1PU2A

Crystal structure of the k246r mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
371
structure length
356
Chain Sequence
b'MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWRGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title The role of substrate-binding groups in the mechanism of aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
total genus 112
structure length 356
sequence length 371
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1pu2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pu2A01
1W0CA 3O4RA 3TNLA 1AXEA 3WNQA 1RM5A 2C2XA 3ZWNA 3QWFA 3GHHA 4JP3A 3VZQA 5JDIC 2VWGA 1O9BA 4D43A 3TRIA 1HT0A 2P9EA 1N1EA 1I32A 5JAIA 4HV4A 3BA1A 4Z9XA 5ICMA 1VJTA 4PLWA 3PWKA 4B79A 1BTOA 2PGLA 3G3EA 1HYEA 1VC2A 3PQFA 4BNYA 4YAKA 3ANMA 5A5FA 2VRBA 1R0SA 1VL8A 3A9WA 3C3XA 4ND2A 1A7KA 1SOWA 1PJBA 4GGOA 1EE2A 5I8ZA 1HE4A 4N18A 2TMGA 5A05A 4YTEA 1DPGA 4MVJM 4CM7A 5JO0A 3PXXA 1C1XB 3IJRA 3C24A 4NJOA 5CEEA 1ZSVA 4XQCA 4JJIA 5JY6A 1Z7EA 2FHSA 1W6UA 3BMNB 3P7MA 2HMUA 2EIHA 4TSKA 3VPHA 1CRWG 1IL0A 4R51A 4BO8A 4XQEA 3RJ9A 3KVOA 1U7HA 2TMDA 4DLLA 4DXHA 2A35A 5BNFA 4WLFA 4IS2A 1FMCA 4YDRA 1D3AA 2BELA 3AUUA 5EIOA 3Q2KA 4E5YA 4JN6B 2HJRA 2DT5A 3GG2A 4JGBA 3RCBA 1JVSA 1C1XA 5LC1A 5I7VA 5G0TA 4NPCA 5JDIA 4PGFA 1QMGA 3BMNA 4JLWA 3WBFA 3OIGA 2NUAA 1PS0A 3KLMX 4W4TA 5F21A 4UREA 5CDSA 5CPFA 2AEFA 1PQPA 3CIFA 3HSKA 4EJ6A 1ZMTA 3EW7A 1MC4A 3NYWA 4RDHA 3VAZA 1IOLA 1H2BA 1KY5A 1FK8A 4GBJA 3QHAA 3ZI0A 2Q1UA 1LDEA 1GUFA 1N5DA 3VPGA 4UEKA 4UVIA 3M2TA 3IS3A 4R9SA 4NIMA 3U9LA 3OEWA 4WCFB 5A3VA 4XYBA 4MVJP 1Q1NA 5L40A 4PLTA 1YL7A 1HDXA 4IIUA 5CP8A 5AOVA 3KSDO 1MC5A 3FWZA 2VYND 3INGA 1EFLA 4DREA 5COAA 4LSWA 4PLPA 2B4TO 3H9JA 1XLTA 1IYZA 1YE3A 2HMSA 1U5CA 4J49A 5KVSA 2VUTA 1GV0A 1GZ4A 1PS9A 2AQIA 2HMVA 4WCFA 1E77A 1N9GB 1QP8A 3R6DA 4J9VA 2Q45A 3LYLA 2EW8A 4PG6A 4XDYA 1EVZA 1LU9A 3VVBA 2RCYA 2FR8A 2HKIA 1ISHA 3ZHYA 3ZHZA 4EBFA 2AEJA 4ND3A 4RQUA 4KQXA 2UVDA 3D3EA 2C29D 3INTA 3MJCA 1D4FA 4XYGA 6LDHA 4AICA 4BNKA 4JBGA 3V5NA 2GZ3A 3PFFA 1H5QA 2RHCA 3EDMA 3GEMA 4O1MA 3ULKA 3O8QA 4XGIA 4ZVVA 2DVMA 5KKCA 1ZJYA 2FZWA 1KIFA 1N9GA 2AW5A 3WSVA 1C1DB 4LCJA 4XEHA 1K6JA 4F6LA 4YT4A 2GDZA 2NVUB 3KSZO 4RQTA 5IG2A 3M1AA 4BQPA 3L9WA 1NVMB 2Y1CA 1Y8RB 2B83A 1QV7A 1PX0A 2Z95A 3HDJA 1VJ1A 4R1SA 2UDPA 3ZU2A 4CMCA 3WGQA 3F6YA 3I9OA 1J4AA 3K92A 3VOSA 3LF1A 1DSSG 3RSHA 3QWHA 3L07A 3WTBA 3IKVA 4BL5A 1C1DA 5AYVA 5C37A 4Y6SA 2DBQA 2WTBA 3C1OA 3SC4A 1E7YA 3WQRA 8ADHA 3VDRA 2NVUA 2QW8A 1QXSA 4OM8A 2O3SA 1RJWA 1PR3A 4QO8A 1Y8RA 1JA9A 3WGOA 5ENDA 4BV9A 3OA0A 4NZ9A 5JXWA 1E3LA 1YJQA 3WQQA 3ZWCA 3ABIA 2YFHA 5DBIA 5LDGA 3DZFA 3GRKA 2O48X 2PV7A 3NRCA 4YT2A 4EUEA 1AXGA 3PIIA 2ZCVA 3CMCO 2P68A 4R68A 5L7YA 4CV3A 4CMKA 4HBGA 1UXJA 4BO9A 1NBOA 1EDZA 2QG4A 1RYDA 3QSGA 1NHWA 4HNGA 4CMGA 4B7XA 3BYZA 4IM7A 2W90A 3LF2A 5FFFA 5COBA 1R66A 4GKBA 3OECA 3QY9A 4G2NA 2C5EA 3WYEA 1A7AA 4OKNA 1K0UA 3DBVO 1X14A 3I6QA 2I6TA 4IS3A 1PZFA 2JKVA 4YAJA 1JKIA 2GZ2A 5L4LA 3U09A 1IPEA 1EVJA 4PIVA 1WDMA 2ZB7A 3GOHA 1DIGA 1JDJA 3OQ6A 4MP8A 4U6SA 1O95A 4OGWA 4BNHA 2YV2A 1Y5RA 1KETA 3IDSA 1I30A 1LDGA 2EKLA 1LC3A 5L53A 1C0PA 1ZNQO 1M6WA 1MFPA 4YAEA 4QECA 4JQCA 5BSFA 1PL7A 3FR7A 1CDOA 4TZKA 1OBFO 3WGYA 1I8TA 4RPJA 1EBFA 1DRVA 1SMKA 2GUGA 3U62A 1DIHA 3KBOA 4DUPA 2ET6A 1SC6A 5GY7A 3LK7A 1R12A 2Y0EA 3QA9A 2Y1DA 3AM3A 1UDBA 1JTVA 3B1FA 4L4RA 3U49A 2XOXA 2X0JA 3HE3A 2IXBA 3BZUA 3ANLA 3ENKA 3DBHB 4WLUA 3TOZA 3WIEA 3NDJA 5KVQA 3K9QO 5A3JA 2WDZA 2QYSA 5IZCC 4IDFA 4BNZA 1HYHA 1FXSA 1R37A 4J1TA 1BVRA 3DAGA 5AXDA 1B3RA 2BMAA 4UVDA 4IIVA 3VC7A 2VTEA 2HSDA 3O26A 3UFXA 3V2GA 1M66A 1WDKA 4CMEC 3U3XA 4ZQBA 2Z5LA 2H6EA 2HRBA 5ILGA 4R69A 3AJRA 2FMUA 1NM5A 3JD4A 5L4SA 3IKTA 1NQTA 3NX4A 4J1NA 3WJAA 1YDWA 3WGZA 4PVDA 1PJSA 4DPKA 2X5OA 3FSRA 4YXFA 1GZ3A 1JKFA 1LDYA 3L4BA 5BSHA 3ETEA 1NNUA 4J7UA 3G1TA 3OICA 4DL9A 4IMRA 4IQ8A 2NQTA 4TWRA 4R3WA 1UXIA 3GZ4A 4Y9DA 3NEPX 3F1KA 5JYFA 4UAGA 1XKQA 1N8KA 3ZWYA 3PZBA 5EQDA 3ZWXA 5KNLA 3JQFC 4KQWA 1P33A 3T7EA 4M54A 5JCXA 2V6FA 1EUCA 4OL9A 5JE8A 2G76A 1KYQA 3FBTA 3WMWA 4IQ0A 3GNSA 1S7CA 2QRLA 1EDOA 4B4UA 5IZCA 2NQ8A 1J5PA 3G79A 1J0XO 3GN1A 2VUSA 4DBZA 3PVZA 3DXFA 4R1TA 1N7HA 1ZBQA 2Y67A 3UXYA 3VHRA 4DA9A 1ONPA 4PG5A 4AJ4A 4MO2A 3UH1A 4CLOB 1KC3A 3SX2A 4ZQGA 3UCXA 4CMEA 1JAYA 3DBLA 1X7GA 3KO8A 1SPXA 5F1OA 1E3EA 1LX6A 4R5MA 3RASA 3RU7A 2JL1A 4H7PA 5DCUA 3OA2A 3C1AA 4AG3A 3B70A 4NH4A 4E5MA 2IZ1A 1WAMA 2G17A 1GD1O 4MVJD 3B1KA 3IP1A 1T2FA 3JYOA 1FDTA 1F06A 1CIVA 4DLAA 5KCZA 5ADHA 1VSVA 5B4TA 3ADOA 2QIOA 1DC6A 2UUPA 1LC0A 4YT5A 2NVBA 1N7GA 1U2DA 1E5LA 1ISFA 4CLOA 4K6CA 4KUGA 4DMLA 2DPGA 1E3WB 2FPIA 5GMOA 5L95A 1U5AA 2NU6A 1H6CA 2IEDA 1ONOA 2ILTA 1NWHA 1EQUA 5AXCA 1F8FA 1K6XA 2A92A 2HCTA 3UICA 2Z1MA 1KBZA 3NDIA 4AJ1A 1PU2A 4E5PA 5JAMA 1XU9A 1SBYA 3BTVA 4ZGWA 1QV6A 1P31A 3DR3A 3N74A 4HFNA 3KRTA 4GWGA 5A04A 4YQYA 1L7EA 3I1JA 1C14A 3EK2A 1IE3A 3NTRA 3HHPA 1E3WA 1LLUA 2B37A 4P38A 3PRJA 1U28A 1I3KA 4RVUA 2QQ5A 5L9AA 2OHXA 2VTDA 1DIBA 5JY1A 1P1HA 2D0IA 2HJSA 1MXHA 1QG6A 2GN8A 4XKJA 5KJEA 3RI3A 2IEBA 2W2LA 4YJDA 3H8VA 4GX5A 4ZJUA 3PLNA 1A9ZA 4GPD1 1ADCA 5HS4A 3L6DA 1UR5A 5U1PA 3GDFA 3ONDA 4HFJA 4XJSA 3E9MA 2WD8A 2VYVA 4PN3A 5A9RA 4O63O 2X22A 4GLLA 4J2HA 1B7GO 2Q99A 3JQ8B 4ZQFA 4CM1A 2J8ZA 5F5NA 1Q7BA 3NT2A 3TOXA 3FCOA 5TNXA 3D64A 3D3WB 4RLHA 3GK3A 4ALIA 3ZW8A 3OH8A 2R00C 4PZEA 1ZZEA 3QVWA 1GEEA 4FS3A 2Y99A 4I9UA 3IQDB 1XCBA 1PJTA 4WOJA 3GVHA 3QRWA 4IGFA 1IB6A 4EEZA 2GYYA 5BSEA 1LRKA 1HE3A 1W8DA 3HZZA 4F3YA 3JQ8A 3PDJA 4XX0A 2DLDA 2HRZA 1I0ZA 2CDAA 2J6IA 4I1IA 1U4OA 1NQAO 3E9QA 2OXIA 1BXKA 3WYBA 1F8GA 1U9JA 4WLNA 3D3WA 2EP5A 1UUFA 1WXDA 1YB1A 1B8UA 5DF1A 1FDVA 3QP9A 1P1FA 3RUHA 4ZU3A 3Q2IA 4EI2A 3RROA 4WGGA 4IXTA 5L45A 5KJ6A 3UCEA 5LCXA 4TKLA 3ROMA 5KVCA 5DCYA 4AJNA 3QWBA 1ZEMA 3AI2A 4ND4A 3CE6A 3OP4A 1E1NA 3ZNOA 3KETA 2SCUA 3AOEC 4GL4A 1VJ0A 3B20A 3FNGA 4NFSA 5EESA 4CM3A 4CV2A 4YWJA 1HDRA 5IDYA 3U4IA 4CMHA 3KZVA 1ZUD1 1DRWA 4IXWA 4W9NA 3ZNNA 4BB5A 2YHUA 3QJ5A 1VPDA 2DTXA 1J49A 4FSHA 3UN1A 3ZWVA 2R00A 4RLSA 3A14A 3TZQA 1TT5B 4U5QA 4XD2A 4AJLA 4E5KA 3JQ7A 2R6JA 1HSZA 5TX7A 3ZHBA 4MVJE 3LLSA 1UZLA 1I36A 2WEKA 5THQA 2ZYDA 1SZJG 5JYEA 2OOSA 1MG5A 1BG6A 4MP6A 1EK5A 1L1FA 3ZU3A 3FF4A 1BXGB 4L76A 5JLAA 3JQCA 3ZWBA 4NQZA 1LSUA 4PLFA 1HTBA 1JN0A 1MFZA 3LT2A 2B5WA 3S2IA 3W8DA 6ADHA 5I9NA 3S2FA 1GFSA 3WWYA 1CF2O 2DBRA 2ZQYA 1T2AA 2EHDA 2D8AA 2Q2VA 3ICPA 3SEFA 4D41A 1G0NA 3H5RA 5JSFA 5K6AC 4YRBA 5F3RA 2VHWA 3HFGA 4H16A 3TJRA 3H9QA 5CDUA 1M6HA 1ZKMA 1YO6A 4ZN6A 2CZCA 2OORA 4D45A 1BHSA 4IDEA 3LC7O 4OJNA 1LRLA 2Y1GA 1GUYA 4CUKA 1NFFA 2BH9A 1UJMA 5ILOA 2Q49A 3L0DA 4IQGA 1ENZA 4NDNE 1A5ZA 3AM4A 2DAPA 4FD3A 4ZQHA 2B4RO 1KVSA 3MJ4A 4W7HA 4GX1A 3IUSA 2EG9A 4XRGA 4DPMA 1SNYA 1CETA 1LDBA 4RVHA 1VKNA 3L4SO 2JCVA 3OETA 4M86A 5MGBA 2PH5A 3C1TA 1E1KA 1ENPA 1FDUA 3Q9NA 2NU7A 1VL6A 2P5UA 3GFBA 3H65A 4KTTE 1R4NB 4NNJA 2J3KA 1P3DA 4TQGA 4BKRA 4UUPA 3RFVA 1LA2A 1YKFA 2IXAA 3PQDA 4XR9A 1ZIDA 2RHRA 2AQHA 4RPKA 3D7LA 2X6TA 1U3VA 2P2SA 5L4NA 3PGJA 1ZMOA 1GZ6A 5KOIA 1GR0A 1PGQA 5IXYA 1YOVB 2YJZA 4DC1A 5K6AA 4J2OA 5CDYA 3JQ6A 1M2WA 1R4NA 1ISJA 2WE8A 2A9FA 3ETDA 2LDBA 2VHZA 1JKJA 1Z75A 3DZJA 3F46A 3H7AA 5GZ1A 4LMRA 4LN1A 4KWHA 2I9PA 2PD4A 5EJ2A 3PPIA 4BGVA 1IUKA 4AJPA 3QWAA 4II2A 3S55A 1DHRA 2FOIA 3U5TA 2PZLA 3GQVA 1GU7A 3K73O 3TZCA 1LJ8A 5I9LA 3L9XA 1HF3A 4Q3NA 4QTZA 4YJHB 1YOVA 1LEHA 4ZRNA 3NGXA 4DRYA 4DIBA 3IAHA 1V0JA 3S1LA 2AMFA 1TB4A 2Q2QA 2Y66A 4II3A 4BO3A 4N5NA 4K9DA 2D1YA 2WSBA 3MTGA 4CV1A 4E6PA 5A4DA 3UAGA 4QT0A 4BO7A 4CL3A 2FPPA 1DFIA 3GMDA 4GLOA 3PEFA 3ZNPA 4FR5A 4YR9A 5JMWA 1P1RA 2J5QA 4CLDA 3I52A 1I01A 1XQ6A 4BIIA 1XG5A 3B1JA 1R16A 1XEAA 1R0KA 4YJHA 2RH4A 4MVJH 1KC1A 3FNHA 2LDXA 4R1NA 3FPLA 2AHRA 1UP4A 4RPLA 3RBVA 2EXXA 4PZDA 3VZRA 2IODA 4BVAA 2CNBA 4NMHA 4RVFA 1UAGA 4YACA 1SEVA 3OJEA 1EQ2A 1PZHA 2CFCA 2CSUA 4J1QA 5K0ZA 4CLHA 1VSUA 1KVUA 4GKVA 4Y6PA 5B12A 3LLVA 4BNXA 3DMTC 1E0DA 4IGEA 2VCYA 2OO5A 1JU9A 4WASA 2I66A 3EZLA 1AHIA 1F17A 1CWUA 3RC9A 1HE5A 4X54A 2IDZA 1OC4A 3E48A 1PWZA 4LCEA 3JD0A 1WWKA 3KV3O 4EZBA 1ZCJA 4YQZA 3ITKA 3EY4A 2D59A 4UUMA 4JCOA 3CZRA 1AGNA 4GMGA 3GEGA 4NBUA 3D5TA 3M2PA 4BNMA 1KEPA 2PFGA 3QQPA 5H83A 1K89A 2H5LA 1RWBA 4RZIA 4BKPA 1MP0A 4U7WA 1I24A 1EMDA 1LLQA 4DYVA 1VI2A 4ND5A 1XA0A 2HU2A 5C7OO 4RDIA 4A5OA 3F3SA 2AA3A 1A4UA 4NBVA 2D4AA 1Q0QA 1ISIA 1BVUA 1UXKA 2ZB8A 2EJWA 2BF7A 4J1SA 5JC8A 4A7PA 1E1LA 2VRCA 4IJKA 2BFPA 3ZU5A 5ES3A 5KKAA 4G5HA 3ZCXA 1IZ0A 3I3OA 3G17A 5JMPA 3X2FA 9LDBA 2C5AA 3TWOA 3DMTA 3C85A 4MKXA 3ZN2A 4ALMA 4UUNA 3EC7A 1PJ4A 3BMQB 4UEJA 5L7WA 4QFDA 4WLVA 1LI4A 2BGMA 5I7SA 4I08A 3FI9A 1HYGA 2Y93A 2JAHA 1WMBA 1P1JA 1T2EA 1DEHA 4Q39A 2HO5A 3V1TC 3AI1A 3HNPA 3UF0A 1PIWA 1H6AA 3MJVA 5IXSA 3GR6A 2PKQO 1W73A 3O8QB 1Q7CA 3BAZA 4RL6A 1Y9EA 2Y1FA 2YQ5A 5DBGA 4IBOA 3VTZA 1ZH8A 1YRLA 3BMQA 3BIOA 2DBZA 1UDAA 3INRA 4AJJA 3FNFA 2Q4EA 1Z73A 3PWZA 1T26A 5DT9A 3RWBA 2CDBA 4ALJA 1I5RA 4UEOA 4R3NA 3OSUA 2OP0A 4E13A 2V6MA 3AUSA 5IDQA 4HX5A 2B69A 3F1LA 1C0KA 3X2EA 4MIEA 3TZHA 5CEFA 4B7CA 2ZK7A 4GH5A 3GVXA 4IDAA 3KYBA 5AVOA 4BO5A 3GFGA 4OKIA 1NFRA 2FZEA 5ER6A 1DAOA 2I5PO 2JHGA 4BKUA 3UW3A 2ZTUA 3VPFA 1NQOA 3H4VA 4CLXA 2CVZA 4XR4A 4MDHA 3AU8A 3T4EA 3FTPA 3I9KA 4U0KA 3T4XA 3LZ6A 1T24A 1LNQA 4PLVA 3JQAB 3PYXA 1NQ5A 2J3HA 1HETA 2UYYA 3PI7A 1X1TA 4E3ZA 3JSAA 2NTJA 2BFMA 4L73A 2NU8A 5A1TA 1GQ2A 3QVTA 3C7DB 2D2IA 4UUOA 4F46A 4DGSA 2CDCA 1E3JA 4PCVA 4RF2A 5B4VA 1WW8A 3BHMA 2Y05A 4XGKA 2E49A 4OYRA 4BS9A 4RCVA 1NHGA 4GMFA 3PGXA 1R6DA 4ZICA 5TT0A 4TVBA 1IZ9A 1JLLA 3CXRA 3R3SA 5AQ1A 4O59O 2GNAA 3JQAA 4N5LA 4GX2A 4FW8A 1YB4A 1P0FA 3Q6IA 1F0YA 4NK5A 2ZB3A 4PG8A 3PP8A 3S8MA 3ORFA 3K31A 5G4LA 3WS7A 4OAQA 3ZV4A 2AG5A 2VT2A 2BGKA 1NR1A 2QRKA 4I8XA 4NR0A 5KVVA 1TLTA 2OMEA 4CR6A 5FWNA 3AY3A 2O3UA 4L8VA 3PHHA 4OSOA 4EGFA 2G1UA 5KJFA 3BTOA 1H2HA 4TRJA 4NFYA 3TN7A 4ILKA 3PYLA 4M89A 5JCJA 3CINA 1QYCA 2JFHA 4B4VA 3VDQA 1SB8A 3ITDA 1X7HA 1XU7A 1DC5A 3WTCA 4K28A 5HRUA 1ZK2A 5T57A 1MV8A 5G0SA 4PLHA 1BW9B 5BR7A 2W2LD 4M1QA 1Y8QB 4D44A 3MEQA 5HM8A 4WNCA 3RC2A 4NU5A 4YAIA 2PD3A 1B8VA 3DBRA 2WWRA 4BQRA 2VYVD 4Q3AA 3NUGA 2OP1A 2GN4A 1PJCA 1HDZA 4YA6A 3RKRA 4CMIB 4J0EA 4GAEA 4FFNA 3D4OA 3JYPA 1XELA 4NFHA 4FFPA 3OMLA 1R4MB 1M75A 1NFQA 4GSKA 1LRJA 1HLDA 3ROPA 2G0TA 3ETGA 3SLKA 4URFA 1BW9A 3HN7A 4DTIA 1GL3A 1Y8QA 4R41A 5I7EA 3WDSA 3P2OA 3PQEA 1EFKA 4BNUA 4EITA 3WB9A 4CMIA 1CQIA 2UV8A 4IDGA 4WKGA 5HTOA 1TA4A 2E4AA 3K96A 3HDQA 1IPFA 2Q4BA 1R4MA 5JO9A 4LVCA 2DFVA 3W1VA 1OC2A 1ZK3A 2VHVA 3GC6A 4CR8A 5CG2A 4A0SA 1Z82A 3Q9UA 3RJ5A 1NTOA 2J5RA 2HK7A 3RAJA 2EERA 4D46A 3I6IA 4NK4A 5DOZA 1DFGA 3GGGA 3NTQA 2DU8A 4B3IA 2HAEA 2WE7A 5MDHA 5F1PA 1LTHR 3U4CA 3U0BA 4DQUA 4DMMA 1EUDA 2VHXA 1WZIA 5I9MA 4LVUA 3BTUA 2QZ9A 3R1IA 3ON5A 2VUUA 4ALKA 3H5NA 4Y98A 3FTNA 3CUKA 1YONA 2D5CA 4L74A 3TDKA 3LC2O 2V6GA 4O5OA 3CH6A 1D8AA 3JD1A 1L7DA 3K8ZA 4BGUA 4DBVO 4KDFA 3GPIA 4OQYA 1ARZA 1VLLA 4F6CA 3KYDB 3I83A 5KIAA 1F14A 2PH3A 4XQGA 4CMBA 3WGGA 4EUHA 2F1KA 2BFAA 4J43A 4XDZA 2VZ9A 3IL2A 4XB2A 1FJHA 2EV9A 2Q3EA 1XGKA 3DBLB 3AY6A 3GEDA 4J4HA 4E33A 4W99A 1J6UA 4BB6A 3ZH2A 1E3IA 5JAZA 3GY0A 2NTNA 3WFIA 4P8RA 5JYDA 3P5SA 3WBBA 4FB5A 1SAYA 1OFGA 3W4JA 4LGVA 1GYRA 4IJVA 3DFUA 4OSPA 1H94A 3T7CA 4FC6A 1V35A 2EW2A 3G49A 3KYDA 3VZPA 1DO8A 2DC1A 3MWEB 2VNAA 4M87A 2W8ZA 3BHJA 4PLGA 3FR8A 2DBVO 4AJ2A 1EBUA 3AWDA 3BHIA 2E48A 2O50A 3RUDA 1K5HA 3K30A 3F5QA 4GI2A 2O23A 3JQBC 3UVEA 1ADFA 4OMUA 5U9CA 4LRSB 3PDUA 3RUFA 5J23A 3PK0A 4P4GA 3VH4A 3NT5A 5CFZA 1T25A 3DOJA 4K6FA 4OHUA 4BMSA 4ALLA 2IYPA 3I9JA 1EVIA 3D5QA 4FIZA 1RPNA 1H9BA 3OJFA 2DUWA 3TQHA 3U4HA 4B4OA 3H5AA 1WNTA 2FPGA 4YJGA 5DP2A 2DKNA 3EHEA 2EWMA 1E6EA 1XDWA 3KM0A 2O3QA 2CVOA 4K26A 4KDEA 4P22A 5L3ZA 3WIDA 4CM4B 8LDHA 3WQSB 4GVXA 1ZW1A 3G0OA 1DIRA 5BT9A 1EVYA 3MJTA 3JQFA 2X0NA 4WEQA 5EPOA 3ASUA 3GAZA 2CMDA 5G2OA 2BKAA 2BFOA 1H6DA 3H2ZA 1G6KA 3E5MA 3DOCA 1UP6A 3IMFA 4BMNA 1ADGA 3HN2A 3RBZA 4B4WA 1KEVA 5CAEA 1B3BA 1X13A 3Q1LA 4FFMA 4N5MA 4BKQA 1DJQA 2JD1A 4CM4A 3KUXA 3ROQA 5TJHA 2PGJA 2WM3A 5TF4A 3DC2A 1V3TA 2F00A 4Y8VA 1PJ3A 5ENVA 4JBIA 4C7KA 3VTFA 4P4LA 4FC7A 3PHIA 1TT7A 3KLPX 3WJ7A 3GDOA 1KY4A 2NU9A 5TLSA 5HBRA 1RKXA 3JQBA 4I9HA 3OM9A 3FN4A 1T1SA 1FDSA 1Y81A 1Z7BA 1U2GA 1EZ4A 4FJ0A 3C7AA 1ZK0A 1JVBA 3GVCA 2CF6A 3GLQA 2I3AA 1KERA 4MKRA 1NPYA 4FN4A 1DLJA 4LRTB 1O89A 3D4NA 5T8KC 2PK3A 3GMSA 3HB4X 1QLHA 2EGHA 1Q7GA 4R4JA 3RQSA 1PR9A 4Q3CA 7ADHA 3WOHA 3QLJA 1KVTA 4J3FA 3AY7A 5BQFA 4BNFA 4FFLA 4FOOA 3FBGA 1UZNA 3VH3A 4BNIA 3ADPA 1D7OA 2PZJA 1ONNA 2QRJA 4OQZA 4AL4A 4D3SA 1OZAA 2YYYA 3FPCA 4QUKA 3UHAA 1PZGA 3FD8A 3WSWA 1P77A 4KMSA 3QW2A 3TFOA 3L77A 2I65A 5CPBA 3ZDFA 1A71A 1W4ZA 1RM4A 3V1UA 4BNTA 3ZHXA 1D1SA 4U6QA 1PEDA 1NVGA 5IJZA 3AU9A 1GPJA 2E6UX 1GYPA 1PQUA 1X7DA 4CM8B 4Q3EA 3KB6A 1MXFA 2AQKA 1U1IA 2FRDA 4BUCA 2P9GA 1HKUA 3FNEA 2Q1WA 2I76A 1OI7A 1JWAB 2IZZA 2VZ0A 2PNFA 1T4BA 4E12A 1DJNA 3TF5A 1HXHA 3EVNA 1V3UA 3S2GA 2YV3A 1PWXA 1X1EA 1LBEA 3JQ7B 3S2EA 4WEOA 1JWBB 3GGOA 2JAPA 2C7VA 5THKA 3DAPA 5IFLA 4RVDA 5I8WA 4CM8A 3ZWOA 4MOWA 1I2ZA 4NG5A 1HSOA 3E1KA 3P2YA 4LSMA 4QO7A 4J9UE 4E5NA 3DONA 2X5JO 5FI5A 1GEGA 5TSDA 1G0OA 2RAFA 5G0VA 2OBNA 3GUCA 1H93A 1E92A 1K2WA 5L51A 2NWQA 2P9CA 2AXQA 4RORA 1SO8A 3E9NA 2NM0A 4AJOA 5F1KA 4BO4A 2W98A 3WMXA 3OIFA 1B2LA 1I2CA 2X0IA 1P1IA 4JJGA 5JDCC 3WWZA 1NAIA 2O3RA 4BNWA 3PJEA 1WP4A 2C7GA 1MGOA 3E8XA 4R5HA 3DHNA 2VRCD 3RFXA 2J5KA 4A03A 3F5SA 1I3LA 4PRKA 2YW9A 3SLGA 4ALNA 2V7PA 3WGIA 1A9YA 4AVYA 3UOGA 2AG8A 3IC5A 1HDCA 2BHLA 4BOYA 4JIGA 1ZVMA 3HB5X 4BO0A 4XCVA 4RVSA 2I67A 3AK4A 2HMTA 4B8ZA 2VWHA 3AOEA 1NP3A 5B1YA 4ND1A 2VT3A 3IP3A 1AN9A 3QE3A 3WLEA 4D79A 2G5CA 3ZV3A 1PJQA 4PG4A 2NVWA 4FFOA 3RUAA 2BGLA 4MKZA 1VRWA 2NV6A 3GGPA 3ZWMA 1KEUA 2J3IA 4S3MA 1DC3A 4I9NA 4NBWA 1P44A 5ICSA 3VKUA 2AQ8A 2ZIZA 4HWKA 2Q46A 4FOSA 4I5EA 2OUIA 4M55A 1DIAA 4U0JA 1JAXA 3JCZA 1YH3A 1RM3A 3HUDA 1QKIA 3JQDA 1RM0A 2NSDA 3R3JA 2NACA 4EJ0A 1DAPA 4YB8A 1T2CA 5DN9A 3ZW9A 4BO6A 5TC4A 5JDCA 4RF5A 3AFMA 2VN8A 3K2EA 3N58A 1GTMA 3GN2A 4IJUA 3KXDA 2X1HA 1QRRA 3A4VA 4WE3A 4B8WA 1V3VA 5TRTA 4BO2A 2ZB4A 1E1MA 2Z1NA 3IOYA 1OOEA 4MVJF 2EF1A 3QWIA 2FWMX 4KZPA 4CUJA 3A28A 1YL6A 3DFZA 1SB9A 3F9IA 4Z3DA 3ZV5A 2VQ3A 2W4QA 3E03A 4EW6A 4O6VA 3DZBA 3PFWO 4I5DA 4J90A 3NJ4A 1ZO8A 4BHTA 1R15A 3AUAA 3D1LA 2Q1TA 4J6FA 3F4BA 2X7HA 1A27A 3E5RA 5KJCA 1CQJA 4L4XA 3DO5A 2GGSA 4XYEA 3I9LA 1YQDA 4BNVA 3PHGA 1YQGA 4OO3A 2IE0A 4DC0A 2X9NA 4PZCA 3M1LA 3RC1A 1LSJA 3Q11A 1JW9B 1NVTA 5ER9A 2DTEA 5JNLA 3JTMA 2B36A 3WFJA 2X9GA 4HUJA 5DCWA 2J3JA 2X23A 4L4SA 1I2BA 3JQAD 5TS3A 3WGTA 2PLAA 1DC4A 4IINA 3SBOA 2EP7A 1WZEA 1IY8A 4FQ8A 4JX8A 3KEOA 2P5YA 4E2ZA 3BMOB 3V8BA 2DM6A 4DWVA 1UZMA 3PZRA 3GG9A 3P19A 2C20A 3ZWPA 3GDGA 1ULSA 3FRJA 3GUYA 4ZRMA 5A5EA 2Q50A 3ONFA 4IUYA 4YYZA 5IF3A 4GGPA 4BNLA 1KOLA 1B15A 4W6ZA 3PWSA 5JCJD 1QYDA 2X9VA 5DOVA 4CV0A 5HS6A 2NNLD 4NHEA 1MUUA 2AEMA 1WMAA 4XYLA 4EDFA 2HLPA 1GV1A 2GD1O 3ZWWA 4UULA 3BMOA 5A06A 2QX7A 3OIDA 3E6AA 1QLJA 2X4GA 4Y67A 1TI7A 5AXBA 4YPOA 2FN7A 4G81A 4ZD6A 4PVCA 3JQEA 3KTDA 1WLYA 4WUVA 1B8PA 3QVXA 4BV8A 3I9NA 4E31A 5KJ1A 2PKQP 3SVTA 4ZQEA 2FSVA 5EINA 3EGOA 2B35A 5L7TA 2HUNA 1U7TA 4WPGA 4NU6A 2WJPA 3OJ0A 2ZJ0A 3BMCB 4WLEA 4YJFB 1SCUA 2GN9A 4WCFC 3CPSA 1SOVA 2X8LA 1U3WA 3LU1A 4Z9FA 2BLLA 1TVEA 5DBFA 5IN5A 4ZHSA 1Y1PA 4MJLA 1GUZA 3GAFA 3MZ0A 4QEDA 4BNGA 4NI5A 1H6BA 2BI7A 5IDXA 2IZ0A 4CM9A 3W4IA 4IDDA 5T6BA 2OZPA 3CMMA 2RIRA 5T5QA 4UVGA 1C3VA 1MB4A 4N7RA 4MIYA 3I5MA 5IN4A 3I4FA 1DBVO 1ZXBA 4XIJA 3BMCA 2CF5A 4YJFA 4TRNA 3TL2A 3ICCA 5T67A 2JHFA 4CQMB 1PGJA 4U8GA 1NX6A 1ZJZA 3D0OA 4QXMA 4ROSA 4Z3KA 2PKRA 3BXXA 3GT0A 2YHIB 4FGSA 4LMPA 4IZIA 1CERA 1XSEA 2H63A 5J9GA 3DL2A 4WNIA 4UVEA 1DXYA 4DYDA 2UUOA 2OFPA 4J91A 3OQ1A 5COQA 3N7UA 3MWDB 3GNTA 5JFOA 1HRDA 3AM5A 2W2KB 4EEXA 3HJAA 1HDGO 3QVSA 4TKMA 4XQ9A 1PGNA 4BGIA 4E2XA 5CG1A 1GAEO 3V2HA 2JD2A 4CQMA 4PLCA 1ID1A 3GH3A 4MP3A 4XB1A 2YHIA 1E7MA 2E82A 2XXJA 1ENYA 4J4TA 5FEUA 4C4OA 3ENNA 3DDNA 3DHYA 1LQUA 3OBBA 1P74A 4PFJA 4RVGA 4S1VA 2W2KA 3F47A 1GQYA 4XRRA 3RFTA 4J7CA 1LDMA 2O2YA 1Z45A 2PZMA 4CM6A 1A4IA 1GCOA 3WG9A 1LSOA 3K6JA 1O0SA 1BMDA 3ZZNA 1T2DA 4JROA 3SJ7A 3RUIA 2EGGA 2D3TA 1U3TA 1HLPA 3WYCA 5TIIA 3O9ZA 5I7FA 1V8BA 2X0RA 2ZCUA 5IDWA 2A4KA 2WYVA 4HXYA 3UKOA 4AJKA 2WYUA 4AJIA 5JAQA 1I3MA 2C82A 1NYTA 4IMPA 4HY3A 4M8SA 4W82A 1IULA 3A1NA 1JQBA 1BXZA 3RC7A 3AOGA 3RVDA 3O03A 1Q0LA 2FY8A 4J0FA 3GVPA 3LVFO 1DB3A 3H6KA 5ITVA 2VOEA 3QVOA 4J4BA 4NBTA 4RV9A 3D4PA 4TZTA 3DHEA 4DQXA 2QYTA 5JBIA 2D5AA 4J16A 1YQXA 4Q3BA 2HK9A 1MX3A 1RYEA 5FYDA 4R54A 2ZATA 4EUFA 4MINA 3W4KA 2DQ4A 4D3FA 1BGVA 2HMWA 4KOAA 2RBEA 1NASA 3DBRB 1P1KA 2VNSA 1HZZA 4CR7A 4GVLA 4I5GA 1PJLA 2B4QA 1B16A 3OHSX 3GZNB 3Q0EA 2VHYA 3KHUA 1U8XX 2FR0A 4R16A 4H3VA 3E18A 3OJLA 4K1LA 4Z9YA 2Y1OA 1NPTO 2XAAA 2B5VA 1U4SA 4FFRA 4MVJG 1DOHA 4N54A 4FPXA 1ZK1A 1KVQA 1HL3A 3FWNA 3NTOA 4EJMA 5H82A 2YZ7A 3PHJA 4Z6KA 3L6OO 1LLDA 4YRAA 1XYGA 1OAAA 3NDRA 4PRLA 2O7QA 2P4HX 3W6UA 1ORRA 1NPDA 2GASA 2DUUA 1VL0A 1E3SA 4B7UA 3GZNA 2C07A 2CD9A 2Q1SA 4RGBA 2AE1A 4CMAA 4JK3A 2GCGA 2OL4A 4KWIA 1YL5A 3G1UA 3EYWA 3L4BC 1E6UA 2CY0A 2YDYA 5C5IA 1UXHA 2HK8A 4RO0A 1K3TA 4CMJA 4WCDA 2DTDA 3K2BA 4W7IA 2JD0A 2V65A 1YXMA 4BNNA 2ZYAA 1EUZA 4OIMA 1GCUA 4YEDA 4CODB 3DTYA 2WMDA 4C7JA 4TMFA 2HQ1A 3PJFA 3NJ8A 1U3UA 4DLBA 3VPSA 2B0JA 3WXBA 4LK3A 3FHLA 3C8MA 3TPCA 1ADBA 3EVTA 3DTTA 1YJ8A 1G1AA 3H9GA 4NJMB 1E5QA 3GRPA 5DULA 4BKOA 4JBHA 4E2YA 3R0IA 2HDHA 4WK6A 1GPDG 1LQTA 3DAFA 3QV1A 3EZYA 2EEZA 3PJGA 5BNTA 2JCXA 2PWZA 5IZ4A 4B3HA 4KUHA 1NAHA 1E7WA 2C2YA 1O6ZA 4R1UA 4FJ1A 5TGDA 3RUCA 2YFQA 1HDOA 2X86A 4Z0HO 4OXNA 4YT8A 1NXQA 4Q3DA 3ASVA 1Y9AA 3Q3CA 1CJCA 1VKOA 3EUWA 4WLOA 2VYNA 3W6ZA 5DNAA 3TZ6A 2PY6A 4CPDA 3ST7A 4MVJI 3IIEA 5CDTA 4NJMA 4TROA 5DDIP 1A72A 3DBHA 4GQAA 1HE2A 4RJTA 1UDCA 4GSLA 9LDTA 3HADA 2XF8A 3I4CA 5EL0A 1P9LA 5ITWA 1T1RA 2GERA 3AUTA 4R9RA 1MA0A 3ROKA 2GN6A 4E4YA 1ENOA 3EMKA 2BI8A 2YQ4A 3LC1O 3ANNA 4KTVE 2FP4A 4AFNA 4ITUA 2GPTA 2Y0DA 1B26A 3CTMA 3HQ4O 3AI3A 3JV7A 4YJGB 3LQFA 3O38A 3SXPA 1BDBA 3SC6A 7MDHA 5H81A 3U4DA 3MOIA 2NADA 2VOJA 1B0AA 3JD2A 1DFHA 1MLDA 4XZ3A 4BNJA 1E7QA 1XQ1A 4WECA 5TJ9A 1EE9A 1O8CA 3DOOA 1Z74A 1M67A 3PHLA 5CDGA 3VH1A 3RKUA 3STHA 4JJFA 1CYDA 2YDXA 4B3JA 1T4DA 1CEQA 1K6IA 2Y0CA 4CL8A 3OFSA 1KEWA 3JD3A 4Q9NA 3MOGA 4LISA 2GR9A 1YVEI 3H9UA 3MJSA 1XWFA 5GZ6A 3HFSA 3LT4A 1AE1A 5U4QA 3ZNQA 3VVCA 1N2SA 1YDEA 4A2CA 4DQVA 1EEHA 2BRUA 4YAGA 1GQQA 4FCCA 4Z0TA 2AE2A 4UVHA 1HDYA 3DZGA 2H9IA 2PGDA 5B4UA 4H15A 2X58A 1ML3A 3ONEA 5G0UA 2PZKA 1YB5A 3KSUA 4F45A 4R01A 3BTSA 4OOFA 2ZYGA 3PYMA 1LXCA 3JYNA 3GNQA 1V6AA 5GZ3A 1I10A 1PSDA 2O4UX 1QSGA 1O94A 4GX0A 4RPGA 1BDMA 2GRAA 2CVQA 1M76A 3F4LA 2C59A 2PD6A 1VE9A 2V6BA 3MCVA 4KUEA 4ONEA 1P0CA 3IUPA 3K5PA 1WDLA 3RIHA 2FR1A 1QYXA 5TQVA 1BSVA 1QYVA 1WVGA 3W8FA 2GLXA 3OQBA 1Y5MA 4XIYA 2DFDA 4WJZA 2WD7B 2PR2A 4QFCA 1I3NA 4D42A 4E0BA 4LW8A 4AJHA 4JNKA 5JYAA 1XR3A 3PIDA 1MG0A 4D0RA 3TZKA 3RBXA 3H9EO 2C54A 1S6YA 2GSDA 2OGUA 3RD5A 3EAGA 4A10A 1PS8A 2WYWA 3HG7A 1ZK4A 3ZU4A 1PGOA 3HDYA 3ZWAA 4ESOA 1ZEJA 2VWQA 1YGYA 4EYEA 4YCAA 5A02A 3AW9A 4E32A 5CEJA 5A9SB 4IDCA 1E6WA 4BO1A 2WD7A 3DQPA 1X0XA 2X5KO 2EKPA 4HP8A 4TRRA 4OH1A 2QZZA 3V2UA 1LLCA 1QR6A 4I5FA 1HEUA 4ID9A 4A73A 3NKLA 1X0VA 5HWSA 3TL3A 2O4CA 4YRDA 1DLIA 4M49A 3DZKA 5M6DA 3JQ9C 4W9NC 4A27A 1YBVA 4IZHA 5T64A 4D3DA 5KTKA 3LT1A 5A03A 4HKTA 5A9SA 1ZFNA 4TVOA 4INAA 3OJOA 3HDHA 5TT1A 3KOUA 1FDWA 5DP1A 5C7IO 1HWYA 1Q2XA 2GF2A 4AJEA 2VZ8A 4ZA2A 4XWYA 4P4NA 1XIVA 5AXAA 4CLEA 3RUEA 1E7SA 4D7AA 1HZJA 2Q2WA 1PZEA 4MIOA 3LT0A 5T8KA 2XXBA 1QORA 2NTVA 3CKYA 1V9LA 4L9RA 2P4QA 1TEHA 1GY8A 4KP7A 1BWSA 1OMOA 4JP2A 1ZXLA 2FSSA 4G65A 3V1YA 3KYCB 2Q22A 3PLRA 5EN4A 2YV1A 3ZV6A 4GWKA 2IYOA 4CLRB 3TSCA 2R2GA 3A06A 1D1TA 4HFRA 2QHXA 4NBRA 1PJ2A 1PL8A 2Y1EA 1YBMA 2ZQZA 4DVJA 1ISGA 1XHLA 2I99A 1Y6JA 2PTGA 5T73A 1PTJA 1DDOA 5JW6A 1NWCA 3UUWA 2O2SA 5JS6A 3IJPA 2BD0A 3NV9A 3JQ9A 1ISMA 3LSYA 3SJUA 2I3GA 1U8FO 1IHYA 2CUKA 3KYCA 1DRUA 3AFNA 4Y6RA 4HFMA 5EQFA 3WICA 5JC1A 4RPHA 5G4KB 4IDBA 4CLRA 1VM6A 1PQWA 3GHYA 1F12A 3LDHA 4YVFA 3I23A 2YUTA 3B6ZA 5BSGA 4D0SA 1AHHA 4RF4A 1N1GA 3VZSA 1QYWA 5KWEA 3H3JA 4OXKA 5DZSA 1KS9A 3PTZA 3MJEA 1YBAA 3CZMA 4CM9D 4DPLA 4A26A 1Q0HA 4YBZA 4CJXA 3NT4A 1YWGO 3COSA 3QIVA 4RF3A 1SEPA 1UAYA 3H2SA 2VWPA 5G4KA 3OEYA 5B37A 1TT5A 1PGPA 3VKVA 3UGKA 4XA8A 4XYMA 1I33A 3H3FA 5G0WA 4BGEA 4MVJA 3L6EA 1O5IA 4QSMA 2JFFA 5CHEA 3WX0A 4OXYA 4IJWA 4FJ2A 1P45A 5IAAA 1GDHA 1BXGA 3DB2A 1ZSYA 3C7CB 3OF2A 5C3MA 1C0IA 1GADO 5JPIA 1NR7A 4O0LA 4OOEA 1ULUA 3JYLA 3GVIA 3PJDA 4FBGA 3NAQA 5EMHA 4E21A 4HNHA 4CUZA 3DZHA 5FI3A 2Y68A 3VH2A 5HA5A 4PLZA 1E7RA 4E2WA 3I9MA 4L75A 4TRMA 4IY1A 1B14A 4CQMD 3GF4A 2EKQA 4CQLB 4HADA 4FDAA 3JQGB 5FF9A 4BMVA 3HWRA 4PG7A 1X15A 2O3JA 2POQX 2ZTVA 3DEYX 4MPDA 4PLYA 3DWFA 3DMYA 1UH5A 3E82A 2NLOA 3WNVA 4DIOA 1DHTA 5LDHA 2DPHA 3UCFA 4FGWA 3JYQA 2RH8A 2O3TA 3W8EA 3WLFA 4DIFA 1UP7A 2IRWA 1R0LA 1Z6ZA 3ZGYA 2JFGA 4XJTA 4Z0PA 1LSSA 3WR5A 1LDNA 2ZTLA 1Y7TA 3CSDA 3TFQA 5BNIA 5F5LA 5K9ZA 4CQLA 1H0KA 2YY7A 3JQGA 1YS4A 3M6IA 2EJVA 2GZ1A 1BRMA 4XGNA 2PA3A 3GA0A 3KEQA 2O7SA 2JJYA 4IPTA 5A9TA 2UAGA 2ZTMA 1UXGA 2GO1A 1N92A 5C7LO 1ZSNA 1C0LA 1H9AA 2H1SA 3WGHA 3CEAA 4QX6A 2OBYA 4J7XA 1AUPA 3NGLA 4RZHA 3MTJA 2A94A 1EK6A 2E37A 3GPDG 1KVRA 2JCYA 2P91A 2ZJ1A 4JXKA 1TXGA 2C0CA 1IHXA 1GYQA 2XPCA 2ZKLA 4QQRA 3VPXA 1WPQA 5EERA 4WOKA 3DZIA 1PL6A 4CM5A 4E30A 1FF9A 3RU9A 1LUAA 4L0QA 2G82A
chains in the Genus database with same CATH superfamily
2GJAA 4F8EA 1ABEA 4G5FA 3EGIA 3JR3A 5E3IA 5EGNA 4JMLA 3UPDA 4Z51A 1QRUA 1OGYA 1RM5A 3QWFA 2ZUEA 3D5EA 3L02A 1K1EA 3OKAA 3TW3A 5JDIC 4P5PA 3O8NA 1ZVKA 4YCMA 1JXOA 4ZCQA 5GADl 2M6LA 3UBTA 2ABWA 1I32A 2HV9A 3GJTA 4M8IA 5DHSA 1E1CB 3LS2A 3OOSA 3PKZA 2O2IA 3FVRA 1AKNA 3H18A 3FPKA 3MQFA 3KJNA 5SV2A 3Q10A 4EVIA 3T3PB 2VRBA 4QGSA 4ND2A 1FRZA 1PJBA 2ZS8A 4BU0A 3RE1A 4PZLA 3HCCA 4I7EA 5I8ZA 1W19A 4A3SA 4GYJA 3HCBA 5A05A 1QH9A 2I6UA 4YRNA 1PBNA 2ZYWX 1CY1A 1T4CB 3C24A 1ZC3A 4B4DA 4XQCA 2XGMA 1GTZA 1WPGA 1QZUA 1BX3A 4CKZA 3EULA 2IOFK 3IDOA 4A0RA 3JARB 3ADBA 4XQEA 1SKBA 3VSCA 4KNVA 4AN0A 1L5OA 3D8RA 1IMJA 1RQRA 2TMDA 3KVOA 2A35A 4TXHA 5E6SA 4IS2A 1KWKA 4YDRA 2BELA 1B6TA 4YGXB 3WB2A 1ODCA 5JI2E 3CLRD 1JJ7A 2IC5A 3MGAA 4E5YA 3L4KA 4MWCA 2JBAA 3CCBA 4KPYA 4JGBA 1JVSA 4HYQA 3IWBB 3W5AA 5I7VA 2XTMA 3EG9B 3MA0A 2RBKA 3ZKWB 4J94A 1HT3A 1U81A 2ZWMA 3JPWA 3EAQA 4KR2A 1L7XA 3TEFA 3A2NA 4JLWA 4ZEMA 3E9YA 3OIGA 1XXHE 1Z0DA 3DAOA 2NUAA 4PPNA 1GNQA 3IVRA 1KEEA 1J2JA 2PUJA 1D6SA 2PRIA 4IG9A 3KLMX 1LB1B 2EX1A 5EMMA 4RK7A 3S7ZA 3OZRA 3GJ7A 1PQPA 1NZFA 3ZQJA 1CUWA 1MC4A 3P97A 4JKYA 1IOLA 1M1YE 2YWHA 4R6WA 1Z6AA 3NHRA 3I4LA 3MWYW 3QHAA 4LYFA 3WYAA 3ZI0A 1JHMA 5A4FS 3CF6R 3T1VA 4MW9A 2C4HA 3IS3A 4R9SA 4NIMA 1Q11A 3ONNA 4WKCA 2J3MA 2RGNC 5D8DA 3AEXA 1M0WA 4LE1A 4KEAA 4LJAA 3ZZ1A 1QOPB 3K9FC 2F3TA 1XXHA 1RPJA 3T1QA 1NOIA 1VRVA 5D3MB 4JC0A 1HH4A 2IYTA 1GO2A 4X90A 3KSDO 3UJAA 4YV1A 5AW1A 1CNMA 1SUCA 1NI4A 1EE1A 4BZZA 1EFPA 2B99A 1JYEA 2XHZA 4XPIA 5TXGA 4KO8A 4PLPA 1UOPA 2V4UA 2XVMA 3Q72A 2B4TO 3H9JA 3ZX4A 1M1YA 2IHJA 1VG0B 1OY1A 3CGWA 1ZL0A 2XNKA 5KVSA 4PCAA 1GV0A 3A1UA 2AVDA 1ICIA 3MYRA 4ZHQF 1MX9A 4RPIA 5M5BA 1F0PA 1PD1A 4N65A 2E5FA 2AQIA 4UC0A 3KV1A 2HMVA 2QIPA 3GJQA 3R6GA 1N9GB 5FAXA 2O07A 3JAKA 4RK6A 4IMIB 2Q45A 4PG6A 1A9SA 1WL8A 4IFEA 1J70A 2D1SA 3TVYA 4OLBA 4BDSA 4UD6A 3R3ZA 2HLDD 3GJZA 5AKLA 2X5XA 4EY4A 3S68A 4EBFA 1BD3A 4AUMA 4OQDA 4H3HB 5E6RA 1HE8B 5JSZA 1QG4A 1U7ZA 3V5NA 1IIBA 3QGMA 2AK2A 2TSYB 3TLCA 1OTXA 1ZIYA 2ACEA 1FYWA 2VP3A 3C4QA 1IEXA 2COKA 1EHIA 4GVPA 1W9MA 3H16A 4PYLA 3O8QA 4XGIA 2DVMA 4KYVA 4MI1A 4HAWA 1KIFA 3QVLA 4YP7A 4CEIA 1Q1QA 1E4VA 1C1DB 1ISSA 4LCJA 1I6MA 4XEHA 4OHRA 1E98A 1TW2A 5KNBD 1LH0A 1XVVA 1ZCZA 2GJKA 4KIGA 3PCRB 2GDZA 4JB0A 4RQTA 4YS6A 1S5PA 4BP8A 5IG2A 2QSYA 2NZYA 4UZFA 4BQPA 3L9WA 3EXIB 1KK0A 2Y1CA 2EP8A 1Y8RB 2BM9A 2H5JA 4INOA 1AM4D 1QV7A 2FUCA 2HUPA 2CXQA 1SKUA 3U1VA 3UK0A 1WMFA 2JFPA 1VJ1A 3JVEA 3N8DA 4IZ6A 1E6MA 3B36A 2HPZA 4OHMA 1XRSB 4R1SA 3TBKA 5I01A 3IDQA 3I9OA 1GQRA 1XMVA 3VOSA 4M98A 4MRAA 4Y1EA 4HG2A 4G4JA 5ICCA 5KREA 4JJEA 3IQFA 2IUEA 3L07A 4PIPA 4WFJA 1SGWA 3UJ6A 2WTBA 4A4DA 1M1NA 1OXBB 1TQ6A 5KQSA 8ADHA 4JI4B 1ICEA 4M1YA 3GP8A 4QO8A 2IGTA 1UINA 4PC3A 1J2TA 2TMKA 1JA9A 3FUTA 3C14C 4RD4A 4BQNA 4JT9A 5AUOB 2IE8A 2JDIA 2ZRIA 5JT1A 4MIKA 5DM60 3ENZA 1D2NA 3IKMB 2VNIA 1ZD2P 2EZ8A 2GPSA 1E3LA 2ZSUA 4DSAA 3FFWA 5DYIA 4DW8A 1YJQA 3G7SA 1BX0A 1SXJE 2P75A 4MVXA 1ZESA 3J80A 5DX1A 2O48X 1SXIA 3QUCA 1DMRA 3QKSB 1CZRA 3FVTA 3GD5A 4P86A 4UU1A 4ZANA 3T3GA 4D8YA 3R5JA 4EUEA 2I6XA 2L42A 2W00A 1WQ3A 3DEIA 2P68A 4R68A 1WCYA 4W1RA 4CMKA 9ABPA 3KUCA 5JNRA 1OIWA 3H4MA 1VIMA 3QSGA 4P3PA 1NHWA 4LRQA 2C7RA 1U2PA 6REQB 4P31A 2Y27A 1J2RA 4XEUA 5MFZA 3NYRA 3BFPA 2GZAA 1L7QA 4R2LA 4ZAXA 1R66A 2J3QA 4GKBA 1E96A 3OECA 3ZGOA 3BDVA 2RARA 4B71A 4MR9B 1K0UA 4ESEA 1SXJA 2VEOA 1Q57A 1U7PA 2EBHX 4K6KA 3DBVO 5JAPA 3FMOB 5T6MA 3F5DA 1U8YA 2JKVA 2JLYA 1NM5C 5HIAA 3QJGA 1LI5A 1WDMA 3HVHA 3AF4A 1DIGA 1Z36A 4S24A 3AEQB 3TQTA 1U9YA 4DLRA 3BF8A 4MSUA 2HU8A 4C22A 4DCCA 4ZMRA 3HBAA 1KETA 2IY8A 1L5VA 1NN1A 3NEJA 4M0CA 4YROA 1CZKA 1JHUA 5AVQA 3M6MD 1VDMA 3VR5D 5L53A 3FLAA 3JZFA 2IV3A 3L1UA 1G291 3TKYA 1MFPA 2ZSDA 1RXIA 4FT2A 3U48A 4HRVA 4JQCA 1JMVA 3HP1A 2C61A 3PUJA 1BWRA 5T4EA 2K7ZA 3LNTA 4KQJA 2QP9X 4DBLE 4EHHA 1SOAA 2GUGA 1F8UA 3G9UA 4EHIA 3RG8A 4TT3D 4QE3A 1KF0A 1L5QA 4GM0A 2Y0EA 3AM3A 3U49A 2RK3A 4K9OA 2AMLA 5AKJA 1Y4SA 3HE3A 4WLUA 4TMVA 2C88A 2Q6IA 1WV0A 4FI3C 3QK7A 3IOEA 3W77A 2QUZA 4Q9IA 3GJ3A 4YRKA 5A3JA 4HB4A 1I7DA 4IDFA 3H1BA 4QOGA 4R2IA 4BNZA 3A4MA 3PCTA 3IPRA 4JAVC 3SKXA 1HYHA 1MA3A 2C5FA 2P0AA 1MPXA 2XOKD 3HB0A 4BWVA 4CZ2A 4EYKA 5AXDA 4Q4HB 1QDEA 1S9DA 4LOLA 2IZ5A 1ZAYA 4IIVA 1E6CA 2VTEA 4M36A 2HSDA 1RKUA 2O2XA 4PC2A 3K6SB 3IALA 3LIIA 3V2GA 4P32A 1M66A 1A5SB 1ETUA 1DTWB 4OD0A 4Q18A 4KR3A 5BYJA 3VOAA 3ZXSA 4Z4EA 3SG0A 1SVIA 4O4HB 1KMQA 4ME6A 3IB6A 1A2OA 1NQTA 1U1CA 2J4DA 2GM3A 3C6ZA 1G9XA 1ORWA 2C3UA 2IVFA 3WGZA 3A1WA 3NX4A 1PJSA 1WBBA 3KAJA 4DIEA 1JKFA 1BCSA 3IBTA 3LUPA 5B1HA 3L4BA 1NNUA 4J7UA 5JJIA 5JD6A 1XYVA 1ZNZA 3R7WA 5ALHA 3OICA 4C7MA 5GONB 2RAUA 4IMRA 3DFIA 4NMXB 3EQ6A 2BGWA 1FSZA 4B40A 1L5WA 2BMDA 2SKEA 1EYZA 2VT7A 3JATA 3NBZC 3KXPA 1E2DA 2JIMA 5ECGC 3F1KA 3UWSA 4DEXA 4IHJA 1UPUA 3HK2A 3I5YA 3KLOA 3K5HA 1TVMA 4GI1A 1N8KA 5HDBB 5EQDA 3IE0A 3ZWXA 4Z8XA 5JVDA 3KSBC 4D4KA 4DJDC 1M8PA 1T5OA 3NR2A 3HCAA 3BXPA 4XPZA 5JCXA 4AO8A 1EUCA 2RGEA 1HBJA 2VJYA 2ZKIA 4JI0B 3NAZA 5JE8A 1NXVA 1KYQA 3FBTA 3V8QA 3A7DA 1KYWA 1R4ZA 3PXBA 4QGHA 3UMBA 4HGNA 2GXSA 5BWCA 4IQ0A 2WR8A 5DNVA 4PQFA 2AN5A 4GOKA 2VATA 1EDOA 5IZCA 1L3IA 4ER3A 2O54A 1J5PA 3E3MA 3B5IA 3G79A 4DBZA 3PVZA 5EEHA 1RSZA 5ITZA 3KFXA 2HM7A 3NWPA 2OESA 1ONPA 1CY0A 4AJ4A 4EHFA 1QFSA 2BZSA 2FE4A 3LY7A 4FE3A 4US0R 3U3ZA 4CLOB 4DLZA 2FMTA 1G20E 1H0SA 5AHXA 3IMKA 1SR8A 3ROFA 3T1OA 1JAYA 4W7SA 4WY2A 3T7AA 1X7GA 2H1RA 5FTKA 1A2BA 1E3EA 1KQ3A 1LX6A 3ZTWA 4R5MA 1RHKA 3RASA 4H7PA 5CM8B 3OA2A 1JB9A 4O29A 3B70A 2AZTA 3VDNB 1WUTA 1GKUB 1QVAA 2IZ1A 1YCGA 1GD1O 2QA5A 4ZV7A 5C1DA 4KAJA 3RK1A 4LTDA 3LW7A 1YRQA 2MSNA 1XD9A 3ZHTA 4JLNA 4DLAA 4C06A 5ADHA 1NJ1A 2QIOA 4Q5IA 1DC6A 2UUPA 3TB4A 4B0PA 4EUSA 1GRNA 4LYGA 3LCVB 1G20A 3P2MA 5CVJA 2B1IA 3GFPA 1D5WA 2AF3C 3PKIA 2DF8A 4GLBA 5AM0A 4Z1MA 3MS2A 1TYCA 2GVNA 4EPXA 4EHDA 3KWMA 1C3OB 4JJKA 2JGKA 1E3WB 1K06A 2FPIA 1I2DA 1ST3A 2JVKA 1XTTA 2NU6A 4LXXA 4TQUS 4CGZA 3D6JA 1CG6A 3DOHA 4RM2A 1XPRA 3IQIX 1KL7A 1NT4A 2PLFA 4JY7A 5AXCA 4G8CA 4PZAA 1K6XA 3QIAA 1AHPA 2XMSA 4NP6A 3MK31 2ZULA 4HNUA 3WZLA 1XJ5A 2FA9A 3LTEA 4ZGWA 1VOTA 3OZFA 1GZSA 3Q5GA 4DNXA 8GPBA 2C84A 5LJIA 3HXQA 1PYGA 4E1AA 5K03A 3SS9X 1X6VA 2X7XA 1L7EA 3NW9A 4URXR 1C14A 2Z4RA 4EM6A 4REOA 1IE3A 5CDHA 3HHPA 3ZGVA 3AEZA 5ELXA 4G97A 2GBLA 2ACVA 1LLUA 1Z26A 3Q7QA 3BB4A 4ZVOA 4DA7A 5GIPE 1P2UA 3E4CA 3KUUA 1U28A 3KVYA 1UKZA 3IXQA 5FI0B 4PSCA 3LRTA 2OHXA 2VTDA 1NJFA 2FN4A 2PO7A 5E9QA 1P1HA 5HKLA 5B53A 2HJSA 4CN9A 5FOQA 3RI3A 4HVTA 5JOQA 2NYRA 1C4WA 3A1SA 5JS2A 5FWDA 4DLPA 2ZE8A 1ZI8A 4WFIA 4GPD1 3IILA 5AWFC 4AW9A 1UR5A 2FZCA 3G9ZA 1PAUA 2I78A 2C58A 3ONDA 2BE9A 4CI0B 1IXYA 5DI3A 4O63O 4V3BA 4GLLA 1IY0A 2WKRA 3MBIA 2XUGA 1CCWA 1B7GO 16PKA 1ZW6A 4ZQFA 1KO8A 1ORVA 3BRWD 4XGQA 2FEOA 3EGDB 3L7AA 3WHLA 1W0JD 3FZQA 4CM1A 4D9BA 4G0UA 1IHOA 2ODQA 1Q7BA 3NT2A 3NHYA 3TTXA 1FMFA 3E35A 3RH0A 4BFSA 2VT6A 4LQCA 5FPHA 1JHZA 1SKYE 2P6UA 4BVLA 4CF3A 2CL6X 1J90A 3L8GA 4CL0A 1XEXB 2C4NA 3I6ZA 4LGYA 5IX8A 4HATA 1QMPA 1E20A 2QTVA 4YRCA 7YASA 2W2MA 3O1HB 3QVWA 1MU0A 2J31A 5AKXA 1RKBA 1T2VA 2VAXA 5H3LA 2PQ6A 4IGFA 3QRWA 3AHFA 3M6VA 1JG3A 1AY0A 1IB6A 3LNCA 4MZDA 1LRKA 1HE3A 2AK3A 2C98A 2NZ8A 4ZOEA 3QELB 3NC4A 3JQ8A 3VU8A 4D1YA 3TG8A 4XX0A 2AOUA 2HRZA 2QTAA 3AIKA 3IUNA 3WK4A 3T9FA 2I9KA 4ZCTA 1NQAO 3E9QA 3LP6A 3EEQA 721PA 1JFFB 2DR0A 4YRPA 3AXSA 4G0MA 4AX4A 2RI0A 1LPPA 3DWEX 4WLNA 3OQMA 1M6NA 3K16A 1A88A 1UUFA 2BEJA 1QZ3A 2UKDA 3J7TA 4MAAA 4LF5B 5DLPA 1B8UA 4N7BA 2ZSAA 3JWJA 5C53B 4RD0A 4LRWA 2DEUA 5FP0A 1FDVA 2WF5A 2WTNA 1SD5A 3CB2A 2R8BA 1P1FA 3MQ2A 1QQTA 2IYXA 3H13A 3U2QA 5HCIA 1X7YB 1MDFA 1D6MA 4RULA 1TF5A 2BKVA 3N2YA 5HFAA 4B34A 3AEUA 5LYJB 2E4WA 3DXXA 4I50F 1BAPA 1GPKA 2ARKA 4CG3A 1Q95A 5LCXA 3IIKA 1GGNA 1KRHA 1VE5A 5DCYA 1IJFA 4AJNA 4ARCA 3R24A 1U0HC 3A70A 2MYPA 1DQPA 2BMWA 4UDXX 3QWBA 3LRPA 5C80A 5IJ0A 3NTLA 1TPZA 3AV0B 3CE6A 2D1TA 3CLTD 3IKJA 3V1NA 1ZM2A 4EIWA 3KETA 3D6FA 3OFVA 4Z99A 4EW2A 2EYUA 1VJ0A 3CF4G 3DKRA 3GFQA 3VKWA 4WRRA 3FNGA 4CV2A 1HDRA 5IDYA 1L8AA 2E9SA 4NEQA 4XSHA 4IWXA 4N9QA 1UBHS 1ZUD1 5D3ZA 4I8IA 2C9BA 2YHUA 3D2AA 4O4IB 1P7YA 3ZWVA 4FSHA 4KX3A 4MUEA 2ZJ3A 5DEOA 1CDDA 1RXCA 3UO8B 3A11A 4U5QA 4XD2A 2ES4A 2QU7A 4AJLA 3C3KA 1Q7EA 3JQ7A 1N32B 1NVVQ 3N8IA 2J0UB 1XKTA 2VUIB 5KDLA 3ZHBA 2B94A 2AFHE 5G1NA 4UNSA 4MH0R 2B1RA 2J85A 2PL3A 4QYSA 5JATA 1L1FA 3VR6A 4MP6A 1EK5A 3WADA 4R2JA 3ZE0B 3ZU3A 2PWPA 1PE0A 1BXGB 5A4AA 1AMOA 4LF8B 1XDSA 2MSKA 3IUMA 2COUA 4CEJA 1C1HA 1USWA 4PLFA 4P35A 3LT2A 1C8VB 4CDNA 2P5SA 3S2IA 4EEKA 1RCFA 6ADHA 3S2FA 2YN4A 3D3KA 1CF2O 2YMQA 3DZDA 2Z08A 3N5CA 5KINB 3WY9A 2Q2VA 3ICPA 3SEFA 4D41A 3IE1A 3H5RA 2R8PA 3OVMA 4AO7A 2GYWA 4YRBA 5HUHA 5F3RA 1RWVA 4H16A 1NQVA 2AFHA 5FTMA 4EELA 1Z4QA 4AZSA 5CDUA 4J8PA 2R25B 2I2CA 3TCXB 2XUOA 3IPXA 1N77A 4OQ4A 4W9RA 2E21A 1I9GA 4BQIA 4MRNA 3PC2A 3PNBA 3UJDA 1ZWKA 2QGZA 2NX2A 4GE3A 2AI3A 1E0AA 4L5BA 3AW8A 1TIBA 3MWFA 3OZVA 1ZUNB 2VFAA 5B30A 2KX7A 4C0XA 4L7QA 1NFFA 2P1ZA 1UJMA 4MUJA 3GXBA 4M9XA 4OXXA 4AK1A 4BWFB 4EARA 4KPGA 2DAPA 4Q24A 2B4RO 2EDCA 1RCTE 3MJ4A 1PR6A 4YJ2F 2F8TA 4LVNA 4B9AA 1SNYA 4RK0A 1L9XA 4I19A 4WESB 4B2LA 4ZCRA 1FS4A 1VKNA 1I7QB 1WSAA 3I2JA 4LY3A 4D8WA 1QHGA 2PH5A 1ABFA 4NABA 4LY9A 4NV0A 5L3RA 2ISSD 3Q9NA 3LUGA 2NU7A 2P5UA 4KMOA 3T3IA 3T6KA 1WUKS 4G1UC 4TQGA 1WEKA 2ISCA 4Q00A 4EF6A 3NOQA 1LA2A 1JKJB 2BOVA 2ZI9A 4IOMA 2CXOA 3MCZA 4ENWA 3T3NA 4HDCA 1ZIDA 2W2PA 4PCUA 5TVGA 2XUDA 3GD7A 3BQ9A 3EIOA 4RPKA 4YASA 1W47A 2CHEA 4NE2A 1U3VA 2GOYA 3EHDA 1V16A 4ZOAA 1YBHA 1X1SA 5ADVA 5SZKB 3PGJA 1ZMOA 2GCPA 1GZ6A 4OHBA 3CVVA 5JV5A 1GR0A 1E64A 3UGQA 5EJGA 4XSGA 1JTFA 4AY6A 3IIMA 3UT5A 4KK4A 4IGAA 2FKAA 1D9XA 1FUKA 5AFSA 3NYQA 2A9FA 3ETDA 4NAHA 4TV9A 2VHZA 5A7FA 1PG2A 3A6GA 3H7AA 1Q0UA 5JRDS 1SUPA 2YWXA 3T9EA 1C9JA 2JLSA 3LXMA 4KWHA 4LN1A 4Q4AB 4B46A 5EHZA 1RWOA 1O0CA 4X66B 4M1MA 4CTNA 3BE6A 3PU6A 2FPMA 3FY4A 2PZLA 3A05A 1P4JA 3GQVA 3IWCB 4FNAA 5GM1A 2B7LA 4ISCA 2XMGA 4R83A 4WBSA 4YHBA 3MUOA 3BF7A 1FP4A 1HF3A 1U80A 1YOVA 4DCVA 3UAZA 1PYDA 2V4ZA 4DRYA 3IAHA 1ABBA 3QU7A 4Q7JB 2AMFA 2HLHA 2Q2QA 5KNDH 3VUEA 4N5NA 1NSFA 1MX5A 4K9DA 1EFRA 1ULTA 2O06A 3MTGA 4FMCB 5A4DA 3FI0A 1E9AA 1K2VN 3S1AA 4BATA 3CT4A 1GUDA 4YCCA 1A69A 2BWJA 2VP6A 5E4YA 3GMDA 3ZNPA 1AA6A 3PA8A 4UATA 2FMXA 4BJ6A 1VPVA 2J5QA 5C1BA 2AC4A 4GXNA 3QX8A 1DARA 3LPMA 3PR1A 5GOZA 4UUAA 5KTTA 1GNTA 1MO5A 3TW6A 5AKGA 4G5YA 4MVJH 1NVXQ 2E4UA 1KC1A 4EHJA 2LDXA 2ZJOA 3N8GA 1S8OA 4MKHA 3SQNA 2AHRA 2GD6A 2NO6A 2P2NA 3KOYA 3VZRA 1UT5A 4N1AA 4PZDA 5ALPA 1WXEA 4H59A 2GYUA 4C7XA 4H1VA 3SICE 1AIPA 3R7SA 3VPCA 5F1YA 2QM8A 1G6Q1 4QU9A 2CFCA 1WKCA 5JMTA 4MMXB 1VSUA 3VHLB 1NJSA 13PKA 3I8XA 4BNXA 2WQZA 2Q9AA 3BCRA 3SMVA 5TMDA 2FWPA 3SSAA 3R74A 2VCYA 2OO5A 3IYLW 1S8AA 2FG6C 1XHEA 2XWPA 4J03A 1F8XA 3DF7A 2YMMA 4KRYA 1CWUA 4LI3X 3MD9A 5D5PA 3NUZA 4Y9RA 1OC4A 3MCTA 3E48A 3JD0A 3R7DA 1R1DA 1ZCJA 1L9KA 2RB5A 3AR8A 1EGHA 2AIRA 2D59A 3ITKA 4HDNA 4YQZA 3HBMA 2Q29A 3CZRA 3WGLA 1YTLA 2HPAA 2I6FA 5D85A 4GMGA 3VAAA 1SIUA 1RWKA 3D5TA 3U80A 3M2PA 1NDHA 4NENB 4AY4A 3BIJA 4D82A 4V0RA 5H83A 2I1WA 2IL1A 3ENWA 1QMHA 5HYVA 1RWBA 4BVFA 2I03A 1MP0A 1PR2A 3FVQA 1AB6A 5DNWA 3RAPR 5GJBA 4NCHA 2IPNA 4G26A 2E89A 4PAQA 5B3LA 3W78A 1YACA 3E9CA 1VI2A 3OLXA 1NJ5A 4RHUA 5MGNA 4C0KA 3FCCA 3QLEA 4RDIA 4A5OA 4EFLA 5HKBA 1H4QA 7REQA 1A4UA 2XBUA 1NXPA 4O4JB 4QYMA 2JI7A 1KI7A 2D4AA 2XUHA 3AM1A 3E1GA 1BVUA 5C4IA 1BMTA 1ULZA 2WQ7A 1NVVR 2LV8A 1M1XB 1D0SA 1E1LA 3WDLA 1W0KD 5EXXA 2O2ZA 2GO7A 4IJKA 5DIFA 5KYNA 1VA5A 2NPIA 1UWCA 1S1CA 4G5HA 3NKVA 3ZCXA 1P9WA 1X7WB 1Z6QA 2TS1A 3FE2A 5AOAA 2CE7A 4RUKA 4EKGA 4KFSA 3PC4A 4P4SA 5JMPA 3X2FA 4H77A 9LDBA 3H8SA 2C4MA 4MYSA 3DMTA 2G1AA 2CNDA 5FNVA 2UZ1B 3ZJUA 3ZN2A 1QFXA 4KZKA 4UUNA 4NDZA 2XYQA 4ZAYA 3FNQA 3TIXB 4EB0A 3QEKA 4WGFA 4QFDA 1I5OA 2IUYA 1D6NA 1G7RA 2JH8A 1HYGA 4GSYA 4KGVA 1FNCA 3CX6A 1P2VA 4GPBA 1EK0A 2Y93A 3BN3A 2FPUA 1BGXT 2JAHA 5D86A 3U81A 2PT6A 1FYVA 4COKA 4YJ3F 3VO9A 3KUDA 4G1MB 4JSYA 1CPYA 2PXAA 4WUTA 3GR6A 3SPXA 2YIVX 4L51A 2PKQO 5ULLA 3VU1A 1VMAA 1E9CA 3PBKA 3RVMA 5LXTA 1B1CA 1GLGA 1T8SA 5EZYB 3W5BA 5DBGA 3HKBB 1KZGB 4FXOA 4UPDA 5HFNA 4HZUB 1YR1A 4HB2A 1M7GA 2X5NA 1ZH8A 1WB6A 2J5BA 2H2WA 2NO1A 2QRGA 5F78A 1P1CA 4JVOA 3MJFA 4H0CA 4D02A 4AJJA 2QQEA 3ZE6A 2Q4EA 5BQXA 1Z73A 3RAGA 3A1FA 2HI0A 5C7YA 1OJ7A 3RRNA 1JXMA 2WTEA 4UEOA 5DMXA 5LFAA 3OSUA 9MHTA 3QBJA 4GG1A 4PTLA 4HX5A 2B69A 1M2HA 1N5OX 5AKHA 3X2EA 1HLFA 2WDPA 3KPJA 3H2BA 3IHTA 5ENZA 4MUAA 4ZO7A 4BN5A 3QUQA 2PH7A 3GVXA 4UCWA 3GDHA 1FYDA 3W8RA 1HX7A 4BO5A 4OKIA 1AZSC 4G0ZA 5ER6A 2FDXA 1HEIA 2JHGA 2ZIXA 4LX8A 3W2IA 4N3CA 3LWDA 3VPFA 4PXYA 4JGIA 4CLXA 2VH1A 1P91A 2A1UA 3L0IB 4LXIA 4BEJA 1KYTA 3SBXA 4R7TA 4DMCA 1JG6A 2FMHA 3AU8A 3T4EA 3B1XA 2JK1A 4NKRA 3FTPA 3HZRA 3I6BA 4WZAB 1SUEA 1Y80A 2AR9A 2D13A 5CA0A 2W6PA 3UB2A 3ZTYA 4CF6A 3ZDAA 2V58A 4EFDA 2IUTA 2BH2A 2QZSA 1PVOA 3PYXA 3W5JA 2NQ2C 3TR0A 1X1TA 1XNRB 3DTVB 2KLHA 3C16C 4L73A 3CNLA 3HVIA 3T3HA 4FFBA 3QI7A 2NU8A 3VJLA 3ZEIA 3ZGZA 4LY6A 3C7DB 3NAMA 1FS6A 1H22A 4UUOA 4W5RA 3UJ9A 4EGSA 1XVAA 3EVGA 3SWWA 5KYYA 4BMZA 4JLUA 1U7XA 2A1IA 3VHXA 5B4VA 2PX3A 3TOCA 5JROA 5KI6A 4M99A 4BS9A 1XPJA 3CF4A 1NHGA 1HE1C 1QC5B 4JI8B 1R6DA 4ZICA 1QZTA 3P9QA 1UBNA 3CXRA 2OHGA 4KYUA 5AQ1A 3FSJX 2OQ2A 2JI4A 4JVSB 4FW8A 4EW3A 1YB4A 4ZU1X 2OO3A 4YMLA 2GNOA 2IYSA 4KAFA 1DKNA 1NATA 2VP2A 3L5OA 4DOMA 2Z2JA 3PP8A 1K66A 2MSWA 4Y9TA 3T7IA 3L6BA 3WB0A 1Q15A 4PC7A 5DTMA 4GC5A 3NXSA 4QGAA 3BAFA 4WVFA 3ZV4A 4BB0A 3O8LA 5BOSB 4OX9B 4I8XA 4P7KA 1EGMB 1E66A 1W76A 3OLCX 2GFQA 3AY3A 4OSOA 5EP1A 2ID7A 1XTQA 2OD7A 2WVGA 2G1UA 3S2ZA 2APJA 3U7JA 3H19A 4RTLA 3MGCA 4DIKA 3OTOB 2R7NA 4L72A 4NFYA 4X5OA 5H80A 3TN7A 4Z4IA 4P4UA 2XMDA 2XCUA 5BWNA 3F3KA 4Q9HA 5FX2A 4B73A 2WJZB 1N5IA 2XRFA 3IEVA 3T9CA 1XX6A 1QYCA 2JFHA 4B4VA 4KR6A 3VDQA 1SB8A 4FQ7A 1T5IA 1FJXA 2P2GA 4AKIA 3QVGB 4K28A 1WW3A 4EA7A 5HRUA 4OJMX 3SZ3A 2MSDB 1XTJA 2ZWAA 2ORED 3ZHRA 1Q0ZA 2JH3A 5BR7A 1ZGCA 4M1QA 4UZSA 5CT9A 2VRNA 1KZ7B 3QXCA 4YPFA 2VO1A 4HVCA 4IQ4A 3NM4A 4EK9A 2F64A 1QBKC 2BEWB 1JEYB 4CF5A 2RHLA 3MHTA 3DBRA 1FLAA 1LS1A 1KP3A 2PSFA 2RGDA 3N7TA 4Q3AA 3VSEA 2VTBA 1LV7A 2GN4A 2CSXA 3KR1A 3EZ6A 4LECA 4MPPA 2I6GA 5KOYA 4GAEA 3D4OA 1O6BA 5E3HA 1C7JA 3H1FA 1Y7IA 4KO3S 4FFPA 4QU8A 4HO1X 1PLKA 2EW1A 4YQEA 1ZBDA 1THZA 1WU8A 4RS4A 4YO8A 2B98A 2BPOA 4OAOA 3F78A 5F5XA 1BW9A 3W9UA 2VJNA 4DRXB 4B83A 1GL3A 4ZZIA 1SZPA 1NLMA 4OHKA 3EP6B 4R41A 1J22A 3EIQA 3FTQA 5CX4A 4S1NA 3AV3A 4GDMA 2LXNA 2P3LA 4XQ0A 1E4YA 1K8XB 3V00A 1P2TA 3PF9A 4B85A 2V7TA 4PPGA 4TTIA 1CJBA 1LNZA 2BW0A 4Z4CA 3NVKI 3SX0A 3WB9A 2O2GA 4CMIA 4NXNB 1ULBA 1ZX1A 3R23A 4RCYA 3DEAA 2JLBA 1R4MA 3TX6A 2DZDA 3G6KA 3QMWA 4GR4A 1W87A 4LXGA 1YRBA 3RJ5A 1GGJA 6GPBA 1R6VA 1TZBA 1YMQA 2ZDQA 2XRYA 5EIFA 1XZ8A 1UPBA 1YVUA 5DOZA 4D46A 2PE5A 3T1HB 2AZ4A 3NTQA 2YHAA 3B9BA 3RRFA 4B3IA 1E1YA 4LE2A 2JAXA 3SYNA 4CIXA 1D07A 3AR9A 4GICA 3RTGA 4DQUA 4N5HX 1E6KA 2VHXA 1WZIA 2ZBFA 3CZCA 2QAGC 4LVUA 4BFUA 3O3MB 2VBCA 3P9NA 4XJVA 1IM8A 3SNHA 3FTEA 1JVNA 3CUKA 3TDKA 2H2HA 4LIPD 4QG7A 5ARBA 2RE8A 3CH6A 3V7WA 2NXJA 3S4YA 3JD1A 3K8ZA 1L7DA 3H9CA 4HDKA 3KKLA 3GPIA 4BNKA 2YVAA 3RSQA 2GN2A 3KYDB 3I83A 2OENG 4M0DA 5DTEA 4XQGA 1YCHA 1Z0IA 5KYVA 5I51A 2XCSB 4EUHA 2YJGA 4B6QA 4Y2UA 4CKCA 3IL2A 1IRXA 4LXYA 5HZKA 5FOSA 2HBRA 3DBLB 1U8TA 3GEDA 4JOQA 3TQRA 3WKBA 4A2WA 5BV0A 1DCTA 3V46A 3P94A 4DDMA 2YRFA 4QJ5A 5JAZA 1D2EA 4P8RA 3IO3A 3KOXA 3OESA 5E3JA 4TWZA 3V8MA 3I9V6 2BEVB 2PUTA 4HSGA 4L08A 1O94C 1BMQA 1DG9A 1GAWA 1MV5A 1DBPA 1V35A 3G49A 3TTYA 5CXUA 1MTOA 2DC1A 2WFMA 2VHEA 3AHDA 4W5OA 2PX0A 2W8ZA 3TNYA 4CWAA 3PDIA 2DBVO 4I4IA 4AJ2A 5IP5A 2OZLB 1G9SA 1V26A 3CX4A 1EDDA 3C70A 3IP5A 2UZ0A 3K30A 4JEHA 3CNNA 3F5QA 2GCOA 3QU4A 5EJ4A 1QOZA 1K6MA 1MJHA 1YNSA 3DL4A 3P71T 2B82A 4LRSB 5ERYA 4D92A 5DHUA 5J23A 3AB8A 4ROTA 2FB9A 1T25A 2MWMA 4K6FA 4Q7EA 3OTHA 4ALLA 3I9JA 1EVIA 2VJPA 3IIJA 5BYKA 5KTOA 1LI7A 5HCUA 5KTPA 1Y4AE 5DASA 4NCKA 1GPH1 3COYA 3MN1A 3E22B 5BN1A 3CNEA 2FPGA 5FOXA 3RC3A 5TMPA 4YJGA 2CHQA 2O52A 3OZWA 3EHEA 3GA7A 3KPUA 1YA6A 1G19A 4KDEA 1KU6A 3WIDA 3UK2A 1TJ3A 3D3NA 4AZVA 2HJVA 2C2GA 3FA2A 4MZXA 1ZW1A 4C0JA 1UK8A 3MRSA 2CE2X 1T0BA 3MJTA 3JQFA 2GCNA 2X0NA 2I4TA 2H4JA 4MWGA 1CIJA 3KCNA 3ASUA 3GAZA 1SIOA 2A9JA 3S5UA 3UUGA 4XUCA 5A71A 1KSGA 1G6KA 5SYAA 2VYCA 1RACA 4K3UA 5B7NA 4B4WA 2D2FA 4DCPA 3EA0A 1TJNA 1X13A 1R8QA 3Q1LA 1JKXA 4FFMA 3L1VA 3OZUA 4KBGA 3KJEA 4TWIA 4BKQA 5C4GB 4CM4A 3U6BA 4R8SA 5TJHA 5BMVB 4GZ6A 3L0ZA 4HQOA 4R0VA 5TF4A 1CUDA 1QHHB 1TCAA 3W79A 4OL0A 2FRDC 1PJ3A 4QYWA 1BE8A 3DFKA 5T4BA 5J47A 1SUWA 4RIGA 3FDFA 3VHQA 1JHQA 4K9MA 1UAAA 1TT7A 3KLPX 1ZLYA 3GDOA 2NU9A 3P9PA 1S1MA 4MAMA 2ZITA 4RKWA 3WJ7A 2JNWA 3U9SA 1FFHA 1M0EA 4HVLA 1FDSA 4MV6A 3TLKA 3EF1A 3C3BA 3ZJXA 4MGHA 4C0SA 1NXOA 3LO8A 2X19A 1JVBA 4MHSA 3AVOA 2PMEA 5K3EA 1WCIA 3GLQA 3NH9A 1KERA 2WUWE 1YAHA 4H17A 4MKRA 4BB9A 1PR1A 3QEOA 4GBGA 4FN4A 1DLJA 5ED0A 4LRTB 1G8GA 1O89A 5F7ZA 2PK3A 2XKJE 3LWBA 3GMSA 5TPWB 5H7XA 2J6CA 1PR9A 2P1RA 2PQ2A 1MW9X 4HH0A 7ADHA 2AYXA 4J3FA 3AY7A 4BNFA 3QX3A 2C42A 2WJAA 4FOOA 1UZNA 1ZN7A 4QPNA 3VR2D 1FU7A 1JR2A 1Z0AA 2ZAOA 3QKUA 2X6QA 2EWVA 1OAKA 3W8NA 4BZQA 3CUTA 2QRVA 4OQZA 4MW6A 4TLEA 4CKXA 4CTOA 1S3GA 3DL0A 1IZ7A 2V8OA 3T35A 3UHAA 4C87A 3EXEB 5ALOA 4BLOA 3FD8A 1D04A 2WF7A 4GRIA 4Q1FA 3IDFA 3IAXA 3Q8XB 4HMOA 3T7KA 3UJCA 5CYGA 3ZDXB 5B6IA 1P2FA 4JHXA 3RYCB 2HU7A 2I65A 3ZDFA 1A71A 3C7TA 3OUTA 3PNLA 1W4ZA 3OEEA 3PUXA 4HNRA 3Q8LA 1U5BA 1OSNA 1D1SA 1J25A 2RK6A 3DEFA 3N6XA 5C8XA 1TZCA 3AU9A 4QHYA 1GPJA 4YRFA 3S27A 2ZS9A 3DL7A 4GT1A 3P0HA 4EF5A 1P8JA 4LFBB 1S4MA 1J8DA 1ZR2A 1MXFA 1U1IA 2WM2A 1TO6A 4ZGBA 3WQBA 5KOHB 3FB1A 2IPAB 2W2XA 1DDGA 2IZZA 4W8HA 3GZJA 3IDZA 4M7OA 2E1PA 4XOUA 5BT8A 1T5DX 1SJ9A 3V4RA 3TF5A 5A6SA 3HFJA 4ZREA 1SQSA 3VPBA 4IJMA 1QIGA 4K6GA 3GU3A 4J6EA 2I1LA 3I1YA 2PGOA 5THKA 5FWXB 2IXGA 1XLVA 1TOAA 3CU5A 4AG5A 2CLLB 1EGVB 1JBQA 1YQ9A 3QKIA 1RI2A 3TD2A 5AICA 5AIAA 3SEAA 1Y3DE 1I2ZA 2H7YA 4D4MA 5LM3A 1DC7A 4H7IA 4AZ3A 3E1KA 1HOXA 4LSMA 4OHWA 2VK1A 1U2ZA 5CLGA 3DONA 5DSTA 1SC3A 5AVVA 3LZCA 5HVNA 2IV2X 4B5KA 4GXQA 4BWGA 1R6AA 1JF8A 1AN0A 4A0HA 2RAFA 4MWBA 3WK7A 1C2TA 3K0EA 1R6UA 2P3SA 3CYFA 3T9DA 3ZXUB 2QORA 5L51A 3ICOA 3FOWA 1LCIA 4WN9B 2P9CA 1DBIA 4BX3A 4YMHA 1WPXA 1UC8A 5EWLB 1CUYA 1EXWA 1I2CA 4BCCA 4GQBA 2JAQA 4ZEVA 4M53A 2AI1A 3UWDA 1UBEA 1XMQB 1UPTA 1ZG3A 1MGOA 1CTQA 3U7QA 2J5KA 5F52A 3EPHA 1DWPA 3F5SA 3WYDA 5IJ9A 4L6IA 1ZAKA 3NKFA 2H3EA 4P08A 5DHAA 1VDZA 3AKEA 2V7PA 2Q41A 3EQZA 5SZHB 4ALNA 1BC5A 2O0HA 4U0JA 4UM9B 1MKYA 4G1VA 1T35A 5JSKA 4A8JB 5EKDA 1IONA 2QE6A 1XMXA 4EG4A 2XAUA 1OV4A 3JQPA 3GEHA 4FEGA 5DM70 3F98A 4BO0A 2Z56A 1Y6QA 2PQMA 3KQVA 4XCVA 5J2TB 4P0PB 3Q9SA 2HMTA 3OFNA 5C8YB 1B1AA 2NYUA 3O90A 4DDHA 2PL9A 1C30B 3A3YA 5B1YA 4KE8A 5JZVA 5BVHA 5BVGB 5GGXA 2AZDA 3G0CA 3QVMA 2P9JA 2VK4A 5JNLA 1FFDA 2WYHA 2G5CA 2J7PA 4FLFA 3NANA 5C31A 2OV3A 1ECLA 2NVWA 1C29B 1V8PA 3C7KA 1WULS 4KW7A 2H0QA 3ZWMA 2GK6A 4I55B 3UMFA 4EHLA 2J3IA 3A10A 4S3MA 3I9V1 3O4FA 4NWIA 2W70A 4I1YA 1QGDA 2AQ8A 1M72A 2ZIZA 4O2AA 3A9SA 3M1IA 2GZDA 3KNZA 2Q46A 1QIJA 3D4BA 2WFLB 1YAJA 2IT1A 2PVCA 4FYIA 3JCZA 3X2SA 1RM3A 1JAHA 1QKIA 3HBLA 4MA5A 4DILA 1RM0A 3EJWA 5FYQA 2XQGA 2C94A 2J9GA 1P0QA 1RRFA 2WILA 4U63A 3DDWA 4V1CA