1PU2A

Crystal structure of the k246r mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
371
structure length
356
Chain Sequence
MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWRGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title The role of substrate-binding groups in the mechanism of aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
total genus 112
structure length 356
sequence length 371
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1pu2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pu2A01
2NVUA 4E13A 4HBGA 4XYLA 5FI3A 4XGNA 1Y5MA 5C7OO 3FTPA 4J6FA 2WD8A 3DEYX 2NQTA 2EKLA 2Q1TA 5EESA 2J6IA 1I2ZA 4PRKA 5DBFA 1LDMA 1V3UA 4TVBA 3WICA 5K9ZA 3ZHZA 4CV2A 5KTKA 2DBQA 3F4LA 3K9QO 3B6ZA 3QHAA 3SC6A 1DLJA 1IUKA 2ZTUA 3WSWA 1GZ6A 1G6KA 4E5NA 3TZCA 2H63A 3Q1LA 1FDWA 2PZLA 4MO2A 2AG8A 1HEUA 3WGYA 1U28A 3TZKA 4I1IA 1I5RA 4PLVA 4XB1A 4DC0A 3AUSA 1NASA 1IPEA 2YV3A 1A27A 4B7UA 2GASA 1VL8A 3L4SO 3JD4A 4HY3A 3QVWA 1EZ4A 1V8BA 5JYEA 4RZIA 3FBGA 5I9MA 4BNWA 4KQXA 1PJ4A 3PIDA 4IQ0A 1YBVA 3Q9NA 3IUPA 3M2TA 5TC4A 4D42A 4MKZA 5L53A 2D0IA 3O4RA 1XA0A 3D64A 4YQYA 3PJFA 4CM6A 4E2ZA 5BNTA 3NKLA 3BTUA 4KUHA 1HDOA 1GU7A 1ZMTA 2EERA 2VWGA 4UVEA 1LSJA 2J3JA 4ALMA 4DREA 1ONNA 2P9GA 2Y1EA 1ULUA 5AVOA 5BSHA 1PJ2A 1HYHA 2DPHA 2D3TA 3LF1A 4ZQFA 3IAHA 3DOCA 1DJQA 1R0KA 4CMEA 3KSZO 1I33A 4WE3A 3IQDB 2AMFA 3INRA 3UGKA 3HUDA 5CEEA 1V3TA 3PLNA 1F06A 1NR7A 3LC2O 3LC7O 4Y9DA 4F6LA 3P2YA 4CLRA 2GO1A 3RFXA 3T4XA 5JY1A 1SC6A 1MGOA 4CM4B 4FQ8A 4H3VA 1WLYA 1WDKA 4YAEA 4RJTA 4ND5A 1H5QA 1LXCA 2X86A 1EQ2A 3JQ9C 3NDIA 3GNQA 1PTJA 1HDCA 1TI7A 3NT5A 2UUOA 3ZW8A 1QLHA 2WYVA 7ADHA 2FHSA 3CTMA 1BDBA 3FNFA 4YTEA 3TZHA 3H4VA 4I08A 4N7RA 2E6UX 4JBHA 1B0AA 3DTYA 1VJ0A 4EEXA 1W73A 4ID9A 4RLHA 3TL3A 3K2BA 5BNFA 1LDEA 4J3FA 4W9NA 4DBZA 2Y1DA 1UZMA 3LYLA 1XDWA 2J3IA 4D43A 1SNYA 2VUSA 1EMDA 2VRBA 1XR3A 4CODB 3PYMA 5IDQA 4O63O 3CZMA 3F1LA 3L6DA 3JD1A 4OM8A 3WG9A 1KYQA 3F5QA 4YAJA 3PWSA 2VRCA 2GPTA 4HFMA 4O0LA 1LBEA 4BNJA 3ONEA 3KYDB 1P1IA 1ZW1A 4WLUA 3BXXA 4E33A 4DRYA 4ZRMA 1JKJA 1ZIDA 4K6CA 1EE9A 1U2DA 1GQYA 1KEVA 4TROA 3IC5A 4WUVA 2B69A 5HWSA 1TT7A 5T8KA 5L51A 3PHGA 2ZB4A 1K3TA 3HHPA 4DIFA 4HFJA 1X1TA 3INGA 5M6DA 3GUCA 3QIVA 4J2OA 3ZWVA 1HDRA 4RPHA 5JBIA 4Y8VA 5THKA 1PQPA 4EZBA 4IIVA 4XJSA 4P4LA 4FJ0A 4MJLA 4MDHA 4GGOA 2O3JA 4MVJP 1D1SA 4BKQA 1UUFA 4XD2A 1VL6A 3TN7A 3IKVA 2JAPA 2CF5A 3RUAA 5A1TA 2WM3A 5IFLA 4E0BA 4PG6A 1MG5A 1WMBA 2GRAA 4XDYA 5CPFA 3PHIA 3NTRA 3LT0A 4UVGA 5K0ZA 1PJQA 2GZ2A 4DIBA 1MLDA 1UZNA 1CQJA 2Z5LA 4FR5A 3K8ZA 3RI3A 3ZHBA 3DMTA 3HDJA 4IJWA 1OBFO 2PGDA 4DUPA 3WYCA 3O8QB 3HFGA 4RCVA 1VL0A 4TRJA 4FOOA 4II3A 2JD0A 3GG9A 3PI7A 3IP1A 4FPXA 3PZBA 3BTVA 5H83A 2HMVA 4C4OA 1W6UA 1PSDA 3OIGA 4A73A 4YT2A 5FEUA 4P4NA 1E1MA 3GRKA 2Q46A 4QQRA 1GR0A 3WFJA 4MVJG 4D3DA 1MXHA 1YL5A 1ARZA 1P45A 4AJEA 2W2LA 5TIIA 1OC2A 4H15A 5CG1A 1ZH8A 1ML3A 4I5FA 1LJ8A 2Q50A 4RVUA 3ONFA 4YEDA 4JCOA 4R01A 4E5MA 3ZDFA 2PK3A 5KJEA 1NNUA 1B15A 1QORA 1P31A 3GDGA 3QY9A 4J9VA 3ONDA 1ENYA 1CF2O 3WJ7A 4RPGA 4WLVA 1U3TA 3ZU3A 4EGFA 4BO5A 4I5EA 1QYWA 1GYQA 2QHXA 1KETA 4Z9YA 2VOJA 1T2AA 2PLAA 3UVEA 3HDHA 1B8UA 4DXHA 1R4NA 3C7CB 1YJQA 5I8ZA 2PY6A 2GERA 2V7PA 4Q3AA 1PL8A 1XU9A 4D44A 1NPYA 2QZ9A 2B4TO 1H6CA 3ITKA 4J4TA 2HAEA 2VYNA 4GLOA 4IJUA 1J6UA 4Z9XA 1YXMA 3UICA 2Q1SA 4RGBA 2ZYGA 5CP8A 3AUAA 5JXWA 1PZFA 2O50A 4OSOA 4FSHA 3R3SA 2GN9A 1XELA 1GFSA 3WWYA 9LDBA 3DL2A 1AXGA 2AEJA 3DAFA 4GH5A 3RJ5A 1GZ3A 3JQGB 3ETGA 3CEAA 1P74A 1MUUA 3GDOA 1XCBA 3R0IA 4PLCA 1C0LA 1EFLA 2PNFA 2O4CA 2Q22A 1NFQA 1LU9A 4A27A 3RUHA 1YBAA 3I3OA 1I0ZA 1LDGA 4EJMA 3QVSA 4PVCA 3GN2A 3RASA 3A28A 3TL2A 3RBVA 3OJLA 1K0UA 1HZZA 4PZDA 4BO4A 2PWZA 1XWFA 4DGSA 4CM8A 1JVBA 3KV3O 4QEDA 2C2XA 4J91A 4B4OA 3RVDA 3SVTA 3C8MA 2GN6A 4R3WA 5MGBA 4MP3A 4LMPA 1ZVMA 1DC5A 3FF4A 4YBZA 4N18A 4FDAA 1QRRA 3AI3A 2QQ5A 1JAXA 4YT8A 3AI1A 1YL6A 5KVQA 2JHFA 4RL6A 2OGUA 4ZQEA 3WMWA 3ZW9A 5L7WA 4PCVA 5L9AA 4Z0TA 2W4QA 1NPTO 1DDOA 3OQBA 4J7XA 4H16A 4AJHA 2EKPA 4R5HA 2DM6A 4PLWA 1HF3A 2VWPA 3EVNA 3ANNA 4RZHA 1MP0A 3QVOA 3D0OA 4YQZA 3SX2A 3H2ZA 3RU7A 1X13A 2QRJA 4AJJA 2RH8A 2NM0A 5KJFA 3ZV4A 3EW7A 4CMBA 4BNVA 2QRKA 2A92A 3GK3A 3CINA 4OGWA 3VVBA 4HFNA 2FPGA 2UYYA 4E2WA 1DC3A 2P2SA 3LQFA 1AUPA 2Y0DA 2Y1OA 4CM7A 1EUCA 3CH6A 3CSDA 2WMDA 4GKBA 3E5MA 3G3EA 4RDIA 2B83A 2IXAA 5CAEA 1BGVA 2B5WA 3KRTA 3PVZA 5G0UA 5IZCA 5I7FA 1MX3A 3W8EA 2ZK7A 3GRPA 3NUGA 3C1AA 1E92A 1UR5A 3PPIA 1HKUA 1CJCA 1MG0A 3RC7A 1KIFA 4KDFA 5GZ3A 1QR6A 3TSCA 4FGWA 2NV6A 3MWDB 1G0OA 1JKFA 3DQPA 3JTMA 4I9NA 3FPCA 3U3XA 1ISFA 3PRJA 2WYWA 4TVOA 4XR4A 4FCCA 5C7IO 4J43A 2ET6A 1YB5A 2W90A 4BO1A 3M1LA 1LDNA 2Q1UA 4Q3NA 1DIGA 1N7HA 1WXDA 3S55A 1M75A 3Q0EA 5U9CA 1B16A 4XB2A 1HYGA 1JWAB 1CDOA 1Z6ZA 5TT0A 1EQUA 1X0VA 4ZHSA 4Y67A 3DBLB 2Q3EA 1J4AA 3QW2A 3HB5X 1Y8QA 1A9YA 2AE1A 5A9RA 2JCVA 4WEQA 2PGJA 5JDIC 3VH3A 4FBGA 2VRCD 4OJNA 2BELA 4RVFA 2C5EA 2ZTLA 5TRTA 3F46A 4J1QA 1QYCA 1YGYA 4J1TA 3ZZNA 3OECA 1CERA 1X14A 3E5RA 2GZ3A 1TT5B 3PQDA 3WGGA 1K5HA 3KEQA 1RM4A 4FC7A 1QLJA 1Z74A 1W8DA 1I01A 3JQ9A 4KMSA 4MP8A 4OHUA 5ER9A 3WBFA 1GQQA 2ZTVA 1EBUA 4BGUA 5L40A 4EITA 3RC9A 3OMLA 4OAQA 3X2EA 3H9GA 4DQUA 4LSMA 1YWGO 1EE2A 1FDVA 3OH8A 2Q45A 1F0YA 1P1FA 1R0LA 3U09A 4W82A 3RIHA 4DPMA 1A7AA 4CQLA 4E5KA 1RWBA 5FYDA 1LRKA 5JAZA 2VQ3A 3JQAD 2I9PA 2P5UA 1SCUA 5AXBA 2O2YA 4CLDA 1I3MA 3DZBA 3I9MA 1KEWA 1D3AA 1LLQA 1XU7A 2H5LA 2CMDA 5KIAA 4A10A 2O3QA 2Q2QA 3KSDO 2YDXA 4CMAA 4DPLA 4K28A 5DZSA 3GPDG 1NBOA 1YBMA 4WLFA 1O0SA 2JJYA 4OMUA 5TJ9A 5I9NA 2OHXA 4XQ9A 2Y0EA 2VTEA 5A3JA 5K6AA 4EBFA 1R4MB 1NP3A 4XKJA 3VPGA 5KOIA 1CEQA 2TMDA 3FWZA 4HKTA 5DOZA 3ZN2A 4B4WA 2RCYA 1YJ8A 3BA1A 1GUYA 4QFCA 3GUYA 1M67A 2G82A 1U7HA 4QSMA 1DIAA 4NR0A 4BO2A 2CY0A 2F00A 1KOLA 3U0BA 1O8CA 1V35A 3DBRA 4JGBA 3CMCO 3EHEA 4ALJA 2HQ1A 1EVYA 2W2LD 1F17A 3DONA 4FFMA 2OOSA 2PFGA 1X7HA 1IZ9A 4IUYA 1P0CA 6LDHA 3PDUA 3E9MA 1H6DA 1YE3A 3JYQA 2EJWA 3ZWOA 3P19A 3ZU5A 1ISMA 4ZU3A 2FWMX 1ID1A 3L4BC 3UFXA 1Q2XA 1Y8RB 3BMCB 4AG3A 1JN0A 1R66A 3ZI0A 2YV2A 4R69A 3ZNQA 2B35A 3VZRA 1JU9A 3RROA 4ZJUA 2UUPA 1CWUA 3PXXA 4XIJA 4XZ3A 3HQ4O 1YONA 2GDZA 3F47A 1SBYA 2J5RA 3KLPX 3UUWA 4G2NA 1T1RA 4IS2A 5JAMA 1MC5A 1TB4A 4FFLA 4P4GA 1UDBA 1LX6A 3GVHA 3I6QA 2IE0A 1OZAA 3AK4A 1DXYA 4R68A 4ALKA 2YDYA 6ADHA 4L73A 1LSOA 4M87A 3OQ6A 5KJ6A 4A03A 5A9TA 3JQEA 2H9IA 3M2PA 4BNZA 2VYND 1EVJA 4E2YA 4N5NA 4XGKA 1KEPA 4YACA 3L07A 1E0DA 5LDGA 4IIUA 2YZ7A 3ROQA 5EERA 5DP2A 2YUTA 4ZQGA 3AUTA 4DLLA 3HWRA 4BV8A 2Y1FA 1DC6A 3AM5A 4QFDA 4XEHA 4NIMA 4E31A 4CL3A 1P1HA 1NQOA 2FZWA 1IHYA 3KTDA 2OO5A 2NWQA 3AOEA 1KC1A 1XG5A 3AJRA 1EFKA 4GVLA 1XIVA 1HE2A 5EINA 3BTSA 1PWXA 3VHRA 1I8TA 2X5KO 2YQ5A 3LT2A 3OSUA 3TZQA 2V6GA 3ZWAA 1PJ3A 2DAPA 3W6UA 3E03A 2C07A 1MA0A 3BMOB 3GZNB 1ZXLA 3KYDA 5GZ1A 1B3RA 4XRGA 4GL4A 1ISHA 1F8GA 4IDFA 1ZK3A 2RHCA 3ZWWA 3QQPA 4NU6A 2HKIA 1UXIA 3SLGA 2BFMA 2YQ4A 5CDGA 3I4FA 2WWRA 5IXYA 1EDZA 1K6XA 4GX1A 3WGOA 2NSDA 4B3IA 4P8RA 2IRWA 4LW8A 4XYGA 5A06A 2VUTA 2Y93A 1DFGA 3QP9A 1EEHA 4CR8A 3D4OA 5C37A 4OIMA 3MZ0A 3H3FA 1NAIA 2Q49A 1DAOA 3ADOA 3JQDA 5DCYA 3EZYA 3KLMX 3KXDA 1U5CA 2PD6A 1MB4A 2I6TA 2OP0A 3GLQA 4R1UA 2R2GA 5COAA 4DMLA 3QLJA 4BNLA 4LVCA 3VVCA 1C3VA 3WTBA 3INTA 1A5ZA 4BKRA 4L9RA 5BSGA 1GYPA 3ITDA 5FI5A 2BGKA 4UREA 4A26A 1HE5A 3ICPA 5F5NA 3U49A 3VKVA 4EUHA 4OYRA 5CPBA 2X9VA 2VHXA 4JP3A 3LF2A 5G0SA 2Y67A 1VM6A 1HZJA 3U9LA 1LC3A 5H81A 5G0VA 3TDKA 2O4UX 1E6UA 4ZVVA 4XQCA 1PZEA 1TEHA 5H82A 3DZGA 4AL4A 2WEKA 1D8AA 1VRWA 1UZLA 3IIEA 3RKUA 3S1LA 5A4DA 2DBZA 1ULSA 2Y68A 4BNTA 3AY3A 4CMIB 5B4VA 4WEOA 3OJEA 3WS7A 2X0JA 1KEUA 1X7GA 5JDCA 3QWBA 2WDZA 3TFQA 1PU2A 3ZWBA 4WECA 3EK2A 1UXJA 4XA8A 1BXZA 4HV4A 1P44A 3K2EA 3PYXA 4YJGB 1PGPA 1UP4A 1HETA 2Q2VA 4GSKA 1Y81A 4AICA 4ILKA 4QO7A 3QWFA 4BUCA 5ICMA 1HLPA 3K6JA 2VN8A 5BNIA 1WVGA 5COQA 4XQGA 3MJCA 2VZ0A 4NNJA 4YJHB 3ASUA 1WAMA 5DN9A 3ZHXA 1SEVA 5DBIA 4NJMA 4RF2A 4JXKA 3Q6IA 3C3XA 3O03A 4BNKA 1E7QA 4W6ZA 3JYPA 3SBOA 1WP4A 3VDRA 3WIDA 4DLBA 1OOEA 5AXCA 2I76A 3UXYA 3AY6A 2PD4A 2JKVA 2HSDA 4TKLA 3NX4A 1ONOA 1DRVA 4W4TA 3D5QA 3FHLA 1BMDA 3CZRA 1Z45A 4R9SA 1LA2A 3ETEA 3E48A 3JQFA 3KM0A 5L4SA 3BAZA 3HE3A 4M8SA 4ZQHA 4TSKA 4HNHA 1EBFA 3W6ZA 5CDSA 4OL9A 2BHLA 4YYZA 3DOOA 3FSRA 2GLXA 1H2BA 4JJGA 3E6AA 1QP8A 3WTCA 1E1KA 3AFMA 4NK5A 4E32A 5KJCA 3VTFA 2CDCA 3IOYA 4GGPA 3KSUA 4GMGA 4YB8A 3VH4A 2X23A 2DPGA 3JQGA 3IJPA 1KY5A 2FR1A 1X1EA 4M89A 1BTOA 4PG5A 1C0IA 1ZK1A 4ZGWA 5JAIA 1KVTA 1K2WA 3RD5A 4B4UA 3IDSA 4FD3A 4MKXA 3HFSA 3D4PA 5DBGA 2Q2WA 1Q7BA 1NQAO 2X0RA 1FJHA 1NAHA 4IDGA 4M54A 4QTZA 4O5OA 2YHUA 3G1TA 2NACA 3Q11A 5THQA 4CLOB 2I67A 4J9UE 4DYVA 4FIZA 3SEFA 3VH2A 1U4OA 2WE7A 4OKNA 1I3NA 2A94A 1AHIA 1PS8A 4IDEA 2C29D 3UCFA 1A4IA 2G17A 4RF4A 2P4QA 1HDGO 4L0QA 5CEFA 1E5LA 3WQQA 4DQXA 1ZKMA 4ND3A 3RBXA 3D3WA 1DC4A 4NJOA 4AJ4A 5BT9A 4BS9A 5IZ4A 1KY4A 3JQ7A 1HDYA 1H2HA 2BFAA 5G4KB 1BXGB 2EGGA 4AJKA 1E3SA 1M76A 1TLTA 2VTDA 2VT2A 2CDAA 3WBBA 4Q3CA 3VAZA 1A7KA 2P5YA 1E1NA 3DFUA 5A9SB 1KC3A 1BSVA 1I3KA 4R54A 2HK8A 1EK5A 1U3VA 1DEHA 3F5SA 2AE2A 1B2LA 2VHVA 3EYWA 1A72A 2J8ZA 3QVTA 3ZHYA 3DBHB 2D2IA 3V2GA 2JHGA 3I23A 4RPKA 4IJKA 4OOEA 5JAQA 2Q99A 3KYCB 3I5MA 2HJSA 5JCXA 4JIGA 1DSSG 2G5CA 1YB1A 1Y1PA 1S7CA 1U1IA 2AA3A 5IXSA 1EUDA 3PQFA 1NQ5A 1GPJA 1I30A 2ZQZA 4IMRA 4M49A 5ILGA 5AQ1A 3ZH2A 2YY7A 1DO8A 2HDHA 1I10A 4PLHA 2OBNA 3WQRA 2DTDA 3RKRA 2AEFA 4A2CA 1UP6A 1DFHA 1PJSA 4TZTA 1KBZA 3UN1A 1QYVA 4R5MA 4XX0A 2EP7A 5JPIA 4XJTA 2EHDA 2X7HA 2FR0A 2X0NA 2B0JA 2EG9A 2J3KA 4HX5A 4YXFA 2DLDA 1BW9B 2O3TA 5B4TA 4BMSA 1VSVA 1M6HA 5TSDA 2VYVA 2AHRA 3FRJA 3D5TA 3K30A 2GGSA 3DBLA 5JO9A 3HN2A 1PGQA 3DWFA 1U3UA 1DOHA 3W4IA 1GEEA 3I1JA 4E30A 1S6YA 3PJEA 4GI2A 4Y6PA 2D1YA 4KDEA 4BNUA 1BXKA 1H94A 1SB9A 1YQXA 3M1AA 3JQBA 4MP6A 3D7LA 3QE3A 4P38A 3IMFA 1Y9EA 2ZCUA 1E6WA 3COSA 3LT1A 3WIEA 4GSLA 1EUZA 3WOHA 3X2FA 5AXAA 3DHYA 1VI2A 2QW8A 4ROSA 3B1FA 2NVUB 4BL5A 2PKQO 7MDHA 5HTOA 3BMQA 2ZQYA 2OL4A 3DZHA 3U5TA 3RU9A 4KTVE 1N2SA 2Q4EA 4NDNE 4PLFA 3ANMA 4TRMA 5JC8A 3P7MA 1A71A 2Y05A 2CUKA 4JROA 3LU1A 4FFNA 4GWKA 4NK4A 1UXGA 1LUAA 4TRRA 3V8BA 3FNEA 2R00C 1B26A 3QJ5A 3RQSA 2XF8A 1J49A 5HM8A 3EVTA 4DWVA 1IOLA 2X22A 4BB5A 4D7AA 3I9OA 1P3DA 4JBGA 2X8LA 1O94A 1Y6JA 5I7SA 1JA9A 1U7TA 4RVDA 3WSVA 1WPQA 5HS4A 2E49A 3BHJA 5A5EA 4A5OA 1NFRA 3V1TC 3PHJA 1VE9A 4WCDA 2X0IA 1PJTA 4IDDA 2WSBA 2XXBA 4RORA 4YJFA 4BO7A 1IL0A 3PJDA 3P2OA 4I8XA 1YRLA 1L1FA 3TOXA 3TOZA 4J0FA 4WLOA 3ENNA 3GAFA 2HK9A 4J7CA 1TXGA 1V6AA 3DAGA 1XQ6A 3K5PA 4WASA 1L7EA 5F3RA 5KKAA 1TA4A 4Q39A 2BI8A 3ROKA 4GLLA 1MFZA 2PKQP 4YWJA 1PWZA 4RPJA 4TKMA 3F9IA 3HG7A 4AJPA 2NU7A 3MJTA 2YJZA 4OXYA 1NPDA 4ZA2A 2QYSA 4UVHA 2GUGA 4IMPA 3ZGYA 1X0XA 4CMHA 3KO8A 3JYNA 3L77A 4NU5A 5BSEA 3AU8A 3CE6A 3TFOA 3HB4X 1E7YA 3BYZA 1H9AA 1IHXA 2CZCA 3O9ZA 1Q1NA 2IEBA 5G2OA 4EDFA 2GSDA 1C1DB 4AFNA 2G0TA 2ZATA 3KETA 2GR9A 5ADHA 2OUIA 3F3SA 1WZIA 3CXRA 2IZ1A 3H9QA 5T64A 4BGVA 1PGJA 5DDIP 2O3RA 2GCGA 4IJVA 5DCUA 1CYDA 3KBOA 4K26A 4E6PA 5A02A 4OKIA 2JL1A 1YH3A 3BZUA 5JCJA 1RM3A 3VZSA 4IGFA 3WYBA 1SO8A 3NJ8A 1LDYA 2A4KA 2AQIA 3GVPA 2FSSA 1YOVA 2AW5A 3V1UA 1UAYA 3OJOA 5EQFA 3HN7A 3H5RA 1ZCJA 1HE4A 3VZQA 4E21A 3H5NA 1VSUA 4R3NA 3W4JA 1A9ZA 1PJCA 4OXNA 3E1KA 3DZIA 2DUUA 3RUIA 4O6VA 1N5DA 4BGIA 5KKCA 4EEZA 1UP7A 3FCOA 4BMVA 4AJ2A 1GCOA 1YVEI 1ADCA 2V6MA 3OETA 3IP3A 1RYEA 2RAFA 3DOJA 3RFVA 3DXFA 4UVIA 1HSZA 5L95A 2ZIZA 3QWHA 1C0KA 3GR6A 4U0JA 4J1NA 1QV7A 1U9JA 4PN3A 2QYTA 3K92A 1T2FA 4TMFA 3V2HA 5JE8A 4IM7A 3VH1A 3WB9A 3NJ4A 1I2BA 3SJ7A 3ZWXA 4GKVA 3GEMA 5JYDA 4PIVA 5TNXA 2IEDA 4B7XA 3BMOA 4J0EA 4BB6A 4YR9A 5F1OA 3JQAB 4U8GA 2JAHA 4JLWA 4XRRA 2P68A 1W0CA 4DA9A 5T57A 4FOSA 1SEPA 4D0RA 3AM3A 3TQHA 2YHIA 1G0NA 2DUWA 2UAGA 4RVGA 2Y1GA 3GFGA 2ZTMA 2DC1A 4BNMA 4BIIA 4GAEA 5F1PA 3P5SA 1N1EA 2EV9A 4ZRNA 3GMSA 3NT4A 3D3EA 4N5LA 3OJFA 3AW9A 2Z1MA 3BHIA 1XHLA 3GHHA 4YRAA 1WDLA 1PR9A 3OBBA 4J16A 3GMDA 2E37A 4RV9A 5DCWA 1AE1A 5EL0A 4B79A 4CUJA 4UUOA 1FK8A 4OO3A 4BV9A 2PZMA 4Q9NA 5HA5A 1ZJZA 1HSOA 1ZJYA 1DIRA 1N8KA 4R41A 2AQHA 2NU9A 1N9GA 4CMEC 2ZJ0A 2P91A 3UKOA 4M1QA 3NTOA 1DIBA 3GOHA 3HDQA 4X54A 1L7DA 2P4HX 2J5QA 5ENDA 2VUUA 4JNKA 3I52A 4HXYA 4I9HA 3IS3A 4TZKA 3UF0A 1NYTA 2OBYA 4CLXA 3GVCA 2SCUA 2ZKLA 3PP8A 2BD0A 2OP1A 3ENKA 4HNGA 2GF2A 2WD7B 2RBEA 3VPXA 1T4BA 2CNBA 1QYDA 4IBOA 4LVUA 3RC2A 4MVJA 4YT5A 2YFHA 3N58A 4OSPA 3TRIA 3VZPA 3ZV3A 1PJLA 3HJAA 2EEZA 3I6IA 2A9FA 4CMIA 1UH5A 5TJHA 1ISJA 2CF6A 2PZKA 1LSUA 2GZ1A 4CV1A 4W9NC 1NR1A 4RVHA 1T2DA 3R3JA 3ZWCA 5IG2A 3RJ9A 5EPOA 2UV8A 2ILTA 3ZU2A 3SJUA 2V6FA 1H0KA 4BKUA 3JQCA 3WGIA 1LRJA 1PS9A 4KQWA 3QWAA 2HRBA 1ZFNA 4FFPA 5JYAA 4YJHA 3N74A 2HCTA 2VYVD 4ESOA 4YCAA 4AVYA 3PTZA 4WOJA 5I7EA 1V3VA 1GL3A 1XLTA 4OH1A 1AXEA 4NBUA 5T73A 1P9LA 3GF4A 4JJIA 4DVJA 3FNHA 3C7AA 2RH4A 3GY0A 1RM0A 1HDZA 3OJ0A 3OP4A 4DQVA 4YAKA 4MVJI 3JQ6A 2W2KB 5T8KC 3L9XA 4PG8A 1IYZA 1T2EA 1AGNA 2HRZA 3RUFA 1PIWA 4FN4A 1CRWG 1QSGA 4WGGA 4DLAA 4WLNA 3GA0A 1SOWA 4GBJA 4QX6A 3U4CA 3ZNNA 5ITWA 1NM5A 4I5DA 2E82A 4URFA 1NXQA 5FWNA 1O5IA 1XEAA 4PLYA 4IDAA 4GVXA 5G4LA 4NMHA 4F46A 3ABIA 1UAGA 2DFVA 1ORRA 3RUEA 2WYUA 4RF3A 1PJBA 4E4YA 4MIYA 4D45A 4CM8B 2LDBA 3IJRA 3O38A 4NH4A 1ISGA 1F12A 2EJVA 4L4RA 5ES3A 3UH1A 4MINA 1P77A 3GC6A 1E7MA 2I3AA 4AJOA 3DMTC 2OZPA 3HDYA 4XGIA 1H93A 4B3HA 1QG6A 4C7JA 1I24A 3S8MA 2UDPA 4CM4A 3DTTA 4BQPA 1E77A 1O6ZA 2NTJA 4GPD1 4PVDA 3BTOA 3ZU4A 3MJEA 4AJ1A 5AOVA 2WJPA 2IODA 1ONPA 4MPDA 2BMAA 4DPKA 3EC7A 3WGHA 4CQMB 1IE3A 5GZ6A 5IF3A 3MEQA 4NQZA 1E3WB 1GY8A 3ASVA 2Z1NA 3FWNA 3G17A 1GEGA 1SAYA 3W1VA 5L4LA 1R12A 2FOIA 3C24A 2QIOA 2YV1A 3H5AA 2R00A 4RVSA 1SPXA 3OIFA 4WCFB 2G1UA 1B3BA 3V1YA 2H6EA 3BMNB 1LRLA 4LN1A 3NV9A 3MJ4A 4WNIA 3A1NA 5G4KA 1BXGA 2O23A 4N54A 2V6BA 5JMPA 4A0SA 2YYYA 3H3JA 3AOGA 3DZFA 4OXKA 4BO3A 5LCXA 4L74A 5ENVA 4J4BA 3PLRA 4ALNA 2JCXA 3H7AA 4QUKA 5HBRA 2IYPA 1LLCA 4Z6KA 3BIOA 4S3MA 2HMTA 4UEJA 1EK6A 3DBVO 5JS6A 3K31A 1YS4A 2GN8A 4TQGA 1ZSVA 2AXQA 5DNAA 3AU9A 1C1XB 1WDMA 1NVGA 3OA0A 4FB5A 1I36A 2EGHA 3DBHA 2IZZA 3UCXA 3C1OA 2TMGA 4BO8A 4J90A 2D5CA 4PGFA 1PQUA 2C7VA 3WMXA 3AI2A 4BO9A 3JV7A 2EWMA 3KYCA 1OFGA 1BVUA 2IYOA 2CDBA 2NVWA 1PQWA 8LDHA 3S2EA 1Y8QB 2POQX 1MC4A 4I9UA 5IDYA 4DC1A 5FF9A 2XPCA 9LDTA 1YDEA 4NHEA 1GAEO 3W8DA 4GX0A 2JFFA 1B8VA 2O2SA 4KUGA 1EVZA 1WNTA 2OORA 3L6EA 4NBWA 1DRUA 4XYBA 1Y9AA 1GV0A 5CFZA 4Z9FA 3FTNA 5ILOA 1IY8A 4RQTA 1U8FO 3ZCXA 2BGLA 1ENPA 3ROMA 4PFJA 3O8QA 1M2WA 2C5AA 1BW9A 2FZEA 1X15A 3UHAA 4CJXA 4IPTA 4IINA 2NTVA 1ZNQO 1LSSA 4S1VA 2NVBA 3JQ8B 3H8VA 3IUSA 2X9NA 5KVCA 3DHEA 5CHEA 2DU8A 3OA2A 1DHTA 2PTGA 2FRDA 3E18A 3S2FA 4WNCA 5TF4A 1IPFA 5G0TA 3CPSA 4CM5A 3LDHA 3FR8A 5DOVA 2C7GA 4MVJE 4DTIA 4CMJA 2JD2A 2P9EA 4ND2A 5I9LA 2P9CA 3VOSA 3T7CA 3PJGA 4LCEA 4CM9A 1PX0A 4KZPA 3AUUA 2O7SA 3ON5A 2YFQA 1HT0A 1JVSA 1JQBA 3ADPA 4RPLA 1E7RA 2BFOA 5A03A 4Z3KA 5HRUA 1BHSA 1T1SA 4LSWA 3MTJA 5EN4A 3H9JA 3ICCA 4EUFA 3GFBA 1HWYA 3WXBA 3STHA 1PGOA 2VT3A 4IQGA 1WWKA 3ORFA 4RF5A 4WCFC 1GUZA 1ZEJA 2PV7A 3PFFA 4E5YA 3HNPA 3OFSA 2FPPA 1NVMB 1NQTA 4UUNA 4IXWA 3ZWNA 3DBRB 4FFRA 1OAAA 1ZXBA 4WKGA 5IZCC 3G79A 1P0FA 2NU8A 2B4RO 2O48X 2C54A 2BRUA 4TRNA 5L7TA 5KNLA 1HXHA 3H9UA 1Y5RA 1WW8A 4BNHA 3RSHA 4RDHA 3M6IA 1QXSA 3NGLA 2PA3A 2GNAA 1VJTA 1D1TA 4IDBA 3KZVA 5JDIA 4M86A 1XGKA 2Q1WA 3QVXA 4MVJD 2BFPA 3EZLA 2WE8A 4CV0A 4K9DA 3A9WA 4FJ1A 1XQ1A 4AJLA 2FSVA 1GADO 3O26A 4G81A 4HP8A 4CUKA 3PEFA 5EIOA 2IZ0A 5B37A 1A4UA 3DZKA 4GX2A 4GX5A 4YPOA 3KB6A 4CM3A 1R37A 1T2CA 2VZ8A 3NYWA 2ZYDA 4J7UA 2PD3A 3Q9UA 4OOFA 5U4QA 1DB3A 5DP1A 5LDHA 2HMUA 3U4DA 1E7WA 4E12A 3RCBA 3QA9A 5F5LA 1ADGA 1R6DA 4MKRA 4JBIA 1C1DA 2X5JO 2FPIA 3DZJA 2NNLD 5AXDA 3TZ6A 2JFGA 5TS3A 4MOWA 2FN7A 5J9GA 3SC4A 4M55A 4J4HA 4BQRA 1Z7EA 3DFZA 3ZV5A 1RJWA 1LQUA 5GY7A 1U5AA 4R51A 5J23A 3ETDA 5TQVA 4K6FA 4GMFA 3V5NA 1DAPA 3AY7A 4Y6SA 2FMUA 3E9NA 3GN1A 4G5HA 3U62A 3MJSA 4YAGA 2B37A 3DHNA 4ALIA 1GCUA 2B5VA 1LTHR 2W98A 4IQ8A 2BLLA 2PGLA 3JYLA 2ZB3A 1QV6A 1O89A 3R1IA 4EJ0A 1Q7GA 1XKQA 5CDYA 5I8WA 3HADA 2X6TA 4B8WA 4BGEA 3EAGA 1DRWA 2PR2A 1J0XO 2EIHA 1ADBA 1LC0A 1XYGA 1LLUA 2QRLA 4NBRA 4CV3A 5JO0A 5K6AC 2I5PO 1P1JA 4R4JA 1WZEA 2F1KA 2VOEA 1E3EA 1UDAA 4NFSA 4U0KA 3GDFA 1Q0QA 4YT4A 1R16A 3H6KA 4EJ6A 2HU2A 5JC1A 3GGPA 3GGOA 3L4BA 1T26A 5CDUA 3JQAA 3TNLA 3UOGA 2G76A 5ER6A 1PEDA 4MIOA 5HS6A 3ZV6A 1Z82A 3IL2A 1ZK4A 1VLLA 1FDTA 4AJIA 5C3MA 2NLOA 3LVFO 3OIDA 1JAYA 2DTXA 4CR6A 1HDXA 4CMKA 1Z75A 3DO5A 1HYEA 4MVJM 3DMYA 3QSGA 4Q3EA 3R6DA 3VPFA 1B7GO 3F4BA 3ANLA 3ZNOA 3OQ1A 4J49A 1I32A 5B12A 1TT5A 2VHYA 1ENZA 1RM5A 1YO6A 2C2YA 4CLHA 5KCZA 3H65A 1T24A 2BGMA 4IDCA 4KWIA 5LC1A 3BHMA 1ZUD1 3FD8A 4PZEA 3FBTA 4K1LA 1DFIA 3L6OO 1BVRA 5FFFA 3HZZA 3WGZA 1G1AA 1I2CA 2BKAA 5IN5A 3PGXA 4AJNA 3SLKA 4W99A 3WNVA 1ENOA 1BG6A 4NI5A 1FDSA 3TWOA 4EYEA 2EP5A 2D5AA 5BR7A 4RO0A 1GPDG 4XCVA 2ZB8A 4TWRA 1NFFA 3WYEA 2WD7A 3A14A 3WGTA 4NG5A 1ZMOA 3EDMA 5TX7A 4NJMB 2I65A 4INAA 4B4VA 1LQTA 3AWDA 4QT0A 3WNQA 1QKIA 1AHHA 2QG4A 4NPCA 3EUWA 3C85A 3VDQA 4CLEA 4BKOA 3E8XA 1DIHA 3JD3A 2EF1A 4JX8A 2OFPA 4E3ZA 3ZWMA 4BNGA 2BH9A 3AOEC 5IJZA 1E5QA 1V0JA 2HJRA 3WX0A 2OMEA 4QO8A 4PG4A 4IS3A 5L4NA 4IGEA 4D41A 4KP7A 3JCZA 4UAGA 5COBA 1BDMA 3PWKA 5A04A 1R4MA 3ST7A 1LI4A 4B7CA 4JP2A 4BOYA 5KJ1A 3I9KA 5U1PA 3LLVA 2CD9A 4KWHA 3A4VA 1RPNA 4Z0PA 5MDHA 2NQ8A 3NGXA 4W7HA 4EW6A 5CG2A 1YQDA 4L4SA 1V9LA 2Q4BA 4FW8A 4OQZA 3T7EA 5I7VA 3LT4A 5ICSA 3RC1A 2XOXA 3PZRA 4LCJA 4WPGA 4A7PA 3DB2A 2ZB7A 4NFYA 4UVDA 4PLGA 4RQUA 2O3SA 1JTVA 3GPIA 1PZGA 4E5PA 4LGVA 2A35A 1ZBQA 1BRMA 4PRLA 4OQYA 2W2KA 2DVMA 3MJVA 3ZWPA 4Y98A 1ZSYA 3S2IA 4DBVO 2CVZA 4UULA 4O1MA 1GZ4A 1ZSNA 1K89A 1LDBA 1PGNA 3PYLA 1R0SA 3PQEA 4CLRB 3MOIA 1TVEA 5T6BA 2J5KA 4CM9D 4N5MA 8ADHA 4CMGA 4O59O 4BNXA 1PZHA 4DMMA 2PKRA 2CSUA 1Y8RA 4FC6A 3BMCA 1PL6A 3V2UA 2BF7A 4ONEA 5B4UA 1IULA 1UXKA 2GN4A 5BSFA 5IDXA 3JSAA 1FDUA 4ZN6A 1Q7CA 2AQKA 4CR7A 2FP4A 1OC4A 4Q3DA 1CIVA 3QV1A 3W8FA 4LRTB 3L0DA 4HADA 3KHUA 3NT2A 1SB8A 3JYOA 1GDHA 4D3FA 4I5GA 4L76A 2D8AA 3D3WB 3NEPX 3PIIA 2X9GA 5IAAA 3JQ7B 1ISIA 3WFIA 2HMWA 3CMMA 4JQCA 3DC2A 4KOAA 4YDRA 3JD0A 4G65A 3DDNA 5JDCC 5EMHA 3D4NA 1GUFA 2RIRA 4CPDA 3LK7A 1P1KA 3KVOA 4L8VA 3GQVA 4CQMA 1W4ZA 2NADA 1Z7BA 1E3WA 5DF1A 1F14A 2UVDA 4IZHA 3B1KA 1VPDA 4II2A 4HWKA 2FR8A 4FFOA 3S2GA 1QYXA 1IB6A 4NBVA 3U4HA 3WR5A 1ZK0A 2QX7A 2VCYA 4WCFA 1LEHA 1H6AA 1U2GA 5ITVA 3PK0A 3BMNA 4EUEA 1GD1O 5L3ZA 4MIEA 3RBZA 3ULKA 4U5QA 3GZNA 1VJ1A 1N7GA 5TT1A 3JD2A 4BHTA 1NWHA 2HUNA 3GHYA 1H9BA 3VTZA 4BMNA 3B20A 1HTBA 2CFCA 3GVXA 3WLFA 3I9NA 3QWIA 1YB4A 1VKNA 4GWGA 4BO0A 4DYDA 3WDSA 4BVAA 1O9BA 4CM1A 1T25A 4UUPA 1NVTA 3JQFC 4QECA 3K73O 1F8FA 1EDOA 1X7DA 1E3JA 2Z95A 3PFWO 1C1XA 4L4XA 2HO5A 3EY4A 1LLDA 2HK7A 3NDJA 4B3JA 2PH3A 1E1LA 3GNTA 1K6IA 3ZNPA 4Z3DA 3OEWA 4Q3BA 4WOKA 4XDZA 2EKQA 3NRCA 3PHHA 3Q3CA 5BQFA 1GYRA 4PZCA 1QMGA 1NX6A 5TGDA 2C82A 2ZJ1A 2DBVO 3NAQA 2Y1CA 4JK3A 4LK3A 1HL3A 4FGSA 4PG7A 4DIOA 1DJNA 3OEYA 2X1HA 2IXBA 2X58A 4BNIA 3GZ4A 3Q2KA 2ZYAA 4HFRA 4U7WA 1CETA 4F6CA 2XXJA 3HSKA 4R1NA 2VZ9A 3VKUA 5T67A 4ZICA 1FMCA 4J1SA 1Q0LA 5JW6A 1WMAA 2R6JA 2DFDA 2EW8A 1NHGA 5EJ2A 3AFNA 4EI2A 2Y0CA 4KTTE 3E82A 3I9LA 3H2SA 2DKNA 1JDJA 3BMQB 4XIYA 5JFOA 1ZZEA 4Y6RA 2DBRA 1XSEA 5GMOA 1E3IA 1Y7TA 2W8ZA 3LSYA 4YRDA 2VHZA 2X4GA 3JQ8A 3B70A 4R16A 4JN6B 4ZQBA 1YDWA 3I83A 5F1KA 1KVQA 4WK6A 1I3LA 4MVJH 1FXSA 3OICA 3MOGA 3Q2IA 1JWBB 4XYEA 4LMRA 1ZO8A 4WJZA 2O7QA 5JYFA 4YJGA 3T4EA 1R4NB 3MTGA 2NTNA 1M6WA 1NTOA 2FY8A 1DHRA 4W7IA 4D3SA 1UXHA 2B36A 4IY1A 4PLZA 4NZ9A 1SZJG 1ADFA 3GAZA 1RKXA 3SXPA 1NWCA 3WGQA 2IDZA 1MXFA 1OMOA 1KVRA 3PDJA 2HMSA 3A06A 3E9QA 3OM9A 4YJFB 4CUZA 2I66A 4LISA 5AYVA 5G0WA 3VPHA 3RWBA 1UDCA 3WWZA 4FJ2A 2GYYA 1PL7A 1EVIA 3FNGA 2NUAA 2JFHA 5F21A 2ZCVA 5JY6A 3CKYA 2C20A 3ZWYA 1C14A 2Y99A 3N7UA 3EGOA 3TJRA 4BNFA 4Z0HO 1VKOA 1PR3A 3GH3A 1MV8A 5A05A 2VNAA 2J3HA 3FR7A 3PHLA 3TF5A 3NDRA 1Z73A 3G1UA 4U6SA 1R15A 4RLSA 5JSFA 1H6BA 2WTBA 3FN4A 1GTMA 1KVSA 3WQSB 4JJFA 1D4FA 1YL7A 1SOVA 1E7SA 5TLSA 4XWYA 3OHSX 3GT0A 1KS9A 3F6YA 3LLSA 4ND1A 2AQ8A 1P1RA 1U4SA 3MCVA 2QZZA 4YAIA 1K6JA 3UCEA 1B14A 1UJMA 1M66A 2X5OA 3H9EO 4ALLA 5IDWA 1BWSA 2E4AA 2RHRA 2BI7A 4F3YA 4ND4A 3DAPA 1KERA 3VPSA 5DULA 1D7OA 1SMKA 1YKFA 2NU6A 1YOVB 4L75A 4FS3A 4CLOA 3KUXA 4DL9A 4BO6A 4R1SA 2XAAA 3JQBC 4WLEA 3GNSA 2GD1O 1ZK2A 3PGJA 3TPCA 1GV1A 2I99A 1B8PA 4R9RA 2EW2A 4ITUA 4P22A 3RUCA 1U8XX 1YQGA 1VC2A 3LC1O 2VWQA 3FI9A 4NBTA 3WJAA 1E3LA 2DT5A 4BKPA 1U3WA 3C1TA 4D46A 5A9SA 5DT9A 4GQAA 2VHWA 4UEOA 2C0CA 5L7YA 2VNSA 2D59A 3WLEA 4UUMA 5CEJA 1ZEMA 4IXTA 4D0SA 1MFPA 4NFHA 4PLTA 3UW3A 3VC7A 4ZD6A 2EXXA 4J2HA 3CUKA 2B4QA 2JD1A 5A3VA 5CDTA 4H7PA 3QRWA 3RFTA 4BNNA 2YW9A 4BNYA 1LNQA 3F1KA 4CMCA 1DBVO 1DPGA 1RYDA 3KYBA 4B8ZA 3KOUA 1HLDA 2I3GA 2LDXA 3KEOA 1AN9A 4QXMA 4C7KA 4E2XA 5JCJD 3DR3A 4HUJA 3B1JA 3NTQA 5JLAA 1DLIA 2YHIB 5L45A 1T4DA 3MWEB 2VWHA 1KVUA 3IKTA 3W4KA 1O95A 3OF2A 1GQ2A 1N92A 1NHWA 5T5QA 2JCYA 4YVFA 3FPLA 3RAJA 3U4IA 4UEKA 3I4CA 3RUDA 3G0OA 3GEGA 3GVIA 4IZIA 4XR9A 4YA6A 1JW9B 4YJDA 3L9WA 2E48A 1CQIA 2HLPA 3PWZA 1N1GA 1Q0HA 1OI7A 2H1SA 1HRDA 5IN4A 4KUEA 1JLLA 3D1LA 4XYMA 5A5FA 4CQMD 1N9GB 1J5PA 3GG2A 2PH5A 3CIFA 1PS0A 2O3UA 3G49A 5KVSA 2V65A 1JKIA 4MVJF 3LZ6A 2OXIA 5B1YA 2D4AA 3K96A 2AG5A 1P33A 4D79A 4XQEA 3AM4A 2Y66A 2PZJA 5KWEA 4PLPA 2CVOA 5EQDA 1FF9A 2CVQA 3EMKA 3UAGA 4CL8A 5KVVA 5C5IA 5JMWA 3GEDA 4CQLB 1HE3A 5JNLA 4F45A 1IZ0A 1E6EA 4LRSB 2AEMA 3I9JA 2C59A 2DQ4A 3GGGA 3ROPA 4YRBA 1C0PA 4R1TA 3C7DB 5C7LO 2DTEA 4U6QA
chains in the Genus database with same CATH superfamily
1VL5A 2NVUA 4AG5A 4E13A 3NYRA 5AT1A 2QLTA 1Q12A 4U7JA 1RRPA 4XGNA 2O2ZA 4MQMA 3FTPA 4EG4A 1AF4A 1G5QA 5AKGA 1BA2A 2WD8A 3DEYX 4ZV9A 1R9NA 4CI9A 2Q5FA 5CH5A 4FT2A 3ZVNA 2ZAOA 3DPSA 4RM3A 1Y3HA 4HAOA 1YZFA 4JBNA 3AO0B 5K8UA 5TMBA 2D00A 1N5RA 4S1NA 1J5EB 4PRKA 4PZ9A 1V3UA 4IRXA 2HJ9A 1G6Q1 1C0EA 1ZN8A 1RYNA 3WO1A 3K9QO 3WRYC 3HNRA 1PYDA 3IFSA 3SC6A 4MI3A 1DLJA 1IUKA 3EGXB 5LWQA 4E5NA 1Y82A 1GPKA 2J4CA 1FDWA 2YXBA 1DJLA 2XZTA 4M7WA 3WGYA 4GUDA 1MU0A 2OAGA 4I1IA 4XB1A 2J3MA 5C46F 2P90A 4GYKA 2PANA 3SYKA 3U7JA 3LBFA 1IPEA 4QGBA 3COYA 3L4SO 5G02A 4EIWA 1KWGA 3JD4A 5C32A 3SF0A 1Z5UA 3T0GA 1JPUA 3U4QA 3AQIA 2Z9BA 2C3OA 2P69A 3NC1C 3PIDA 1OFVA 4KQXA 4NARA 5EWMB 2QA5A 5A4IS 1AQNA 4N48A 2PGNA 5TC4A 5EWLB 2JBAB 4PEVA 1SUSA 4LC0A 4A0HA 2D0IA 4TT3D 4B6PA 4FBMA 4YQYA 4EEKA 1QH1A 3EVGA 2PL1A 5CH3A 4E2ZA 1XTUA 3NKLA 1Y3BE 3EGDB 4HAXA 1QOPB 4KUHA 3OESA 1HDOA 1GU7A 3ITNA 4R9NA 1V11B 3U3KA 1ZU4A 1LSJA 3N0RA 2BTQB 1Q84A 1USVA 3P2MA 5D8DA 2GSWA 4BJ5A 1PJ2A 4MHSA 4N5IX 3LF1A 2XVAA 3ZOKA 1R0KA 1CZLA 1WULS 3F0TA 1R5BA 4TMXA 3UAYA 3T41A 3GXBA 3INRA 3MMPA 1P5HA 3HUDA 1U6JA 5C1BA 3GROA 4QDKA 1JUDA 4U2FA 3PLNA 4HO1X 1F06A 3AQ4A 3KVRA 2VO1A 4V0RA 3GLFA 3CTPA 4KNWA 2H9AA 4O2AB 1TA0A 2QRQA 4O2BF 1LH0A 4P7BA 5CT9A 4DDKA 4ZYUA 3GPLA 1O0CA 2GO1A 1VLMA 4GGMX 4Q00A 5JY1A 4J16C 1W1WA 5EXSA 4NJEA 1WLYA 1V1RB 1CZUA 4RY0A 1EG7A 1P4JA 3JQ9C 3HXLA 3NDIA 5BSUA 1ZUIA 3NT5A 3AP3A 3G5LA 2D0OB 2WYVA 5C5CA 7ADHA 3QX3A 3CTMA 1FJGB 2GEDA 4LZOA 5FR1A 3MT9A 4DJJA 3ENQA 2V7WA 3SQWA 3O2SB 1WW2A 3DTYA 1SKBA 3N2KB 4IDPA 5FTJA 1XCPA 2IX3A 2G9NA 4W9NA 2Y1DA 3ANXA 1UZMA 5HE8A 2KHZA 3QBJA 1N6OA 1ZESA 2J3IA 1T9GR 1Z38A 3JWIA 1Z07A 4WFJA 2VRBA 5AFSA 3OC6A 3K7EA 1TYAE 2Z0MA 4A0FA 3GRYA 1J2JA 1EINA 4NAUA 5IDQA 1M2JA 1ULTA 1CR2A 4OGFA 1JDVA 1V45E 1KYQA 4KLRA 3WG9A 4M88A 4O0LA 4Q12A 3ONEA 1H69A 5C5EA 1QV9A 2GF0A 2X6QA 3FOBA 3IBGA 5CYOA 2C4MA 2QUHA 1UOEA 3FKSD 3D8RA 1IUNA 4TS4A 1OYVA 1L5MA 2BBOA 2H59A 4TZ0A 2AMVA 5LFAA 4NXNB 1ZIDA 1PG2A 2HXGA 5DH9A 1Q22A 4I2VA 1XN1A 3SQLA 1PZNA 2VPYA 2ZSEA 4QXOA 3LP5A 3QKSB 1OBOA 3IC5A 3OLWA 1P80A 2I9KA 1TT7A 5T8KA 4BMZA 1FSPA 2ZB4A 2IVFA 1C4KA 3WLQA 2IOQA 3HHPA 4EG0A 4KX3A 2F62A 1USKA 2FCAA 3GPCA 4YRJA 5M2QA 1E79A 1JH9A 5M6DA 2FN8A 4V2IA 5CB4A 4YP0A 3VU3A 2VJLA 3AG6A 1C1HA 4RZXA 1X9GA 5THKA 1PQPA 3ZCVA 2PMFA 2Q2NA 2V5AA 1HH4A 4XJSA 1ZIOA 3ZQ6A 1KS2A 3HYRA 2BHSA 3WHLA 2H9YA 2OZLA 4MDHA 1QOQB 4B17A 2VDPB 4MVJP 5KTTA 1T3TA 5CX1A 5AI8A 2R0QC 1PT9A 1K8ZB 1W85B 4X6YA 4ZO6A 2W2VA 3NVDA 4BKQA 5FPYA 1GNPA 3GCZA 4C05A 6GPBA 2ZM5A 4X84A 1F2UA 2JAPA 3O8OA 3ZGZA 1Q0PA 4JUIA 4K2AA 3RUAA 2ZS8A 4A26A 3RK4A 2ZTHA 1IONA 3TIFA 2BFEB 3V8PA 1K9VF 4XDYA 1GG9A 2V4ZA 4AKHA 2FMFA 1GZ7A 2ZYVX 3PHIA 3NTRA 4D9JA 3VKHA 3I8SA 1J22A 4YUXA 1RI4A 2GZ2A 5K0ZA 1MLDA 1UZNA 3RI3A 3K8ZA 3MGAA 3P9QA 2XCOA 3DMTA 3HDJA 2GBCA 3PUHA 1OBFO 3KUDA 3WYCA 3QXCA 4GNKA 3BGIA 4A9AA 1E8NA 4LGCA 3EDRA 3PXEA 1VL0A 3I2FA 4G63A 4RAQA 5DHQA 2F1RA 2JD0A 1J1UA 3RSLA 3BTVA 2HMVA 2C3MA 4ISCA 1PSDA 4YRRA 2VP0A 4A73A 4D9CA 1CUHA 1H8HD 1BS1A 2H4XA 2YN2A 3FMOB 1UBMS 3LP6A 1E1MA 1PFWA 3GRKA 4P4NA 1GR0A 1IDOA 5EIHA 3X3HA 2QTNA 2O8CB 1UFOA 4MVJG 1CQPA 3GX1A 4G0ZA 4W9RA 2ZYIA 4D3DA 4AM8A 2YCLA 5AI9A 1MXHA 5CVTA 1P45A 2QMQA 3CF2A 1L4EA 3TW3A 2FPKA 3WWOA 3KJQA 5IBRA 4TWIA 5EP4A 2PWPA 1LJ8A 4CU5A 1ZNXA 4IVNA 4AN4A 2UUBB 1Z6XA 2EBWA 1OFUX 2RK3A 3LUCA 2PHZA 3HY6A 5DMHA 2PK3A 3UOAB 3QG1A 4EY3A 4FCWA 2H1WA 1WXHA 1R9GA 1B15A 2FYTA 3KQTA 4LRQA 3QXSA 4PO8A 4PNPA 4RXMA 5I9TA 2NGRA 1I3OA 3B6MA 4J9VA 2XKKA 4RIFA 2WWTA 2AZMA 3ONDA 1FDIA 5FPTA 3ZJTA 4TMTA 1ENYA 1V48A 1P0PA 4MW5A 4L9AA 3HY4A 5AM3A 1J1ZA 4M9CA 3S2YA 1Q77A 1FXWF 1M2NA 2QHXA 3QLUA 1KETA 3RBAA 2C04A 1TM4E 1XO1A 3A6ZA 3EFOA 4LDJA 5IAGA 3TQRA 2K2QB 3VTKA 4IEFB 2IW1A 1R4NA 3MC1A 2AYXA 3ZOZA 3PTAA 4A0RA 5I8ZA 2PY6A 1P91A 4ZVUA 4CHGA 4Q3AA 1PL8A 5IX8A 2C1EA 4KXNA 4MS3A 3ZJYA 3MBIA 2LPMA 4KR9A 1AS0A 4GOND 3SF8B 3JARB 2XCRB 2TYSB 2Q1SA 3IE1A 4KQJA 3F6CA 4DG9A 3P0JA 2CNWD 3C3AA 5J2TF 3EPJA 3R7WA 4OSOA 4FSHA 5EE5B 2WSMA 2OY0A 1AQYA 3FMVA 3HB0A 3MTQA 1XELA 2BMDA 1NDQA 4OTZA 2BBWA 4TWZA 1VHJA 2R1TA 3DL2A 4YI3A 1II8B 1Y4DE 1CZRA 2AEJA 1EE1A 5TEVA 3ZCPA 3ETGA 3VR2D 3CEAA 5LMCA 4ZVMA 1Z0KA 3GDOA 1XCBA 1HDIA 2E4ZA 2IYLD 4PHTA 3C39A 3OD1A 4DLXA 4HH3C 5GGYA 1Z4QA 2QE6A 3GT4A 3TO5A 1YNSA 1LU9A 2WTNA 3M33A 2J3DA 3I3OA 2YWBA 1I0ZA 1LDGA 3OI7A 2R4TA 2BKLA 3GN2A 1OY1A 4DNOA 3ZK7A 3RASA 2QN1A 3A28A 3UB2A 4MLPA 1PDVA 1GG8A 1S7GA 2BIFA 2ISCA 1LZLA 2ZDQA 1Z88A 3C3PA 2G7MC 2HX1A 3NATA 1IVSA 4X61A 1NBAA 1HZZA 4F1JA 4PZDA 1IBSA 2PWZA 2GXSA 3GLFE 3K53A 2V3CC 3DNMA 1I6MA 5K0NA 2IP4A 4J91A 4DCSA 3ZLTA 4B4DA 1QHYA 3N07A 3SGLA 5EXXA 5FWAA 2I1WA 4B4OA 4F9GA 5C8YA 4BU1A 4QXPA 2HREA 3C6QA 3FF4A 3Q7EA 4H9GA 2NO4A 4UMFA 1P2GA 4YBZA 5ALZA 2PV0A 1PKXA 1QRRA 2QQ5A 2MSCB 1JAXA 1Q19A 2CW5A 1YL6A 2PWAA 3AKCA 3L06A 3SE0A 2W37A 3FTQA 3ILXA 2XXAA 1AGRA 4QSHA 4LV8B 2OGUA 1W87A 4G89A 5L7WA 3E9CA 3TG8A 3OIVA 1WSWA 4LC9A 2IIQA 1YFZA 1YK0A 1ZOLA 1DT3A 4ER6A 4F91B 3V7YA 2HWUA 2A67A 3DCJA 2V4MA 4KX5A 4DCVA 3LHKA 3VR6D 4R5HA 2I7TA 2MR6A 1HF3A 4N47A 1YZNA 5KO2A 5CA0F 1EX7A 3L46A 4RZHA 4BDSA 1JLHA 3IKLA 1FIUA 3DDHA 5FFNA 2YNMA 1EHIA 5LQSA 5LP6B 4WVLA 3DTVB 2QRJA 2X14A 3NH9A 2NM0A 4UDYX 3T34A 3DPIA 4Q1AA 3EW7A 4MW2A 3ZV4A 3FZGA 3OUZA 2FPGA 5BMVA 1TUGA 2P2SA 1AUPA 4F1WA 2WNHA 4AWBA 1CIJA 2JPDA 4LQCA 2XV1A 4FDUA 2RGUA 4QBHA 4UZSA 2GFQA 5AHXA 5J63A 4ARSA 4E2XA 1KSFX 3E5MA 2OCDA 4HHEA 4G4GA 4HEQA 3U7EB 2K2WA 5CAEA 1M1XB 3DKKA 1RAFA 4CNBA 5G0UA 3M4YA 1MX3A 2Y27A 1BXRA 2IWHA 2FG6C 3CU5A 3NUGA 1E92A 2CHVA 1G3MA 3VYWA 1H2ZA 2QGZA 1H2XA 3CHYA 1C9JA 3H9BA 1JKFA 4MB6A 2ZITA 5ALWA 3W34A 1J7KA 3KTAB 1A9PA 3N5CA 2C9CA 3BCUA 2W4IA 3SHFA 3UJAA 3FF1A 4C6RA 4LHYA 1C7IA 1FFEA 3PGKA 3GQBB 1Z17A 5BY2A 1OBHA 3A1WA 2IK8A 4EELA 3HL4A 1EH5A 1FUUA 1GZVA 3TW8B 5BSKA 4LOJA 4M4SA 5AWFC 4Q3NA 3S55A 1WXDA 3WVNA 5BNWA 2V03A 1Z34A 3QFRA 3D8BA 4UCQA 1UWCA 2IUUA 5MN6A 4WCVA 4RHTA 4WXEA 4YJ3F 1E6KA 2H4ZA 4INJA 4CKEA 4ZHSA 4Y67A 3CKLA 3DBLB 1J4AA 2IPNA 3QW2A 2JA1A 4EAQA 2LVBA 4B9AA 1A8QA 2XB2A 2AE1A 4ZVRA 4NWIA 1I6LA 4F1KA 5JAUA 4WEQA 5EPUA 2PXXA 2PGJA 3LUAA 1ZJWA 1IXZA 2ORIA 3ICEA 4IKEA 4DVGA 1ADJA 3NV7A 2Q28A 3VH3A 5J59A 3B60A 2FW7A 2CL7X 2GEUA 4HUQB 1TCVA 3S81A 2P0EA 3F46A 2ZSDA 4X65B 3IEMA 1M74A 2E7ZA 4ZOLA 1AK1A 1YGYA 4J1TA 1LZKA 2FSVC 1B0ZA 3OECA 4IDOA 3ZZNA 4HVCA 3IOEA 1Y7LA 4C0AC 3S1SA 3OFJA 5BXQC 3OEED 3PQDA 4X00A 3N9IA 1COZA 3KEQA 2JK0A 5KYUA 1JHZA 3T7DA 2JJ2D 1Z74A 1ZGHA 2X2EA 3NHYA 4EI8A 1I01A 1ECBA 1I7QB 5FTWA 2QJFA 3UBMA 2DMRA 4BGUA 1D2GA 4ARAA 4EITA 1RZRD 3OMLA 3G2NA 1CFJA 4OA8A 4TMWA 4UTPA 3H9GA 3FOCA 4WESA 5AJTA 4B3MB 1LPSA 3PFHA 3OH8A 4KYUA 3CM0A 4OBXA 4X1IB 4R71A 3ZDCA 1F0YA 2J0UA 2P6UA 3C8DA 5K0EA 4DE5A 3CX3A 4PINA 3TUXA 1SXJB 4J6EA 3FOFC 1WXFA 2PS3A 4JSTA 4E5KA 5KYWB 3EOAI 1QGZA 1RWBA 1Y4ZA 1LPPA 3L0OA 4KNVA 1Z6TA 2VQ3A 1JIXA 1I5OA 2QQ0A 4FKZA 4J94A 4MUYA 4O25A 1N8TA 4WQMA 3ISJA 5AXBA 5REQA 4XWAA 1C4OA 5LB2A 2P0AA 4AYTA 1U0TA 3I9MA 1JDTA 2QQFA 4NCHA 4IHKA 4N9WA 2O3QA 4CMAA 3P5BA 3EPLA 1OW3B 2YJ4A 1PWEA 4K28A 3TEMA 2GYVA 2GTIA 2PMCA 4X6UA 1YBMA 4WLFA 3TSYA 5T4HA 5CVVA 4TS9A 1NJ8A 2OHXA 3GH1A 1DDGA 4XQ9A 2Y0EA 4HOYA 2XD9A 4OXRA 3BL6A 2VTEA 2C2MA 5LP6C 3VM6A 3L4JA 1XRRA 3THWA 5EIXA 4FUQA 5I4BA 5KOIA 2PT5A 2QTAA 1W4AA 3DQZA 3FWZA 3V4RA 2RAUA 3ASZA 1UEXC 3CLRD 2IQ5A 4KN8A 3VNRA 2VBGA 3S99A 2REBA 5EVCA 2PIDA 1N3IA 4M38A 1AG9A 2NUBA 1DIAA 1OIVA 4KI7A 2PBZA 2I2AA 1URPA 1O8CA 2NU7B 1E5TA 1V35A 4QQ8A 3CMCO 2IOFK 4C0SA 3HBFA 4I1YA 3B3GA 1D03A 4KAJA 3EHEA 4P2GA 3VPBA 4ALJA 3T35A 3GUUA 5BSRA 3RYHA 2W2LD 1B0UA 3O1LA 1F17A 4UDXX 3DONA 1WXIA 3IEKA 2VCEA 5K8LA 3N8DA 4NICA 1G3RA 3GA5A 4EKYA 2HA6A 1P0CA 2VTBB 3HDVA 2HA0A 3E9MA 4JOQA 2VF7A 1YE3A 3AVTA 3P19A 3ZU5A 4JOBA 1TK3A 4R83A 4YYEA 2QJOA 2OFWA 4FXOA 1ID1A 2VVTA 3UFXA 3AC0A 1Y8RB 4AG3A 2YZ2A 5DNCA 1M72A 1QFJA 4CT4B 5T41A 2P3QA 3DEZA 3ZI4A 4JXZA 1CWUA 3JYHA 3Q5DA 3ADKA 5BN4A 3H0CA 2A5FA 3JW8A 5EJFA 3F47A 4D9GA 1HBJA 2FP4B 4MWBA 4IIHA 3R4VA 1W59A 4G2NA 4EBBA 2O57A 4RV4A 2WTMA 2OT3B 1LX6A 2DUJA 2PQ6A 2IE0A 2XTMA 1W4RA 3AK4A 3VR5A 5BN3A 3COVA 2YDYA 3QKUA 3ACDA 3BF8A 4ALKA 3AVYA 1F2TB 3NM6B 3EOBI 1LSOA 3EG5A 2QPTA 4CKBA 1NSYA 1QHSA 1IN1A 4BQOA 5KJ6A 4PU0A 2C94A 4S1OA 3A7DA 3M2PA 1JIKA 2VYND 1EVJA 2CXNA 3NHZA 4IWXA 2FGKA 3OCCA 4ZQIA 5IKXA 4X8OA 1KEPA 1KO5A 4XGKA 1OLOA 5D86A 2YZ7A 3CVXA 3B5JA 4UCFA 1L4HA 4PNHA 3ROQA 3V7UA 1VBKA 1POWA 2R60A 3O7WA 2ZCJA 2GAJA 2IXDA 4C0WA 3HWRA 1W9MA 2WI8A 3AM5A 4QFDA 4C5CA 3PR1A 4ZFNA 7MHTA 3DP9A 5IVKA 4L5JA 2OQIA 5ED0A 1NQOA 2H29A 1DKPA 2J85A 3TB6A 1JRLA 4FE7A 2XGSA 2JFOA 4YUYA 1HTTA 1U7WA 3RRNA 1XG5A 3AJRA 1EFKA 1XIVA 4HC4A 3CCCA 1SXJC 1PWXA 4BVEA 5ERXA 2IWRA 3MRSA 3VHRA 3ZE9A 2YQ5A 1X74A 1U80A 5AHKA 2ZBEA 1RWXA 4G8BA 5TMEA 1SBIA 1PJ3A 1W2GA 2DAPA 2PRIA 4XD7D 3SWWA 5FLXA 2WIKA 5EOVA 1CUVA 4O8JA 2C07A 1MA0A 1FFGA 1FUEA 1GSOA 3KYDA 3VOTA 1ISHA 4IDFA 4C0BA 3KE9A 2AN4A 3TB4A 3KV1A 1CR0A 8ABPA 5LOVB 3D8UA 2ECOA 1YI0A 1FZQA 1TYDE 3FPHA 4ESEA 4YV1A 5HK9A 2YQ4A 5CDGA 1XOIA 4J3NA 1LBQA 2EVWX 4Y1GA 2ENUA 3R3WA 3WRVA 2AOXA 1G2QA 2J31A 5HCUA 1CW2B 2JDIA 2FDRA 4O4LA 4HZGA 5JAHA 4YJ2A 1IY2A 2QW1A 4XYGA 3Q7IA 3R6GA 2Y93A 3SSOA 3WK8A 1SBZA 1EEHA 1RHMA 3BOSA 1XNRB 1L3IA 5C37A 4OIMA 3MZ0A 3H3FA 5CGZA 3K8QA 1GT6A 5AVKA 5DCYA 1C3LA 3WB1A 3NNDA 1NL3A 3KXDA 3NVMB 4HTAA 2QJTA 2QBYB 4JI3B 3OM0A 4LYJA 1ST3A 3DM9B 3FVVA 2R2GA 3HXPA 5A5VA 3O0DA 2HU8A 2DPLA 2WAMA 3A0UA 1TCAA 3PKJA 4IIGA 4BNLA 5M5BA 4MKHA 3DEIA 4YCMA 4DIMA 7ABPA 4UQPA 4L9RA 3L7DA 2GTHA 1SC3A 3ITDA 3QX7A 1M2EA 2W70A 3Q5GA 4QAQA 3RTBA 3WNDA 3C3DA 3W7VA 2BGKA 2VJOA 3AUXA 1E5DA 3VU9A 2MIIA 3ICPA 3EIQA 3Q3HA 3V2IA 1P6UA 3FCAA 3ORHA 1GRVA 4OYRA 3W5CA 1JMYA 1RRVA 3DZ2B 2BKUA 4DTCA 2VRWA 2G0AA 5HM6A 3D1VA 4OJMX 4EYSA 4YMTA 3TDKA 3SHWA 4G0QA 1E6UA 5CB8A 1USWA 1PZEA 5H82A 2JHPA 3RC3A 4MAAA 1KYTA 1RDFA 5FL3A 3TLYA 5EMMA 1JEYA 2Z6QA 2HW8A 3IIEA 3R4CA 2JA2A 1CB0A 3GO4A 2DBZA 2EL7A 3BC1A 1DXHA 2VFAA 3TRHA 2HWKA 3MGCA 4G9GA 5H59A 2QVZX 2B61A 5AJWA 2BZGA 2P5TB 1MX1A 3NRJA 5SV2A 2IV2X 2VHEA 4U7PB 3WS7A 3LTNC 1N3LA 1O4WA 3U0VA 2WWFA 1ZI9A 4FTWA 3I73A 2PMBA 3DBOB 1SGWA 2QB5A 2DHQA 3QZUA 3OTOB 4I50B 4YRLA 4QGSA 4DMGA 1P44A 1TCCA 1L5RA 3HYNA 4MWDA 1WD7A 4ROTA 4YJGB 3M9XA 1UP4A 1HETA 2AJ8A 4AICA 4BUCA 4C3ZA 4ILKA 2M1ZA 5AUPB 1YSCA 3K70D 2BOVA 1M8PA 4PX3A 5COQA 1ZD3A 1TA9A 5CHYA 1TGVA 3K9NA 3KAQA 1JFLA 1W581 2O8FB 1K8YB 3LECA 4RE6A 2GB4A 4GI7A 4ZTBA 4L2IA 1NUPA 5CT6A 5T4FA 3RRFA 1WUJS 4NJMA 4JXKA 4JUBA 4V0MA 1A8PA 2C8JA 3C3XA 4LV6A 4CKYA 3LD9A 5HUHA 3KVVA 3EA5A 3NEAA 2IYEA 3KBBA 2IEAA 4TTVA 4W6ZA 3OZAA 4M22A 4AKTA 2YWJA 1YOBA 5ALJA 3WIDA 3BFKA 1KE1A 2C31A 1Y1TA 3ACBA 5JYCA 5IYZF 4TKLA 2FR8C 1S3GA 1YRWA 3FHLA 1BMDA 1N2XA 2E1PA 2ZRGA 1Z45A 3CZRA 1QO0A 1ZPDA 3E48A 4R9SA 1H0RA 1JSCA 3KM0A 2FRXA 5HJ7A 1TPZA 1TJNA 4KPYA 2XUOA 5IAEA 5IEBA 3K0KA 4DCOA 4BKRA 4BVLA 2H2IA 2P77A 2YOHA 2PRSA 2JEZA 4TL9A 1JE1A 4OHMA 3O2JA 4XTCS 1U0OC 4D8VA 1I4OA 5JQWA 1J42A 5FAKA 1OAOA 1SCQA 1TYZA 3EN0A 4HPXB 1MTZA 4F7WA 1IM5A 1T4CA 1RWMA 2VIIA 5AW2A 3B1ZA 4NK5A 1WPGA 4ZO4A 4JQYA 4JZKA 4LHWA 1U9IC 4H1VA 1QO9A 4G5XA 3KSUA 4KSYA 5EJ9A 1KNQA 1DZ3A 1DO2A 3KQVA 3LX5A 4Q9IA 3BJRA 3VH4A 3HACA 2QQGA 4V0KA 4HGYA 3RVQA 5DYGA 4QFMA 1BTOA 1GIAA 2IYFA 4C5BA 1KI4A 1Z6QA 3AVVA 3U16A 4ZGWA 1TO2E 4NEGA 5CNJA 2C2KA 4F38A 3VUFA 3RD5A 4I3HA 2FMTA 3IDSA 1JYEA 2NSLA 4MKXA 4PR3A 4WNYA 1NYRA 2HY7A 1SWWA 2OVBA 4EAAA 1E62A 1FSZA 1AZWA 3OOSA 2A5DA 1XJWA 1NQAO 4B6QA 1QP4A 2CEKA 1QIKA 2K6GA 1NW6A 2W8BB 1N5MA 4IDGA 4QPJC 5GM1A 4O5OA 3T7IA 2QZ4A 3F49S 3U3JA 4JT4A 3I42A 4KLCA 2QK4A 4MNTA 4MV8A 1NTRA 3JAKB 2I78A 4UFOA 3LQRA 2Z83A 3VH2A 3C15C 3V4FA 1Z5OA 4ZVNA 4OKNA 2A94A 3FWKA 1X38A 5I9SA 2G1PA 3IAAA 4B44A 3K0AB 1JFSA 2CB0A 1D5CA 2G17A 3O4HA 1VSTA 4RF4A 3HB9A 3JAMA 5CEFA 1E5LA 1Q57A 3EDOA 4QASA 1XJCA 1I13A 2SBTA 2Z2KA 1BS2A 2H7VA 1SG9A 3D3WA 2G4LA 3NOVA 1PD0A 4ND3A 3ERCA 3ZDDA 3ZD7A 1OV4A 4BS9A 1WY7A 3HXKA 1WUTA 5JSUA 3JQ7A 1BIFA 4AY3A 1AZTA 2BFAA 2ZREA 1BXGB 2NYAA 3VX4A 3ADBA 3AF4A 4AJKA 1E3SA 1M76A 3A0RB 3LBHA 1Z18A 4HRXA 1XPOA 2VT2A 2G72A 2XODA 1PG0A 5K03A 5JH7F 3WBBA 4CTKA 2DXIA 2SNIE 3AJ8A 4DR1B 1LWOA 3P4UA 3VAZA 2GCIA 1A7KA 1IWOA 1E1NA 3DFUA 4NZNA 1VGRA 3TNFA 1T4GA 1I3KA 5HNKA 3G9ZA 4DYHA 3DE1X 3SHTA 3F5SA 1Z63A 3NAZA 4G1EB 3PFIA 2L19A 7GPBA 5DM60 3EYWA 4YMVA 1D09A 4U7GA 3EVCA 2UYQA 4UAUA 1FC0A 4GOJA 1GTL1 3IALA 4C04A 2J8ZA 1WF3A 3CLTD 1A1SA 3DBHB 3K5IA 4KN6A 3V2GA 5JAPA 1Y8ZA 3FB4A 1K4MA 4KE7A 4KIJA 1A04A 4KFSA 1TKCA 3EUFA 2X9QA 4IJKA 4OOEA 3UMCA 4JI2B 3FJYA 2OBFA 4LTNA 1HYQA 1CJVC 3KD2A 3OOEA 1Z36A 4MV4A 3WOVA 3GARA 1U1IA 4B45A 2IVZA 2ZYSA 1EUDA 1RJGA 3PQFA 5FOWA 3WL8A 1RKUA 5DEIA 4GZMA 4KLAA 4PS1A 2JFPA 3P52A 4HJRA 3EFEA 4MCHA 2ICAA 1D2EA 2YY7A 1MTOA 4IJ6A 1ATZA 1I10A 1UC8A 3D2LA 1D2NA 4PLHA 1GARA 1LW6E 3QUBA 4BZXA 3NASA 5EZYF 4A2CA 1N5OX 4DJEC 5EKSA 1X39A 3G2JA 3KHKA 4BMDA 4DANA 4EYGA 2XZLA 2BBTA 2IEYA 4XJXA 5I4IA 2IZ7A 4E1AA 2GA9A 1O5TA 1MMFB 3ABRB 1DI0A 1FP1D 2R68A 1U63A 2J3KA 4WZBA 1TAGA 3BGOS 4XVCA 1XMOB 1BHO1 3GCGA 1NZFA 3M5DA 2WFMA 3R77A 4JMLA 5IS2A 2BHNA 4LJ6A 5I8PA 2VYVA 2YRFA 3FRJA 1NLFA 1PSZA 1U04A 1KPHA 1UJ6A 2GGSA 2Q5QA 2WHRA 2WOJA 3E7PA 2Y1LA 5TXGA 3TCXB 4K1XA 3I5AA 4ZDJA 5CYPA 1WHSA 4EFLA 3Q41A 3AIIA 3W4IA 4D92A 4EMSA 4GI2A 5K2MA 2UZAA 2XVMA 4DCTA 4D74A 4BNUA 5CVDA 2CBXA 2XUHA 1JR4A 4KPEC 4P38A 3TECE 1J0EA 2BBSA 2VATA 2ZCUA 3CZPA 3THXA 3AM1A 5HIAA 4GSLA 1EUZA 1JDBC 2FE1A 4O1IA 2A30A 2XGJA 3O4FA 5JBNA 2XTZA 1XALA 3A6HA 3DEJA 3EBLA 4BL5A 4E3WA 4OFWA 2WJGA 3KE8A 3IT0A 4B3FX 5KQSA 1ZGGA 4NS4A 2ZQYA 5DX1A 3S8EA 2OL4A 4H7IA 3WGUA 1Z6AA 2C77A 4NMXB 5E4TA 2XCLA 4KTVE 2Z5VA 1N2SA 2Q4EA 1OXKB 2P3SA 2YWXA 1QFSA 4NDNE 2H4HA 4UBMA 4NG4A 2GWHA 3AG5A 1A71A 3KZCA 2HB6A 2IDJA 4LXIA 1U81A 1UK8A 3LU1A 5J47A 4CRWB 4R6WA 4GWKA 4EA8A 1LUAA 1RQPA 2WMOB 4Q18A 3V8BA 4LYHA 1BD4A 5GJCA 1FS6A 3RQSA 4RKWA 3EVTA 2J0SA 3RFUA 5AKZA 3JZMA 4Z86A 3BKXA 1P3DA 2X8LA 3T5DA 2PL9A 5LMUB 4DR7B 4TX1A 1JA9A 3VFDA 1DBIA 1NV8A 5HS4A 1WPQA 3FYUB 2Z08A 2E49A 4I6GA 4JR1A 4L8WB 4O4JA 2QZJA 2UUCB 1TTQB 3PHJA 4C4RA 1Q7EA 2HA4A 4ABTA 5BQOA 1DQNA 1R0YA 1PW5A 5IK2A 2GTPA 2X0IA 3OZEA 2WSBA 1RQXA 3LY5A 1E2FA 1CVLA 3CNNA 3IA7A 4N5HX 3MS4A 4A2PA 1P7VA 3A8TA 3TOCA 3Q3VA 2C42A 3E8MA 2QKYA 3N6VA 4WN9A 4J0FA 3TOZA 1XRNA 2V8OA 3U13A 2QGNA 1RWWA 4J7CA 1TXGA 4DLVA 1HFEL 1XQ6A 1R5OA 2BFDA 4FOLA 4MZDA 4UE3S 3TI9A 3V97A 5CW2A 1JNYA 3FPEA 2DWOA 4XLZA 1TA4A 4WDRA 4Q39A 3ROKA 2WAOA 4GLLA 1IXRC 3AH8A 5C81A 2PKQP 4X24A 2R7NA 3JWGA 4TKMA 1QFXA 3CZAA 3ZE7A 1BQEA 1RHKA 1U94A 5ECDA 3V46A 1P4AA 5KTNA 1NPDA 2XWJI 1JF8A 3CR8A 4KDCA 2ZJ2A 4ZOCA 3QLEA 4RGQA 1GFIA 3ZGNA 2QMHA 2ZIUB 3D81A 4FYYA 4Q15A 4IMPA 4LKRA 3ZGYA 1X0XA 3A10A 4RENA 4CMHA 4G1CA 3JYNA 1AK9A 3MWLA 4IXMA 3HU3A 3MWFA 1YE5A 4KYVA 4U3JB 3CE6A 1VOTA 3FZYA 1ULBA 2O19A 3QVVA 1E7YA 5DM1A 1E1RA 1PKEA 3E35A 2CZCA 1Q1NA 1XD2B 3O9ZA 4J2TA 4PZPA 4WZ6A 2FZ4A 4EDFA 3CVJA 5LXTA 1C1DB 2OR3A 4G5RA 2G0TA 1QH8B 2GR9A 4BQSA 2OUIA 2GCOB 3F3SA 4MS1A 4TVSA 4BGDA 4PCUA 2G5PA 1R3DA 3CXRA 1U7OA 4JQOA 5KTKA 2CZGA 4LXXA 1C7EA 2Q9AA 5WRFA 5A62A 1A0OA 2CKDA 2GCGA 4PW0A 4AS2A 5DK4A 5A2GA 1IXSB 2PU5A 4RDXA 4BY9E 3WMFA 1WCIA 3OY7A 3UATA 2QR2A 1EWRA 2JL1A 3FVWA 4FNGA 3SU8A 4ZJPA 1YVUA 2REQA 3BZUA 5JCJA 1RM3A 3AIOA 1OLXA 4IGFA 3ROTA 3NJ8A 3SYNA 5LM3A 2A4KA 4ARUA 5M7EA 1E2BA 2Q3HA 2AW5A 1BO6A 2FH5B 6NULA 1UAYA 1QCZA 5BQ3A 4CCYA 3BPSA 3ZDQA 1PLJA 1ZCJA 2C99A 5CVJA 3H5NA 3T3OA 1WABA 3A70A 5E6SB 1VZ2A 1A9ZA 4LYFA 1V1JA 5D3KA 2C1ZA 1Z5GA 2XKAA 5TY0A 3R0XA 5KKCA 4HGOA 2VNIA 4ENSA 4R84A 1KFJB 4TKVA 4EEZA 3EVDA 3EOZA 1YR8A 5LIRA 3A6PC 4G1VA 4M0UA 1CJUC 3FPKA 3WRYA 4EKEA 5FOVA 1ADCA 1B43A 5DK6A 2P0YA 3H18A 3OETA 4U2GA 1R00A 4ENWA 2G9QA 1JEDA 1YA8A 3ETLA 2CLHB 4UOQA 1ACLA 5D85A 1E3QA 2XBLA 4DJAA 2QAGB 3DDZX 4X8HA 5DBEX 1C0KA 3NW9A 4HDCA 5AKLA 5L95A 1S2OA 2FUEA 4GI3A 2CSXA 1ULAA 3D1JA 4URUR 3CN9A 4LWPA 5A3RA 2Q21A 1OT3A 1IJFA 2WTXA 4BQIA 1MDBA 2CFTA 2WHYA 4INPA 5CCEA 3NJ4A 2ZRJA 4F8JA 5C7YA 1OH8A 5SZHB 1NURA 4YFVA 1ZLXA 4TV9F 5B7NA 5BRAA 2NTYC 2I3ZA 2QR3A 4B7XA 5BVHB 3FYUC 2ZIAA 3BMOA 3BXZA 3PFCA 1FFYA 2WKPA 4I4TF 3AF3A 4U8GA 2LRHA 4XRRA 4JGGA 2CFSA 4X0EA 4LUCA 4C1NA 3O93A 3G7SA 4OI4A 4REMA 1JILA 4U7HA 4CMIB 1N9ZA 1N57A 3ZGOA 3EEIA 5FX2A 2NO7A 1GCAA 2YHIA 2DUWA 2UAGA 1YE8A 3BM5A 3MWEA 1GPUA 3ZHRA 3IERA 2V5UA 4RVGA 2X19A 5H3CA 3GFGA 2ZTMA 3P9IA 5DI3B 2MYTA 4JL8A 3FPJA 1IK4A 1YKGA 1E61A 3BXFA 3TQTA 3BZBA 2HLNA 4G4SP 4MIKA 3SJCA 1JL3A 3LIIA 2F17A 1JBEA 2VSQA 4CKCA 4XWKA 4KR3A 3LNTA 1SXPA 4JS0A 2VZEA 4WZBE 1EFTA 2PUWA 1ADYA 1R74A 2VPTA 3OJFA 1DEAA 1M8JA 2D54A 3AW9A 3GHHA 1XHLA 4HEJA 4R1OA 3UAVA 2R8OA 4NYIR 1K06A 1X80A 1PR9A 5DCWA 4J16A 4CUJA 1UK6A 1WDWB 1XMXA 1ZM4A 4XWGA 4UUOA 4RFSA 3WNCA 1CDZA 1FK8A 2D5BA 4N8DA 4BV9A 1JA0A 1H65A 2EIXA 2GBLC 4IR7A 2WJZB 4DBLE 1N8KA 2AQHA 2EJTA 1KARA 2AB0A 1NVWQ 3HB1A 3HKCA 2ZJ0A 3SR3A 4FFWA 2VPZA 1QZUA 3BHNA 3NTOA 4KRGA 1L7DA 4X54A 3GU3A 2J5QA 4CDGA 3VO9A 5ENDA 2R1VA 2VUUA 4A6PA 3UF0A 1M5TA 2B30A 2FW6A 1ZL2A 3IS3A 3RIGA 2GJ4A 4CLXA 2GH1A 4AMZA 1MEEA 3GVCA 2JFNA 3B3AA 1EFPA 2WD7B 2RBEA 4NULA 2X2FA 4ZARA 4DN6A 4KQ2A 4R05A 3HR4A 2GZAA 3TRIA 1UBTS 3N58A 4OHRA 5IBPA 3VZPA 2DG2A 4LRUA 4AUNA 4PAOA 2JIBA 4D8WA 5IFKA 2C7QA 3NVKI 4DB2A 2Q4DA 4TS1A 3WGLA 1YR3A 1J9GA 3EEBA 3KQLA 2ZI6A 2WIJA 1RFLA 5BVGB 2X4DA 3GJ7A 4I55B 4H7FA 4CV1A 4BXOA 1NR1A 4ME6A 1DCKA 3CPEA 5LQDA 3CISA 3K0HA 4TYPA 1TZBA 1WQ3A 4WHMA 3OX4A 5EPOA 4POAA 4QPNA 3EA4A 1PEAA 4BKUA 5CT8A 2RAVA 3JQCA 5P8WA 1J8YF 1ZMXA 1NC1A 4JP5A 3DW3X 5F33A 5CJ2A 4JC8A 1Z5NA 3A6EA 1P18A 1ZFNA 4FFPA 5IM5A 1OYWA 2HCTA 5EE9A 1Q5PA 3BXOA 1VBFA 4NKRA 4QHTA 1GP2A 4DLYA 2A1TR 3EGXA 4WOJA 4L5YA 4G0MA 1I7DA 4K9PA 5T73A 1HT2E 4ZANA 3GF4A 4HQNA 3NXKA 2C4NA 1T1IA 1HMPA 1W5BA 1OFUA 1N1MA 2PZGA 3C7AA 4UCWA 1MB2A 4MGEA 4MVJI 4UUAA 1FVHA 3CLHA 2HIMA 3HVUA 3RJMA 1PIWA 3A9RA 1CRWG 2W43A 1U1DA 2JBHA 3EIEA 3GA0A 2C5HA 4L85A 2W71A 1UT6A 4MKFA 4MQUA 2V6JA 3DTNA 1HQDA 4IGKA 2OYSA 1CKEA 3ANSA 2E82A 5DX8A 1KYXA 4URFA 2E5LB 5HFNA 4TMYA 3ONNA 1FBTA 3DAHA 1EQAA 5HKBA 3T5PA 2OV3A 1S8NA 4NMHA 4F46A 3GP3A 2CLMB 1UAGA 2EQ5A 3DOEA 2DFVA 1N36B 3O75A 2E85A 2XDQB 3CZ4A 2WYUA 1XKLA 2QT1A 4UHHA 5BWMA 1PNVA 5B1IA 5KOHB 3KJEA 3G0GA 4JLUA 2LDBA 3IJRA 3OU6A 4LZPA 3UY4A 2G08A 1T91A 1FX0A 3I72A 4K3VA 1QYIA 4ZAGA 2EJVA 1HYBA 2QSYA 1RADA 1QRDA 1SBHA 1SQFA 3AHFA 4REQA 5TGZA 3KP1A 3R9XB 2P2ZA 4I1UA 4AJOA 5JJIA 1THGA 4O2AA 3C3YA 3F2IA 2OEPA 3E0QA 4BFXA 4KQHA 3QEMA 2ZRIA 1FFXB 1MOQA 3H2GA 4JC5A 4MJ7A 5FPPA 3U2QA 4V0SA 3VR5H 3SOZA 5FBKA 5IJ0A 3DTTA 4BQPA 1E77A 1V1RA 2J46A 3QKRA 2YVQA 3KB2A 2OBMA 2RGCA 1X7WB 4I6JA 1AQLA 1DKUA 4GPD1 1XLWA 2WG0A 3LUDA 3ZU4A 1SUIA 2GEFA 4LQDA 3BKWA 4QG7A 2X8BA 3G2HA 2PKYX 3K0SA 5AOVA 2WJPA 1BE1A 1W46A 1XN4A 3QTTA 4B80A 4QOFA 3Q8MA 2BMAA 4DPKA 3EC7A 2NZXA 2PKXA 2W00A 3G2OA 2AHOA 5A1JA 4QPCA 4YUWA 5IF3A 3MEQA 2XIJA 4OVKA 3E9EA 3FWNA 1XEFA 4X8MA 3W1VA 3AGQA 5L4LA 1N0VC 1UPFA 4I1VA 1ODCA 2XA2A 2NXWA 3H5AA 4RVSA 3BGVA 3K1ZA 4WCFB 2G1UA 3L40A 3L6CA 2HDOA 2I22A 4YV2A 2H6EA 2XB4A 1S2IA 3PQCA 2NPOA 2IY7A 1BGXT 1KSHA 1EUCB 1LRLA 4YAWA 1JV2B 2NG1A 4UHFA 2V9CA 2ZJBA 2IS6A 3V7NA 1T5LA 1GVHA 2ILVA 3TAUA 2O23A 1SK8A 4N54A 4RDCA 1H1LA