1PU2A

Crystal structure of the k246r mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
371
structure length
356
Chain Sequence
b'MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWRGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
molecule tags Oxidoreductase
source organism Haemophilus influenzae
publication title The role of substrate-binding groups in the mechanism of aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
total genus 112
structure length 356
sequence length 371
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1pu2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pu2A01
2EG9A 1TLTA 3C1AA 4MIEA 3JQGA 5HTOA 1Y5MA 1Z75A 4LMRA 2AW5A 4HFNA 4B4VA 3INGA 1ZUD1 4E0BA 3WGGA 1PL6A 1NR1A 3AM5A 3GDGA 3GDFA 4Z9XA 1T2DA 1QR6A 2J3JA 3LC7O 4I8XA 1GYRA 2J6IA 4OSOA 1UAGA 5K6AA 4N5LA 2HMVA 4R9SA 3CMCO 2QRLA 4XR4A 1T2AA 1CIVA 2W2LA 3WWYA 4BVAA 2D4AA 1LJ8A 3WR5A 4O1MA 5A02A 1I2CA 4NBVA 3OSUA 2GF2A 4FCCA 3RJ5A 2DBVO 3FBTA 3QVOA 3AUSA 1WZIA 1E92A 4C7KA 3NEPX 4DGSA 2D1YA 1PTJA 2AEMA 2Z1MA 5GZ1A 2JCVA 4OO3A 2POQX 4CPDA 2QZ9A 5GMOA 4AJEA 4L74A 2A92A 8LDHA 1KC3A 4RF5A 4DQUA 5I7EA 4Z9YA 3PJGA 2GZ3A 1D1SA 3GZNA 4I1IA 4KQXA 1BXGB 2OOSA 3ZWAA 3KYBA 4KWIA 3HDYA 2OMEA 3OIFA 4RPLA 4A73A 2CDAA 4R3WA 1N7GA 4Y8VA 2HMTA 1WP4A 3GGOA 1M66A 3UF0A 3KEOA 1DFHA 4L8VA 1O8CA 3L4BC 1U5AA 4ZD6A 1C0IA 3U3XA 4D3FA 1NNUA 3TNLA 1F17A 1SAYA 1ADGA 3DMYA 3RUEA 1OI7A 4B3HA 4YAIA 1H6CA 2VWQA 4U6QA 2PZMA 4M49A 3DFUA 3GH3A 1VI2A 2O4UX 4JXKA 5T8KC 3FRJA 2PGLA 3BTUA 4IBOA 5IG2A 3HDJA 3P7MA 2ZB7A 1U5CA 3BMQB 3KVOA 2NQ8A 3S2GA 4CV1A 3VOSA 2ZB3A 1WMBA 2JHGA 5T73A 3RVDA 3RU9A 1RM0A 1PJ4A 2PWZA 1E3LA 4ALIA 3KEQA 4DIFA 1PWZA 3QP9A 4I5DA 1EUCA 2BF7A 4YTEA 4YAKA 5CPFA 3ST7A 4DMMA 1BW9A 3F3SA 4PG5A 2OP0A 3QVSA 5IF3A 3OHSX 2ZYDA 5CP8A 2C7GA 4OOEA 4J1QA 4BS9A 3JQ6A 3G3EA 3IKVA 4DPLA 3WIDA 5COQA 2Q2VA 4ZQBA 4NFSA 3WSVA 3PZRA 3IQDB 3PK0A 4D41A 3OBBA 1YOVB 1SB8A 3AOEA 2ZIZA 4ROSA 3HNPA 1NBOA 2BFMA 2Y1DA 3PWZA 1YONA 2C5EA 4XD2A 1QYWA 2EJVA 5G0TA 5I9MA 5IDYA 4WNCA 4TZTA 1B3RA 1GQYA 3MJEA 5CG2A 3VZPA 1V8BA 3ITKA 4FC7A 2BGMA 1I3LA 3GMDA 1H6DA 4WJZA 1B15A 1GADO 5BNTA 4NPCA 1DFGA 4BO7A 1ZMTA 3JQEA 3RUDA 2AQ8A 4GX1A 1KOLA 2EGGA 3E5MA 1GCUA 2AE1A 3W4KA 3IUPA 3GVIA 2GN9A 1R6DA 2WWRA 1VL0A 1L7DA 5KJEA 2EW8A 2NM0A 3U5TA 1I32A 4EUHA 2PZLA 1DIGA 4TRJA 1XU7A 3DZBA 4L4RA 4Z0TA 3AU9A 3GFBA 3M6IA 1PJ3A 3C7AA 4FPXA 3GPDG 1HE3A 1R4NA 1UUFA 3OEWA 4WE3A 4BNWA 1VC2A 2NU7A 5DBIA 2CZCA 5EQFA 4ID9A 4RPGA 3NRCA 4EJ0A 2JJYA 3NYWA 4RQTA 1YS4A 2IE0A 1X7HA 3GLQA 4BNYA 4CV0A 4NFHA 3Q11A 5AVOA 1P3DA 2HUNA 4YQZA 3VH1A 1EEHA 3OJOA 1EVIA 4GPD1 1X0VA 3DQPA 4CLOA 1FDVA 1C0PA 1H93A 2NSDA 1BGVA 3ROQA 3S2EA 3OQBA 3L9WA 4Q3DA 4IIUA 1QG6A 4BMSA 4RF3A 3DOJA 3OJEA 1ZSYA 4N5MA 2B69A 1IULA 2F00A 3O03A 2WYVA 3B1JA 3DL2A 4XJTA 4DL9A 4PFJA 1EMDA 3ONFA 3DB2A 1NQAO 1Q0LA 2NVBA 4RPKA 5GZ3A 1ZCJA 1B26A 4FGSA 3G0OA 2YDYA 3C7DB 1O89A 4RVDA 3WIEA 4EUFA 2WYWA 2BFAA 3QWBA 4IDFA 3ZV6A 2O50A 1WAMA 3DOOA 1GCOA 2CSUA 4J4BA 1LC0A 3A9WA 1P1RA 4MINA 1YRLA 2WE8A 4Q3CA 2YV3A 3PGXA 4IXTA 5A3JA 4Q9NA 2Y1GA 1HTBA 4JROA 2AQHA 1UP4A 5EMHA 1PS0A 1DIAA 5JDIA 1KEUA 2CF6A 4JP3A 2YUTA 1GAEO 3QIVA 2LDBA 1DLJA 3E82A 1OC4A 3VPHA 5JNLA 1BSVA 3JQ8A 1PU2A 1DSSG 2B37A 2VUUA 4YYZA 2GYYA 3D4PA 3WFIA 3A4VA 5JMWA 3FPLA 4XYBA 1K89A 3ZWOA 4GQAA 3KUXA 3JYQA 4GX5A 2Y0DA 3KETA 2X9GA 4J7UA 4PLWA 1UZMA 4XCVA 4BGIA 2C07A 4BKQA 2O7QA 2BH9A 2VYND 3PEFA 4DPKA 7MDHA 3AOGA 4AJIA 2Q2QA 1B14A 5DN9A 4CMIA 3PXXA 3JQ9C 1B2LA 2D59A 5IDQA 5GZ6A 4UUNA 1ENOA 1A27A 1MC4A 1UH5A 3EAGA 3PIDA 4C7JA 4CLRA 4LCJA 3RC7A 4CM5A 3B20A 4II3A 4BUCA 3U9LA 3K73O 1IL0A 2P5YA 1LNQA 4I9UA 2VQ3A 5I9NA 3VH3A 3W1VA 5L7YA 2I5PO 3C1TA 4KUGA 1FK8A 3U4CA 3SX2A 1ZVMA 1FDTA 3AUUA 4LW8A 2EV9A 4NH4A 1PGPA 2NU8A 1U9JA 4TMFA 2GCGA 4E2ZA 3D4OA 3VDRA 4MVJH 3T7CA 3JD2A 3M1LA 5L45A 3WOHA 4P38A 1N9GA 5BNFA 1OZAA 1LLDA 3TDKA 4A10A 1SPXA 1V3VA 4L9RA 1MGOA 2EIHA 3V1UA 4E2WA 2P9CA 2Q99A 2ZYAA 1Q7BA 4E33A 3IJPA 2PH5A 3GK3A 4A2CA 1DBVO 1A72A 3UGKA 4NNJA 3T4EA 3BTSA 2VOEA 1K6JA 4Y6SA 4OYRA 3RSHA 3U09A 3FNGA 2X5OA 3ANMA 4JBIA 3ZN2A 3Q3CA 4CQMD 4Z3KA 4IQ8A 3ZNOA 5JC8A 3OA2A 5KIAA 3H6KA 3RKRA 4MPDA 1S6YA 2PLAA 4WLNA 4A27A 1LQUA 4I9HA 3WWZA 3ROKA 1ML3A 3SC6A 4D44A 4UVGA 1NTOA 1ZEMA 3ZV3A 4RVHA 3F6YA 4QSMA 3D3EA 1DXYA 2EF1A 2ZCUA 3B1FA 1ZK2A 3AUTA 1GDHA 3ZV4A 2WDZA 3DMTC 5JYFA 4JBHA 1JU9A 1M75A 4NU5A 3RROA 5BR7A 1PJLA 2PKQO 3D1LA 4BO9A 4R4JA 3DMTA 1Y9AA 4PIVA 3AW9A 3G1TA 5FEUA 4DWVA 3EYWA 3LVFO 1ZXLA 5IZCC 4GKVA 2CUKA 2OP1A 1NM5A 1YE3A 3QVTA 3AM3A 4WLEA 1NWHA 4EUEA 4FOSA 1SOVA 3KXDA 1DC5A 4E31A 2WM3A 1YVEI 2X7HA 3ZWWA 4CLXA 1Q2XA 4BOYA 2IEBA 3EW7A 3QRWA 3WNQA 3DZIA 2X9NA 2B4TO 3ZU5A 3RCBA 3FWNA 1NHGA 4BQRA 1P1IA 1NVTA 2FHSA 1ZK0A 4B7CA 3RWBA 3KV3O 4ALNA 1ISHA 2GRAA 4X54A 4WOKA 2H9IA 5DCYA 5IDWA 4K28A 3F5SA 2DM6A 4B7UA 1P74A 1ISFA 1YGYA 1DHRA 3T4XA 4BQPA 1LDEA 1QYDA 1HE5A 4CMHA 3DHYA 3WJAA 3R0IA 5F21A 3GVCA 3GHYA 5L9AA 4I5FA 1NVGA 3ASVA 2R2GA 1GU7A 1PGJA 3PDJA 4O6VA 5JAMA 1HZJA 2D3TA 4RORA 1DRVA 4Z0PA 5G0SA 1NXQA 4BKPA 3JQ7B 4E5NA 3MOGA 3VTZA 1QSGA 2FN7A 3PLNA 1DAOA 4ZN6A 2ZATA 3PHIA 2F1KA 3EZLA 3NGXA 1O5IA 3WGYA 3E5RA 4RVGA 5EIOA 3VAZA 1EK5A 2J3KA 1LEHA 1QLJA 5F5NA 5MDHA 3KSZO 3AM4A 3UOGA 1I0ZA 1KVQA 3PJFA 2HJSA 4QX6A 1TVEA 4AG3A 3F1KA 1BRMA 3R3JA 3Q2IA 2Y93A 1PSDA 4NBTA 1GPDG 3ULKA 2C29D 1I2BA 1T1RA 3BMNB 3GG9A 1JAYA 5L51A 2QX7A 2E82A 5AXBA 3WTBA 4ALLA 1HXHA 1JLLA 4BNZA 3PWKA 4UVIA 1LA2A 1FF9A 1GUZA 2Z5LA 5JCJD 4J1SA 4YJDA 5AXDA 2JL1A 1E3WA 3LLVA 5A3VA 5TRTA 4XQEA 2HU2A 2BMAA 3MJCA 4A5OA 1YL5A 2GR9A 3DAFA 1RPNA 1XIVA 2AE2A 2AG8A 1GFSA 2X8LA 4TKLA 1IPFA 2QYTA 3PGJA 5H81A 3IKTA 3MZ0A 3U62A 1P45A 2AQKA 3FWZA 2IYOA 2YFHA 4NQZA 4WKGA 1O94A 2WD7A 4RGBA 5I8WA 3H5AA 4WGGA 3GPIA 4GAEA 4ZQGA 4OHUA 1GEGA 4HNHA 3RBZA 4LRTB 4Q39A 4R68A 4CM9A 4DTIA 4PVDA 1Z6ZA 4HFJA 2VTDA 2X0NA 4RZIA 4PLZA 4AJNA 2JKVA 3CH6A 2CF5A 3DBLB 1Z45A 5EERA 4BNXA 4YQYA 4M89A 3JQBC 4J1NA 3DZKA 5HWSA 3D5QA 4WLOA 3H8VA 5F1KA 2NV6A 4Y67A 4E6PA 3BTOA 2BKAA 3RFXA 3DBHB 4JBGA 2Q1SA 4ZVVA 2OBNA 3JYPA 2JCXA 4BB5A 3NTRA 5COAA 4LVUA 2QIOA 1C0KA 3PQEA 3ZH2A 4CR7A 1U1IA 4XIYA 1IY8A 3G17A 3I52A 3EY4A 5HS6A 2JD0A 3FI9A 2YJZA 3KZVA 3TPCA 3ICPA 1PS9A 1B3BA 4QFDA 5CDTA 5ER9A 4CMEC 4CUZA 4GI2A 1LRJA 1WMAA 3ZI0A 1VL6A 5CDSA 5T8KA 4FGWA 2FSSA 4Y6RA 5L53A 5IJZA 3WTCA 2OGUA 2IEDA 1IZ0A 1I5RA 1A71A 4FD3A 3AWDA 1Z82A 4IPTA 5KKCA 2GPTA 4FIZA 4E30A 1H2HA 1BVUA 4PLGA 4RQUA 3OQ1A 4B4WA 3L4BA 2CDCA 5DBFA 4KOAA 2YY7A 2GD1O 2O3RA 3WICA 2GN4A 2WSBA 3DXFA 4D3SA 3VKUA 4HX5A 4PG4A 1UP7A 3QWHA 4UUOA 3ONDA 5FI5A 5LC1A 1A9YA 3UCXA 2VHYA 4D45A 4AJ2A 3R1IA 2ZB8A 3ENNA 1IUKA 1M6HA 1JN0A 2X1HA 2YHIB 3OH8A 3OEYA 4ND3A 2R00C 3WGOA 2RH8A 3DR3A 3HFGA 1QORA 2X0RA 4ZGWA 4MVJI 1J5PA 1ONNA 2JAPA 1AXGA 1P77A 2HKIA 3HN2A 4R01A 2FPGA 1NQ5A 2QRJA 4J7XA 3KHUA 5DULA 4BO3A 1ARZA 3JQ9A 4E21A 1UP6A 4YACA 1NFQA 1QYCA 1F12A 3GGGA 1DO8A 1NQOA 1QYVA 2UUOA 4R54A 1HYHA 1OMOA 1U3WA 1LDGA 1U8FO 1TXGA 2CFCA 1L7EA 5I8ZA 5BSFA 1Q0HA 4DMLA 2VZ9A 1OOEA 4BIIA 3EHEA 4K9DA 5G0VA 1DJQA 4LRSB 3E9QA 4TVOA 2P91A 2SCUA 1UJMA 1OFGA 2W2LD 5G4LA 3E1KA 3ZGYA 4CLOB 4EI2A 3JYLA 1X7DA 2X6TA 5FWNA 3W6UA 3EVTA 1YL6A 1E6WA 3PFFA 4CMAA 4RO0A 3GNSA 1M6WA 3OECA 4YJHA 2PR2A 4BO8A 3FD8A 4CM6A 1M67A 3I1JA 4J3FA 4J1TA 2ZTLA 1I10A 3QSGA 3R3SA 1GUYA 4TROA 2O3UA 3W8DA 5A5EA 3DC2A 4H3VA 1YQGA 3P2YA 4Q3EA 2ET6A 4BO0A 3OJFA 1E3IA 2VRCA 3UICA 2AQIA 5IDXA 5IN5A 1ZNQO 2QG4A 3DEYX 5U4QA 2D2IA 3UUWA 1X14A 1T25A 1IHXA 4OIMA 5I7SA 2E49A 1GZ4A 1CERA 1PR3A 1F14A 2HJRA 3NJ8A 4XQ9A 4DXHA 4Y98A 2GDZA 3R6DA 4MVJM 1O0SA 2TMGA 5G0WA 4IDGA 3RU7A 2YZ7A 1I30A 5T64A 2Q22A 4MP8A 3VPXA 4DLBA 1GYQA 4JLWA 5ITVA 1PZHA 4G5HA 4O63O 3IMFA 4BO1A 3W4IA 4CMCA 2DFDA 3GNTA 1PGQA 4D42A 2C20A 4OJNA 1BTOA 4I9NA 3PP8A 2BFOA 3VVBA 1LDNA 1OBFO 4RF4A 4BO2A 3AJRA 1GQQA 1P0CA 3CXRA 2BGKA 1YDWA 3H5NA 4QQRA 1ZXBA 4PG8A 3W6ZA 5KVSA 3CTMA 4XX0A 1SB9A 4IDEA 1WPQA 2D5CA 3NTOA 4QT0A 1S7CA 2O3QA 3SJUA 5HS4A 5EESA 4BNIA 1QV7A 4Y6PA 2IZ0A 2G82A 2EJWA 2NADA 3DOCA 4FW8A 3BZUA 4BNFA 1MX3A 3ZU3A 3IL2A 4XKJA 4XYLA 3PTZA 2J5QA 4AFNA 4WCFC 1D3AA 2DUUA 4HY3A 2H1SA 3RJ9A 4CLRB 2VHVA 4QFCA 1DIRA 4C4OA 1X7GA 4CLDA 2I9PA 5L3ZA 3TRIA 3I9NA 2X5KO 1WDMA 3WGIA 4NHEA 2YQ4A 1XQ6A 4TRNA 4E2XA 2GN8A 2Q46A 4HWKA 5G4KA 4B3JA 1IE3A 2O3TA 2RH4A 4INAA 3JD1A 3N58A 4R5MA 3OJ0A 3UCEA 2OHXA 1Y7TA 2Q4EA 4UUMA 1ZEJA 2V6GA 1SC6A 1I01A 2CVOA 3DZGA 2EXXA 4PLHA 5JDIC 1HKUA 4PRKA 4PCVA 3RFTA 3JQ8B 3TSCA 1Y81A 1D1TA 1X0XA 5JYAA 3RC1A 1IPEA 2PD4A 4HP8A 3QE3A 1ZSNA 3OICA 1B8PA 5DOVA 5B12A 4WCFA 1B16A 4HKTA 3DBRB 3BHMA 1A7AA 4YCAA 3QW2A 3I4FA 3IJRA 5KCZA 1KEVA 2GERA 4BO4A 3RUCA 4I5EA 1MB4A 1MXHA 5AXAA 2E37A 1MG5A 1H94A 2DQ4A 2NTJA 9LDTA 4QTZA 5ITWA 1U7HA 4I08A 3BYZA 1HYEA 1GZ6A 3KOUA 4GLOA 4JCOA 4F3YA 3C85A 3CPSA 5A9SA 3JD0A 3O8QA 5ADHA 2WE7A 3ZW8A 1X13A 2X4GA 1MP0A 5JAIA 1JKFA 1JWBB 1LSSA 3L6OO 4WEOA 4E3ZA 1ENYA 3L6EA 2HRBA 3LC1O 4CLHA 4UULA 1XSEA 2NLOA 1NASA 3O26A 2JAHA 3FNFA 1LXCA 7ADHA 3TFQA 3ZWCA 3C8MA 2O3JA 1W8DA 3EGOA 3JQGB 2C59A 4IMRA 4FFPA 2B0JA 3AY7A 4H7PA 5CDGA 1O95A 1FDWA 4KMSA 2AMFA 3E03A 4I5GA 1TA4A 5F3RA 4MOWA 2G17A 2VT2A 5DF1A 1CQIA 3E9MA 2BD0A 3M2TA 2P2SA 3C3XA 2DKNA 1JKIA 5MGBA 1VKOA 5TC4A 3TOZA 1R0KA 2I6TA 3AI1A 1YKFA 2PZJA 4IINA 1AHIA 1HLPA 1DLIA 1GTMA 3FHLA 1H6BA 3PJDA 1I8TA 4WCFB 4YJGB 4TWRA 5EL0A 1T26A 1EBFA 4XDZA 4ND5A 1C0LA 3NT5A 3S55A 1H9AA 4E2YA 3TZCA 3JD4A 5J9GA 2TMDA 1ZZEA 1KS9A 2H63A 1NFFA 1WZEA 3BMQA 1LRLA 3TZHA 1LDBA 4A26A 4XGNA 4HV4A 4BKRA 1K6IA 4KUEA 1F06A 5JLAA 5A9SB 4CV2A 1ZKMA 5K6AC 5KVVA 2G5CA 4K1LA 1WLYA 4S1VA 4BV9A 2DVMA 4GGOA 1KBZA 3V5NA 3U0BA 3ITDA 1SNYA 5EJ2A 1H9BA 3GFGA 3ZWXA 5IAAA 2QZZA 4YAJA 2VYNA 3GAZA 5KJ6A 2DTEA 4IJWA 2P4QA 5L4SA 1XR3A 3IIEA 3IP3A 3RKUA 2Y67A 4KUHA 2IZ1A 5A9RA 4J7CA 4IJVA 4J4TA 3UVEA 5CEEA 4LGVA 3NDIA 4R16A 2DTXA 9LDBA 2RHCA 3I3OA 3DFZA 3WGQA 3E9NA 3RUAA 4CMKA 1GD1O 2GN6A 3ZWMA 5LDHA 4KP7A 4DREA 4BNVA 2VCYA 3IAHA 3JYNA 4LSWA 2PH3A 1LSJA 2E48A 2CY0A 4H15A 5IFLA 3HE3A 3NX4A 4HUJA 4RL6A 1PGOA 1YJQA 1SZJG 2NTNA 2AXQA 5L7TA 2YDXA 2HLPA 4ALKA 4RF2A 2DT5A 2YW9A 2B4QA 3I9LA 4NZ9A 3H9UA 1WWKA 1RKXA 1MUUA 3K8ZA 4LSMA 4YT5A 2EKQA 4XRRA 3WQSB 4RCVA 3JQCA 1TI7A 4OL9A 3I83A 3L77A 4LN1A 4Z0HO 1D7OA 5F1PA 4B3IA 5JXWA 4L4XA 3D64A 2CNBA 3AY3A 4CR8A 1KVTA 3O8QB 4D7AA 3W8EA 4MJLA 1R37A 2JFHA 3JQAB 1XLTA 4YT2A 4ONEA 4CQMA 1FJHA 4OM8A 5DCWA 1E7QA 1ADCA 5I7FA 4MVJA 2G76A 4R1SA 5COBA 2W98A 3CINA 3OM9A 5L4NA 4IS3A 3PZBA 1W0CA 3HN7A 2VZ8A 4MP3A 4TVBA 3GZNB 1BDMA 4R69A 2UAGA 3PHGA 5JMPA 1KVUA 4LCEA 1YOVA 1R66A 2X5JO 4Z3DA 3LSYA 1EE9A 1Q0QA 1LSUA 5JCXA 3UH1A 3ZNQA 4ZQHA 4B4OA 5FYDA 3MOIA 1MXFA 1I2ZA 2Y1EA 1X1EA 1HF3A 1M76A 2W8ZA 2ZJ0A 3NTQA 1UDBA 1UXKA 2GSDA 2O7SA 2RCYA 4GVXA 2HK7A 4WNIA 1JTVA 4IUYA 4PRLA 4YRDA 1BWSA 3QV1A 1V3TA 1CWUA 4KZPA 4BMVA 1JWAB 4ITUA 5B4UA 4YJFB 1IHYA 2PFGA 4JGBA 4XZ3A 1XWFA 3P5SA 4CL8A 2HK8A 4P22A 2JD1A 4FFNA 3ZWYA 4CJXA 1G0NA 2ILTA 5HBRA 5K9ZA 1HLDA 1C1XA 4XYGA 1WNTA 3RI3A 1OC2A 1W4ZA 2I65A 4J6FA 1E5QA 3H7AA 2E4AA 1R4MB 3HG7A 1HEUA 3VZRA 4GMGA 4E5MA 5TJ9A 4Q3AA 4GBJA 2C82A 2A9FA 3ETEA 2J5KA 3KSUA 4PLVA 5ILOA 4ALMA 1AUPA 3LU1A 2YFQA 2RBEA 4CM9D 3ONEA 1Z7BA 1NP3A 2FZEA 2DC1A 3G49A 4HNGA 3GOHA 4FQ8A 3VH2A 2HMSA 2I66A 2PTGA 3WGTA 5JBIA 2HO5A 3DBLA 2VUTA 2EW2A 4R1NA 4CODB 1F8GA 1NX6A 4MKZA 1Y5RA 2CVZA 1WDLA 3WYEA 4D0SA 4IQGA 1SCUA 3Q9UA 2ZTMA 2O23A 4MIYA 1PR9A 4BMNA 3K2EA 2JHFA 1HDCA 4U5QA 3V2UA 3IS3A 2XAAA 4W7IA 4FFLA 3RBVA 3GMSA 3H9JA 3S1LA 5JAQA 1Q7GA 4ZA2A 2X23A 1KVSA 4TQGA 3ANNA 4MP6A 1KY4A 2FR8A 1N1GA 1XHLA 4JK3A 3AI2A 2D8AA 2NQTA 1CJCA 3OF2A 4EGFA 3VPSA 3TZKA 3N7UA 1WW8A 3RC9A 3WBBA 3C24A 1MA0A 1YB5A 2BHLA 4XYEA 5B37A 3GRKA 4EW6A 3SLKA 2ZB4A 3WYCA 4II2A 4QUKA 4TZKA 3INTA 4WOJA 5AYVA 1WDKA 1YXMA 3O4RA 4U7WA 5HM8A 1RJWA 4EEXA 4YJGA 5A4DA 3D4NA 4WASA 2I76A 4ZU3A 1H6AA 4GX2A 5TS3A 3RFVA 1U8XX 3LQFA 4YAGA 2HSDA 2FP4A 3AOEC 3U4DA 2UVDA 4WCDA 1D4FA 1P1HA 1HDZA 3FR7A 4FFRA 1YWGO 2R00A 2YYYA 3OP4A 1XEAA 1CRWG 4DQXA 4ALJA 2VOJA 4JJFA 4JQCA 1UDAA 3ABIA 4W9NC 5CDUA 1E0DA 4J2HA 4R1TA 1ZIDA 2NVUA 4IGFA 5TF4A 4NIMA 4YPOA 3F4BA 4J0EA 4Z9FA 3U49A 1LU9A 1V6AA 3H5RA 1E1MA 2EGHA 2G1UA 3PRJA 2XPCA 3B6ZA 3F46A 4L75A 4UAGA 5A9TA 4AJ4A 4ZJUA 2JD2A 3U4IA 4XGKA 3PQDA 3WG9A 1DRWA 3GEDA 2VHXA 4J0FA 4BNGA 4GMFA 4B8ZA 5LCXA 3HFSA 4IY1A 5IXYA 4E32A 4EJMA 3UFXA 1NVMB 3H3FA 4J90A 3KYCA 2VZ0A 1TT7A 3DBVO 3KTDA 3STHA 5GY7A 3WMWA 1E7MA 3JQDA 1SEPA 1CQJA 1E3JA 2EP5A 4RVFA 1F0YA 3ZNPA 4A0SA 1UXHA 5C5IA 2Q1WA 4MVJF 1HETA 1VPDA 2Y05A 2JFFA 4LISA 3NT2A 4KQWA 5THKA 4IQ0A 3FF4A 3BMCB 1EUDA 4MKXA 4BNMA 3OFSA 2OL4A 4U0KA 4P4NA 2DFVA 5T67A 4D3DA 1VE9A 4BNLA 4CM7A 3HWRA 4IS2A 3WS7A 1K0UA 3AK4A 4UEKA 3TFOA 3D5TA 3KLMX 1E7WA 1BXZA 1G1AA 3MJVA 4QECA 5JY1A 1LDYA 3DO5A 1XA0A 1LC3A 3ADPA 3K6JA 4OH1A 3ZHYA 1G0OA 3ZV5A 5JDCC 5FFFA 4M8SA 1U3UA 3KM0A 3DONA 3FTNA 5TGDA 3TL2A 4CUJA 3UKOA 2NU6A 3M2PA 1P1FA 4B8WA 3GNQA 4OKIA 5H82A 3GUCA 1VL8A 3AU8A 1DB3A 1Y6JA 2J5RA 3N74A 5JYEA 3JYOA 3H65A 1I33A 1KERA 3BIOA 3MJSA 1PEDA 2FPIA 5IXSA 2EKLA 1GL3A 3DTTA 4CR6A 3U4HA 4CMBA 4P8RA 4FFOA 4XR9A 4PGFA 1HT0A 3INRA 3DBRA 1LLUA 3GVPA 3VZSA 5BSGA 4G65A 1XYGA 1ZO8A 3IDSA 4JJGA 3HQ4O 3EMKA 3GT0A 4BB6A 4R1UA 1GV0A 2X9VA 2OXIA 1LLCA 1F8FA 2PD6A 4WPGA 1TT5A 3Q1LA 5TSDA 1E1NA 4ZQEA 2R6JA 3GF4A 4GWGA 3BMCA 4E5PA 1E3SA 4ND2A 3C1OA 2C54A 4FBGA 3TJRA 2O2SA 4NR0A 3RBXA 4DQVA 1R4NB 3JCZA 4DLAA 3NUGA 2OFPA 3K5PA 1K2WA 1HE4A 3K31A 4BHTA 1VRWA 1XG5A 5JYDA 2NNLD 4DVJA 4GSKA 3QA9A 2YV2A 2CDBA 4R41A 2HMWA 4GLLA 4TRMA 2FZWA 2J8ZA 4AVYA 5CEJA 2H6EA 3I9OA 3DDNA 3GR6A 3TOXA 4FJ0A 1ADFA 4PLFA 1EQ2A 4XYMA 2O3SA 1EK6A 1ULUA 1A7KA 3WBFA 1MLDA 2A4KA 4AJ1A 1Z73A 3PPIA 1VSUA 4U0JA 4UEOA 3V1YA 2Y0EA 4AL4A 2BFPA 2HCTA 4BKOA 2IXAA 1RYEA 4W4TA 4ZRNA 3KRTA 3X2FA 4FSHA 4IDAA 3M1AA 2ZYGA 1U3VA 4HADA 5CPBA 3K96A 5DOZA 1JDJA 5JO0A 5J23A 2RHRA 5M6DA 4MDHA 2DPGA 4JIGA 3GQVA 2AA3A 4UVHA 5G0UA 1Y8RA 3FTPA 4F46A 3SXPA 1YBAA 3MTJA 1HSZA 2P68A 1KEWA 1MC5A 3IOYA 1VJTA 3OA0A 2GASA 1JVSA 1TT5B 4NU6A 2OORA 4FFMA 1E7RA 1T2CA 4N5NA 3RAJA 4PG6A 1U2GA 1NHWA 3KB6A 1Y8QB 3VVCA 2DBQA 3NDJA 3ICCA 2B83A 2I67A 3MCVA 5G4KB 1PZGA 1YL7A 2DTDA 3F5QA 1EVZA 4N18A 2C2YA 4FJ1A 4W99A 4RDIA 3G1UA 4YRAA 1C1XB 5AOVA 1IB6A 1T2EA 2HRZA 4RLHA 4QO8A 3SC4A 2P9GA 2Q45A 1HWYA 3BHJA 1UDCA 1D8AA 3A28A 5TJHA 4RJTA 4XB2A 1Q1NA 3QHAA 2WJPA 3OQ6A 4BNNA 2W90A 1JVBA 2NACA 1K3TA 1KETA 5JE8A 3SBOA 3ETDA 3DAPA 4FB5A 5ICSA 3GVXA 4MKRA 4YAEA 4O5OA 4XA8A 3G79A 4F6CA 2XF8A 3WLEA 5KVQA 5A1TA 5BSHA 1XGKA 4BNKA 1GPJA 3BTVA 2JFGA 4KTVE 1E1LA 3Q0EA 1ZK3A 5I7VA 1U28A 3GDOA 1CF2O 3P19A 5EN4A 1DRUA 4GGPA 1O6ZA 4XDYA 4CM1A 3WXBA 3QWFA 1E7YA 1DJNA 1YBVA 2WD7B 4FN4A 4BV8A 4WLVA 5LDGA 4BGVA 3L07A 4CM8A 3WLFA 2CMDA 3LT2A 2QQ5A 3FCOA 3GEGA 3KSDO 1E1KA 3HADA 3OMLA 4CQMB 5DDIP 1PZFA 4YDRA 3FNEA 3QLJA 3F9IA 1VKNA 1ADBA 2Q1TA 1P0FA 1C1DB 3I4CA 2VHWA 1IZ9A 3K92A 2EP7A 3JQAA 2FR1A 1QKIA 3D3WB 4JX8A 2X58A 4LMPA 1V35A 2VWHA 3C7CB 4DA9A 3HJAA 3O9ZA 2GZ2A 3LDHA 4G2NA 3TN7A 4D43A 5KTKA 4CL3A 3RQSA 6LDHA 5KVCA 1JQBA 4W9NA 3PI7A 1QXSA 3ZWVA 4IJKA 1E6UA 2WTBA 2QW8A 1YBMA 4EEZA 4O59O 2PA3A 3PYMA 1A4UA 2XXBA 1GY8A 1T1SA 4GL4A 1YB1A 4CMIB 1H0KA 4FS3A 1UZNA 4QO7A 1LBEA 4BO5A 5B1YA 3LK7A 2P4HX 1MFZA 2VUSA 2W2KB 1NQTA 5EQDA 2PD3A 2YQ5A 3H9GA 1J4AA 1HDGO 2JCYA 4A03A 2WD8A 3RASA 4ZRMA 3VH4A 2AEJA 3ZU2A 3WSWA 4XIJA 2NU9A 2QYSA 1KEPA 1IYZA 3ZZNA 5EPOA 1ISJA 2X86A 4BNTA 1R15A 1UR5A 3FR8A 1ISMA 1HDYA 1WXDA 3IP1A 1NR7A 1ZW1A 2ZQZA 5TLSA 1RM3A 3BXXA 3PQFA 4OXKA 4NDNE 1DC6A 3S2IA 3K30A 2HDHA 1R12A 2OO5A 3HDQA 3KYDB 4K26A 4L73A 2Y0CA 3NDRA 2J3HA 1EDOA 2VHZA 4CM4B 3ZDFA 4UUPA 4E5YA 2X0JA 4J4HA 1HDRA 3GY0A 4YBZA 3GVHA 3PIIA 1DIBA 1U2DA 2RAFA 1C1DA 2C2XA 3RD5A 3NGLA 4NMHA 3GUYA 3QWAA 2FSVA 1XELA 1ULSA 4IZIA 2EEZA 4TRRA 3ZHZA 1P44A 5FF9A 2O48X 4DPMA 1PL7A 5IZCA 4XJSA 2NWQA 3FN4A 3DHNA 3F4LA 3PFWO 2QHXA 4PG7A 1PJQA 3EUWA 2DU8A 1J0XO 2VRCD 4DUPA 4OAQA 5JS6A 2BLLA 5T5QA 2NUAA 1CYDA 2VWGA 5KJFA 2Q1UA 4R5HA 1AGNA 1HL3A 3HHPA 5DP1A 3CMMA 3W8FA 2BI7A 1CEQA 4NBWA 1U3TA 1P1KA 1YO6A 4OXNA 2A94A 3RUHA 3AY6A 3NJ4A 4MVJG 4EBFA 2V6MA 5JY6A 4JJIA 5DBGA 3D3WA 5BNIA 2FPPA 5TT1A 1PQPA 4FDAA 1C3VA 2V6BA 3NT4A 4MIOA 5DP2A 5ENDA 5G2OA 4PLYA 1PIWA 3AFNA 4IZHA 1HDOA 3WDSA 1R4MA 3CKYA 4JP2A 1B0AA 1ZJYA 4K6CA 4BNHA 4YT4A 4O0LA 3MJTA 3HB4X 3MTGA 2ZQYA 5U1PA 1LSOA 2AEFA 5U9CA 3HUDA 4NJMB 4QXMA 1T4DA 3H2ZA 3KBOA 4XQCA 4HFRA 1DAPA 1EBUA 1A9ZA 5JAZA 4IM7A 1YQXA 4Q3NA 3UHAA 4ILKA 4B79A 3GAFA 1SO8A 3WNVA 4PLPA 1EQUA 1XQ1A 3W4JA 2IZZA 3GGPA 4P4GA 2XOXA 3A1NA 1XU9A 5CG1A 3WQRA 2EHDA 5ICMA 4U8GA 1I24A 3HZZA 3RUIA 4YJHB 1B7GO 1ENZA 4TSKA 1LI4A 3L0DA 1ZBQA 4AJPA 2B36A 1P33A 3TZ6A 4CM8B 4CV3A 1HSOA 3KO8A 5ER6A 2B5VA 3CUKA 1ENPA 4YWJA 2NTVA 1O9BA 2VRBA 1UXGA 2DBRA 4R3NA 5AQ1A 3JQBA 5A5FA 1GZ3A 2DUWA 2Q50A 3H3JA 5JDCA 1ZK4A 2VTEA 3RUFA 4OGWA 4YA6A 4RZHA 1R0SA 4LVCA 4IJUA 2VNAA 2Q49A 2VN8A 1PJTA 4IGEA 2PZKA 5DZSA 3ADOA 1PQUA 5I9LA 4U6SA 5A03A 2GLXA 1LX6A 1N1EA 4N54A 3KLPX 3V8BA 3OIGA 1SBYA 4KDEA 1H2BA 4PZCA 1I3KA 4HXYA 1V9LA 4J2OA 4XGIA 2ZJ1A 1GR0A 1YQDA 3SVTA 3I9MA 1E5LA 1N8KA 4HFMA 4B7XA 2I3AA 1BHSA 4ZHSA 4TKMA 2D5AA 1GV1A 4D0RA 4NFYA 4DYDA 4NBUA 4IDBA 1CETA 4BO6A 5HA5A 1RYDA 2GO1A 1VLLA 1J6UA 4CLEA 3H9EO 1AE1A 1YDEA 4IDDA 1ISGA 4M54A 4N7RA 1PJBA 1FXSA 1VM6A 4PLCA 3SLGA 1ZFNA 3QJ5A 1BMDA 4W82A 2CVQA 3I9JA 1IOLA 3LC2O 5C7OO 2EERA 3ENKA 4DRYA 2GGSA 4NJOA 4DIBA 2VYVD 2V6FA 1N92A 4YRBA 4L76A 4NBRA 5L7WA 1JW9B 5B4VA 3IC5A 4GWKA 1MFPA 1X1TA 3CE6A 3F1LA 3QVWA 2W4QA 5CFZA 5K0ZA 3JSAA 1RM5A 3PLRA 1LTHR 3NAQA 1EE2A 1BXKA 3CZMA 1NPTO 1ONOA 3JD3A 3LT4A 4J91A 3I23A 5A04A 3UN1A 4EZBA 4RPJA 1YH3A 4MVJP 3HB5X 3DHEA 3Q9NA 3V2GA 5L4LA 4RVSA 4OXYA 3LF1A 1I3MA 1YJ8A 1FMCA 2PKRA 1DDOA 1FDSA 3EK2A 2FOIA 4NK4A 1AXEA 5T6BA 4CQLA 5KOIA 3I6IA 2DBZA 2C5AA 1PL8A 3VDQA 3OJLA 4DYVA 1R16A 3GC6A 1EZ4A 5JCJA 3DZFA 4IIVA 3VTFA 2D0IA 5CAEA 4OMUA 2UYYA 2G0TA 4WLUA 1M2WA 2NVUB 1QV6A 2PK3A 2Q4BA 1EDZA 1PX0A 4M86A 4YEDA 1GQ2A 3NKLA 2Y1OA 3ROMA 3D7LA 2Y99A 4YT8A 3RIHA 1E3EA 2P9EA 1GEEA 3WYBA 1U4SA 1SEVA 3L9XA 2O2YA 3A14A 3V2HA 2ZKLA 4WUVA 3S2FA 1NWCA 2BI8A 4CMEA 1Z74A 5ENVA 4WECA 1KYQA 3TL3A 5KJCA 1ZH8A 1LLQA 4J9VA 5DCUA 2V7PA 1CDOA 2FMUA 3MWDB 5JO9A 4S3MA 5DT9A 1N2SA 3DZJA 3JTMA 2Q3EA 1V3UA 3UXYA 3FBGA 3ZHBA 3LZ6A 4YR9A 2IODA 3SEFA 2PNFA 1HYGA 4YVFA 2BELA 1WVGA 3FPCA 4JNKA 5B4TA 4J49A 1JAXA 4UVEA 2E6UX 1E7SA 4ND4A 2HAEA 2PV7A 4NJMA 3L4SO 3JQFA 1UXJA 3B1KA 1EVJA 3F47A 2Y68A 2ZTVA 1DC4A 3HDHA 3BMNA 1E3WB 5DNAA 3DBHA 3A06A 1HE2A 4H16A 5JPIA 3CIFA 3ZW9A 1AHHA 4OOFA 5HRUA 1GYPA 4YB8A 2PY6A 3GEMA 1EVYA 1ORRA 1AN9A 5CDYA 1NAHA 4AJLA 3JV7A 3BHIA 3EVNA 3E6AA 1DEHA 2B5WA 1KC1A 4UREA 3QWIA 5H83A 1Y8RB 3DWFA 2YHIA 2EKPA 1VSVA 4RLSA 4NK5A 2OZPA 5KJ1A 4DBVO 4CMGA 1LUAA 2QRKA 2FWMX 4HBGA 1DPGA 2OUIA 3UCFA 4BNJA 3L6DA 3MEQA 2Z95A 1QRRA 4PLTA 3DZHA 4XRGA 4M1QA 1XKQA 4M55A 3K9QO 4QEDA 4RDHA 1QP8A 1ZK1A 2WMDA 3FSRA 2YHUA 2ZCVA 1EFLA 3MJ4A 4G81A 3TZQA 4Y9DA 3BAZA 4FR5A 5TT0A 2IYPA 4KDFA 4FC6A 2GNAA 5F1OA 5L40A 3RC2A 1T4BA 3GZ4A 2DLDA 1LQTA 4PZEA 3AUAA 4PN3A 4GSLA 1QLHA 5TQVA 2C0CA 2LDXA 4URFA 3VHRA 5A05A 4AJJA 2X0IA 3COSA 5C7IO 1N5DA 2IRWA 1V0JA 4NI5A 4IDCA 3I6QA 5F5LA 5L95A 3E48A 3OIDA 4L0QA 1NPYA 2H5LA 2Y1FA 2W2KA 4LK3A 3TF5A 1TEHA 4DC1A 4GH5A 4FOOA 3CSDA 1LDMA 4OQYA 4ESOA 1N9GB 3LT0A 3E8XA 3E18A 2J3IA 4GVLA 4D46A 3ANLA 5JW6A 4XQGA 3H9QA 2OBYA 3ZWNA 4EITA 2VYVA 3ETGA 3PHHA 4WEQA 3BA1A 4PZDA 4RV9A 4DIOA 2UDPA 4MO2A 2Y1CA 2UV8A 5TX7A 3LYLA 1SMKA 1T2FA 2C7VA 3WMXA 3WX0A 1YB4A 1Y1PA 3ORFA 3UAGA 1JKJA 4K6FA 4EYEA 3LLSA 1RM4A 2RIRA 3K2BA 3ZHXA 1SOWA 1HDXA 3PYXA 3KYCB 2Y66A 1NFRA 3TWOA 3ZU4A 1EFKA 4P4LA 5EINA 3EDMA 4W7HA 1KY5A 3Q6IA 3PHJA 1TB4A 4F6LA 4OSPA 1T24A 3PHLA 4JN6B 1K5HA 4UEJA 4L4SA 5BT9A 1A4IA 1EUZA 4RPHA 3VZQA 3ZNNA 4EJ6A 4NG5A 4CUKA 3QY9A 3VKVA 2EWMA 4BKUA 1KIFA 1Y8QA 1PQWA 4MVJD 5T57A 4AICA 4E5KA 4RVUA 3CZRA 4GKBA 4ND1A 2WEKA 1BG6A 3ZWPA 1VJ1A 1P9LA 3PVZA 3VPFA 1BDBA 1H5QA 5C37A 3QVXA 3PDUA 5THQA 1E6EA 5ILGA 3ON5A 5C3MA 4DC0A 1HZZA 2ZTUA 2O4CA 3JQFC 1DIHA 4KWHA 3BMOA 2HQ1A 2A35A 3JQ7A 3WB9A 1ZMOA 2BRUA 2PGDA 2B35A 3I9KA 3HSKA 1PZEA 3WGHA 1A5ZA 4IMPA 1PS8A 4BGEA 4AJKA 3DTYA 2PGJA 1BVRA 4DBZA 3O38A 2AG5A 1NYTA 1PJSA 3ASUA 3EC7A 5CEFA 2DAPA 3MWEB 3ZCXA 1FDUA 1ZJZA 3PWSA 1ZSVA 4J16A 3SJ7A 2P5UA 3JQAD 1U7TA 4CQLB 3WGZA 1MG0A 1LRKA 1QYXA 3LT1A 5JSFA 4OKNA 2VT3A 1DC3A 2I99A 4FJ2A 2I3GA 2VWPA 4OQZA 3VPGA 4EDFA 3B70A 1ONPA 4E12A 5TIIA 4IXWA 1P1JA 2XXJA 1MV8A 1J49A 2ZK7A 3T7EA 1KVRA 2FR0A 3OETA 5JFOA 2WYUA 2AHRA 1ISIA 3D0OA 3GG2A 4XWYA 4E13A 3PYLA 4M87A 3H4VA 2BGLA 3KYDA 1Y9EA 1DOHA 4YJFA 5CHEA 1DFIA 5ES3A 4BNUA 4XEHA 4PVCA 1Q7CA 4AJOA 5KNLA 3CEAA 2HK9A 3GHHA 1XDWA 3X2EA 1OAAA 3V1TC 1PGNA 1R0LA 1UAYA 4D79A 2GUGA 4MVJE 5TNXA 2GZ1A 1W73A 1C14A 4GX0A 1X15A 2FRDA 3H2SA 3Q2KA 1PJCA 3TQHA 1BW9B 1G6KA 5C7LO 4WK6A 3WFJA 4YXFA 4A7PA 1JA9A 3IUSA 4R51A 3DAGA 2UUPA 2HMUA 2YV1A 4J9UE 3AFMA 4ZQFA 4AJHA 5IN4A 1I3NA 1PJ2A 1W6UA 1GUFA 1UXIA 1DHTA 1NPDA 4UVDA 4F45A 5AXCA 3S8MA 1I36A 3WQQA 5A06A 3GN1A 3ROPA 1RWBA 1VJ0A 4B4UA 5IZ4A 3GRPA 4CM4A 4BGUA 3QQPA 3NV9A 5KKAA 2PKQP 1L1FA 4CMJA 1XCBA 3LF2A 5JC1A 3FNHA 5FI3A 4Q3BA 3VC7A 1E77A 1PWXA 4CM3A 3WJ7A 1QMGA 5KWEA 6ADHA 3AI3A 4ZICA 2Q2WA 4W6ZA 2B4RO 2CD9A 1HRDA 2X22A 3PJEA 2DPHA 1UZLA 2FY8A 4J43A 2VNSA 4WLFA 5BQFA 1B8UA 2Z1NA 1NAIA 4R9RA 3P2OA 4BL5A 3I5MA 2NVWA 4Z6KA 3GA0A 1K6XA 4KTTE 2V65A 4DLLA 4XB1A 1BXGA 3UW3A 5BSEA 8ADHA 1U4OA 4E4YA 3EZYA 1B8VA 2IXBA 3GN2A 3BMOB 1ID1A 3ZWBA 1P31A 1N7HA 2IDZA 1Z7EA
chains in the Genus database with same CATH superfamily
2FQYA 1TLTA 2RBGA 4I1UA 3C1AA 2KLBA 1YK1A 3SEAA 1NBIA 3H4IA 521PA 4CFYA 4YNBA 1Q1QA 3ZTTA 3LIPA 3IULA 3H7IA 2H2HA 3CLSC 2AW5A 4HFNA 4B4VA 5T3UA 3FSGD 3PUHA 2W37A 4DWWA 1M5TA 1PL6A 1QKJA 3GFPA 1NR1A 2QSUA 3AM5A 3GDGA 5C1PA 2ST1A 4Z9XA 1T2DA 1Q3TA 1YI1A 3IVRA 4QWMA 5J2UA 1PW5A 1E2KA 5EJMA 3WQHA 2ORED 4I8XA 5NULA 3TD2A 2QUKA 5THXA 4OSOA 1OWMA 1UAGA 5BNWA 5I9BA 1RKQA 2PX5A 2PN1A 5AVTA 3K70C 3B78A 3CMCO 1U8CB 2Q6TA 2QRLA 4XR4A 2NPIA 2M32A 3AH8A 3IPXA 2FMKA 4HNRA 1F8YA 4L85A 2ID9A 3SMQA 2D4AA 3TVYA 4BVAA 1WMFA 3WR5A 1NN1A 1VHDA 1OSNA 4NZPA 2KQUA 4FGJA 2GF2A 4FCCA 3RJ5A 2P75A 3ESYA 1Q20A 3BXGA 3GPBA 4PS1A 1Q1ZA 3QVOA 3D6TB 4FNGA 4V1CA 1WZ2A 3E4CA 2BE7A 1E92A 2Q5EA 3NEPX 4C7KA 3LFHA 3SEZA 4RTNA 3L8YA 4UU7A 3UUGA 4WZAA 2Z1MA 5KNBA 3EPLA 1L7NA 3QUQA 4KYIB 1QMPA 5GMOA 4ZOEA 3QEMB 2HREA 4C03A 1UM8A 1KC3A 3BQNB 4WZAE 3PEVA 3EODA 3USCS 3HP1A 3GZNA 5CVUA 3RSQA 1DQZA 2OB2A 3ETNA 2FTKE 5F2KA 1FYVA 3LY8A 4CFZA 4WI1A 1I7PA 3LUDA 2FVYA 5KYWA 1Z4KA 1EGQA 3HDYA 1LBQA 1UKBA 4ZOLF 1Z8DA 3ROXA 4BRSA 3N1UA 1G4UR 2QQGA 5DI3B 1UBKS 1VRCA 2B1JA 1XKXA 1OILA 2BFNA 2HMTA 4QIHA 4BEJA 2KJQA 4MAAA 2J9RA 3LV8A 1DFHA 3JQPA 3CJRA 2QR3A 1ADYA 1U02A 4LMAA 3WYDA 3L4BC 1U5AA 5DV9A 4ZD6A 2R7AA 1C0IA 2IY9A 1WBDA 1NNUA 1VBMA 3RSZA 1S2MA 2ZT8A 3BF8A 1ZN7A 4JUDX 5ARDA 3G2NA 2JJ1D 1TYDE 3ZDXB 1C29B 2WRZA 1EHCA 5IKPA 5CYGA 3DFUA 3EQ2A 2HRCA 3AINA 3WKCA 5F12A 3OOWA 5IG2A 3DC7A 4R2WA 2Y6VA 4A1OA 3A6DA 2VYQA 5EZ5A 1Y4SA 3VOSA 3TUTA 2TRSB 5ICCA 1ZMBA 4Q12A 5AJWA 3RVDA 4LDPA 3R3WA 1R18A 4LKRA 3RU9A 4RFLA 4DJ5X 2GJKA 2GXAA 3HXQA 1PJ4A 4V0NA 2PWZA 2YJGA 4Q7EA 1TQ8A 1ZCZA 3HSYA 2GCEA 1AXRA 3SS9X 4ALIA 4E46A 4ISCA 3EDRA 2Y1XA 1KQGA 4I5DA 2WAOA 4D9CA 3VR1A 2BF7A 2MSEB 4YAKA 5CPFA 3ST7A 3UY4A 2W2TA 5AW3A 4GPAA 3PR1A 4PG5A 1PTKA 1E99A 2X3FA 5IF3A 1Z6TA 2IH2A 2O8CA 1XP5A 3C6KA 1GPLA 2I4MA 5HF8A 1GPAA 2AMVA 4BS9A 1EAYA 2A58A 1H2EA 4BNDB 2YYZA 3IEIA 3L7OA 2ATIA 1HLGA 3QPDA 4N5DA 4CEJA 1XEXB 5COQA 1V1RB 4M8NE 2PUAA 3RIYA 4JLOA 2ASEA 2QPOA 3FOZA 3AOEA 3ZGYA 4NZNA 2BFMA 3GJYA 4ROSA 3TI9A 1YONA 3EZ2A 4GS5A 2QRUA 5FPHA 4AKEA 1BMTA 4HUQA 6PFKA 1G5FA 2PVCA 4LYDA 3WA7A 1BE0A 2VIIA 2WJAA 1Q83A 3L0IB 1GQYA 1PVVA 5BQOA 1D2HA 2GTIA 2JGRA 3TKAA 3VZPA 4ER5A 1NJ1A 1QMHA 2E21A 5CT8A 3UMFA 5CG2A 1LZKA 1T9GS 3T5PA 1NBMA 2BGRA 1Y3AA 4WJZA 1B15A 4H0CA 4AZ0B 4LOHA 3G82C 4UNNA 1ZMTA 4MUNA 1L5VA 4UQOA 3RUDA 4CG1A 4EKNB 5KBYA 2MIIA 4GX1A 2PPVA 5TPWA 4HTFA 3KKPA 3DXYA 1EVQA 3ZR4B 5CXQA 3PVCA 3D43A 3VSDA 3HY6A 2QN9A 5A4FS 1R6DA 1D0VA 2OHFA 2W6NA 3IDAA 4KSYA 1L7DA 4HI0E 2CBZA 3TXXA 4BX3A 3RVOA 4EJSC 4EO9A 4EUHA 1QHXA 4GXRA 3A0RB 4U3JB 4G09A 3IUNA 1AZTA 2PZLA 5ECWA 3FFXA 3N6RA 1XU7A 3E53A 4L4RA 5AOAA 2PS0A 4Z0TA 4G0XA 3M6XA 2IX9A 4ZGGA 1P61B 2KLHA 3UG7A 1E9FA 3VQTA 2BEUA 5DBIA 4U7GA 2EFDB 4YMSA 1OFTA 3TW8A 5EQFA 4ID9A 3ZJYA 2JJYA 3NYWA 4PXYA 4B5LA 2H1FA 4QBIA 4CV0A 5I51A 3Q11A 5AVOA 1RJFA 2HUNA 2ZUTA 4EG5A 4M0MA 2PYZA 2P77A 3L8GA 3NNSA 3OFND 3GAAA 4V0KA 1SJ9A 1OWOA 4DSUA 3REQB 5KTRA 3ZG6A 2JLYA 4HDKA 3OLZA 1AF4A 3DQPA 1DV1A 1QVZA 5DYWA 1R0BA 1H93A 4BP8A 2QF7A 1BGVA 4BMCA 4NZOA 1NRJB 4E08A 3W1EA 1UPTA 1E66A 2ZT7A 4CCSA 2B7CA 3CZQA 3FI0A 3SBDA 3HU3A 4WZBB 1PK8A 3IMCA 4LX0A 1GTRA 4I4TF 4ZJPA 1DADA 1I4DD 2QJTA 3BE4A 2HF8A 1UJ5A 4YGXB 2QMYA 3DL2A 3H3XA 2Y1KA 2A9QA 3EFOB 3L93A 3DB2A 1NQAO 3ONFA 3KHKA 5DXAA 1CUEA 1SXGA 2A1TR 3D6MA 2NVBA 1IJBA 4O8ZA 4D3XA 2P2GA 5CLJA 1WY5A 4CTNA 2FMXA 3OZAA 4DW8A 1S7GA 1H0SA 1XDZA 1AGPA 4FGSA 3LP6A 3G0OA 4KL8S 2Q5OA 4P5EA 5ALXA 5K3SA 3RS8A 4LDJA 4EUFA 3B8HA 1KJNA 3QWBA 4MQFA 1WAMA 3ZZUA 1GCOA 2CSUA 5BR4A 3CF0A 3E61A 3T5AA 1P1RA 5F78A 3UT5B 1XTJA 2IEAA 1ZH0A 2WE8A 1XZLA 1G8AA 4IXTA 1SCQA 5A3JA 3U6KA 4Q9NA 2PXCA 3P9ZA 4EECA 1TYZA 3I0ZA 3QE2A 2CGEA 4H6PA 4JROA 4LV5B 4Q9IA 1UP4A 4HZUB 5I4IA 5IM4A 3SEQA 4YX9A 721PA 3WLIA 5JDIA 5CB4B 3VR4H 1FFSA 2YUTA 4GOND 3HI4A 1WV1A 3KZXA 3AIKA 4XE5A 1RXVA 1X8KA 1JQJC 3JQ8A 1JH8A 4LHVA 3SF0A 1K97A 5ELLA 3RAEC 4YYZA 3IP7A 1ZI8A 2RGNA 3OM1A 4DSOA 1BHJA 4MCJA 2GYYA 2V8BA 5KAPA 3V8PA 3DG9A 3A4VA 3N39C 3QU4A 3RVPA 3GP5A 5JMWA 3FPLA 3JVIA 4M98A 1V7PC 4ER7A 4AQ7A 5BN4A 1TU3A 2JJ2D 1UMBB 2Z98A 3KUXA 4Q3KA 1DG1G 4QXRA 5TQ2A 1W2WB 5IYZF 4RMGA 4PLWA 4B44A 1BE6A 1T0IA 4OX9Y 2VYND 1OV6A 3BUSA 4PGGA 4CG2A 1C4OA 1PZMA 2ZJ6A 4PS0A 2B8WA 1F2TB 4CMIA 3FYTA 4EF4A 5CBPB 4GE0A 1B2LA 1CRLA 2D59A 2AZ4A 1VJRA 2ZBUA 4M38A 1KR5A 1A27A 1MC4A 3PIDA 4DIEA 4MUXA 1QP0A 3DP9A 1HA3A 3H75A 1PNOA 4UBOA 3RC7A 4AMZA 4ETNA 3B20A 5BMVA 4II3A 5KHOC 3LUHA 3KHTA 1M2OA 3PA6A 2ZUUA 2N9UA 1LNQA 4AUEA 1JIVA 5JHHB 2BGUA 2O05A 3VH3A 5I9NA 1EGAA 5J1TB 3SQMA 4K81B 2CE2X 1II8A 4OATA 5L7YA 5EE1A 3W1VA 1BXRB 1XL0A 3A4IA 5DLQC 3U4CA 1ZVMA 2CXOA 1DO0A 2OB1A 2BFCB 5EKXA 2EV9A 1MJGA 5FX2A 4NH4A 4TYYA 1YUNA 2BSAA 1QUEA 4ED9A 5C5CA 4LFAB 2IUTA 3VDRA 1DDIA 3HP7A 3T7CA 3LHKA 4EK9A 1H3NA 4AS2A 4O4JF 2A88A 3WOHA 4M1SA 5L45A 4S05A 1N2CB 1UMDB 2HCFA 4IVQA 1N9GA 2F3UA 4UPVA 1YB2A 2YUIA 4YUVA 2Q4DA 2XMDA 1Y1QA 2OCXA 2DGDA 2L69A 1SBCA 2XDAA 2PH5A 4RXUA 3V4OA 2GSWA 3L7BA 4TKZA 1DBVO 3OM8A 2BUAA 4FHEA 3EP7B 3PX7A 1OTHA 2QLTA 1V1RA 4HX2A 3BTSA 2YN2A 1IRXA 3EIQA 1KMHA 1L0BA 1YVDA 1XQ9A 4LA4A 4X5OA 4F91B 1C7QA 3DL4A 4JBIA 4AZTA 2OV8A 3GIWA 2PMCA 1U0NA 2OTCA 4Z3KA 2Y4NA 3NYIA 1QGAA 3KWLA 4LE1A 3FYDA 1ZL2A 3ZNOA 1PLJA 2HD4A 3IPYA 3IUMA 1A9TA 2B8JA 4LCBA 2JB9A 2JGAA 2OKGA 5E1DA 2VH5R 4NHOA 5F4ZA 4DM4A 2V3VA 5KDDA 2PLAA 4A27A 3E8SA 4X61A 2FSPA 4I9HA 2V3WA 3AJ8A 3GGDA 3V9AA 3WWZA 1ML3A 4HZIA 3KT3A 5DTEA 1IB0A 4X8MA 1GDDA 2HQBA 1P2BA 3MLAA 4PSDA 2FFHA 3C97A 3CRW1 3WI7A 3M0EA 1KEKA 4RVHA 3LD9A 4TV8B 5CX4A 2JGFA 1ZU4A 3FJ1A 2ZJ5A 4GMHA 3KOZA 3AUTA 3D8BA 2H0RA 3TLYA 2P9TA 4MRSA 2HXYA 2WDZA 4NU5A 1HZZC 4X6UA 1QM5A 2QI9C 2OCYC 1F48A 4CT5A 4QXOA 2IHBA 4B87A 3L7KA 2BHNA 4BO9A 4R4JA 3H42B 1KAMA 1XVAA 3G1TA 2GYUA 4Q3LA 2PL1A 2V98A 4Z9BA 1WXHA 4KG7A 2JFUA 2VXOA 1N5RA 1SZPA 1SHZA 2Q3BA 3GUVA 3II6X 3LVFO 1UC4B 1ZXLA 2A9RA 3VMMA 4NL4H 1E20A 4OXRA 4JI4B 2ARKA 2OP1A 4WLEA 3KELA 5IJWA 6REQA 4DWJA 4FOSA 4QGFA 2WWXA 3KXDA 4L8FA 1B4DA 5BWLA 4G56A 5DW3A 5KNCD 1U9IC 2WLSA 1Q44A 2FZGA 2P67A 2WM3A 5CLLA 3WL3A 1SVNA 2R8PA 4BASA 1FX0B 1YZ3A 4CLXA 4OIFA 3TZLA 2IGBA 4AROA 3K32A 4TMWA 3L8MA 5HFNA 1RP1A 3UK2A 2GD0A 2H59A 2I22A 2J7PD 2R8YA 4NYMR 4AZ3A 3RCBA 1AG9A 5AVKA 3FYHA 5KEIA 2YXEA 1OPXA 3LT5A 1FTQA 1NBME 1YUBA 3FRHA 1XXHB 3HB1A 4FGZA 4NQRA 4OA5A 4FWIB 3KV3O 4ALNA 1DWQA 3VR5A 1G7SA 5K09A 13PKA 4X54A 2GFHA 4HVAA 4D8XA 4MV8A 3HPRA 1OIVA 1EFRD 4P81A 2GLTA 2DM6A 2REXB 4YI5A 4DDTA 4MRNA 4ER0A 1TYCA 4BQPA 1YGYA 2R6R1 3L41A 5JZMA 1LDEA 3E3OA 4L4ZA 5K8LA 2O7VA 4KVZA 4C3UA 4CMHA 3WJAA 5K8TA 5F21A 1TK2A 3ZY6A 4EP1A 3C4QA 1QK3A 4I5FA 2IPOA 3ASZA 3TRJA 2XCOA 4RE5A 3LX5A 3M6WA 2WAYA 3BE6A 2CLKB 1GZSA 2R2GA 5AI8A 4L8LA 3HKBA 5H0IA 1GU7A 1WZUA 3GJ5A 4MPPA 5C8YA 3STWA 4O6VA 5LYJA 4MGIR 2HTFA 1QGYA 1DRVA 5G0SA 5IARA 1NXQA 4BKPA 2HB6A 1NMXA 2WUDA 2WT9A 1EH5A 3CRZA 3DCYA 3LLUA 1J42A 4OYYA 4WN9A 1XVVA 3JQ7B 4TV9A 1CUXA 2WJGA 3EQZA 3M6AA 4KQJA 3VTZA 3AF4A 4Q4CA 1DAOA 3BXEA 4ZN6A 5JS8A 2ZATA 4CNBA 3PHIA 3NGXA 4NBNA 2H9YA 4RVGA 2J3KA 5JISA 3PNSA 3TGPA 1JWLA 2CFSA 2W9XA 3AKEA 3EBLA 1IJFA 4GC5A 1FP4B 2IHKA 3KXPA 3RAFC 2VPZA 4DB2A 4QX6A 5H80A 3M49A 1YTLA 1TVEA 4Q6WA 2BUBA 4PXSA 1RZRA 2FV8A 1O8BA 2HV8A 4NBTA 2IQIA 3R40A 3IP9A 4TV8A 1VQ1A 4G0ZA 2C29D 2NSJA 2ZIXB 1GGJA 3OPYB 4L3VA 3TPFA 1JAYA 5L51A 2YOFA 2QX7A 2E82A 3JR7A 2WB4A 3FTDA 5AXBA 3WTBA 4ALLA 1BXRA 3C3KA 4TMKA 1LA2A 1ZUWA 5CM9C 1FCJA 3ELDA 3KPWA 3KJXA 3LP5A 1AA6A 3MT0A 3S7TA 2JL1A 5TRTA 4AG5A 4AJ9A 2YRXA 4KC0A 4QU0A 5BRJA 4JI8B 2HU2A 1KO8A 2VP6A 3B85A 1WXXA 3BE8A 2AE2A 1YNSA 2AG8A 1IUNA 3HDVA 4QYSA 4Q9AA 4WXYB 5AUPB 5JC8A 4TKLA 1IPFA 2QYTA 2UXDB 3GBSA 3M9LA 4H4EA 3NBAA 1QVWA 1FP6A 4KWTA 4DDUA 1IONA 2FWNA 2BBTA 2MT9A 2CJWB 2YFHA 4NQZA 1FFGA 3PQ3A 1SIOA 4LZAA 4MNTA 5TQ2B 1U3DA 4XIIA 4RD2A 5I8WA 2VTVA 2VC2B 3K8OE 1QRTA 3GPIA 1RQRA 4FONA 1NVBA 2IE8A 1B74A 1C3LA 4GVPA 1FA9A 2FYTA 3V7NA 2O2GA 4JOBA 1E3TA 3PNBA 3QK7A 4CTJA 3WLQA 4F38A 4HFJA 5B30A 5J4YA 4RZIA 2R4QA 1D4OA 3DBLB 3ZQ6A 4BNXA 4C4XA 1UPBA 4YQYA 2ID7A 1NQXA 3MVEA 2VP3A 3UGQA 3NONA 3WDKA 4BWYA 4C76A 3LPAA 3C6ZA 1XD9A 4J1NA 3W6PA 4PGMA 1ND5A 5HWSA 5A7HA 4U4AA 2H4YA 4G0UA 4QJ3A 1WX1A 3H8VA 4DEYA 2FJUA 3BTOA 1GPMA 3R7WB 3RIGA 4BLSA 5AM5A 3WHLA 4EKYA 3HWX1 2MCFA 1R64A 3PICA 2WM8A 1LPAB 3AYXB 1UEXC 3U4AA 2M6RA 4K88A 4NENB 5IAJA 2AWOA 3AFOA 4TUYB 4UAUA 4Q00A 3IT0A 1S3SA 1UFOA 1QP4A 5B1SA 1OAOA 2ZROA 5G1PA 4CLQA 3ZH2A 2VPPA 3DZ6B 1G7RA 1U1IA 2QW0X 3I2KA 4BP3A 1KP9A 1P1BA 5BRAA 3UW1A 5EZYF 3M3PA 1ZR2A 2V55B 3I52A 3EULA 5HS6A 3OZUA 1UOOA 2EU8A 3FI9A 3IXMA 4FNMA 4KH1A 3TPCA 1EPUA 2AXEA 1PS9A 4NCAA 5ER9A 1KJ8A 5CFMA 4GI2A 1LRJA 1WMAA 1RRPA 1VL6A 4D4KA 2ODWA 5A5GA 1W4RA 2DB3A 4Y6RA 2AKEA 1CRQA 5J5CA 4NV1A 1Z5OA 4I4TA 5IJZA 1D0IA 2IEDA 2OGUA 5EKDA 4A2WA 1OH5A 3OIYA 1A71A 4FD3A 5L3RA 1A77A 3EVFA 2IJGX 5AWFC 3EXEA 4FIZA 4JQYA 4ZVPA 2Z5VA 3OQ1A 4MAFA 3P52A 2CDCA 3WHKA 1QE5A 5E3HA 2P27A 2C3OA 5KNDH 4J2TA 1DU4A 2JJ1A 3QU2A 3DKKA 1HEYA 5I3ZA 4D3SA 1RIFA 1VSQA 3IODA 3NHAA 4ENRA 1GJRA 1LW7A 4FE3A 4XJXA 4E88A 1G3UA 1A76A 5CTJA 2IPXA 1D6SA 2JFWA 1T3ZA 1JIQA 2O8DA 1R5JA 1RLUA 4FKZA 4MWCA 3WK6A 2EX1A 2XODA 5J43A 2B9EA 3AY0A 1R1DA 2RHBA 4AJ2A 1P4JA 4F56A 1FMTA 2YHIB 1JN0A 3OH8A 4O08A 3VI3B 3WGOA 5U4XA 4A36A 1J09A 1U1DA 2PLRA 4X7BA 1GFWA 4QE3A 1RMYA 2A33A 4YV1A 1F38A 5J2TF 1OUMA 2Z3VA 3DNMA 4EDHA 1E2MA 5FTLA 1N6KA 3I9FA 3G0CA 4U3JA 1Z13A 4L5YA 2IIPA 2A14A 2GXQA 2E2WA 1RRVA 1JG3A 1ZMRA 1AXGA 1P77A 1J1UA 1KMQA 3HN2A 3SR4A 1CDZA 3WIVA 2JLVA 2MR5A 1TCCA 5TE9A 4WXPA 1KH1A 3KHUA 3UA3A 1ARZA 1Y4ZA 2BEWA 1N1DA 3JQ9A 2GBIA 2PU7A 1UP6A 1QTQA 3HBJA 4ZI3A 1QZUA 3MERA 3RIMA 4QYMA 1BKSB 4C7BA 2CNNA 1AMUA 2O06A 5DGHA 2VPWA 1QYVA 2DH6A 4R54A 3SSNA 1XRNA 2GZSA 5KB3A 5ISMA 2JIOA 3HY3A 3ND5A 1U8FO 1J9EA 2CFCA 2YRFA 5B5SA 3PXEA 2NXEA 1ODIA 3M9WA 2VZ9A 1ZVQA 1OOEA 2CMKA 3H1PA 4BIIA 5KYUA 2PYDA 2X9LA 4ESEA 1K4KA 1RLMA 2ANBA 5CU7A 1CEYA 1P5FA 3OOHA 4Y30A 4CEHA 2W2LD 1YIAA 1U5BB 2G04A 3R24A 4A91A 4AULA 1RJDA 3U31A 4NTZA 2C0QA 3PXBA 2YCBA 3HYRA 2XW6A 4RO0A 4YJHA 5CX1B 3HJCA 4X90A 4FX2A 4KK4A 4WDQA 2XMRA 3I1JA 1S2LA 4J3FA 1UBSB 1YACA 2PT6A 4TROA 1GUYA 4UUAA 5HF5A 4DA8A 1H05A 4H3VA 2K7ZA 3KS9A 4IKEA 4FYIA 2GF0A 4QL3A 5AK4A 4BO0A 1E3IA 1TVKB 2GRJA 2VRCA 2CNLA 1NSFA 2XYGA 3QEJA 4ZU1X 2X13A 2YXDA 4L9WA 1JSCA 1E2NA 4KPYA 5F1YA 2I2CA 4FMPA 4ZMBA 2HX1A 2D2IA 4NEHB 1TU0A 4QXPA 1T25A 4XWWA 5TPWB 4LVOA 5I7SA 1S3IA 1JLRA 1GZ4A 4LXTA 4N01A 2IY8A 3O1JC 4DXHA 4CCWA 3AG5A 4XQ9A 2WR8A 5E6RB 4MVJM 2TMGA 3O2QB 2ZEJA 4IDGA 4KLZA 1U0JA 3TZBA 1QAMA 5ADUS 3JPWA 4JGGA 2D5LA 5LBUA 3HVRA 2W6JD 4MP8A 3D81A 4KBGA 1I7NA 5TARA 2JAUA 2Q3JA 1JA0A 4LV8B 3IMFA 4BO1A 4RL4A 4FZRA 1T2VA 3BULA 3H87A 5DI9A 1NG9A 2VATA 2PDAA 4FFWA 1PGQA 1I6MA 4X1OA 3ESBA 4OJNA 4I9NA 1VKZA 2BFOA 4B3GA 1FQWA 1RYHA 5ES4B 2FW8A 1NIJA 3X0DA 3ZDEA 5K45A 3KHSA 2J6HA 4LZOA 1RE1A 3T12A 5AVXA 3CXRA 5CXXA 3HNRA 4J0HA 2BGKA 3KQHA 1YDWA 4QQRA 3G8AA 4HS4A 4IMIB 1TE2A 3MJFA 4PV7A 4G26A 1ZN9A 1A88A 1EM8B 1VLMA 4XX0A 1KMIY 2OM6A 4FSDA 4TWBA 2HIHA 3UJ8A 4WFQA 2AUTA 2CUTA 2ZRJA 4URUR 3T35A 3OE4A 5HS4A 5KOJA 5EESA 2H57A 5J2TA 2XOKD 4Y6PA 3UHJA 1M74A 1MB2A 2EJWA 3R09A 3UJHA 1YVPA 2QTTA 3CX4A 4XKJA 1QGZA 4XYLA 2C2WA 2D54A 4YAOA 4AFNA 4C88A 2J0SA 3KAPA 1TJ5A 1ZOLA 1HEIA 1CUAA 2EZ9A 3AF3A 3RJ9A 2VHVA 2W00A 1DIRA 3BWEA 1K7EB 1NA5A 1O7JA 5LOVB 2HYIC 4MJ3A 2QWXA 3E5NA 2R84A 5L3ZA 3I9NA 1Y1RA 5EIBD 4NHEA 1VKRA 2YQ4A 4IOLA 1RWNA 5K01A 5JH7B 3FOFC 3LVBA 1IE3A 2VNKA 1A7UA 1W59A 3NYQA 2D2FA 4LIPD 4R0VA 3UUFA 3OJ0A 5F76A 4G1EB 4UUMA 2V6GA 1SC6A 3FVVA 3AFHA 3DOIA 1I01A 2CVOA 3VRHA 3U3KA 3LUGA 1T5OA 1KH3A 1Z2EA 2VHTA 4D9IA 5JDIC 4PCVA 3S1AB 4ABYA 1A9PA 2AYYA 1B6RA 4P5PA 2VL7A 3ZX5A 4H4CA 1RXSA 1FUKA 5CBKA 2CT8A 1EYZA 2VYFA 1WNFA 4CKCB 1NYRA 3GGJA 3AFIA 3AXSA 3QE3A 1D2CA 4FEAA 5E9AA 1F51E 4U7DA 1QU3A 3OICA 1CRPA 5DOVA 4LY9A 4DMRA 3A26A 1QB8A 4LGCA 4HNUA 3C98A 1A98A 1RD4A 1VBFA 2QP4A 3DBRB 2VNHA 2ZJZA 4OUDA 5DE3A 4MW9A 3CEPB 1M2GA 4MVWA 1S89A 4GM0A 2R6GA 4ZO9A 1MAWA 2X6QA 4I5EA 4MGHA 4I3HA 3T9AA 1MB4A 1MXHA 3WZLA 3LBFA 2QBYA 3JZMA 5E9JA 5AJZA 2NTJA 2J9XB 4DV1B 5H16A 1X7WA 4P7JA 4UATA 4RK6A 3H5IA 1Z36A 2JH9A 4LYEA 3GGCA 1PNQA 4PHTA 5EP3A 2ZSFA 1BX1A 2C00A 4JCOA 4R8KA 5AVZA 2LCIA 4MB0A 5T4FA 3DTVB 2G8LA 2NOAA 1GLNA 4RXTA 4HVTA 1NV9A 3ZW8A 2LPMA 3N2EA 4GBMA 1JWBB 1RZ3A 3SCZA 4C4AA 4IIJA 2R7LA 5HJ7A 1G5IA 1P0PA 1U0HC 5CCXA 3GRAA 4CLHA 4UULA 1N0IA 1XSEA 1TTHA 1ZZGA 4HSGA 4BEVA 2RI0A 1H2XA 1RHRA 3QGMA 4PX2A 2J9GA 2VNIA 1LXCA 5E9QA 4M0CA 1OJ7A 1Z7GA 4YALA 1UMKA 2G72A 1DEAA 1E6MA 2O3JA 3EGOA 1I7MB 3R2JA 1QONA 3PHCA 4RIEA 3HK2A 2IW1A 5JROA 3G5UA 3KU1A 2YNMD 4HNAA 4KMSA 2EQBA 2FF7A 1WUHS 3E03A 5B58T 4YPVA 3CBGA 4MROA 2VT2A 3CKMA 1CQIA 3E9MA 3TRFA 3B52X 1OXKB 2GBLA 3E7PA 4GI5A 2P2SA 3C3XA 2DWPA 3HGMA 2DKNA 1RC0A 4H3HB 4QOSA 1TAHA 1NVXQ 2CXTA 5KQRA 2YVQA 1OXMA 5TC4A 1CLUA 4OLAA 4WESB 1MDFA 1R0KA 2I6TA 2QRZA 5AI5A 1YFLA 1XMVA 3QU9A 5DLPA 1YRQA 3ZGNA 2ZSAA 1AHIA 4B2IA 1DKOA 5F3WB 3C6XA 3HB9A 3TSWA 1TK3A 1E1QA 1MAVA 4WAUA 4I50A 1I4EB 4LHYA 4D8UA 4F1WA 1OYYA 3RVSA 4QJ4A 3NT5A 4LNUB 1CUUA 1YR2A 3DAYA 1NW4A 1M72A 4NYIQ 2AN1A 3GNLA 2JKYA 1K06A 3D3QA 3JPYA 4QGAA 2XNCA 1Y1SA 1I7BB 3GEHA 5AI9A 2JEOA 2DMRA 2PU5A 1N8NA 2Y71A 3BMQA 2V7EA 5HP4A 1T6ZA 4PONA 5EHNA 1G5RA 4XVQA 2AUNA 1LRLA 2OV2A 1X7XB 4QOGA 1OTYA 2O2JA 4CWAA 1Z2NX 5HIKA 3HFRA 4BKRA 4ZTBA 4KUEA 5A9SB 3SQLA 2WF6A 1H1LB 3A9TA 4K1LA 3HB0A 3JALB 4S1VA 3WNDA 2R47A 2DVMA 4ZXFA 1CT9A 3V5NA 2QSZA 4QYIB 1SNYA 1IBSA 4O4IA 1H9BA 5EVJA 3CRRA 5IAAA 1Z6PA 4NMWA 3GAZA 4LOLA 1PQYA 1W8IA 3IR6A 2ODAA 2DTEA 2QVGA 4TYPA 4UXIA 3M5PA 3HA3A 1UJ6A 2HY7A 3E9YA 1IZZA 3PU6A 5JNUA 5LA6B 2BDTA 2VQDA 4RZXA 1O6GA 3V8VA 2Y67A 4KUHA 5B7NA 5CVTA 1AKEA 3GJSA 5ITZA 4C7OA 4IJVA 2IYVA 2V8OA 2J1LA 5DBHX 4KPEC 3NDIA 4MX8A 1PR5A 2EFJA 2IU6A 2VZEA 2VQFB 1QIFA 5J3JA 2RHCA 3RUAA 2ZSBA 3DFZA 3E9NA 5DI3A 4ZIRA 1RKBA 2GN6A 4M7WA 2V5AA 5LDHA 4Y2HA 1Q2UA 4XX0B 5ESXA 4HEJA 5K20A 1UZUA 4BNVA 3IE0A 3C48A 4HDSB 4MQMA 3WWEA 3FIJA 2G70A 3ZOZA 4QATA 4HXEB 4H08A 5JS7A 3ZIAD 1C2TA 1E0SA 2ZRAA 4H15A 3DO8A 4NDAA 4DIUA 1ZJ5A 3FPEA 1YCFA 4A6EA 3RS0A 2P4SA 1KRHA 2TS1A 4G5XA 4KIGA 1JR3A 4GOLD 3D3KA 2YDXA 4W5RA 2FSUA 2ODTX 4WNYA 3G2PA 1G42A 3KAJA 2DT5A 2JIZD 3ORRA 5EXEA 2B4QA 4NZ9A 4F86A 2X8BA 2LKDA 2UU9B 1XJ5A 4L2IA 2VI5A 4P3YA 4YT5A 2EKQA 1FXWF 4GKJB 1Z5GA 4RCVA 3I83A 1L1QA 2H0QA 3AEUB 4FYYA 5GAJA 1D7OA 3UWOA 5HTKA 4MRMB 2XQFA 4B3IA 2FPPB 3O82A 1M8KA 2FSFA 4FEGA 4L4XA 1KY3A 3TTXA 3WIBA 3VAYA 4RKYA 4BUJA 4EA8A 2B3TA 2BM8A 3GFSA 1JHMA 4E31A 2JFHA 4KAJA 4NY1A 1HM5A 4D9HA 4ONEA 4CQMA 3GZJA 2XD9A 2G76A 5COBA 3P9XA 1UYJA 1Y4DE 3AHFA 4QRIA 5ABPA 2A0YA 1NYLA 5L4NA 3FFWA 3NOOA 1QRUA 2R1ZA 2CBGA 2FP3A 3DS8A 4MTCA 3WMEA 3QHPA 3OKPA 1MABA 3IH5A 1Z88A 1RAFA 1BDMA 3PNKA 5EZYB 5JMPA 1U8ZA 2K2QB 4YRCA 4NZZA 4CETA 1X1DA 3A6ZA 3LSYA 3RSGA 1NZDA 2J30A 4OK5A 1XVUA 1G7CA 1SD1A 1O94C 4ENWA 4ZQHA 1W96A 2MR6A 5H3HA 4B4OA 1MXFA 2GN2A 1K5PA 3QBDA 2ZUCA 3NASA 3K35A 3NM4A 4Q24A 3BERA 1RDFA 2ID8A 1XX6A 3OTQA 5ERGB 1UDBA 4WK4B 4PPGA 4UDXX 1XV5A 2HK7A 4WNIA 2DFKB 3FUUA 4EFLA 5EJ6A 4R3UC 1Z2DA 3D4LA 4TWAA 4B6FA 4KZPA 3AF5A 1Z6GA 4I55F 1BQ4A 2XYPA 4N7BA 1G8MA 1JWAB 2WV7A 3OZ7A 3THWA 2C8VA 3KDSE 3KG2A 2YWXA 3OKCA 3QEMA 1EA7A 4JGBA 4OF4A 4RK0A 2IZ6A 4RCZA 4CL8A 4O2RA 4F3TA 4MRMA 2AJBA 2JD1A 1ITZA 2AFRA 2AJLI 4G5OA 1N5MA 2QU8A 4AWBA 1G5PA 4EZIA 4RENA 4CJXA 2ILTA 5A7GA 4EMSA 4LECA 3DE5X 2PSSA 4QM6A 3G0BA 4XYGA 1WNTA 1C8VB 5AKLA 1W4ZA 2ID4A 2QRPA 3DWGA 1R4MB 2MU1A 2BI4A 2EKDA 4H7EA 4E5MA 2DLNA 2FWIA 1JX6A 4O4JA 3UYLA 2XE6A 3RNLA 4N3NA 4E4RA 1JHRA 3KKEA 1YHYA 2C82A 2HFKA 2QX4A 3KSUA 3KDAA 3KTAA 4ALMA 1AUPA 2NO0A 4OBXA 2WBLC 2Z1DA 4LC9A 1NQVA 2NVOA 3PCXA 3ECCA 2RBEA 4GMKA 3ONEA 4GUDA 4NCIA 4ZVLA 4CM9D 4CQJA 2OXRA 1KFCB 2XV1A 1FL9A 1Z7BA 1NY6A 1AKNA 2DC1A 2FZEA 2ZYUX 3DE3X 3N0VA 5IDVA 1QV9A 1MABB 2NZJA 4UD2A 3GRRA 3KR9A 4JXJA 2I66A 2PTGA 1HG1A 2R9VA 3ABZA 3WGTA 5CA1B 5HILA 1P9WA 4JWKA 4DCVA 1Z62A 1EZ1A 1NLUA 4NXNB 4YJ2F 3PD0A 5BMVF 1F8GA 1IQRA 2JA1A 2X77A 3EC1A 2Y8EA 1XAJA 4J29A 4XPIA 1NX6A 4MKZA 3FHOA 1GNPA 1PEKE 1MGPA 2XNDA 3ZEIA 4D0SA 1ZNXA 4IQGA 3HYTA 1SCUA 5GGYA 1E5TA 3UJ3X 3QVKA 5A4JA 4F3KA 1MC8A 4MIYA 10MHA 2WKWA 3GU3A 1V95A 3DTNA 4U5QA 3IS3A 1Z2CA 4FFLA 4KSBA 2F6RA 4QYIA 5JADA 1WOMA 2FN3A 1LVUA 2XQKA 5KU1A 3IHTA 4C2UA 4ODIA 4RCYA 1Q7GA 1G6OA 1KVSA 5BWMA 4IGAA 1YMVA 3ANNA 3KB1A 3N28A 5EE9A 3N07A 2VDMB 3FLAA 1G2IA 2UUCB 2BGIA 4MRRA 2UKDA 4YY3B 1N1GA 1KHHA 1XHLA 3ED1A 1YC5A 2D8AA 1CJCA 2H5EA 4EGFA 3EGXA 3S2ZA 1KPHA 3JRWA 3W5DA 2Y0BA 3N7UA 3VYTB 5HZGA 1MORA 1MA0A 1YB5A 1W94A 3UAWA 2P9YA 2BHLA 2I2FA 3CJTA 3M3HA 2P62A 4QRDA 1BX0A 3SLKA 3HP4A 4QUKA 1CS0A 4O3FA 2X1MA 1IBKB 1J0EA 4J75A 4UM7A 1ZD4A 4G9EA 5C8YF 3MGKA 1R6AA 1W93A 3R0JA 1CF4A 4C7OB 4EEXA 1M2FA 1K0FA 1KU0A 2I76A 3D4NA 3KE8A 3DLBA 3DVLA 2PQ2A 1DT3A 4HDSA 4KQCA 2YBDA 4R8SA 1Y8AA 1NUPA 2R86A 2WC1A 3U4DA 2NQ2C 1Z07A 3KUCA 5J47A 1P1HA 1L8LA 3HBLA 1KS2A 3G7NA 4FFRA 1H69A 1XTZA 4HAVA 3TYXA 2YYYA 1SHTX 1XKLA 3CN9A 3I4LA 1XEAA 1GITA 1QH8A 1SXIA 1RLIA 1TKCA 3DGFC 2VOJA 3IMKA 3F8TA 2Z3WA 3KYIB 1GQFA 4W9NC 1OBHA 1UDAA 5CDUA 4R2XA 1E0DA 3HUEA 2C88A 1H1LA 2F3PA 2NVUA 4IGFA 2PHZA 1R3UA 1C5KA 2ZRKA 1Q1AA 4YPOA 1VXOA 1W36B 3F4BA 4J0EA 1Y3BE 1V6AA 2WFAA 1Q1BA 4XCQA 2IZ7A 2EGHA 1RWOA 4BQFA 3ELYA 3VGJA 4U39A 5FT9A 3GJXC 4FWBA 5FQOA 2JD2A 5A9TA 1AJEA 4A2PA 5DNDA 1IHDA 2HMYB 2YFKA 4AUNA 2O5EA 4KFSA 1DRWA 3GEDA 1CUHA 2QQFA 3I2FA 4J0FA 4WZBA 1GRVA 3ACCA 3C5CA 2HHLA 4B8ZA 3LBNA 3LZDA 3DPSA 4D25A 1IU9A 2A9OA 4IUBS 4EJMA 4XDGA 5BOSB 3AV3A 3H3FA 3OTWA 5KINB 3MJDA 1VPEA 2AFHB 3RSOA 3C3CA 4JLMA 3DBVO 3KTDA 3E7XA 4K9KA 4OREX 4DFDA 1E7MA 4RH0A 2OHVA 3HM9A 1F0YA 3ZNPA 1UXHA 2Z3ZA 2Q1WA 3IQHX 2JFFA 1IXKA 1DX6A 4EKGA 3H2YA 3NT2A 1YT5A 2XWPA 4G5GA 5HQ3A 4KQWA 4MYHA 1ATZA 3BMCB 1EUDA 4MKXA 1LFAA 2HU5A 2IYAA 3B36A 4FUTA 4RA6A 3KUKA 5SV2A 3ZQKA 4BQEA 3ANTA 3VNSA 4NECA 2V0NA 1FSFA 1GAWA 1VE9A 4IOMA 4P86A 4XUEA 3S81A 4CM7A 4MGZR 4EYSA 1VYTA 4F4FA 5BV2P 3TFOA 3ONVA 5KHAA 3D5TA 5EWMB 2EIXA 1E7WA 1TIKA 4QECA 4YMIA 5LP6B 5JY1A 4XEUA 3RVKA 2IP2A 3NV7A 1VE5A 1CBUA 3ADPA 3K6JA 4R9UC 3ZHYA 1G0OA 2HA6A 4F06A 5JDCC 2Z4TA 1J39A 5HGXA 5INTA 4I0WB 1W5SA 3U40A 3NP9A 3EQ7A 4X41A 3DONA 5K0SA 3PUZA 2HA7A 2FN8A 5LJLA 4ZO4A 3TLMA 2BEVB 3B6KA 3NTUA 4IAOA 3B13B 3EZ7A 3KNZA 4PU0A 5H82A 1L5LA 4KXYA 3SFTA 5KSZA 1Y6JA 5DFAA 1N9KA 2J5RA 3EARA 3N74A 3TPZA 5JYEA 2VO1A 2Q62A 3H65A 1KERA 1N0HA 3HRKA 1VMKA 4DLUA 2QE7D 3U60B 2FPIA 3VR4A 2Z56A 1LBIA 3DMHA 3F9RA 4YMTA 2R6ZA 4ZCIA 3RREA 2JASA 4PGFA 1HT0A 4KNWA 4YH1A 3EGCA 1PHPA 3DBRA 5C46F 4P31A 3PPWA 2X0KA 3ABSB 1ZO8A 4P32A 3IDSA 1SD2A 2WK1A 2ZI4A 3UWMA 3ZVRA 3GT0A 3U7RA 5KTSA 3U19A 5CFLA 4AMGA 1BKDR 2PUFA 1L4FA 4KLCA 1FX0A 1G21E 2XEDA 4RSMA 5DTMA 3ZLTA 1VA5A 2AJTA 1GV0A 4H7IA 4XOIA 1LLCA 4X24A 1YAJA 4AMYA 4UHEA 3BDVA 4TTJA 1STOA 1KGSA 4EHBA 2O5VA 1O08A 1W44A 3MQFA 2R6JA 4ZQEA 4ANFA 4OJYA 1EK2A 2IKQA 4GWGA 5EWLB 5IYZB 3PWTA 1E3SA 1K68A 4A82A 2F90A 1USWA 2I6FA 3CGWA 3AERB 3F5MA 5HMMA 4LMBA 3SWWA 2WF5A 4DQVA 4DLAA 2I3DA 4DCPA 2OFPA 1QO7A 3K5PA 2J45A 1VRWA 5CIYA 4KAXA 1XG5A 2HHCA 3NTXA 4IVNA 4BE7B 2Z43A 1R9JA 1TAUA 2NNLD 2V7TA 4GSKA 3RB8A