FA 1DAOA 1NR1A 4JK3A 1E1KA 2WTBA 3PHGA 4YVFA 3ETDA 1HE3A 2IYPA 3L77A 4XQEA 3RBVA 1VL8A 1WW8A 1MC5A 3DOJA 3C7CB 1J6UA 4OIMA 1E3WA 3OJOA 5K9ZA 4QECA 4U5QA 3QJ5A 1BG6A 3G17A 4XIJA 4FFRA 1KY5A 2AA3A 4R3NA 1XKQA 3KXDA 4TMFA 4LVUA 3PJDA 3GMSA 4ALKA 1DXYA 1E7RA 4GPD1 4KUHA 4J7CA 2LDBA 2Y0DA 2PKRA 2VUSA 1MG5A 2PD6A 1U3VA 5F5NA 6LDHA 3DMYA 3FCOA 4BKPA 3TZ6A 3C7AA 4FPXA 3NT2A 4B8ZA 2C0CA 4XX0A 3ON5A 1Y8QA 4NJMA 4AG3A 1IHXA 3UXYA 4AFNA 4DXHA 1V9LA 3ETGA 3AK4A 3DO5A 2OFPA 4BNMA 1LBEA 3NT5A 1I30A 3V1YA 3ROKA 3IMFA 1SZJG 1HLPA 2LDXA 4PCVA 4J2HA 3RUFA 3VOSA 4J0EA 4Z6KA 1Y5RA 3VZRA 1EDZA 4AVYA 4CMHA 4WOJA 5JE8A 3D5TA 4RDIA 3WIDA 1W6UA 4P4NA 5IDWA 1TT5B 3GGOA 3WSWA 1Y9EA 3U49A 3D3WA 3MOGA 4JROA 3JSAA 4BV9A 2PGDA 3H3FA 1HSZA 3QVOA 3UKOA 3W6ZA 4YRAA 1TVEA 3OM9A 2NVUA 2VRCD 3CZRA 4DQVA 4NFYA 3DZGA 4JLWA 4CQLA 1QV7A 3I6QA 5L7WA 2BKAA 1PZEA 4FOSA 4TRNA 2I65A 4FFMA 4QFCA 4FJ0A 1RYDA 3FHLA 1N9GB 3JYPA 3WJ7A 2B0JA 1PQUA 5TF4A 1UJMA 2B36A 2Y67A 3VAZA 3WB9A 4MVJF 3RC9A 3H2SA 4CV0A 1C0KA 1K89A 5JC1A 5JMPA 3PVZA 3WWZA 4PLWA 2SCUA 2B5VA 1P3DA 2BFOA 3WGGA 9LDTA 2GO1A 4HWKA 1I8TA 4BMSA 2NADA 5CP8A 3KBOA 1C1DA 1MB4A 2VWGA 1QG6A 5B4TA 2ZYDA 1WZEA 1DFIA 1IY8A 3TOZA 2C29D 3D3EA 4LCJA 2GZ2A 3FPLA 5DCUA 4YT4A 3KVOA 3KV3O 4XYBA 1F8FA 2P9CA 2VYVD 2FOIA 5BNFA 2BH9A 3MTGA 4FBGA 1YB1A 4RPKA 4J1NA 2A94A 4IINA 2HQ1A 4ZICA 3GHYA 5IDXA 3RKRA 1PU2A 1QP8A 2VT3A 3W1VA 3PJGA 3ZV4A 4C7KA 3TPCA 5C5IA 3IC5A 5ES3A 2GN9A 4R51A 1O8CA 4PFJA 1NXQA 2P2SA 1K0UA 3GN2A 3ZHBA 4BO5A 2V6GA 3K2EA 2DBVO 4ZGWA 1EK5A 1AN9A 3RD5A 1GL3A 2WEKA 3P7MA 1KS9A 5A05A 5KWEA 1EMDA 1LU9A 2OXIA 3Q2KA 1UP6A 1DIRA 1M6HA 4UUMA 3T4XA 3PHIA 4Z9XA 1EVZA 4W7IA 3D1LA 1YQGA 4ALMA 4KUEA 3GG9A 3GDGA 5DP1A 5ER6A 1E5LA 1A71A 3OHSX 3RVDA 1I3NA 4Q9NA 1X0VA 4XB2A 3AY3A 2H5LA 2DTDA 5BNTA 2X0JA 1RM0A 4PZDA 4Y9DA 2O48X 1RYEA 3DHEA 4M55A 2EW8A 3V8BA 4WUVA 4ITUA 4XYGA 4D42A 1PX0A 3C85A 3NT4A 5I8ZA 1GQYA 4XRGA 3KYCA 3TRIA 3AJRA 4XDYA 3WLEA 1V3VA 3K73O 2E82A 1SB8A 4CMJA 1LSUA 4ZQHA 3ZWPA 2C82A 3KOUA 2Q49A 3GPDG 2CDAA 1PGNA 2VNSA 4R01A 4RPGA 1CIVA 4LCEA 4A10A 4IQ8A 1BW9A 4BO7A 1DDOA 4FFNA 1VJ1A 4U0KA 3OIFA 3L4BC 4HKTA 4J1SA 3RSHA 3W4KA 3I52A 2RH4A 2GRAA 1Y81A 3HB5X 5IZCA 3K92A 4EW6A 2FZWA 3VDQA 4B4VA 1HYHA 5I7FA 3MEQA 1WAMA 4B8WA 3JQBC 3L6OO 2CMDA 1NQTA 2WE8A 4J0FA 1XU7A 1UAYA 2Q46A 2FPPA 4XRRA 4ALNA 1GQQA 1U2GA 4TWRA 3CUKA 2UVDA 4OKNA 3PP8A 2J3JA 2YFHA 2QRKA 1HLDA 3JQFA 3L6EA 2I67A 4HBGA 4AJ1A 1UR5A 1E6WA 1PWXA 2JFHA 2EKQA 3H2ZA 3AOEA 4DGSA 3FNHA 4XKJA 1ZCJA 3CE6A 3INRA 4ZQGA 3ZWOA 4BO1A 2FN7A 2I76A 4YJFB 3T7CA 3IJPA 4RLSA 5CDUA 1P9LA 2Z1MA 5KTKA 1ADBA 3FSRA 2PD4A 4BV8A 4E2WA 2W2KB 2ZK7A 4KDFA 4DYVA 2O3QA 4N18A 1DFGA 4CQMA 3FD8A 4BMVA 4FIZA 1E7WA 3GA0A 3QQPA 4JN6B 1FDVA 4RVDA 1H94A 2ZIZA 3VTZA 5CG2A 4J49A 3DBRB 3V2UA 1B26A 3ZHXA 2X22A 1I33A 1DRVA 2PV7A 1M2WA 4M86A 4URFA 1BVRA 4O0LA 3S2IA 3RC2A 3ZZNA 4CPDA 4XR9A 5DDIP 1FXSA 2QX7A 4O1MA 2FHSA 4FC7A 4B3IA 2HU2A 4YT2A 2O7QA 4UULA 4UREA 1VL0A 3RC7A 3TZCA 4BNFA 2J3HA 4L0QA
chains in the Genus database with same CATH superfamily
2QDKA 5G02A 4C3ZA 5GVSA 4PSAA 5LP6F 3A3YA 4B43A 5K3CA 2H8KA 2VSNA 3D6FA 3L8HA 2E3JA 4X6UA 5E9WA 3ZYCA 4Z4CA 1IJFA 1W8IA 4OQMA 1WVGA 1NWHA 3PWZA 2PMEA 4JI3B 4AP5A 1ZAYA 4C14A 5TT1A 1P0MA 3MUFA 2HB6A 3K9FC 2HEGA 1P91A 4GX2A 2WC1A 4DMGA 4RL6A 4G5OA 2NTNA 1QIGA 1ECCA 1X8KA 2HBYA 2KWIA 2OXCA 1L4FA 2VPIA 1U9ZA 1W75A 4HAOA 4HLUC 4Q1VA 1U28A 3CG0A 3MJVA 4QXPA 4ZAGA 1YQDA 4YP9A 1U1IA 4FHCA 2VYFA 5LQCA 5CM9C 3T7DA 3T7RA 1Q0SA 4RORA 2C9YA 5JROA 3DH0A 4YRQA 1G98A 3UHFA 3I5AA 2WOOA 3T5PA 2WNIA 4XFDA 1U2GC 3EC1A 4B6GA 1KAMA 2VPPA 1LTQA 3BMOB 4I1UA 5H68A 3FAKA 3PUZA 1L9KA 2QP9X 3KVYA 4ZXFA 4LYYA 5B1SA 4F2WA 2AVNA 1U1CA 4IV0A 3GLIB 2E4UA 2Z58A 1FFBA 2H1HA 1KMNA 2CDBA 3UH0A 1UBMS 5I7RA 3U09A 1R0ZA 1F06A 4H1VA 2CNNA 2J8ZA 1W9HA 3EZ6A 4FD2A 3ZIUA 1CUBA 4LJ4A 4DZZA 1HOXA 1G3QA 2YV2A 3EA5A 2QW0X 3LL7A 3OECA 1U65A 3OZEA 5GV8A 3M34A 3WJAA 3ZD6A 5B12A 2KBEA 1ILWA 3COJA 4QXOA 1SA0B 3T3NA 4WK2B 3C7DB 4CRWB 2JFOA 2QD2A 2YASA 3LPNA 4P82A 4WN9B 4PVDA 5ARDA 3N53A 2O19A 3KT0A 2XCIA 3SD7A 1THGA 1DO0A 1TLFA 4PPNA 4BP9A 4FEAA 3R2JA 1JIKA 3JQRA 2GZHA 3EW7A 1ETUA 1NXOA 4ILKA 1FUIA 3RFCA 4FE7A 4C0AC 1QYXA 2PZFA 3D3JA 4HWGA 3UCEA 4AN0A 3MMSA 3DL7A 1XYVA 4C06A 2G8LA 1HKHA 4MZDA 2IW3A 4PS0A 4S1VA 2CL0X 2BUBA 2R4TA 1FSZA 2WWXA 2RHMA 3K05A 4KFSA 1BN6A 4FI3F 2AE1A 1O0SA 4R83A 5DGTA 3THWB 1A2KC 1GTG1 5FBKA 4RA9B 1JBQA 4L9WA 4WEOA 3T41A 3IBGA 4KN6A 1FNDA 4HRAA 4HXEB 3LCCA 1FMJA 1T8RA 1AS3A 2P6UA 4MB6A 4P4SB 1BYIA 1G18A 4R0NA 4YQZA 3HK2A 2D8MA 3HSYA 1K8QA 1RC0A 1PYOA 2ETVA 4WZBE 3BA6A 4W5NA 4ZV9A 1FTYA 1D2AA 3OPVA 5GAJA 3VGPA 5DWQA 1ZRSA 5CH8A 2GAIA 1KEPA 5IW8A 2YWXA 2YW9A 1LDBA 4MULA 3WG9A 2VCEA 4NMXB 2A8YA 2P5UA 3CZMA 3PFHA 1K3UB 1D2GA 4Z49A 3U3XA 3ED1A 4YLGA 4ARUA 2H1VA 2XF8A 1PFQA 1UOOA 2ODNA 3IQFA 2Q5LA 1PT6A 1NF3A 1NJSA 1TI7A 1TFUA 2JGRA 2QJRA 1P8AA 2QN7A 4RLFA 5IWAB 4KZPA 3MHTA 3SKYA 2B8EA 2CZQA 3IJRA 3OEHD 3TRFA 4M0EA 5HZKA 2BD0A 1U2EA 1C7ZA 1H05A 1TKBA 2D59A 5KSPA 4DABA 3G9TA 3ZDDA 1ZKMA 1AU9A 3WL7A 4UVGA 4F9FA 4D0NA 4EECA 1KJWA 1JFTA 1TEVA 1W6RA 1ZW6A 2PX8A 3F2IA 2VWPA 4UNQA 3U4CA 3EIFA 3V4VB 4TPKA 1DQYA 1XDUA 5ITSA 4RHXA 4JLAA 5DT9A 4C01A 1ZQ1A 3HR8A 3AWDA 1FBNA 5ADWA 2WSBA 4MUMA 3AVTA 1P2DA 4JI1B 1VHQA 1CQIA 3ADOA 2WJJA 5JSKA 2NSHA 3EP4B 4J75A 1OC4A 4L4YA 5DTQA 1O5OA 1VLHA 2XMCA 5D6NA 2MR5A 1VJCA 1DXHA 1T8YA 2JB9A 1RI3A 2NXCA 3QMWA 4OA8A 2J0UB 2WQ7A 1WB9A 3ZCSA 4QLBA 1PWZA 3I39X 1W85A 3UQYS 1Z2OX 4YK7A 5THQA 4FT2A 4KTTE 1RR6A 3RSOA 4KBFA 3E3NA 3FVQA 2X2EA 4LJAA 4JKIA 1MB3A 2XV1A 1WU7A 1P1IA 1Y1TA 3DE4X 3KWLA 3PS9A 5EPOA 1M34B 1N32B 1CF2O 3K2QA 3O4IA 1ENZA 3ENKA 3L7LA 3PXDA 4LW8A 3D8UA 3U62A 8LDHA 2Q5JA 1WHTA 3DEYX 4II2A 1SC3A 4RF2A 1QR6A 2CDNA 4WZAE 2JLZA 4G97A 2WB2A 1BXGA 3FPCA 2QYTA 1Y7TA 1WEHA 4JT9A 3UGJA 4KXNA 4CI9A 3UMRA 4GOXA 1CQJA 3DO6A 2PMWB 4WKNA 5EZQA 4YIKA 1DBVO 3BZUA 4UM5A 1PVDA 1SC4A 3FPJA 4JVNA 1K8ZB 1E3DA 1N2CA 3D2LA 3NFRA 2AD5A 3DCNA 4KL8S 4KXLA 3SK0A 1C2TA 3UGTA 5EIFA 1E8NA 5IF3A 4C4SA 5IT4A 1ZOIA 5BSFA 4DLPA 1CETA 3D31A 1EFUA 3K4QA 1OHHA 3PF8A 4K2HA 2H92A 2PUHA 1I3KA 5DGHA 5LYJA 3K4PA 4ZI2A 1GKLA 1PUIA 3L4SO 1IEQA 2AG5A 4YRTA 3TSOA 4KK3A 1N5DA 3GP8A 3G2QA 2H54A 2KW5A 3JQCA 1IZ0A 4TVSA 4FZJA 4TS9A 4Y1GA 1GZ7A 4YRNA 1Z0FA 3IKVA 2P8JA 4AY4A 5FOSA 1MOPA 4X1KB 2FR1A 2WNHA 5DO9A 2DPXA 5DEIA 1R8JA 4JJ8A 3B3AA 3E5HA 3HG7A 2O0LA 4QWMA 3RSLA 4BQIA 1H1LA 3JQBA 3RS3A 4H6PA 1AH2A 2XOXA 3G02A 1R0SA 4IDOA 1W47A 1JNXX 2DM6A 3RHZA 1IOVA 2ZRFA 3CH5A 3HVJA 1RQPA 2Y05A 1UP4A 1DS6A 3F9CA 1JDBC 1IAVA 3CUTA 1H6BA 1J0BA 3DUFB 1Z47A 3KNZA 4XFKA 5CT9A 1EGVB 1YKSA 2HWKA 4WLFA 3PVCA 4AS2A 2R2AA 4PRYA 2Q3CA 3SVLA 1MIHA 3LLCA 3ZCVA 3G6KA 2IS6A 1NZFA 1UKBA 2CFRA 1V2GA 2X77A 3LO8A 4KRGA 3U3RA 1DIGA 5DNAA 1NY5A 1S2DA 3OT4A 4EB3A 1T25A 5TJHA 2XX3A 1KOLA 3WRVA 5SYMA 1JU9A 4YBRA 2FFRA 1Y7HA 4BZPA 4ND5A 1HBJA 1OY1A 1XB2A 4QYTA 5IWCA 4OH1A 2GPWA 2EW1A 5C35A 2WUEA 4XCQA 3OPXA 4KUGA 4DSUA 1KAQA 1SQ6A 4YCNA 1HI9A 2FN3A 3ETCA 2ONKA 1MORA 1WW2A 2EQBA 5U4XA 3UK7A 1J2UA 1A69A 4I5EA 1VPTA 4TVKA 2NZ8A 4GM0A 5F7XA 1YRBA 3ZVLA 2C84A 4P34A 3L8EA 2FUEA 1U8YA 4BX9A 1O77A 1WLYA 1XT6A 4JHXA 1KY4A 1P7PA 3ZU5A 4NPCA 4YDSA 3DHNA 2FX2A 1OBHA 2I66A 2X9NA 4GICA 2H59A 2UUOA 5K7SA 1W4RA 3DOIA 1QJCA 2C2WA 2R6JA 2BGLA 3DAGA 3O9VA 3T7KA 4GSLA 3H75A 5BV0A 1JF8A 2PV0A 2YWHA 4ETIA 3NOQA 1GXSB 3C5EA 1W46A 3IP6A 1SC1A 5KOYA 3F7MA 2HDHA 2QQFA 1V35A 2CHEA 1QU3A 1FDSA 1HF3A 4NKRA 1HPLA 2ZE7A 2J5KA 5B6IA 1FVFA 1QKIA 4JLJA 4O4HB 4JP8A 4E09A 4R8LA 5FUQA 1W1UA 1CJKC 1HDCA 3BQNB 4FI3C 4LRTB 4ETNA 2J3IA 4JT2A 5EERA 1D7AA 1GILA 2AZDA 2V0CA 3ZCTA 1C8VB 3TTUA 4B4DA 4B6SA 4PANA 3V9PA 3ZD9A 4C22A 3L5OA 3MVEA 3BD9A 5E1MA 4EF5A 3SZRA 2OM2A 3TSZA 4Z1MD 4LRSB 1JI3A 2PFGA 5JLJA 1E2HA 3VR4A 1DO8A 2UZ3A 4OAQA 3KYIB 4HLUA 3DS8A 5BSVA 2Q1WA 1KSHA 1E64A 3EARA 3NRBA 2J9FA 2FA9A 2AC4A 2XWJI 3EIWA 3QXXA 3C7TA 5DYNA 2LIPA 3H6HA 2GM3A 4X6LA 1Z6PA 5IAAA 5KYUB 2PM8A 4FLEA 4A4DA 1NE2A 1LNQA 1YJCA 4I55A 2SKEA 4YA6A 5JYEA 4TMKA 4ZPXA 5CT5A 4BVLA 4KN5A 4YCCA 3F5SA 4XFJA 1XVVA 3VZPA 2ZJ8A 4BB5A 1G4HA 3RARA 2AE2A 5LXTB 1ID8A 1AKRA 4FKMA 5B6JA 1LPSA 4Y2TA 5H80A 3S81A 4E5PA 1M6YA 2W6PA 4WX2B 3DHYA 3OSUA 5BQPA 5JTTA 4M0KA 1I5RA 1ODSA 3T61A 2QR5A 2B9VA 1UK7A 4Q12A 4QNRA 2O1SA 4N5MA 4HDSB 3SYLA 4WGFA 4JI5B 4AF7A 1WULS 5K0ZA 3R7FA 2YQ5A 5K3EA 2JFWA 5E1OA 4BQQA 4GWGA 4OTZA 2M6LA 1KJQA 3U7QA 3WHKA 4YRPA 4XPZA 1JQ5A 3BAZA 5KB3A 5TSDA 2ZITA 4ZA2A 3H1TA 3L5KA 2QZJA 4LBYA 3W9SA 1V7QA 2Y99A 5LQSA 3ZZTA 2J32A 3LT2A 4CMGA 4PCLA 2ZT8A 5JOQA 4WTOA 5JCJA 3ZXSA 4QG3A 4XQ9A 1EXNA 4NFHA 2P69A 2H5IA 4URZR 5K3BA 4Z0HO 2J48A 3VHRA 1G4UR 4S2EA 1REQB 4YYZA 3FLAA 1IONA 3RVQA 1LDYA 1HY3A 2OCXA 2CXPA 1BTOA 1JSXA 3CPJB 3EDOA 3KV1A 5DIFA 3W9UA 4ARSA 1GSHA 3DTVB 2JKVA 4B3SB 3BK7A 4IJKA 4R1MA 3AR8A 1ZJ6A 4P93A 3HJBA 4LXXA 4BNNA 2OORC 4IMRA 3OD5A 4P31A 5SZKB 4CV1A 1HDYA 4UVHA 1H22A 3KSDO 3K6KA 4CKWB 3ZIAA 4HS9A 5HW0A 1QG0A 3AETA 4ZO8A 1EJBA 3Q87B 2HA7A 5JMOA 2B8JA 5AI9A 3JQQA 1Z5PA 4NTZA 4OJYA 2HJRA 1E2PA 4ZYUA 1GSIA 4X1KA 2DBZA 4IDPA 1J8YF 1QAMA 3L8YA 4H6VA 4O1IA 3V2HA 2FP3A 3V3KA 3VTFA 3WE7A 4NZOA 3NVMB 3OAAA 4AF8A 1QR2A 2EG9A 4OHXA 1NF2A 2AKYA 3CXUA 4E2XA 5FP0A 1ONSA 4MKXA 3FCCA 3D2AA 1HWYA 1L5LA 3HVUA 2XITA 3C8ZA 3ZJYA 3FVTA 5KX5B 1UBCA 2R48A 1KOJA 1ZLYA 1NI4B 3D0OA 1OBCA 4XOIA 1I7MB 1DQSA 1AVTA 4PLYA 5D86A 4DWOA 2VQDA 4PN7A 5E3HA 3PSAA 1VHDA 3GHHA 2YDXA 3L8GA 4YPFA 3ZD7A 4XPIB 2QZ4A 2N3ZA 3C3DA 3WLOA 3CKLA 2WPNA 4PSUA 5SZJA 1G63A 3KKQA 4GAEA 3H9UA 3R5FA 4HB2A 3PUHA 5ELLA 4OHBA 4M53A 5D5PA 2G76A 1UXHA 4Q4AA 3KDAA 3BXHA 4KQ9A 3MN1A 1OD6A 3I5MA 5DX1A 4QBIA 5LD2C 2PUVA 1CUEA 1K7CA 3UUFA 4AU1A 3T1YB 3PNOA 1IG3A 4DLNA 4JSTA 1K4MA 2ZJ1A 4J0IA 5A3QA 1M34A 1AGYA 5BWNA 1QGAA 3P9ZA 4XYEA 3IQGX 4OOEA 2EJVA 2BHNA 1HMPA 3BQ9A 2GZ1A 3C3MA 1MEOA 2VSXA 4C0XA 5FWNA 5FIUA 4YO7A 3E3OA 5T64A 3JWIA 3VQTA 3R6GA 4RTKA 4I99A 2H8GA 3YASA 1V6SA 4DVGA 1QZTA 1UKVY 2H4HA 1JNYA 2I8AA 2XCOA 2NYRA 2N9UA 4YAEA 3HZHA 5FD8A 3ICVA 4QTUB 2I29A 2QPLA 1BW9B 1YUNA 2SHKA 1TMGE 3FXAA 3KXKA 5HF5A 1DUSA 1E0JA 2ZJZA 2O50A 4WA7A 1TJ4A 4KNVA 2W22A 5TGTA 4CV2A 5L6MB 4OGKA 2Z6UA 4WK6A 1QQ6A 2WU0A 4WECA 4L3WA 4V0RA 3RTGA 2R47A 5K3SA 1DAIA 1M0SA 3LP5A 2XYVA 2VHQA 2FE4A 5CLQA 2YN2A 4XQGA 3FSJX 2EBWA 5F64A 2FEXA 2UVPB 1KDYA 4NCHA 4DCSA 4RU1A 1Z8HA 2AGVA 1DIHA 3FYTA 3ND7A 1ZGZA 1JJIA 3NX4A 4L16A 1Y5NA 4GPBA 1EZ4A 3HWSA 1UBNA 2B34A 5A5EA 3NV9A 3D8TA 4FMCB 1L7RA 1I7DA 1QM5A 2E6KA 2AX3A 2QLTA 4GPEA 4E31A 1W44A 3PLRA 1N2IA 1PG5A 5J63A 5LBTA 1WEKA 3HP1A 4BO0A 2WTUA 4MQLA 5TY0A 2IU0A 1DE0A 3CA8A 4IH1A 1ZUNA 3KZXA 1U2PA 3A27A 4DA9A 1QE3A 2C4HA 3AUJB 1J42A 1V8FA 1FE8A 5IM4A 1V25A 4DR4B 3GRRA 5DKFA 1KZ1A 1N7JA 4A0FA 2VHCA 3KZVA 3HLYA 4HLNA 2CK3D 4RKYA 3U40A 5EFZA 5J47A 3IT1A 4MO2A 4NULA 1XALA 2RK3A 2WM8A 4HN2A 2OHXA 3KU1A 4QBTA 1KF0A 2L2QA 3ETLA 1M2EA 3ILSA 4NFSA 2V3VA 1X7GA 2H85A 2PX6A 4X1IB 5AJWA 4A8TA 4DCJA 5K3FB 3GZTB 5B30A 4PSVA 4ZQFA 4XGRA 2LRHA 1FZQA 3ANNA 3FROA 4O3FA 2GK3A 2WJ3A 3TZQA 1UZNA 2ENUA 5FUVA 4Z9AA 1XJ0A 1R10A 3AI2A 4JLVA 2R9VA 2H65A 3IQEA 3K72B 3EVGA 4CL0A 5I7UA 1Q11A 5F1OA 3SC3A 3HVHA 1AS2A 1AMNA 3IA2A 1RQ7A 4S0ZA 1CEYA 1DCKA 1UM8A 4PC3A 3AB8A 2JCYA 2FJ0A 1Q83A 5EWLA 3I9FA 1GGFA 1L5VA 4I4LA 4WWHA 3OG9A 4G65A 1KVRA 1GUDA 5HVNA 1DWOA 5M04A 4DUZB 4IDGA 4NICA 4I9FA 3QG1A 4OA5A 2GCIA 5AKLA 3N2LA 4CKCB 4JYPA 4AI6A 1Q77A 1T2CA 4Y2XA 3QTLA 1W8DA 1GVNB 2HBRA 4PIPA 4WCVA 1GEGA 2WU4A 3OETA 4IDEA 4DR5B 3HDJA 4PSDA 3GCZA 1U3GA 3HGQA 3FNFA 4YJKA 2UZ0A 4HEJA 4MRMA 3C1AA 2P2NA 4PZZA 4QU0A 5AW7A 4YCAA 3EXEA 3WAGA 2QVCA 2YC4C 3H9BA 4Y6OA 1X13A 2WIFA 4JI7B 2C7GA 1V6AA 4ZVSA 3L0SA 1G1MA 1RVDA 1ZN7A 4OLFA 2E9SA 3OQNA 2FYTA 3IXMA 4HAYA 5EPEA 3ZX5A 2DU8A 2QBYA 4R2KA 3SKXA 3BT7A 2ADFA 1YRQA 3ET4A 1EWKA 3S5UA 2CV2A 2FCRA 4W8OA 1EB9A 2PKYX 4FDMA 1SPXA 3QU2A 1L7PA 1UDAA 5SICE 1SM4A 1P7ZA 1WCV1 4MYDA 5JISA 1HNXB 2CJXA 1GNSA 1I1OA 4V03A 3GN1A 2AJLI 2H4YA 1KWGA 2ZBEA 3U7EB 3BK1A 1YL6A 2ZREA 5JR3A 5JS6A 3DAHA 2R7KA 4JL5A 5CHEA 3DL0A 2R00C 1Q1ZA 2FNAA 2JGJA 3RVKA 1G3UA 3O2NA 2VUIB 3F71A 3D6VA 3HB4X 3T9AA 4EI9A 2WOJA 4U2CA 3DWGA 5LM3A 1YMQA 4Q7KA 4DQXA 3KETA 1VHJA 2AEEA 1KDRA 4YACA 5CGQB 2NMVA 1M73E 2ZIXA 1QB8A 1QG2A 5LXTF 2JFNA 1YB2A 4HAZA 3U1BA 3EZGA 2OGZA 3QJYA 4Y8VA 5J9GA 4EAQA 2QVXX 2GBPA 1PFUA 4OQQA 4F12A 5JZMA 3WQBA 3DBOB 1RZRA 1E3MA 2QM0A 3ANSA 4GLLA 3VHLB 4LWQA 4LSMA 1IXZA 1E20A 3PC7A 1Y8QB 4W7SA 3G5TA 2AIRA 2ECOA 3A1FA 3MIIA 3I9NA 4Y9RA 3ZY3A 5JO0A 1R4NA 1NQUA 1SXHA 2QV0A 2QJWA 4LE1A 3KUUA 1X7YA 2VOJA 5C5EA 5KVSA 1OLUB 3CLUD 1V47A 2HV8A 3C1UA 1QYWA 3PQ2A 3OO0A 4DV2B 2WJGA 1XXHE 1E62A 2VQSA 3I04A 1UDWA 4F71A 1T5IA 3GH1A 1JHOA 1XZMA 3SXUB 4M1YA 3AHFA 2GFIA 3UF0A 2R86A 1F1JA 4EKYA 1UWLA 2F59A 3FW1A 4OK3A 3QX8A 4R1SA 4DLAA 1QPBA 3I53A 1RYZA 5DB4A 4A2QA 4ZHQF 3WMWA 1PF7E 4NP6A 2ZM6B 4H59A 1LQTA 4HGNA 4KQHA 3ZBPA 4N48A 1PNVA 2Y1WA 4C7OB 3RDPA 4AO7A 1YZFA 4RFLA 1LB1B 2P4HX 3BJRA 4G6ZA 1S8AA 4X97A 4WCFC 4G1UC 4HT3B 1DLJA 2AB0A 3KOOA 5FPQA 4YX9A 1XUOA 1WUYA 1YTLA 1LPMA 3IHLA 3VTKA 5LDHA 3E81A 1SK8A 1SG0A 4HX2A 4MEBA 3DMTA 1BOFA 3RREA 3SXPA 1ZWLA 5EVJA 5KOIA 3KM0A 4TSKA 3IEMA 4NNOA 1N7HA 3C87A 2ZTVA 4KODA 4MWTA 1B1CA 1S2NA 1V5GA 2ZE8A 5ER9A 1O6GA 2HR1A 3A14A 3ELDA 4BYGA 3IHWA 3NASA 4C5AA 3R5SA 2OORA 1EK2A 2AMFA 4OBXA 1UJCA 1MAHA 3RVOA 1K66A 4MMYB 4GL2A 5GINE 1EDOA 4O4JB 4IDNA 5FF9A 3VKVA 4LHSA 1O1YA 2Q4TA 2QNIA 5IFKA 1GPYA 1N8SA 1MO6A 2TECE 3DEFA 2ZRGA 5MN4A 2ZB8A 4G0QA 4KWIA 1USVA 4D96A 3E70C 1SCJA 3I83A 5JCZA 4LMPA 1T5TA 3A0UA 4FK8A 3GF4A 4Y18A 4ESVA 1E5XA 3UJ8A 1P62B 4O4LB 3GJXC 4L28A 2HA4A 4YREA 2N1BA 4DMKA 4KXYA 5HF8A 4MVJI 1DJOA 1GGHA 3K30A 5FWDA 4TLCA 3TO5A 1M6NA 1Y5LA 4EG0A 4F5YA 1Y1QA 2ID4A 3G2PA 4PE5B 5F9MA 1GU7A 3ENQA 3QKTA 3N8KA 5DYYA 1IN8A 3E7WA 3GDWA 4J3JA 3FWNA 3SYRA 5JZOA 2VTBB 3LT1A 3FTDA 3DOOA 4GR9A 4LKOA 3H8SA 4RQUA 4QJ3A 1D1TA 4KHZA 2NO1A 3AVUA 1H8HD 3OZIA 2CKDA 4QGAA 3V8VA 4GPIB 1JXMA 1X7DA 3C8HA 5KVQA 1B8PA 1E2NA 2RGAA 2BBOA 4TLEA 3W8RA 1BXZA 2Y6UA 2HMTA 4TM8A 5HA5A 5L45A 1P1CA 2YR0A 1G55A 5FOXA 3INTA 2JGEA 3Q5EA 4QREA 5A6SA 2M1ZA 1FNSA 2OBLA 5KTYA 3DV0B 3FTPA 1MDBA 3DZ5B 1W5TA 1R9JA 1J21A 3LU1A 4HDRA 4OJNA 5K1ZA 2UVQA 3CJTA 1ZK0A 4WFKA 3CTMA 3W8FA 4BE9A 4YNBA 2YZ2A 2A9RA 4UHJA 3RSCA 1RJWA 1ORHA 5ELMA 2G1KA 2ZRLA 1EH5A 4NBVA 4C4AA 3UJ6A 3W2TA 3QX3A 1B00A 5AW6A 4RMJA 3NIWA 2BELA 2XXAB 3R3JA 5EQJB 3KU4A 1GZDA 2HRQA 4LV5B 1MPTA 1SN7A 3N70A 2EJBA 3PPYA 2I8LA 2ZUCA 1IJKA 4DQLA 4IKOA 3W90A 3L92A 1ZXBA 3KT6A 4C1NA 2FWIA 5JQGA 3NG1A 3L0BA 3R8XA 3EPLA 1JMVA 3ACCA 2WM2A 3EXHC 3KSRA 1FRFS 3H11B 1QDUA 3HCBA 3WGQA 4IZHA 4QDTA 2BL4A 1I4OA 5AVRA 1EBUA 4KQIA 3EIEA 5L4NA 2YQ4A 3JARB 3LSYA 4R9NA 5G53C 5B64A 3LC1O 4GYKA 1Y3IA 2WFAA 3DNFA 3LW8A 5JAUA 3FTCA 4IHKA 4ND1A 4EYKA 2CL7X 3GGJA 2Q9BA 4MJ7A 3LBAA 4C2UA 1Z37A 2BM1A 2HUNA 2Z98A 3H9GA 3TVTA 3B38A 3DM5A 4HJRA 4P5DA 4GP6A 4AZ3A 1P19A 1NP6A 3LY8A 2HHAA 3GRPA 3BHJA 3VPFA 4E14A 2DHDA 3DA8A 5IZCC 1Z35A 2IRWA 1DEOA 1YS1X 3K0BA 3PC8A 4JP3A 1S2MA 2A5JA 4GZ3A 1XTRA 2DR0A 4U2FA 1FU7A 5FA5A 2ZSUA 3PGLA 5GIOE 3ZJ4A 2JJ8A 1QIJA 4DA0A 1FFWA 3VR5D 2ID8A 4CLRA 3A4LA 2ZRBA 4LBVA 4MR7A 2AI1A 4PAMA 4UZFA 4ZCSA 3RLFA 2JANA 4I4TB 2GK4A 1NYRA 2CEAA 4DQKA 3LDHA 5JD4A 3IVMA 3P2OA 4TLMB 1T9DA 1YR8A 4R9VA 4YQEA 1I2CA 3EAFA 4FMDF 1R0YA 1KO8A 3ZWKA 2V7WA 1I7SB 4RW0A 3QF4B 2ZBFA 4PGAA 5A5VA 2Q4EA 4ITRC 1EEHA 1EX1A 1PL6A 3BIOA 4OG2A 4TTTS 4UCWA 2ZYUX 4WD3A 5EMLA 2A5DA 4RNCA 2A3NA 3A70A 1OAOC 4RD4A 5H9VA 1LI7A 1MJGM 1M2OA 1QPZA 3NHJA 3AR9A 4CIXA 3Q0TA 4JCCA 1BD3A 2H1SA 1HT1E 2Z9CA 3KO8A 4PQYA 2JGDB 2D1SA 2GTPA 2VPTA 4F84A 5CLLA 3MSCA 1ADYA 4CYMA 5A4KA 5JSQA 2JVKA 1OA1A 2H9YA 2P9FA 5JPIA 2O0KA 3ZV3A 3GEPA 2L18A 3UHAA 1ZDMA 3EEYA 3D4NA 4NV0A 3NM4A 4PVCA 3TXXA 2H18A 3QMMA 5K0SA 2QYHA 2Q5OA 1SB9A 2GJ9A 5MDHA 4LZLA 4U2DA 4Y1EA 2HZBA 1G2OA 1ESEA 3BULA 4I3HA 3CZCA 4YFYA 1PV1A 5JARA 3FJYA 3A3NA 3IUMA 3AJDA 1IDN1 4FCTA 2PH1A 2H1LA 1F17A 1P39A 2VDUE 2VFAA 2XEXA 1U2TA 3B1VA 3IXQA 4J0JA 2FAXA 4W8HA 5FFNA 2JKYA 5ALTA 4JY7A 3K8ZA 5EJAA 2YJTD 1W4AA 1V8DA 5AKGA 3A2KA 1X14A 2IHKA 2J09A 1YXMA 2XF2A 2Q8NA 1YL5A 1AUPA 3G2NA 3QBDA 2YJ6A 3FUUA 3GUUA 4FHEA 3DNPA 3A1NA 4OMUA 2QUJA 3VR6A 3CLSD 4C4PA 4ZK2A 2P6MA 4F0JA 3MF4A 1CDZA 1GP2A 1NYLA 3UAYA 1K7YA 5F1YA 3SS7X 2GJ8A 3L1UA 3IBFA 3CRW1 3N8DA 4L5IA 4ND2A 5FOTA 3KZNA 4KAAA 3AU9A 3H16A 1ABBA 5KYGA 1ISPA 2YYAA 4YAIA 5IF9A 2QRLA 1E79A 3H5VA 2J5BA 2OHHA 3EMKA 1XEWX 2AG1A 3M4YA 1Y7LA 4MKZA 3PNBA 4JOSA 1FDUA 2AEFA 4BAZA 4HQRA 1FZTA 4QU8A 1MXHA 3H9CA 4IHJF 2X1MA 2YMQA 4X45A 5FBQB 5K5EA 5GOZA 1G5QA 1LDGA 1Q57A 2QY6A 1J1ZA 4XGIA 1IZYA 3KL2A 5E4FA 1UKCA 3H7IA 4ILEA 1Z5OA 3VZCA 1V4VA 2JAOA 2VHYA 1GA1A 1H2RS 1QHXA 1XVAA 4KXQA 1AUOA 3RSSA 1F2TB 3H5OA 3QU9A 3ORHA 3O8OA 5EQFA 4FMBB 3PYLA 4KSBA 2O8CA 4BC1A 1H8HA 3AR4A 2E2WA 2P78A 3GRZA 2B5WA 2C9DA 5CIQA 3PFFA 3P4UA 4U9IS 3BH7A 3OC6A 1GUZA 2FG7C 1XRMA 1KSJA 1VBMA 1W2WB 3DP9A 4KE8A 1EX6A 4KAFA 3MGBA 3OIGA 2R1UA 1FF9A 4V2IA 1VA4A 1XLWA 2PQ0A 2VJPA 3I34X 5KTNA 4X91A 1QP4A 2G25A 4I1VA 2XDWA 4UEKA 1T2VA 5GONB 1N9KA 3I05A 4TMXA 1TUIA 1MA3A 3PEUA 4W5RA 1OXVA 2FOLA 4M1MA 2VPXA 3Q8MA 4QXQA 4OQXA 3PGXA 1AKEA 2WKPA 5TDHA 5EJ6A 4OPMA 5FFMA 2BBWA 4JB2A 2HJSA 4RJ2A 1W85B 4YTEA 1U94A 4RGQA 3IEKA 3OQ6A 5DTJA 1GPJA 5F77A 5KUTA 4WFQA 3X3HA 3CM0A 6YASA 1E1YA 1BDBA 1R50A 3U4GA 3T5AA 3VYVA 4GMHA 3FA2A 2H1IA 4IBOA 4Y6GB 4COOA 1R18A 4UOEA 5J4LA 2WD7B 2XZOA 5L51A 5HZGA 3LF2A 2HU5A 4MRVA 4N41A 4KCGA 3CGGA 1HE8B 2Q5FA 4L5CA 5IDVA 3BCSA 3GJ0A 4WY2A 2DLDA 4XGNA 2EP8A 3LXMA 4JDPA 4E5MA 1ONPA 1A95A 5BQOA 1PQYA 3O3MB 4B9EA 2WYVA 2XUZA 4Z9FA 3W4JA 1CERA 3BQMB 2IV2X 4BBPA 3A3KA 4IO1A 3AETB 4JUAA 5BQFA 4MKGA 1XA3A 5C8DA 2P91A 4HNHA 1RI4A 4LAFA 4R54A 2EZ4A 3EE6A 3D3KA 4HP8A 2HFJA 4NONA 1F60A 4W5TA 3OU6A 2ZOSA 1RFLA 3X1WA 2QTWB 2X7XA 3DKKA 4QQFA 1XL1A 5I9BA 5REQA 3TRJA 3SP1A 3CLKA 2FWPA 3MTAA 4WNCA 4YAJA 4B3CA 1JECA 2G6BA 3HCDA 3S55A 3QQ5A 1DCTA 2VNKA 5JDCC 4GGOA 1X7ZB 1NVFA 1NUUA 3DQZA 1VRCA 2P9GA 2ZWVA 4NCIA 3B36A 3R9WA 4GLBA 2LVBA 1GPKA 5IUKC 5F1PA 1AHHA 3O73A 3WK6A 2I22A 5TLSA 3B2EA 4UHKA 2ZVDA 4D3SA 4JLPA 3L05A 1IQ0A 3ANXA 1E7MA 5F9FA 1Q7RA 2EARA 1G6KA 5P8WA 2BJHA 4G8DA 4EENA 2ZIVB 4LJYA 3G8YA 4P4SA 1XD2A 3PTAA 3HZZA 1ULUA 2XVMA 5LUAA 1Z08A 3WMFA 4CEJA 4NZMA 2Q8PA 1QYVA 2EBUA 2F8TA 3D8HA 1O4WA 4MV8A 2QP4A 2PUGA 3JY6A 4OH7A 4ZOAA 5D01A 3TFOA 4ZAWA 2QMZA 4HGOA 3I5XA 1Z9BA 1IXKA 3W06A 3RODA 3LVBA 4F7WA 1PNRA 4ZC1A 4L8YA 1V3UA 4O4IA 2NXEA 4KQ2A 1T5SA 1HYGA 3NBQA 5B7GA 1QCCA 1LS1A 3O0TA 4OQYA 3ZI0A 1QAOA 1S2LA 3EQ8A 4DLUA 4GP9A 4MITA 1UOPA 2BFDA 3PUIA 5FTJA 3RWOA 3W4IA 1WA5A 3V7NA 4N3CA 1A96A 4CMEC 2Q6OA 2XWQA 4K9DA 2EX0A 1D6MA 1ZONA 4RABA 4EB0A 1P1HA 1PJRA 2DH6A 4X92A 3ETJA 2IHTA 2V59A 1RYBA 4EKNB 4XYMA 3A1DA 2BGNA 4DIEA 2J7PD 2XH8A 4WBXC 3E6AA 1L7QA 3KTDA 4GSKA 2IYOA 2O2DA 3OFSA 4OHZA 4LJLA 2UZ1A 1MX3A 2HDOA 3D43A 1T2FA 3QBTA 2V1XA 2HRZA 5AW3A 1M10A 3BF7A 4Y2SA 4OLBA 4PWZA 3DBHB 1T2NA 2VNHA 3NR2A 1KEKA 5K8LA 3ABRB 1DAMA 3MJFA 3NKLA 4ARVA 5I6DA 2I55A 3KB2A 1K88A 1DTWB 3HNPA 2Q50A 3IRUA 1CFJA 2GKGA 3L4BA 1WNFA 2WSIA 1DAGA 1YI8A 1ZEJA 3QW4B 1A8SA 1Q1QA 1WXXA 2XWBF 4IWXA 3QE4A 5CB0A 3GL9A 3T5BA 1T4DA 2H16A 1J06A 1CF9A 4BFYA 3VH4A 1NNUA 4GT1A 4GUDA 3BHNA 3FLBA 1CR0A 3BVPA 4JJZA 4ESHA 3P1JA 3WZ2A 4KREA 3AP2A 2O3TA 3ZWCA 5LLSA 4CKBA 2IKSA 1SVSA 3R3UA 2OESA 5GJBA 3BTUA 1AXRA 1RT9A 4C6TA 3V4ZA 4MB2A 1NN3A 2Q1YA 4F1WA 1Z4IA 2BKEA 4TTRA 4RESA 3AESB 3LLVA 1L1QA 1YTUA 1CLEA 2JA2A 3HCFA 1MIOA 5AI0A 1XZGA 2CLEB 1T2DA 5SY9A 4G07A 4YT8A 1GARA 1IDOA 1VECA 3OOWA 2NUBA 4CL2A 4GH5A 3BFJA 2W4MA 3IQXA 1ODJA 4RGBA 3TUZC 2JJYA 2HL6A 3QA9A 1Z63A 2OUKA 4BFWA 5DHFA 3E9EA 5DK6A 5C8YF 3VZDA 1C3JA 3H0VB 1KYVA 4TL8A 3WK5A 3VNUA 1QHNA 3AI7A 3P32A 4XD2A 3HWWA 5LQRA 4YP5A 4DCCA 3IDQA 3PQCA 4RV5A 5L3RA 3H04A 4FZVA 3QFFA 4QQRA 3EBLA 1JJFA 4FONA 4Z3KA 2YL2A 5KYVA 1YZGA 2NIPA 5B1HA 4TVBA 4KSCA 1WO8A 2ABWA 3CW8X 2NU9B 5LMNB 5DYGA 4OFWA 3CY6A 4MA4A 2JBWA 1WQ4A 4RPCA 4LJSA 4V0ME 1FLAA 4R81A 5H1YA 1B41A 5A9SB 1QBGA 2DJIA 3LWBA 4QUKA 5G4KA 4YRKA 5C3MA 1FX0A 2BKLA 4BTEA 5DWDA 2YHIB 2M98A 2QMQA 2O52A 421PA 1U80A 2XGGA 4F6RB 4MOWA 1UMCB 4J3NA 1F3OA 2RGEA 4UJ3A 4DA4A 2CJWB 5DM70 1A9ZA 2KBFA 2HSGA 3TL3A 4G5XA 4DJEC 4JLMA 2FQYA 1CQPA 1HEIA 3NETA 3PD7A 4UVEA 5K03A 2C4WA 3C15C 4PBRA 1THZA 1HYBA 3JWPA 3NVAA 3MRTA 4BZWA 3BMNB 4U6QA 3OZRA 3Q2OA 2P77A 1CUHA 4Q47A 4XGKA 3VI4B 1Y9AA 4M1SA 1NXPA 3VDNB 4E30A 2FJUA 2OMEA 1XNRB 1T6BY 1TVMA 2VK8A 3K0EA 1JAHA 4GIBA 2ZUTA 4IGEA 1RBMA 4KWHA 4NFLA 3RVBA 3TZLA 2C5AA 1M72A 1NATA 4MNTA 5EWMB 5IZ4A 5E6RB 1D8TA 2DZDA 3WO0A 3A25A 1E77A 4Q18A 3W04A 4GEGA 3DOEA 5A1TA 2QJOA 2IY8A 2VJMA 3GFFA 3O4VA 1V5FA 4Q93A 3A6JA 1A7UA 3LUCA 1FS4A 1BXGB 4LQ4A 5KHAA 4C4OA 1ZD1A 4FYMA 4CF6A 1B14A 2QOEA 4REMA 2XQIA 4BCDA 4X62B 4J03A 4JP2A 1XD2B 1EE9A 3QOFA 2HDWA 4JQSA 4PXYA 2Y1FA 3MMZA 1VMKA 5DISB 4D8XA 4KVGA 1E32A 1SCKA 1DEHA 1C7JA 2VDWB 1E1RA 1QORA 2VT2A 2RAPA 1CDOA 2VEOA 2XUPA 3FAZA 2DRIA 2Q6KA 3QXSA 4J0CA 2XYPA 3KOZA 4BGDA 4FGWA 1Z6AA 1L5HB 3KR1A 5COBA 3B6MA 2IYRA 4PAQA 1OXMA 1UINA 4Q00A 3HJAA 4J1QA 3ZCXA 3RABA 4F4UA 3L41A 3GA5A 5IVKA 2XAAA 3NZEA 2H6EA 2PO7A 4Q3NA 3KWFA 5A2GA 3OUTA 3HVKA 4XJTA 4G36A 4B45A 1DKPA 121PA 2RJOA 1HURA 1SNYA 1OWMA 2I4TA 4MS4B 1EP1B 4LZJA 5D3MA 4NR0A 1ODFA 3PB3A 5M34A 2WAMA 2EFJA 4ZVQA 3SC6A 1UBSB 3JAMA 3RAGA 2B4RO 3QE2A 5L6LB 1A9SA 3WDLA 2PJRA 1WP9A 2CC2A 3IV7A 2HQOA 3DE6X 4GXNA 4G0YA 3FWYA 4Y2YA 3L4JA 2DY1A 3MJDA 2X9VA 3MWFA 3ECCA 5A02A 4Q3BA 5IC6A 4Y1FA 1DSSG 3B13B 1JTEA 4YP1A 1PT7A 3WBBA 3MCWA 3HZRA 4L51A 3VAAA 4S24A 4V2UA 3ITNA 4NE7A 3LZ6A 4O02B 4CUKA 4DV0B 1UZLA 4DT1A 1HA3A 5F33A 3RCBA 3JQ8B 3IMGA 4OXNA 2HMUA 5EMNA 1Q3TA 1J33A 5FWYA 2BSAA 4JI8B 4A0RA 1JI0A 5EZ5A 3W7VA 1Y82A 1U5BB 3UFXA 2LCIA 2ZZNA 1PHPA 2J7PA 2CCJA 1T6NA 3MYRA 3Q7TA 3MWEA 4NDAA 4M4SA 4UDYX 5FKJA 3V32A 4KRXA 4MV1A 3S2GA 4BEJA 1XAIA 3PEVA 3AH8A 1ENYA 4AMVA 4CM8B 2ZPTX 4JJEA 3RTDA 2IHVA 2OK7A 4AKTA 3ESDA 2CXHA 5IEBA 3NBFA 4NENB 4E21A 5T8KA 3OIDA 2GXAA 2JHFA 4J4TA 2G0TA 3QXJA 3L82B 2VJLA 4DQ0A 4JR1A 4JZKA 2PRIA 2XBLA 4CF4A 1DC3A 2PCJA 4MWSA 4PS1A 1MPXA 1WXEA 2YXDA 1C29B 3MINA 1CYEA 1Z4LA 5BRNA 2PT5A 1E99A 5KREA 3AF6A 3FMFA 3RYTC 1E1LA 1P1FA 2J41A 4L27A 5ALWA 4S2UA 5AT1A 4QUGA 4R1NA 3INYA 3T5CA 2E4AA 2ZCUA 4HUJA 4IIYA 2XCLA 1DKMA 5FOV