1PU2A

Crystal structure of the k246r mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
371
structure length
356
Chain Sequence
MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWRGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title The role of substrate-binding groups in the mechanism of aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 112
structure length 356
sequence length 371
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1pu2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pu2A01
2JKVA 4UVDA 2D5CA 3Q2IA 1XDWA 4XR9A 1E3WB 3RSHA 1UZLA 1VKOA 4J0EA 1B3BA 4DMLA 3L07A 2FRDA 2X5OA 5G2OA 1E1MA 3NTQA 3AI2A 4RZIA 3DBHB 3CIFA 2AEJA 1SOVA 2PNFA 2ZB8A 1NNUA 4IDAA 3RKRA 1BXZA 3RIHA 4PCVA 1NPTO 1FDWA 9LDTA 3E03A 4DUPA 4Z9XA 3LU1A 3TRIA 1TT5B 5GZ3A 1U2GA 2VNAA 4M86A 4LCJA 1ZNQO 4ALIA 2Y1OA 4H7PA 1JW9B 3AU8A 1YL5A 4RQTA 4NFHA 1K2WA 4PLWA 4CLRB 2A4KA 3HDHA 1M67A 4ND3A 3TZKA 3PDUA 3RVDA 3VZQA 2JCXA 4CM9D 5T57A 4TSKA 1E3IA 2IEDA 2LDXA 4QX6A 5ES3A 1GDHA 4UVHA 4ZQHA 1RM4A 4UVIA 2O3UA 2ZB7A 3PDJA 3UHAA 4GX2A 4UVEA 3LT0A 1X7GA 1MV8A 5KWEA 1NXQA 2CF6A 1LDGA 1PGJA 4OOEA 1C0LA 5EMHA 3KYBA 2VTEA 1GUYA 3UCEA 4HV4A 2D4AA 4ALNA 3ONEA 5JE8A 3KOUA 5I7SA 4BO0A 3JQAA 4HFRA 3WYEA 4AL4A 4JP3A 3LYLA 1N9GB 2Q1WA 1G0NA 4EUEA 4NBWA 1YL6A 4ESOA 3OIDA 3OH8A 4HXYA 3BMQB 4L9RA 4IBOA 4BO8A 3RBZA 1WNTA 3VPGA 2HQ1A 4J6FA 2Q2WA 2O50A 2X86A 5DN9A 4EBFA 1VKNA 3PJGA 3KHUA 1EDOA 5A5FA 3AJRA 1GYPA 1LLUA 2PLAA 1M66A 4XZ3A 2CUKA 3BHJA 4UREA 3TZHA 5A3JA 1PZGA 1JAYA 2Q99A 2QZZA 2NVUB 1PJLA 4OSPA 1WPQA 1X15A 1B7GO 3KEQA 4UEOA 3NEPX 5TF4A 1X0XA 2AG5A 1NHGA 5B4UA 3QVSA 2PFGA 4WLFA 1SBYA 4JGBA 1WDKA 2GRAA 4BGVA 4B4VA 1EEHA 4TZKA 3FI9A 1TLTA 1ZXBA 5ITWA 1MA0A 4RF4A 4E2XA 3G49A 2VRCA 1S6YA 3RC9A 2JHFA 4D42A 1ONNA 2R00A 3HNPA 1XU9A 4QT0A 1YJQA 4D45A 4BNTA 5CDGA 4R68A 3D5TA 2QRKA 3WBBA 4M8SA 1Y9EA 5IAAA 4FFNA 1Y5MA 1VJ0A 3EMKA 1MG5A 4FFRA 1M2WA 2VWGA 3E9MA 4TRMA 3PEFA 3R3JA 2VT3A 1XELA 3H9GA 3RUFA 3RBVA 1LQUA 1YVEI 5TT1A 4HUJA 4I5FA 3DFUA 4IS3A 3SLKA 3IUPA 5JMPA 2DTDA 4I5GA 3S55A 3JQBA 2IODA 4DYVA 2BH9A 3QLJA 3GFGA 4Y98A 4HFJA 4YT4A 3BXXA 2X9VA 4CM4B 4RQUA 2JD0A 4ZQGA 4YA6A 1N2SA 1TXGA 4BKPA 3C7DB 4EUFA 3L9WA 3Q1LA 3E5MA 3JQ7B 5DP1A 1PGQA 1U8FO 3CZRA 3ZDFA 3DC2A 1VL8A 4OGWA 2B35A 5I7VA 4OMUA 3FNFA 4GL4A 4YJDA 5K6AA 4TRNA 4BO7A 3FTNA 4KMSA 3KB6A 4D43A 4J2OA 1O0SA 4GLOA 1N7HA 2FZEA 1GZ6A 2DFDA 2OFPA 3T4EA 1M76A 1B14A 3E1KA 1YDWA 4TWRA 2ZTUA 3UXYA 3GF4A 3K92A 4L74A 4AJ1A 4YRAA 1MG0A 5JMWA 2V65A 5JAQA 2QG4A 2B4QA 4NHEA 5AXBA 3JTMA 4CM9A 1WP4A 4EEZA 4DTIA 5COAA 4M1QA 3G17A 2VWQA 3JYNA 3IKVA 1JVBA 4J9UE 1UZNA 4BS9A 4OM8A 3RUCA 1BHSA 3GGGA 2X4GA 2X0IA 2X1HA 4E30A 5DCWA 3DTYA 5H81A 1DC5A 1GUFA 2ZCVA 1E6EA 3Q6IA 3GZNA 3H7AA 3VVBA 1LQTA 3VPXA 1UDBA 1NQTA 5AXAA 1LSJA 5JPIA 2JFFA 3PYXA 4IDGA 2VUUA 4OXNA 1IHXA 1MLDA 4DRYA 1D1TA 3JCZA 1LRJA 1YGYA 1JA9A 3DR3A 3QSGA 3ZWAA 4DPKA 2OL4A 2W90A 5IXYA 3CMCO 4MVJF 5F5LA 2WE8A 4KQXA 4QO8A 2YV3A 2W2KA 1IPFA 4RLSA 1R6DA 5IXSA 1CF2O 3OJOA 1HKUA 1YOVB 2AQKA 3VZSA 3DBLB 2HK9A 1AUPA 5DBGA 1PGNA 4BNYA 1E92A 1SNYA 5CAEA 1BVRA 1ZZEA 1ZSNA 4GAEA 5AQ1A 1ZJZA 3PYLA 3OIGA 1K0UA 1Y81A 3ZV5A 1HE2A 4BIIA 5B37A 2UUOA 3NYWA 1UP6A 3KETA 5GZ1A 1H6BA 4P4GA 2VQ3A 2PKQO 1G0OA 4WLUA 4R54A 1HEUA 1KVRA 2O7SA 4LRSB 4YJFA 1PL6A 4E5NA 1Y6JA 2X8LA 3JQCA 3CUKA 4XIJA 1ADGA 2CNBA 3MJ4A 4B7UA 1LBEA 2PH5A 4N5MA 1LRKA 3DHEA 1OC2A 4CMBA 5G0WA 2EXXA 1GUZA 1ENYA 2ZK7A 3V1UA 3JSAA 2PGJA 2RHCA 3U5TA 1DIGA 4Z0HO 2FSSA 2IDZA 4WUVA 2EERA 3HSKA 6ADHA 1QV7A 1GTMA 1ZK2A 4XYLA 3DMTC 3V8BA 1N1EA 1UXHA 2GN6A 2I6TA 1NAIA 3AWDA 3Q9UA 4KUEA 3WQRA 4CQLA 3EY4A 2AG8A 4CV1A 2DT5A 5TGDA 2I99A 4NR0A 5HA5A 4DIBA 2NQTA 3W6UA 3E5RA 4KTVE 4J1NA 4M49A 3Q2KA 1BSVA 2FN7A 2Y1DA 2BELA 1XR3A 3PYMA 1F0YA 2WE7A 3AUUA 3GPIA 4O63O 1PJTA 3LZ6A 4BO6A 1NVMB 3G79A 4OHUA 4BB6A 3AM4A 4RPLA 3QP9A 4FJ0A 3EZYA 3U09A 4WCFB 4KUGA 1LA2A 4CV2A 3AM5A 3ZWCA 3L4BC 2BF7A 2P5UA 1ZEJA 4L75A 4IJWA 5IZCA 4B7CA 1LRLA 4DREA 5L4LA 1GCUA 5DOZA 3NX4A 4CMIB 2GN4A 3I52A 4DYDA 3MCVA 3NT4A 2ZYGA 4FB5A 3OP4A 5JNLA 1BDMA 4K26A 4JP2A 3RC1A 3ETGA 4FJ2A 1F17A 4YVFA 5A02A 2H63A 3WQSB 3PGXA 3A06A 2FWMX 4CMKA 4I5DA 3GEMA 1LLDA 3L9XA 5JYDA 1GY8A 1BDBA 1NYTA 2AW5A 3HN7A 3U0BA 1KIFA 1KERA 4CPDA 3GK3A 1ZXLA 3PIIA 4D46A 2RH4A 5EERA 4A10A 3TZQA 4ITUA 1XYGA 2JAPA 3HQ4O 4J4TA 5TX7A 1EMDA 2NLOA 3B1FA 3OHSX 1KY4A 1YL7A 3H9EO 2NQ8A 4CLEA 4D44A 1VC2A 4CQMB 8ADHA 4O0LA 4CLDA 1N1GA 1YS4A 1BXGB 1LC0A 4GKBA 1DEHA 3WGIA 2JFGA 2PTGA 4YR9A 1E3EA 1R0LA 4EUHA 3U62A 5A1TA 4BNXA 1EQUA 3V5NA 2NNLD 3DB2A 4GSLA 1WWKA 3V2UA 4E32A 4B3HA 4J1SA 3KYDB 1Z82A 2GZ2A 3KXDA 2FHSA 1NX6A 4FR5A 4R1UA 1NR1A 1O89A 1U2DA 3T7EA 4XQCA 4PLYA 3I3OA 2GASA 3NJ8A 5ITVA 1PQPA 3KSUA 1T25A 1CJCA 1MP0A 1JKFA 4J3FA 4BUCA 2VTDA 4JCOA 2JCVA 3PLRA 3K2BA 1BW9B 1A7KA 2RBEA 3DWFA 1NFRA 2YYYA 4RGBA 1I01A 1MUUA 1U9JA 2GCGA 4Q3EA 4O59O 1EE9A 2VN8A 3PHJA 4FFPA 4C7KA 1BXKA 3GVHA 1QYVA 2DFVA 4YJGA 1OI7A 1B2LA 3A1NA 1KVTA 4ZU3A 4MIYA 1BGVA 2X7HA 3VAZA 1PGPA 5F1PA 3MWEB 4RJTA 3WB9A 1PX0A 4ROSA 1FF9A 3GVCA 3K6JA 1VM6A 1CEQA 3U9LA 4LK3A 3IP3A 2DBVO 5JC8A 1PR9A 1KC1A 2HMVA 5JO9A 3F1LA 1GAEO 2AE2A 2WYWA 3RUDA 3SJUA 2EF1A 2FOIA 3GMDA 3HFGA 3HWRA 3RKUA 2FR0A 1W6UA 3ORFA 2J5KA 3QHAA 4A0SA 2B36A 2BRUA 3FR7A 3NRCA 4TQGA 4DC0A 1CQIA 4BMNA 3A9WA 4XB1A 3H2ZA 5I8ZA 1L1FA 2EJWA 1NP3A 2GNAA 4N5NA 1TI7A 1BTOA 1HT0A 4YB8A 4AJKA 1UP7A 2DVMA 4P4LA 3TZCA 2ZQZA 1MX3A 2XPCA 1LU9A 4UEJA 4D3FA 2FP4A 1YWGO 3G1TA 5BNTA 2P9CA 2RHRA 4CM5A 2JFHA 5J9GA 4CMEA 1CYDA 3GOHA 4HKTA 3GC6A 5IJZA 4BNZA 4XD2A 2OHXA 1MGOA 2PKRA 1QYCA 3ITKA 1E6WA 4PLFA 4FGWA 4DVJA 4I5EA 5A03A 5DNAA 2RAFA 3K9QO 4RVSA 4DPLA 3FR8A 3VTZA 3W4JA 1L7EA 1Y8QB 3QWBA 4MKRA 2J8ZA 2DAPA 1XSEA 3O4RA 5HBRA 1DJQA 4WLNA 4UUOA 4FJ1A 4O1MA 1LNQA 4CM8B 4F3YA 1PZHA 3QWHA 3D3WB 1NFQA 2B83A 2DBQA 3RWBA 1NPDA 3D4PA 1M6WA 1LEHA 5DBIA 4YDRA 3FTPA 5C7OO 3BMCA 2NVWA 4BO3A 4NIMA 1DJNA 4CLXA 5L45A 5TT0A 4NBVA 2Y67A 2TMGA 2Q50A 4P38A 2C29D 2EGHA 2YW9A 4A26A 4DMMA 1LLQA 3H6KA 1CRWG 2DBRA 1CETA 1HYEA 3GHHA 1YH3A 2EEZA 2J3KA 3DZGA 1F06A 1D8AA 4TKMA 2V6FA 1GADO 3H3JA 3B70A 4R01A 1PGOA 2ZTVA 4CR8A 1IHYA 2NU8A 1J49A 1GYQA 2QIOA 5MDHA 4BNKA 1RYEA 4RF3A 3LT4A 2FR8A 3CMMA 3GY0A 3AI1A 4YT5A 2EJVA 4YEDA 1DRUA 5A06A 1ULSA 1C14A 1JKJA 3OBBA 3WIDA 3GUCA 1DBVO 3INTA 3IL2A 3ABIA 3TWOA 1U3VA 4AICA 2AA3A 2V6MA 3JD1A 5IN5A 3MTJA 1HF3A 4TZTA 3AY6A 2BGMA 4DWVA 7MDHA 3AUTA 3HG7A 3CEAA 4BKOA 3JQAB 1SMKA 2O4UX 3O26A 1YE3A 2G5CA 1HXHA 2ZTLA 4FSHA 1ONOA 2SCUA 4YQYA 1VPDA 1OMOA 2C2YA 4WLEA 1RKXA 2IRWA 5LDHA 3KZVA 5JY1A 2B4TO 4NFYA 2AHRA 4BKRA 1GQ2A 2VNSA 4CLHA 3TOZA 4N7RA 4E0BA 3JQ8B 3NGXA 4M87A 2JAHA 5LDGA 1MFZA 1H94A 2D3TA 4ND1A 4M89A 4XQEA 1R4MA 4BNIA 5A4DA 3UUWA 1I8TA 2J3IA 2WYUA 5TNXA 3WGZA 3I9LA 1W4ZA 3OFSA 1KOLA 1R66A 5CG1A 3P19A 4Y8VA 1PJ2A 4MVJI 2BFAA 2Y1EA 5T8KC 3HUDA 4IQ0A 4G5HA 4CJXA 3H8VA 5BNFA 2OP0A 3GGPA 4YXFA 2W2LD 2JL1A 3GLQA 1U7TA 1E1KA 1Y5RA 4AJHA 2I3GA 3DTTA 4Z9FA 2I65A 4EEXA 2AQ8A 4B4UA 2C20A 2O23A 4MKXA 3VH2A 2PKQP 5JDIC 3DAFA 1NBOA 3U4HA 3AI3A 3PVZA 2CVQA 1SB8A 1AHIA 4H15A 1QXSA 4N54A 2I3AA 3WWZA 5A9SA 5JAIA 2PWZA 3DBRA 4E2YA 3WJAA 2IZ1A 4KDEA 3G1UA 3O03A 3OJLA 1HLDA 2VWHA 1JLLA 3VZPA 4XWYA 4R51A 3UKOA 2OOSA 1E3JA 1I2ZA 2HK8A 4KQWA 2EWMA 1ENZA 1JQBA 1PJBA 5U1PA 3E18A 4CMJA 2ZB4A 3E48A 1LTHR 3F46A 4XRGA 3U4IA 1T1SA 2G76A 2V7PA 3JQFA 3RJ5A 1B8UA 1JVSA 2NU6A 2WSBA 4KUHA 1C1DB 3WGHA 3QW2A 1YJ8A 3BTOA 1XU7A 9LDBA 1QYDA 2HU2A 2ZJ1A 4XGNA 4PIVA 3F5SA 4BKUA 2CDBA 4Y67A 4M54A 4FOSA 3QA9A 3AY7A 4JN6B 3BMNA 4BOYA 3C1OA 3D4OA 5G4KA 4RDHA 2XXJA 3UICA 2C59A 2VHVA 4NU6A 2QYSA 4ND4A 5A5EA 3L6EA 2IZ0A 1Z7EA 3WSWA 4IDBA 2W4QA 4NK5A 4BO2A 1O9BA 3PZBA 1VJTA 1A9ZA 4LCEA 3PLNA 1BWSA 3GRKA 4U6QA 1PTJA 4MOWA 1DO8A 2XOXA 3HADA 3WGTA 2DPHA 4MP6A 4YQZA 1HLPA 1FDUA 4E4YA 1X7DA 1CQJA 4XB2A 4R1SA 1I0ZA 3A4VA 4N18A 3OJ0A 2DM6A 1C0KA 1Z7BA 2PD6A 3C85A 3ZNOA 2LDBA 5KJ6A 1LXCA 2YZ7A 4RLHA 5EQFA 5CEJA 4Q3NA 5KKCA 1Z74A 4JQCA 2GUGA 4QXMA 3I9MA 3AOGA 1YB5A 1QMGA 5L4NA 3D0OA 2WYVA 3E8XA 1B8PA 2YV1A 1U3UA 3OQ1A 2Q1SA 1R0SA 1UUFA 3PQFA 2J5RA 2OP1A 2CVZA 4YPOA 4YRDA 4Z9YA 5THQA 3FNEA 1TA4A 3B1KA 1HL3A 5EIOA 3LF2A 6LDHA 3JQ9C 4MVJD 4YYZA 4B8WA 4YAJA 2JD1A 4PLGA 1X14A 2H5LA 5ER9A 1YONA 3R0IA 3ZHZA 5I8WA 1WDLA 2H6EA 1T1RA 4R5MA 4J91A 3WOHA 3KTDA 3PPIA 5LC1A 4B7XA 1DXYA 2O2YA 1ORRA 3DONA 4UEKA 3C1TA 4RL6A 1AHHA 2W2KB 5EINA 3JV7A 1Q7BA 3BIOA 2PA3A 4GPD1 4FD3A 1HZJA 3JYOA 4RORA 5BSFA 2O3TA 1PS0A 1FDVA 5KVQA 4LW8A 4ZD6A 4PG7A 1ML3A 1D1SA 1DFGA 4E21A 2EIHA 2C0CA 1PL8A 2P4HX 4YAIA 3DOCA 3WX0A 1WMBA 2WD7A 4ZRMA 3F4BA 3NT2A 4KWHA 5L95A 4I08A 2W2LA 4URFA 2O3QA 4E13A 5FFFA 3BMOB 1E7WA 1NASA 1HE4A 4JK3A 2G17A 4XGKA 5JAZA 5AVOA 2NACA 2VZ8A 5TC4A 5KTKA 1P44A 5FEUA 3MOIA 3BA1A 2GZ1A 2R00C 3GN1A 4ND5A 4ZA2A 5L3ZA 4PG5A 4YJFB 2X23A 2VHYA 4B4WA 3PWZA 1UJMA 1NWCA 2POQX 1KVUA 5FI3A 2BFOA 4QEDA 3GH3A 4PG8A 3GDGA 4XEHA 5IZ4A 4HNGA 4OL9A 5DF1A 3PJFA 2OUIA 4YT2A 3OEYA 1B15A 4PLCA 3WICA 4E2WA 1KS9A 2C5AA 3JQBC 2DUUA 4RVHA 3H4VA 3FBGA 2C7GA 3RUHA 3VDQA 2G82A 4H3VA 5U4QA 3BTSA 3OICA 5COQA 1HETA 1H2BA 5JS6A 5JY6A 1R4NA 1ISFA 4CQLB 2VYVD 4L4XA 5L40A 3A14A 1JWBB 1XHLA 4U0KA 4E12A 5BNIA 3GEGA 4FBGA 4WPGA 4Y6SA 3RCBA 2EKPA 3E82A 4E2ZA 2OBYA 4J16A 4MO2A 4NI5A 4H16A 4NJMA 2D1YA 2RH8A 3GUYA 4NMHA 1DOHA 1KBZA 4MPDA 5K6AC 3L77A 2YQ5A 1LJ8A 4OYRA 4CL3A 4CLOA 2F00A 2GDZA 3R3SA 2Y93A 3C8MA 1EUDA 1NAHA 3WWYA 3FD8A 3GRPA 4R1TA 1HDXA 3OJEA 3RI3A 4IDFA 3DHYA 4CODB 5HRUA 3EYWA 3HB4X 4JJIA 3CE6A 4CUJA 2CSUA 1WXDA 4RVFA 3QWFA 4WGGA 1E3WA 4C7JA 1GYRA 4FC7A 4AG3A 1VSVA 2YFHA 2Q1UA 4QFCA 2QRJA 1ZIDA 4FN4A 1JAXA 3ZWBA 3ZV6A 2DPGA 1P1RA 3GNQA 4AJ2A 4XYBA 4X54A 3Q9NA 1YXMA 4LGVA 1VJ1A 5U9CA 4INAA 5GY7A 3MJCA 1YQDA 1I5RA 4AJOA 3B1JA 2P9EA 3IS3A 1FJHA 1H6DA 2D0IA 1I2CA 4PG6A 5C3MA 3WTBA 3VPHA 1CWUA 1F12A 3QVXA 5DULA 4MVJA 4GGPA 4HP8A 1DC3A 4J2HA 1NWHA 3TSCA 4NZ9A 3JD3A 2YHIA 1I33A 1E3SA 1E1NA 5THKA 2YDXA 4A27A 5ICMA 2B5WA 1AE1A 1EZ4A 1ZBQA 4HFNA 1T4DA 4WOJA 4GMGA 2OMEA 5CDSA 5JAMA 4MVJP 2HLPA 4IIUA 3SC4A 1UXIA 4B4OA 3IC5A 4R9SA 2XAAA 1HDZA 3WGOA 5COBA 4UVGA 5GMOA 3ST7A 4DLAA 2O2SA 1HDYA 3SBOA 1N9GA 3LK7A 2WEKA 4PVDA 3PHHA 3BMQA 5K9ZA 1IOLA 1SPXA 2V6GA 1SEPA 3S8MA 2GN9A 1R12A 4CUZA 2DKNA 1DAPA 4GWGA 2VWPA 3CINA 1M75A 3NDIA 1U5CA 1WMAA 1ENOA 4GH5A 1OC4A 4QO7A 4R9RA 4YJGB 5DCUA 4UAGA 1X7HA 1NHWA 1E5LA 4XIYA 3VHRA 3WLEA 4C4OA 1EVJA 2BFMA 3D7LA 3GVPA 2CDCA 4J7CA 4G65A 1C0PA 3LF1A 3WFJA 3N58A 3R1IA 4EJ6A 5C7IO 4W99A 3ANNA 4ID9A 3D3EA 3PK0A 4GMFA 5T64A 4BNGA 1W8DA 3EUWA 1NTOA 4EI2A 3MOGA 1DC4A 3ZWMA 1ENPA 5G0TA 4EDFA 3GDOA 3CKYA 4IMPA 2YV2A 3GDFA 4ILKA 3TNLA 2VYVA 1Y1PA 2GYYA 4IJVA 2Z5LA 1EDZA 5HS4A 2OO5A 4PLVA 4QQRA 4BNVA 2NTJA 3NAQA 3TFQA 5I7FA 4BQPA 4TRJA 4ZHSA 3NV9A 5KIAA 1BMDA 2Q49A 3O38A 5H83A 3KSZO 4IM7A 1NVGA 3RD5A 5CPFA 3HZZA 3RC2A 1PZFA 1WZEA 4OKIA 2TMDA 3OF2A 2NV6A 4KZPA 4TMFA 3W8DA 1PS9A 1LUAA 1QR6A 3DZFA 2GLXA 1J6UA 3IIEA 1D4FA 3ZWNA 3PQEA 3JYLA 1XG5A 1N8KA 1PJQA 2FZWA 3C24A 5IZCC 1DDOA 1EK6A 3ITDA 4B79A 4LSMA 1DPGA 3PWKA 5JLAA 8LDHA 2B69A 1G6KA 2D59A 2PR2A 1NQOA 4Y9DA 2X6TA 1YKFA 3VDRA 1JU9A 4Y6PA 1XEAA 5F1KA 1Q0HA 2RIRA 4XA8A 3BMCB 4DBVO 4FQ8A 2ZKLA 3FSRA 3L4BA 5IDQA 5JYFA 3VH1A 2UUPA 4EYEA 5JYEA 2HSDA 5F5NA 3K73O 3UOGA 4K6FA 3AU9A 4E5MA 1MC4A 1B16A 1QYWA 3PHLA 3DZJA 4HNHA 5HS6A 2UVDA 3INGA 1LDEA 5DT9A 1IULA 3EDMA 3PGJA 3DOOA 1IY8A 1Q0QA 3WMWA 5C7LO 4GSKA 4XJTA 3P7MA 1YO6A 3ETEA 3I9OA 3M1AA 2QHXA 5AXDA 3K5PA 4EGFA 1ISGA 1T2FA 4IXWA 4Z3KA 5B4TA 4GBJA 3S2GA 3FHLA 1HTBA 2X58A 4D0SA 1XCBA 3DL2A 4IUYA 3I9JA 1PJ3A 3MJEA 1GPJA 1ZCJA 3HN2A 4R16A 3VC7A 1LLCA 1X13A 3H3FA 1ID1A 2AEMA 3IJRA 1PIWA 4YJHA 4P4NA 1IUKA 4WNCA 3GA0A 2WDZA 4D3SA 2VCYA 1AXEA 5ILOA 1QLHA 2X0RA 3RAJA 3ROMA 1UR5A 1TEHA 1P3DA 3ETDA 3X2FA 1GEEA 3LLSA 1E0DA 2JD2A 4ZN6A 3DBVO 4R1NA 2PZJA 1DIBA 4R4JA 1IE3A 1K3TA 3FN4A 4I9UA 4BHTA 1T26A 2Y1CA 5CDYA 1P77A 2OGUA 3I6IA 4W7HA 4ZQFA 2QX7A 2VHZA 1Y7TA 3JQDA 2H9IA 3WLFA 4WJZA 3I5MA 4II3A 3FNHA 2NWQA 3K30A 1DIAA 3RBXA 1EE2A 1HZZA 3HDJA 2QZ9A 4WECA 4AFNA 3NT5A 1GQYA 4GLLA 3FNGA 4R3WA 5TQVA 1RJWA 2ZIZA 1QYXA 3ZNPA 4XKJA 2BFPA 4EZBA 3GN2A 3ZU4A 3KBOA 2Q4BA 4XR4A 4CMEC 3SVTA 1E3LA 2C7VA 3GEDA 2P5YA 2YHUA 5IDYA 1RM3A 3ZHBA 5JDCA 1WZIA 1PJCA 4MVJG 4I8XA 2GN8A 2Y1GA 3I4CA 2FPGA 2P91A 4HY3A 2PGLA 4GX5A 4IIVA 2OBNA 4NK4A 5A9SB 3NDRA 1ZK3A 3OJFA 3EW7A 1P1KA 1I36A 1ZUD1 2Y68A 1DB3A 4OQYA 4WEOA 2Q1TA 2YQ4A 3SEFA 3WBFA 1R0KA 4W4TA 1GZ3A 1VL6A 5IN4A 2C5EA 1XA0A 3O8QA 3I1JA 4JROA 4B8ZA 2NU7A 3OQBA 2ZATA 1TT7A 1WVGA 1P1JA 4RDIA 4BMSA 3RU7A 5B12A 4HWKA 3JQGA 3PP8A 4YAEA 4R41A 1V3VA 2WM3A 1M6HA 4A7PA 5B4VA 5L51A 3ZV3A 4WCFA 3ADOA 2NUAA 5TS3A 4CMCA 4OKNA 1U5AA 1GV0A 1UP4A 1HE5A 1I10A 2AQIA 4K9DA 4ALKA 3WYCA 1RM5A 2P9GA 1Y8RA 4XYEA 5EPOA 5G4KB 4QTZA 3WDSA 2C07A 3VKUA 3EZLA 1GL3A 3WNVA 3WJ7A 2I5PO 4PRKA 3HJAA 1B26A 3GZ4A 4XYMA 1JWAB 1KEVA 2Q4EA 1LDYA 1AXGA 2Z1MA 4JBHA 4BO5A 3JQEA 1ADCA 3SC6A 2VUSA 1UXJA 3TZ6A 3HDYA 3D1LA 3W1VA 3DAPA 2HMSA 1N5DA 4LN1A 4W9NA 4XJSA 1V3UA 1HSOA 3PI7A 4K6CA 4BNUA 3IUSA 1A5ZA 3KUXA 4D7AA 1J0XO 3GVIA 1O95A 4J4HA 5L4SA 2WD8A 3K2EA 1KY5A 4HFMA 3FBTA 1KVSA 1H9BA 1SEVA 1ZK1A 1LC3A 2J3JA 4OIMA 2EP7A 3W8EA 2EW8A 3P2OA 3ZWYA 3QVTA 4WOKA 1P0CA 3WIEA 5DCYA 2G1UA 3FPLA 3UFXA 3QVOA 4Q3BA 5BSGA 4PLTA 2VHWA 3ON5A 3PRJA 2Q3EA 1KEPA 2UDPA 4XGIA 2GPTA 4GQAA 4D79A 3JQ6A 1FMCA 2CDAA 3H9UA 4AVYA 4FOOA 4D0RA 2FMUA 1YRLA 2ZJ0A 4TVBA 1ZH8A 1C1XA 3INRA 4DQVA 3VOSA 4BV9A 2HDHA 4YTEA 5G0UA 4RV9A 1HDOA 4ZGWA 1EVIA 3WNQA 4NNJA 1XLTA 1ZK0A 1OOEA 4Q39A 3X2EA 2Z95A 3QE3A 4PG4A 3PFFA 2WD7B 4TROA 1GD1O 4BNNA 2O3RA 1A27A 2QQ5A 4ALJA 1P33A 2ET6A 3D64A 5L53A 3LVFO 4KTTE 1Q2XA 1EVYA 4L8VA 4R3NA 1KVQA 2AEFA 3K8ZA 2FR1A 2DTEA 3RASA 1KEWA 1LDBA 3D5QA 5EN4A 4JXKA 4OQZA 3LQFA 1O94A 4FFLA 1PZEA 3DQPA 3ANMA 3RFVA 4MJLA 1PSDA 2DTXA 1VRWA 3LSYA 2O3JA 4KWIA 5I7EA 4G81A 1PL7A 5I9LA 1NQAO 3KM0A 1GU7A 4XCVA 1KC3A 2HK7A 4BKQA 3QY9A 2E4AA 4ZQEA 1E7RA 4R5HA 5EL0A 3BTVA 5A9TA 4BV8A 1F14A 3W4IA 5FF9A 3BTUA 1RYDA 4LISA 3T7CA 4DQXA 4IPTA 1HYGA 1XGKA 1Q7CA 5G0VA 1B0AA 3L4SO 4IJKA 1R4NB 2HKIA 4MINA 1A71A 1E1LA 1GQQA 1K6JA 3MJTA 4MDHA 3AW9A 1LSSA 3KYCA 1CIVA 5JDIA 3AOEA 5KJCA 3JQFC 2FY8A 2DU8A 3S2FA 4AJPA 1JTVA 5DBFA 3DDNA 4AJEA 1IPEA 4NJMB 3ENNA 1BRMA 1N92A 4GX1A 4YAKA 4E33A 2HO5A 2E82A 4E5PA 3QWAA 3WGGA 1WW8A 1Y8QA 3F1KA 3BAZA 3BHMA 3VTFA 4B3JA 4GKVA 4QUKA 2NTNA 1R16A 1U28A 3LT1A 1J4AA 4FW8A 2CFCA 2FSVA 4RPGA 5A3VA 1XWFA 1F8GA 2A94A 4BVAA 1ONPA 1YBAA 3VPSA 3TN7A 3IDSA 2Q45A 2B0JA 3OA2A 3E6AA 4JNKA 5ENVA 1RPNA 3FF4A 1DHTA 1ZSYA 2GO1A 2PV7A 1FK8A 1ZVMA 4YACA 5J23A 4HX5A 3JD4A 1U3WA 2NTVA 5DOVA 3CXRA 1ISMA 1ZEMA 4II2A 1XQ1A 3ZHYA 1VL0A 2VRBA 1YDEA 3GR6A 1P1HA 4PFJA 4QFDA 3RFXA 1OZAA 1GR0A 1LX6A 3P5SA 3GAFA 2YY7A 2Y0EA 4LMRA 3C7AA 4YRBA 3GZNB 4ZJUA 3OM9A 1KYQA 2EKQA 4OH1A 5CP8A 4IDDA 4MP8A 1E7SA 3NJ4A 4RCVA 4F6CA 3KO8A 3FRJA 5ENDA 3EC7A 1PJSA 2IYOA 1ZW1A 1V6AA 4P8RA 2I66A 2YHIB 2BGKA 2PD3A 3DZBA 1A4IA 1VLLA 2JJYA 3ICPA 5M6DA 2X9GA 5IF3A 3PJDA 4D41A 4J1QA 4PRLA 1ZKMA 5FI5A 1EUCA 1QV6A 1V35A 3S2EA 3D4NA 1DFIA 2ILTA 2EG9A 3I23A 1JDJA 1QORA 1H0KA 1I24A 2CF5A 3ZWPA 3M2TA 3PXXA 4XX0A 3ADPA 4AJJA 3JQ9A 3Q0EA 5JCXA 3WQQA 4L4RA 2W8ZA 3B6ZA 3LC2O 2J5QA 3VPFA 2XXBA 1CERA 1QG6A 4MVJH 4G2NA 3ICCA 3OMLA 4F6LA 1G1AA 4N5LA 2VOJA 3E9QA 3DAGA 2NM0A 4OOFA 2AQHA 1LSUA 3JQ8A 2BI8A 1GCOA 5I9MA 1NR7A 2PK3A 3PTZA 1T24A 1W73A 5F3RA 3U49A 3WTCA 4JJGA 4PVCA 4MIEA 3HHPA 3E9NA 4IINA 3EVNA 3GFBA 4S1VA 1DIHA 4IQGA 1GV1A 1RM0A 4RF5A 4XDZA 3GPDG 1ADFA 2AE1A 2V6BA 3LDHA 4PGFA 4IZHA 5DP2A 3TOXA 4L0QA 2IEBA 3GHYA 4DXHA 4O5OA 3RC7A 2Q2VA 1QKIA 1MB4A 4BNJA 5KJFA 3RUEA 4FIZA 5KJ1A 2PZMA 3GNSA 1O5IA 1LSOA 2FPIA 2HRBA 4CMAA 4DLLA 3ASUA 3GMSA 3M6IA 3QJ5A 3COSA 3VH4A 4IJUA 2BLLA 1I3NA 1DAOA 4Q3AA 2Y0DA 3RROA 3UGKA 1MXHA 1X1TA 2BD0A 2X22A 4L76A 4NH4A 1E7QA 2ZYAA 3DXFA 4WKGA 4BL5A 4CM6A 5C5IA 2B4RO 2BHLA 3RUAA 4BNWA 3SLGA 2C54A 4CV0A 2AXQA 1I3MA 2ZYDA 4E6PA 1Z6ZA 5KVCA 5TIIA 3PFWO 2VOEA 4UULA 1P45A 3QV1A 1JN0A 4RVDA 1WLYA 3SJ7A 3ZWVA 1C3VA 3MTGA 4L4SA 5L7TA 1SAYA 1WDMA 1SZJG 5L7WA 4LVCA 4WASA 3GNTA 3H5NA 4FFOA 4KDFA 2HJRA 1QRRA 4FC6A 1ZSVA 2YJZA 3FPCA 1QP8A 2GR9A 3ZU3A 4E3ZA 3AK4A 2DUWA 4R69A 2VT2A 4BO9A 1TB4A 1C1DA 4CV3A 3U4CA 5KKAA 1B3RA 5TLSA 2D2IA 4XRRA 4ALMA 4CMHA 5IDWA 4JBGA 4PLZA 3DBHA 2YDYA 1AGNA 2ZQYA 4BGUA 2VYND 1YB1A 3SXPA 1A9YA 2HRZA 2I67A 1I2BA 3I83A 4KP7A 3WR5A 1K89A 3I6QA 1R37A 3ROQA 4E31A 4GI2A 3V2HA 5EESA 1KEUA 4J49A 1TT5A 1KETA 2J6IA 4FFMA 5BT9A 5TSDA 3T4XA 3WSVA 4CM1A 5JO0A 3B20A 4MVJM 4JX8A 3ZH2A 2WJPA 3NDJA 4EJMA 1FXSA 1MFPA 2IXBA 1YQXA 3PJEA 4CLRA 1Q1NA 1T2CA 2VHXA 3TFOA 1PS8A 2YFQA 3I9NA 4ONEA 5TJ9A 3CZMA 4BNHA 5KVVA 3CSDA 2PY6A 1UXGA 2Y99A 1T2AA 3IMFA 4DLBA 2YUTA 4FCCA 3C1AA 4BO4A 2NADA 4W6ZA 2CY0A 3ULKA 2Q2QA 5EQDA 4LSWA 1UH5A 1XQ6A 2BMAA 4IXTA 3JD0A 3UCFA 1P9LA 3LC7O 5BSHA 1EBUA 1HSZA 1PWZA 3ZW9A 4TRRA 3BHIA 2X0JA 4ND2A 3PHIA 4RVUA 3S1LA 2P68A 4BNFA 5JSFA 4PZCA 3V1TC 4DBZA 3ENKA 1L7DA 1IZ9A 4J1TA 3VH3A 2BKAA 2ZB3A 3L0DA 4WNIA 4YJHB 1ULUA 2CZCA 3I4FA 2CVOA 4ZICA 4GVXA 2I9PA 2PGDA 3Q11A 4U6SA 2E48A 3TJRA 1NPYA 4NG5A 5IG2A 2GF2A 5ER6A 2NVUA 3S2IA 1UXKA 4CR6A 3PIDA 3ZCXA 4I9NA 5JCJD 3L6OO 4IGFA 2WMDA 3WS7A 5KCZA 1S7CA 1HRDA 5L7YA 1PQUA 2EHDA 3MWDB 3NTRA 4L73A 1EUZA 1IZ0A 1E77A 1H5QA 2UYYA 4EJ0A 3BMOA 1Y9AA 4WLVA 3HDQA 2IZZA 3F3SA 3JYQA 4BB5A 2QYTA 3AUAA 5H82A 2VZ9A 3UN1A 4Q3CA 1PJ4A 4AJIA 4F46A 3ZU5A 4A2CA 3AFMA 3KRTA 5BQFA 1QSGA 4FDAA 4YAGA 4RF2A 1E7YA 5JYAA 1DSSG 3WYBA 1IB6A 3H9JA 4P22A 3GVXA 1DC6A 3PZRA 3ZW8A 4S3MA 4J43A 2QRLA 2FPPA 2Q46A 3GGOA 3OETA 1P74A 2X9NA 3LT2A 5I9NA 1SO8A 1GFSA 3OSUA 3H9QA 4A73A 4E5KA 1ZMOA 3OIFA 5JBIA 4F45A 1RWBA 5FYDA 3DMTA 4WE3A 5F21A 3ZWWA 3P2YA 1EVZA 4A5OA 4CM4A 5JFOA 1DHRA 5CDUA 2VUTA 1VI2A 1Z45A 2Q22A 4E5YA 4MP3A 3K31A 5KVSA 4PZEA 3JQ7A 3O8QB 3C7CB 3IQDB 3DOJA 1BG6A 3FWNA 3HE3A 1UAYA 2ZTMA 2EW2A 2HMWA 3V1YA 5BR7A 3JQGB 2VYNA 3WFIA 5F1OA 1H6AA 2UV8A 3AUSA 4UUNA 1A4UA 1DFHA 3CTMA 1OAAA 4D3DA 3RJ9A 3CPSA 4YWJA 1Y8RB 3HB5X 3ZNQA 3EGOA 1I3KA 3IJPA 5TJHA 1HDCA 3KLPX 4HADA 1D7OA 1LDNA 1UDAA 1R15A 3KLMX 2GSDA 3C3XA 4CR7A 4W82A 3UF0A 1J5PA 3IP1A 3Q3CA 2OZPA 1MC5A 4DGSA 1I30A 3IAHA 4K1LA 3RU9A 3DMYA 3U3XA 1VE9A 1A72A 3ONDA 5EJ2A 5ADHA 1U7HA 3NKLA 4QSMA 4Z0TA 4IQ8A 4IDCA 1V0JA 3WGQA 1NVTA 5CDTA 5T67A 2WWRA 3RFTA 3EHEA 1K6XA 1EK5A 1XIVA 2DLDA 4RPJA 2C2XA 3EK2A 4XDYA 4ZRNA 5JW6A 3RUIA 3DZKA 1T2EA 2QW8A 1SB9A 4CQMD 5C37A 2HMTA 4J0FA 4CM7A 3GG9A 3KV3O 1WAMA 4NBTA 3BYZA 2E49A 4EW6A 2PD4A 2P2SA 4OO3A 1MXFA 2IYPA 3DO5A 2NSDA 3WMXA 4NBUA 3DZIA 4QECA 5KNLA 4LMPA 1H9AA 1P1FA 3F5QA 2DQ4A 2GGSA 3FCOA 4YCAA 3ZHXA 4FGSA 1OBFO 2O48X 2PZKA 3ANLA 5JCJA 4EITA 2W98A 4U5QA 4CM3A 1ZJYA 4Y6RA 2IXAA 1HDRA 2WTBA 3NUGA 1JKIA 1YOVA 3DBLA 3DEYX 3QQPA 3F47A 2EKLA 1C1XB 1R4MB 4MIOA 1N7GA 1PWXA 3NTOA 1GEGA 3G3EA 3H5AA 4JBIA 4O6VA 3TL2A 3ZWXA 1SC6A 1T2DA 3HFSA 4J4BA 2IE0A 4NFSA 5KOIA 1FDSA 2B5VA 3QIVA 2EGGA 1I32A 1V3TA 2EV9A 1ISIA 3QWIA 4CMGA 5ICSA 2XF8A 3STHA 5AXCA 4BGEA 4YBZA 3M1LA 3N7UA 4UUMA 5IDXA 4TKLA 3R6DA 3EVTA 4OXYA 2A35A 3H5RA 5JDCC 4IGEA 2A92A 2NU9A 5JXWA 4NJOA 3DFZA 3GT0A 4I1IA 2Z1NA 1SOWA 1E6UA 2E37A 4XQGA 1K6IA 1XKQA 1DRWA 3PWSA 1D3AA 3DBRB 4FPXA 4XQ9A 4IY1A 1PU2A 1ZFNA 4WEQA 3WG9A 2H1SA 3TDKA 1U4SA 2PH3A 4DIFA 5TRTA 1SCUA 2Y0CA 1OFGA 3ZU2A 2Y05A 2I76A 3KYCB 2P4QA 4Z6KA 4DIOA 1F8FA 2J3HA 5DDIP 4WLOA 1U4OA 4ALLA 2UAGA 5FWNA 5CHEA 5CPBA 5BSEA 1UAGA 1H2HA 4WCFC 1A7AA 4OAQA 1PR3A 3I9KA 4NBRA 3OEWA 5KJEA 2G0TA 4FS3A 3MJVA 1VSUA 5CEFA 3BMNB 5K0ZA 4CMIA 4W7IA 2OORA 4LRTB 1FDTA 2HCTA 5G4LA 3VVCA 3AY3A 4AJ4A 3W8FA 1GPDG 4GVLA 4M55A 3TQHA 2VZ0A 1HE3A 3L6DA 4DA9A 5JC1A 1U8XX 4AJLA 1V9LA 1ARZA 5HTOA 3M2PA 1DRVA 1NM5A 5CEEA 2GZ3A 4WK6A 4JIGA 3UH1A 2DBZA 1HDGO 5DZSA 1V8BA 1PEDA 2O4CA 4K28A 4WCDA 1K5HA 1Z73A 3N74A 4MKZA 2HJSA 4W9NC 1Q0LA 4BMVA 3JYPA 4RVGA 3GAZA 3ONFA 4IDEA 2AMFA 4IZIA 4PZDA 4GX0A 1UDCA 3H65A 3UCXA 4CQMA 1ISJA 3KSDO 1BXGA 1EQ2A 1ZO8A 5GZ6A 3NGLA 2E6UX 3IOYA 2HUNA 1X0VA 3GQVA 2R2GA 3G0OA 3PQDA 4NPCA 1E7MA 2F1KA 3UAGA 4NDNE 3ZI0A 3AM3A 1PQWA 1HYHA 3AFNA 3OA0A 4J90A 5A9RA 4OSOA 2BI7A 3F6YA 2O3SA 1P0FA 3KYDA 5G0SA 4BNMA 2BGLA 2X0NA 5T6BA 1H93A 3F9IA 2GD1O 2B37A 3OQ6A 3IKTA 1AN9A 1C0IA 2O7QA 1U3TA 1YBMA 3MEQA 5A04A 2RCYA 1ADBA 3LLVA 1DLIA 1LI4A 2X5JO 7ADHA 3KVOA 1GZ4A 1BW9A 4U0JA 1DLJA 2Y1FA 3DHNA 3VKVA 1B8VA 2D5AA 2X5KO 2A9FA 4HBGA 4PN3A 5B1YA 4GGOA 3W6ZA 5T73A 2OXIA 4J7XA 2DC1A 3UW3A 4IS2A 3BZUA 3PHGA 3JQAD 4B3IA 3U4DA 2HAEA 5CG2A 4DQUA 1ZK4A 1UZMA 4BNLA 1P31A 1YB4A 3VZRA 2PZLA 1YBVA 3ZNNA 4BQRA 5LCXA 2GERA 4OJNA 3ZZNA 2D8AA 3A28A 3CH6A 4U7WA 3UVEA 1ISHA 4J9VA 3QRWA 3ZGYA 3MZ0A 1H6CA 4BO1A 3W4KA 5IFLA 3JD2A 3LC1O 1NQ5A 2R6JA 3SX2A 4RO0A 1ZMTA 1EFKA 3V2GA 4AJNA 4I9HA 1EFLA 1EBFA 2EP5A 1IL0A 3KEOA 3QVWA 3MJSA 3TPCA 4RZHA 4BGIA 2C82A 2JCYA 3O9ZA 4JLWA 5T8KA 1E5QA 1O6ZA 2CMDA 1IYZA 4RPKA 3ZV4A 3TF5A 5ILGA 5A05A 3GG2A 2HMUA 4Z3DA 3OECA 4Q3DA 4KOAA 4ZVVA 4ZQBA 4U8GA 5AYVA 1TVEA 1BVUA 4J7UA 4IMRA 5CFZA 3FWZA 1Q7GA 3F4LA 1YQGA 1I3LA 4LVUA 4Q9NA 4YT8A 5MGBA 1T4BA 2VRCD 3RQSA 1HWYA 3AOEC 1Z75A 4UUPA 4XYGA 5T5QA 1X1EA 2Y66A 4DC1A 5L9AA 1U1IA 3ZN2A 4JJFA 5HM8A 4PLHA 3K96A 4Z0PA 1W0CA 2CD9A 3ROKA 3WGYA 4GWKA 3H2SA 3ROPA 2JHGA 4CLOB 3TL3A 4CL8A 1O8CA 1QLJA 4A03A 4DPMA 4TVOA 1NFFA 5AOVA 4CUKA 3ZWOA 4RPHA 2ZCUA 1P1IA 3ASVA 4NU5A 5HWSA 1DIRA 1LDMA 3DZHA 4CM8A 1CDOA 2NVBA 4OXKA 3D3WA 4DL9A 4MVJE 4PLPA 3WXBA 4NQZA 3EAGA
chains in the Genus database with same CATH superfamily
3ISVA 3UT5A 4O4LA 4DMCA 1WP9A 5HIAA 3RSHA 1XDWA 3FFAA 4NCAA 5FCDA 4PX5A 2FRDA 5TVOB 3OIVA 2ZUTA 3LXXA 2C3OA 1LTKA 1IIBA 4TUYB 1CFJA 3CIFA 3EOAI 2JARA 4GZ6A 1NNUA 2P79A 1HX7A 3CEHA 3VGPA 4E70A 4NV1A 2O8BB 1DWUA 2XQVA 2C84A 3W9SA 4B6PA 1VIDA 4Z9XA 4DUPA 3ESXA 3L8DA 5EJMA 1E0KA 4FSDA 3TRIA 4B7ZA 1I9GA 3A05A 4M86A 3CLHA 4LCJA 5CB4F 3GGDA 2QUAA 3GLHA 1ZCAA 1ULHA 1QWSA 1JW9B 2HX1A 1WO8A 3GFVA 3O4VA 4RQTA 2ZT7A 4UZFA 4PLWA 3COPA 1OVMA 2O7RA 5I3CA 1M67A 1ECPA 4ND3A 4G0MA 1GXSB 2FKAA 2R85A 3RVDA 2WLSA 4KIJA 2WQZA 3I6MA 4ESVA 3ZS9A 3DV0B 4CM9D 2W11A 1AGXA 3G59A 3CO0S 3OOHA 3UXEA 4O2BB 1KORA 5ES3A 4QX6A 2J4FA 1UC9A 4UVHA 1RM4A 1Z39A 2ZB7A 4F5EA 4GX2A 3BXOA 3LT0A 3N2ZB 1X7GA 1U99A 3HLTA 3QOXA 5AHKA 2HL6A 3ZCVA 4ZC8A 1UJ2A 2W4MA 4Y1FA 4D9EA 4BBPA 5KWEA 4U7DA 1BCRB 1D6NA 5EMHA 2AGVA 3DHVA 2B20A 4JLPA 1KEEB 2W2XA 1NVVR 3UCEA 1Z4PX 4ALNA 5JE8A 2OM6A 5I7SA 3GPCA 4BO0A 1G6OA 1MOZA 2QD2A 3PUVA 1G0NA 1Q0PA 4YRKA 1GITA 2ZUFA 3OIDA 1M2EA 3ZDRA 2K7FA 2W8BB 3H1TA 4FN5A 4IBOA 2ZAYA 4K6HA 4QDUA 3T4PA 2JJMA 3GPLA 4DR6B 2HQ1A 3FDZB 4KX5A 4FNMA 2RHOA 1WUTA 1DCMA 2X86A 4Q1FA 3BSWA 1T9KA 3ANSA 1VKNA 4MYCA 4YROA 1ZDMA 5LBUA 1NF8A 3I05A 1W581 3ER9A 2HTFA 1KAOA 2PXAA 3AJRA 1UFQA 1LLUA 3P9SA 4XZ3A 3SHFA 3ZE2B 4H6WA 1FVXA 3BHJA 4UREA 1FPMA 3TZHA 1PZGA 4CWAA 1ACJA 1UQTA 2AL7A 3OCJA 4AMBA 4DSOA 4IXNA 1PJLA 4MMYB 5LQAA 1YQTA 3B2NA 3PXDA 2BFEB 3C43A 3IOMA 1CHNA 5ESDA 4I5IA 1X15A 1GLVA 2JGKA 3K0EA 1B7GO 3VPCA 2ZETA 4GZMA 3NXKA 1Q19A 1U7PA 3M1IA 4UEOA 3BDVA 3NEPX 4KB5A 3RANA 3K9FC 1WUIS 1ESEA 2HCFA 5B4UA 2X40A 4XUGB 5KDOA 4PHTA 2XIQA 2A0FA 4HH0A 1QGDA 2Q4RA 2P2NA 3U4AA 1N5RA 4D5EA 4OCZA 4TZKA 3IDZA 3FI9A 1TLTA 2RH9B 4YMGA 5ITWA 3MYRA 4ED9A 2JJ1A 4JUCA 4AUMA 2VRCA 1P9WA 1S6YA 1OXUA 2JHFA 1E69A 5FP0A 4B6JA 3HNPA 2FRVA 1FS5A 1RFLA 4D45A 5CDGA 3AVXA 1RAAA 4N6GA 3VMFA 4OI0A 1G16A 1Y9EA 5IAAA 5IM4F 3B2EA 1Y5MA 1W88A 1VJ0A 1TJ4A 3BFJA 3EMKA 4QJBA 4WBXC 4WI1A 4HUTA 1XTJA 2VWGA 5LN1A 2WT4A 3PEFA 4O4IA 4YRNA 4E3WA 2VT3A 4NYIR 4D9GA 1P4HA 2BHTA 4KWTA 2SHKA 2PWBA 2FSUA 3DFUA 3I2HA 3IUPA 3K6KA 4UMFA 4JAVC 5EQTA 3SLKA 1W76A 3GFSA 2IODA 4AG5A 4CIWA 2O05A 1WB9A 3QIAA 2W6IA 2ZPAA 4QPNA 1YCGA 3EGWA 3V7UA 1KJNA 1XZKA 4AUKA 4QOSA 1ZINA 4RK5A 3CEPB 1RIIA 4HFJA 3BXXA 3BD7A 5D86A 2NIPA 1WXGA 1N2SA 3IBFA 3MWFA 4RK0A 3UJ9A 4BKPA 4RD3A 5JCPA 1IC6A 3L9WA 3Q1LA 1TYZA 3JQ7B 4QOJA 1KSGA 3UC9A 4CEHA 1PT8A 4QICA 2FU5C 3WGLA 3QF4A 1I4WA 4OGWA 4URWR 3MQFA 3SFTA 3R0ZA 4RD6A 1RQ2A 2HMYB 3MF4A 4GL4A 4CIAA 4JSYA 2VHTA 5ICEA 5TS2A 2FX5A 2GZDA 4BBJA 5HRAA 5JZBA 2DY0A 4FSXA 4OJQA 4O33A 1O0BA 1GZ6A 2DFDA 5CVTA 2E1PA 4JLVA 2H3HA 2XGMA 1JEYB 5J2UB 2N1BA 2TECE 4MEAA 2SKDA 2X19A 3KDAA 4NFLA 3URKA 1ZAKA 3VO9A 5FX2A 2W2PA 3ZKWB 2A9PA 4JBYA 3FLEA 1T6NA 2I6QA 3B8EA 4DMUB 1MG0A 5LIRA 1XZBA 5JMWA 2JAUA 1T3TA 1NGSA 4Y2TA 2B4QA 1HL7A 2VDPB 3EUFA 3NLLA 3DQQA 1FPQA 4CM9A 4EY8A 5KNBD 3I2FA 3H04A 1Q1ZA 5B1DA 1PFWA 1T0HB 1ZD1A 3RTCA 3R6WA 4UMVA 5EWJB 4RYLA 3RS4A 4X63A 2V9CA 1BHSA 1PTKA 3G8YA 1SQFA 2X0IA 1TPZA 3G0GA 3S44A 4ZZ2A 1QZUA 2O2CA 3CLVA 4IJ6A 3SYTA 3L8FA 4Q03A 4CGYA 1DC5A 1GZ5A 2ZCVA 1E6EA 2HLNA 3M9WA 3O5AA 4JT8A 3RAGA 3SQLA 4ZO9A 1WOYA 2AXPA 4R8SA 1U5BA 2XECA 3S70A 4FWBA 1UDBA 3VPXA 3WRWA 4BJ1A 2PS3A 3QTLA 3T52A 1F2DA 4CUZA 1A0OA 9ABPA 2PH1A 5JPIA 4UXJA 5DHFA 3ZGOA 4MICA 3IVMA 4AKHA 2PTHA 2ZEJA 3IR5A 2IDKA 5EE0A 5M5BA 2H31A 3B9RA 1CIJA 3PS9A 3QE4A 1U90A 4PNPA 3IP6A 4JDUA 2AJBA 3W2TA 1LRJA 5C80A 1SIBE 1K6MA 3DR3A 2ORVA 2IUYA 1IBCA 3QSGA 3WKAA 4DPKA 3BWXA 1GTZA 5CRIA 4U7JA 2QGNA 4QO8A 2YV3A 2W2KA 3V4OA 2X42A 4B32A 3UAYA 3BCSA 3B8HA 4B9EA 4RLSA 5K3OA 4WUTA 3B12A 3FFTA 3NHWA 5K09A 5IXSA 5TARA 3OT5A 4RIHA 4AX4A 3WGUA 1H8HD 2BDUA 1HKUA 2W6QA 4INPA 1YOVB 2G4CA 3VZSA 4DQDA 1XRNA 1CS0A 4P7JA 5KQLA 1JIVA 1YDHA 1AUPA 3NTVA 3FUWA 4BNYA 5ALGA 4EG0A 1E92A 2ZT8A 4L3WA 1H4QA 1X1CA 2G67A 1ZSNA 3GMTA 4DNFA 1HGXA 3PYLA 3QG5A 1K7XB 2JZNA 3E1GA 4DS3A 2GTIA 4BXOB 1EE1A 3UXMA 3NYWA 3BKWA 1QVRA 3V4LA 3UWMA 2ILVA 1IG3A 4P0TA 2VQ3A 2YL2A 2JFYA 3KFVA 5FTJA 4MULA 1ZAYA 5EMMA 3EDOA 4GYYA 1EAMA 1HEUA 1UJ6A 2GN1A 1QUEA 5I4IA 1HG0A 1JMYA 4OHXA 4YJFA 3LQ2A 3SNKA 3DL7A 4E5NA 3JQCA 1X39A 3CUKA 3AERB 3C3KA 5E3HA 2EZ8A 3W05A 2WOJA 5FPYA 1BS2A 1OC2A 1JF8A 1GUZA 3VR5D 2RBKA 2RHCA 4LECA 4S1NA 3S2UA 2X2FA 5EVJA 1RLTA 1XYYA 2B8TA 2NSJA 1OZGA 4WUVA 1JHXA 4NRDA 4CM7A 4D1YA 2FPGB 1GTMA 1K8QA 2V58A 3IX7A 2WINI 1QG0A 3F78A 2HRRA 3V8BA 2C8KA 3F7OA 4FCVA 3ROFA 5EUQB 2VF2A 3AWDA 4YAWA 5ITSA 3T1HB 3ILYA 1FP7A 2DT5A 2VHUA 1JJIA 3CLTC 4QXRA 2I99A 4GPAA 4NR0A 2OBXA 5TGDA 1U9IA 4B3TB 2N1MA 2Q3JA 3W6UA 1NMZA 3EBLA 1KEZA 5KHLB 1OI4A 1PR4A 1BSVA 1JS1X 2J07A 4I50F 2A84A 3SZLA 1TFRA 3R9XB 2XCIA 3CZCA 3JTEA 5ALLA 4C87A 4PY2A 3D8TA 1XR3A 4R2LA 4O63O 1JQJC 2Q4OA 3R7NA 4BB6A 4ZYUA 5FA6A 1UMDA 4FJ0A 3EZYA 3T3NA 3RSSA 1KXZA 4KUGA 3IAUA 5ECYA 4CV2A 3HVKA 3AM5A 1PW5A 1YUBA 5DM2A 1B2RA 3E3AA 2DFKB 4B3RB 1Y5NA 2VKTA 5IZCA 2VP4A 1I72B 3B52X 5E8RA 5B3LA 1E5XA 2GN4A 5AK5A 4ARZB 3ORHA 2D0OB 3TM4A 1E2EA 2X6RA 2YZNA 3GOQA 4EI8A 4PNZA 5B2EA 1JHZA 2FG7C 1LV7A 1A8HA 5KNBA 5FJIA 4MWZA 3ZJ4A 5EXDA 1K5DA 4AN1A 1F17A 1MB9A 3DUFB 1QCZA 1L5RA 2RI6A 3IE0A 1W25A 2EFYA 3ZIAD 3D81A 5D3ZA 3WQSB 2FWMX 5TEWA 4W7SA 4QXQA 3T9CA 4F04A 2VJNA 4K0KB 2VSNA 1TTHA 3M82A 2F1HA 1Z2AA 3L9XA 1NATA 1NZJA 2EARA 1F1BA 2Q1XA 3BJMA 4FNOA 1BDBA 3TLAA 2C1ZA 1KIFA 1KERA 5FWXA 2HHJA 3EQ7A 1ML4A 2YZKA 4D46A 2FPRA 2RH4A 5EERA 2XNJA 3L84A 3VA7A 2RHDA 3GJRA 1T6ZA 1Q1GA 5JFGA 3B1FA 3DZ7B 2EFGA 2C9YA 2QZ4A 5ICCA 3EF0A 1G8MA 4D44A 3P9IA 2ADMA 1Y5IA 2YXDA 2XVYA 1XDZA 1XFAA 1R00A 3GRAA 2IHNA 3GO4A 2PKXA 4D0NA 4EF5A 4P80A 2W58A 4A2PA 5TR9A 4LBYA 1DEHA 4AUEA 1JDBC 4ESEA 2WTNA 2YASA 4W9RA 5DN6D 3ZGLA 1DT5A 5SZIA 1EQUA 2QZJA 2WF7A 2VDLB 3F49S 2VG8A 4E32A 4MRMB 2V5AA 3T1YB 1R8SA 4WK4B 5DE3A 1QIMA 2YY6A 2D74A 1F8YA 1V8DA 3KKKA 5T7BA 1Z82A 4EJ2A 2HJ9A 5HQ3A 1NX6A 4FR5A 4NAUA 1O89A 4PSAA 3F3YA 3O1JC 5FLEX 4AZ0B 1H8HA 1TGYA 1L5KA 4PLYA 2C5FA 2I34A 2FH5B 1PQPA 3K1TA 1B4DA 1T25A 2XWQA 3OZBA 4G0QA 4BUCA 2VTDA 4H6XA 3H1AA 4X6YA 4A6DA 4Z4FA 4JBLA 4EW1A 2GAAA 2HT6A 1OGIA 4FGUA 4ECEA 2G1AA 4RMHA 2VUHB 5BWLA 2YYYA 4ZWNA 4UBJA 4YC7A 1SHKA 5IAOA 2GCGA 4Q3EA 3OTIA 4N8SA 1VXRA 2CEAA 1O97D 1B6GA 4DCSA 5AOBA 1KR2A 3IPYA 2FWAA 3A26A 4CDGA 2B82A 5F73A 5NULA 4ZT2A 3A11A 3P0HA 1XEXA 1FXWA 1OI7A 1XCJA 4EDHA 1B2LA 2YX1A 1KVTA 3RU2A 3VYSB 1IWBB 3ECCA 3SC2B 5GIPE 1AS2A 2Y9MB 4TV8A 1CUHA 4RJTA 4ROSA 4N5DA 2HCBA 2V7GA 4LK3A 2WWHA 1PR9A 1HLFA 2HMVA 3D59A 3W6OA 1GCIA 3GA5A 4NCIA 2QAGB 2OPBA 2FOIA 3VR5A 3RKUA 1XPOA 1J1IA 3MWDA 4FW9A 3ORFA 4EPXA 1U9ZA 2BGJA 5A62A 3I76A 4UM5A 3QHAA 4LDJA 3TJMA 1Z5WA 2B36A 2BRUA 3FR7A 3NRCA 1COZA 4IKOA 1V9SA 4RMNA 5AKKA 4ZVUA 1RXIA 3ZR4B 3V48A 1GRRA 4DJDC 3H2ZA 1X70A 2BFCA 4OLFA 3N2GA 3FUUA 2V8BA 3R40A 1IFXA 2ZG6A 2NPIA 2GBPA 1Z28A 1LU9A 1G8KA 3A36A 3HCAA 1YWGO 1Y1LA 3G1TA 4D3FA 1PJAA 2IWRA 3RRFA 2E4WA 4XWAA 4BIMA 1S3IA 4LY6A 3O94A 2D1SA 2NPOA 1CYDA 1C41A 4HKTA 2H1IA 5CYPA 3PX2A 3REGA 4BZWA 4RA6A 3AJDA 4XD2A 4L0DA 5E38A 5ALXA 3H84A 1Y1TA 4ETMA 3R5SA 2FMTA 4QTXA 3WO0A 5EHQA 2GFHA 3QF7A 1V7PC 3HZOA 4FGWA 4FD2A 4D4LA 4DVJA 1T6YA 4I5EA 5DNAA 1Z4KA 1BE8A 2J87A 4MRPA 3K9QO 5CX1A 5JQGA 2OE2A 2DFNA 1NKVA 5JD3A 4IICA 4RTNA 3FM9A 3VTZA 1CUJA 4F12A 1L7EA 4E07A 3LYUA 5B3JA 2AN1A 3GD5A 3TNFA 2DAPA 3D43A 1NV9A 4WLNA 3UB4A 4UUOA 2PFSA 1HOTA 1K63A 3DF9A 5KKNB 3P96A 3E3MA 4B6QA 1NL3A 4M0LA 2L42A 1E2NA 1SIUA 2D2VA 3OOJA 1PZHA 5IVHA 4NC9A 5H3LA 4YI5A 2DBQA 4QDTA 4QFMA 4IGIA 1E9CA 1NPDA 4DNPA 2A2ZA 5JSKA 3EEYA 4TL9A 5B57C 4OX9B 3FTPA 1S4QA 4MH0R 3UJHA 4A1OA 2NVWA 1NXPA 5I45A 2B25A 3ACBA 4NIMA 3R7LA 1QHHA 3QXSA 2R8EA 1DJNA 4JFRA 1N2CE 1MEJA 1R5BA 1EXWA 1H2ZA 2Q21A 3S5UA 3TQCA 3TZLA 4YDHB 4BFLA 5MN6A 3GBVA 5FWAA 2Q50A 4GWLA 2ZS7A 2C29D 3K2QA 4MW5A 4R0NA 4XH9B 1ITZA 4JCCA 4BWVA 3Q5EA 2Q9CA 1ONSA 2DBRA 4JWTA 1E58A 4ATNA 2HLDD 1YH3A 2EEZA 2J3KA 2PS0A 1P6XA 1F06A 2YOHA 3SOZA 1TE2A 4B83A 4I8IA 5DN6A 2PVSA 1FNSA 3RLIA 1NOJA 1XOIA 2V6FA 3HP1A 3H3JA 3NWOA 2G06A 2F3UA 1PGOA 2G80A 2NU8A 1J49A 3K70C 3OQMA 3NUQA 1VJCA 1WS6A 1H1LA 1TJ3A 2GB4A 3ETLA 3QLVA 4G4SO 2H85A 4UNIA 2G71A 4BASA 3PPYA 1GFZA 1ZH0A 2FR8A 3LY9A 1P29A 4W8HA 2EJVA 4YEDA 1CE8A 4YT5A 3SGLA 3BT7A 1KO7A 1UT8A 5A06A 1ULSA 2GYUA 3DOUA 1O2DA 4JJ4A 3IR6A 3WIDA 2CWDA 1FFHA 2FG6C 3INTA 3K0KA 4U2CA 2YV4A 1F6BA 1M2GA 1ZWKA 3FKQA 3LVQE 3QX8A 2AA3A 3W0LB 1MQAA 1VCNA 4W5HA 5E4TA 3SZGA 3G2MA 4WV3A 1LK5A 3EHDA 5IW8A 2V6MA 2W48A 5LIPA 1EJ0A 1VGQA 3X2SA 2JFQA 1WB6A 3CEAA 4LJ9A 4N9QA 1XMSA 2B30A 4L4UA 2OV8A 3JQAB 3NHSA 2B6NA 2HSZA 2Q3MA 2V0NA 3NM6B 4TS3A 1YE3A 4D8YA 1AU9A 5FA8A 2IYSA 2ZTLA 2NXNA 5C8XA 1ONOA 3BREA 4NMLA 1QIHA 2G77B 4WLEA 1RKXA 1V8FA 3KZVA 5JY1A 2B4TO 1JG6A 4RMJA 4XB6B 3B13B 4NFYA 4MJXA 2B9VA 1ZRMA 2ZT5A 3KQNA 1ELOA 1GQ2A 1IM8A 1JEQB 1E2DA 1YI1A 3L82B 4A8JC 3DP9A 3TOZA 4EQ6A 4OJMX 3NGXA 1GU0A 1WD5A 3H97A 4CW7A 1W36D 1AQYA 1SBIA 1X7ZB 1V5IA 2D3TA 3OPYI 4C7XA 2GHIA 1VBMA 4M89A 5LZ2A 4BNIA 5A4DA 3UUWA 1Z83A 2WYUA 2ACWA 5TNXA 3WGZA 1NYQA 1TMYA 1U11A 3I9LA 2J7PD 3OFSA 4A8PA 2JA2A 4ACBA 3F73A 2SKEA 5LMUB 3T3HA 1K8XB 1R66A 2R44A 4K6KA 1X1BA 1CUCA 2C2MA 2DR3A 3BZBA 3NALA 3P19A 3T7KA 4Z4GA 3STVA 1RIFA 3EP4B 2OGTA 4K6GA 4RPIA 2AFVA 2I4RA 1A95A 1NC1A 3D8BA 4S2EA 5E7QA 3HUDA 3K6SB 1JSZA 4G5HA 5CLGA 4KAJA 5JSUA 1X1DA 2RGBA 2IP1A 3ASZA 4G4GA 1GSAA 2GZSA 4PBTA 4KPFC 5BNFA 1VKZA 4LF8B 2W2LD 4YRRA 5AW1A 3D6JA 1Z2PX 2BFBA 2NUTB 4AJHA 2I3GA 2ONYA 4L2IA 4P34A 2CXXA 2BM1A 4O4JF 3A6KA 1FVHA 2R6R1 1YS9A 4B4UA 1BZYA 1J21A 3L0SA 4B71A 4MKXA 1V1RB 2OV1A 3PUJA 1Z3CA 2ZI4A 2PKQP 1S9HA 2FEKA 3DAFA 3O2SB 4QXOA 3LHDA 3MMXA 2BEVA 4KR0A 4MR9A 3ZXSA 1KP9A 4H7IA 4H15A 4XTRA 4FR0A 1YCDA 2X3FA 4MTCA 2XCSB 4XPIB 5A9SA 1UK8A 2JGIA 2PWZA 4RNCA 3N86A 1EP1B 3WJAA 4OP1A 3O03A 3CVUA 1WXQA 3IEIA 3OJLA 1M0SA 1C7ZA 1JLLA 1T5SA 5FBKA 2OBLA 1ZJ4A 2HV8A 3M9LA 3WNDA 2XA9A 3VR0A 1M2JA 3GJQA 5U1PA 1YR9A 3F7NA 3Q7PA 4JKYA 2PSJA 5KSOA 4Z4EA 2P6UA 1LTHR 1Y7IA 1VJGA 4XRGA 2JIMA 2Z08A 1T1SA 2ZU0C 4REOA 1YTUA 1MHMB 1JVSA 1TQDA 3IBSA 1U2RA 1XD2B 4URYR 1Y8ZA 2WSBA 3MQ4A 1EWQA 2HWKA 1C1DB 1HE8B 4GO1A 2QRNA 3WGHA 3LUKA 5F33A 3QW2A 3KELA 4F7DA 2V0CA 3BTOA 4YV2A 2HU2A 3TIVA 4Y30A 1FFEA 4PIVA 2FRDC 3F5SA 3KGDA 2GSWA 3GEPA 4BKUA 1HDIA 2Z5FA 4OXQA 4AIIA 1V11A 3C1OA 1R0YA 2VP6A 4RDHA 1L5WA 5C81A 2C59A 2BMEA 2XW6A 3AVTA 2UXDB 1E9FA 2Z8ZA 3JY6A 3P4YA 2HLDA 3WSWA 2WWGA 1E9BA 4GXTA 4CGZA 3IMEA 4ISCA 3DAHA 4EUKA 1O9BA 1CQWA 4UATA 1VJTA 1A9ZA 1I2MA 4C04A 4C2UA 3KFXA 1YI0A 2ZR8A 3A3YA 3VSEA 4EHAA 3OURA 1THZA 4MPPA 2J59A 5JNVA 4HQKA 2WJVA 4RTKA 2WB4A 3HGMA 3KR2A 3WGTA 4MP6A 1LW7A 2WQ7A 5DNDA 4YQZA 1HLPA 1FDUA 1J9ZA 3UFBA 2OK7A 2VCEA 4E4YA 2PRZA 1MT3A 4XB2A 1N32B 2O6HA 3M4NA 3O1HB 1G5TA 3CLRC 5ESRA 4N18A 3OJ0A 1Z7BA 5K0BA 2PD6A 5K6TA 2YZ7A 5CEJA 5EQFA 1R0WA 2AFHB 1C3OB 2RHJA 4Q3NA 4ZAVA 5I3ZA 1Z74A 2H18A 2GUGA 3AUXA 3I9MA 4HI0E 4HXFB 3AOGA 3H0VB 4ZCRA 1BHQ1 3RYTC 2R2AA 4MR8A 4COOA 10MHA 3ND7A 5TPZD 1KMHA 3UY4A 2OUKA 3RVMA 1D04A 3QPCA 1NU8A 4GBMA 2AOTB 5E3JA 5SY4A 8MHTA 2QL7A 2VEDA 3B6JA 4M1SA 3RVPA 3HXKA 5SICE 5THQA 3GH1A 2A3RA 1EFVA 2C9CA 3ESDA 3B1KA 1HL3A 1UM9B 2PU7A 1OASA 3LF2A 3P27A 5BSMA 6LDHA 4MVJD 1UC4B 2OD7A 2WWIA 4LC1A 4E5UA 2ZJ2A 4PLGA 4HDQB 1LS6A 2H5LA 1BE6A 4QQ8A 5AI8A 5ER9A 4AQYB 3ZQ4A 3W5DA 1UBEA 2C9OA 4YI3A 5EEHA 4B7XA 3LPCA 1VKJA 4Q4DA 3NHKA 3EFOA 1ORRA 1TYEB 4LSGA 5E6UB 4UEKA 2O2EA 5A4FS 3QFSA 5KQGA 1AHHA 2YV5A 3VHLB 1NJ2A 4KZKA 5J4HA 5JZMA 2J7PA 1S3GA 2CHEA 4DV6B 1KIAA 4EB6B 2XUDA 5G1OA 2I3BA 5F7ZA 2COKA 1TO2E 3UM9A 1W96A 1BD3A 3H5IA 4R8VA 1KYXA 1PS0A 4QYIA 4C4RA 1FDVA 4E21A 1XROA 4PG7A 1ML3A 1ZVKA 2OCBA 2P4HX 3DOCA 1M10A 1NW6A 1OXKB 5GONA 1HQDA 2YZGA 1B76A 2NV0A 2W2LA 4I08A 4PHFA 4WKCA 2J0UB 4PN3A 4BWFB 1NASA 2FUEA 3LRXA 4JK3A 3WB2A 4PQYA 1P4GA 4XGKA 5DXAA 5FRDA 3A6EA 3KS9A 2VZ8A 3ZGNA 4OLHA 3FCYA 2FG5A 1P44A 3DS8A 1R74A 2VXYA 4YQFA 2GXQA 2I2WA 4IW3B 3A1VA 4QASA 1QMHA 1X7XA 3BWVA 4ND5A 4C08A 1SOUA 1J09A 3JWIA 2VHYA 1ZIXA 4YREA 4B4WA 4Z5XA 1AMOA 2POQX 2O52A 2O8FA 4R3UC 4RQAA 5FI3A 4YS6A 5BV8A 1A77A 1EX6A 1XZDA 1U0NA 3G2IA 3O7WA 1G20B 2PWYA 4HAWA 3HCDA 4HNGA 1SCIA 3S2SA 1O6GA 1WHTB 1JDVA 2FPPB 3PC2A 3QFRA 5DF1A 4CIVA 3O2NA 5CCEA 2IHTA 2O06A 3FCSB 4LNHA 1V8ZA 1B15A 1JIIA 1WE2A 3OEYA 3OP1A 5DNYB 1DAIA 3KCNA 4KNWA 3FHCB 1JECA 1X77A 3AKEA 4JUBA 2WJGA 2FWNA 4RHTA 3QI7A 4RVHA 2JPDA 3UJBA 5EJ6A 1CY2A 1D09A 1Z12A 2C7GA 3NAZA 4GLJA 4AULA 5COQA 1JDZA 4J3JA 5BV2P 3QLTA 4RY9A 3EVAA 4KKVA 3GLUA 1JWBB 3DE1X 2CDNA 3EG9B 4M60A 3GLFA 3GEGA 1D1PA 4AMGA 5K0LA 4BJ6A 4WPGA 2YRWA 1CSEE 2WJWA 4LYFA 3WIVA 5EWMB 4DCPA 4NJMA 1HT3A 4NOKA 4C2BA 2RH8A 3FSEA 3GUYA 4RU1A 7AT1A 1CR1A 5C51B 2O59A 3D6UA 4P4SB 4QBIA 2JB9A 4NE7A 5FLXA 1NOIA 1Y9ZA 1VP3A 1LJ8A 2GBLA 2YQ5A 4OYRA 3U3JA 2F00A 1GG9A 1UOQA 4QJ4A 3ABSB 4BLQA 3GJ3A 3DDUA 4EKGA 3LW7A 2VQSA 4QLBA 1HDXA 3R9KA 1SC1A 1P60A 4XM1A 3RI3A 4GLBA 1D2NA 3A3KA 4F6RB 5BW4A 1LNSA 3HJFA 3OIYA 3WIUA 3IALA 2VF8A 1GNVA 1ZWLA 3EYWA 4JWKA 4AN0A 3IHWA 3NV7A 4BVHA 4CUJA 2WV7A 2CSUA 5I51A 1WXDA 2ZI7A 3JVDA 1CRLA 3FZQA 3R41A 1GYRA 1I1NA 1M1ZA 2ZJFA 2YFHA 1O96B 2QRJA 4IIYA 2VK8A 1JAXA 3CRW1 3QA3E 2DPGA 1P61B 4HNAB 3ZV6A 1P1RA 3ZWBA 3SJAA 1V1MA 4RK4A 3FTFA 1TTQB 4LBWA 4X54A 2QTFA 3JU3A 3BD9A 2PVCA 5EIBD 1MOSA 2NZ2A 4HNTA 4CT0A 1SC4A 5TPZA 1I80A 3QVKA 5GY7A 3MJCA 2WKQA 2F43B 2HIMA 3B1JA 4BYMA 4BCDA 5A5GA 3KE8A 3IS3A 2D0IA 4MPTA 1ZY2A 4PG6A 5C3MA 5JG7A 3MS7A 4V1CB 2WSYB 3LY8A 4MVJA 1K3FA 4HP8A 1KBOA 1ZIYA 3WDKA 4QLOA 3R8XA 3H87A 3RB8A 3HFJA 3CPJB 1FFXA 1NWHA 3MXOA 4J2HA 4JR2A 3GLGB 5LP6B 3OF5A 4PF1A 1CZRA 3ICQB 2WBLC 1QP7A 4QHYA 5K5EA 1W52X 1ZNXA 2B5WA 3ZHVA 3DB1A 3U19A 2EL7A 3V8PA 3JAKA 2HC9A 3JSXA 4Y2PA 1WZCA 2OMEA 1XJWA 2X8WA 5KTNA 3DEZA 2AS0A 1A7UA 4OK5A 5E3IA 3SC4A 5C5CA 4MGHA 4OHZA 1GRNA 2X7JA 1PFYA 3OD1A 4BZZA 1YS1X 2EQAA 4R9SA 4DUYB 4RH0A 1HDZA 2VJCA 3X1YA 3WGOA 2V4ZA 4X8HA 1EDDA 3B5IA 4DLAA 4O0MA 3CVWA 2J46A 3K2IA 1E4EB 1EA7A 3ZBTA 5B64A 1SG6A 2KX7A 2WC1A 2JIPA 1VPVA 3BK7A 3I58A 3PHHA 1R6BX 1U1EA 4Y1RA 3UMRA 5K9ZA 3ZE7A 3S8MA 1SEPA 3OZWA 4IYJA 2NNWB 3ETCA 5DNWA 2YN2A 4KO8A 3QKSA 4F97A 4YMVA 3CWCA 3P97A 3PNPA 2OYSA 4XVRA 3CFYA 4MYTA 3W06A 1WMAA 1OROA 1OC4A 4BATA 1ZD5A 3QV2A 1MEOA 4UAGA 5IJWA 2WIAA 2IU6A 5BN5B 1E5LA 1E6LA 1FJ2A 2O57A 4XIYA 5CFPA 4EUSA 1YZTA 3IQGX 1EWYA 3UUFA 3AHGA 4LY0A 4BP3A 2O54A 4JA0A 3ZWWA 1BXRB 5EZYF 4J7CA 4G65A 4HZUB 2GBIA 3L1HA 1AUXA 3R1IA 3ZHQA 3O82A 4PEVA 4LPSA 2J1LA 4EJ6A 4ID9A 3J7AC 1OWMA 2CB9A 3D3EA 1NXXA 1PX2A 3BIFA 3PUZA 1QQ7A 4P5DA 4PE5B 3UANA 1W8DA 4OYYA 3A6PC 3EUWA 1GTG1 1Y9DA 4HAYA 3CNQS 3ZI4A 1DC4A 4EI2A 4YRSA 1ENPA 3JVIA 5G0TA 1ODIA 4EG4A 1II8B 3CKYA 4IMPA 3QEKA 4HUQB 1VLQA 5SY6A 1UBKS 3MTEA 4DLSA 3RTEA 4WKOA 4ZI2A 2V55B 1YMUA 3BWCA 3WHKA 1G2QA 2Z5LA 1EDZA 4M3NA 4RTOA 2FP4B 1Q12A 1Z5UA 2PE5A 5EIFA 3R77A 1UOOA 2LCIA 3AETA 3CCFA 3NAQA 1OFUA 2LVBA 3SDBA 3TFQA 3LBYA 3GLIE 1U9IC 2Z30A 3N8DA 4GT1A 4RXMA 3UJAA 1T9AA 1XUOA 2ZYSA 3EYAA 3HKBA 4MK4A 4QDXA 4TRJA 5TQ0A 3TTYA 4ZYYA 2Q49A 1RI4A 2CNLA 2Q3CA 2C94A 3FPGA 3I09A 4FUTA 1RWNA 4UU8A 5AJXA 5H83A 3T95A 1X80A 3HC7A 4IM7A 4QD3A 3TXAA 4LF5B 3RD5A 3DVLA 1PL0A 1RMTA 4IOLA 2CMGA 4BFSA 2YXPX 2EFCB 4MV1A 1QO7A 1LUAA 4O2LA 1QR6A 2REXB 3V80A 1D4FA 3ZWNA 2EBFX 3H2IA 1I7MB 1P2FA 1CUZA 1XG5A 4J75A 5AIBA 1PJQA 3C24A 3C4JA 5IZCC 3RC8A 1TK3A 2VDQB 4PGAA 5T3YA 2HJWA 3LCJA 2ZXEA 4NAHA 4UASA 4B79A 4LSMA 1DPGA 3EDYA 5JLAA 4P32A 4WBNF 1GPMA 2BTOA 1Z0IA 1N1DA 2JIOA 2PZFA 3JXEA 4UBNA 2P5TB 3P9CA 2X6TA 5F64A 2A7XA 4B80A 3VDRA 1JE0A 2ZIAA 5EP1A 5ABPA 4OLAA 4IYRA 1Q0HA 3ENVA 4WNAB 3HU3A 4X0EA 2RKBA 1CZHA 5IVDA 3VYRB 4DBVO 2JRCA 2XTNA 4FQ8A 2W71A 4X62B 3NB0A 2D0PB 3OPNA 5ALJA 2QTZA 1CLUA 1N6PA 2UUPA 3L0OA 4GI3A 5JYEA 1T6BY 1Y89A 2HEGA 4UDNA 1M6EX 3K0HA 2H2DA 2YWJA 4U2FA 1IOWA 2C9DA 3JARB 3OUZA 4HTFA 1P2SA 4K6FA 4QOHA 4B74A 4DV4B 4MI6A 4CKZA 3TBKA 3HHEA 3ODPA 5AI5A 4WWHA 4EHJA 5HS6A 4D99A 3INGA 2JH3A 2JLWA 1IULA 2FUCA 1F2UA 2HCJB 2YUIA 1J23A 3PGJA 4P9NA 1U8AA 2W00A 1Q0QA 5K7SA 4D92A 1Z06A 4HDCA 4JSRA 3RV3A 1E6MA 4W8GA 1PJ8A 4HPJB 5IULC 3FYHA 4GSKA 3AM1A 3IDOA 3QXGA 2ADOA 4WVFA 3I9OA 3EISA 1KAEA 2QHXA 3IILA 3M1AA 4I99A 3OTGA 3KQLA 1H0RA 4I6EA 1EHYA 1SBNE 13PKA 1ISGA 4I8DA 4I3HA 3T5TA 2GWRA 2YVAA 3QX9A 4UJ5A 3H2BA 1JKJB 3A7EA 4MCJA 5EJGA 5B4TA 2JVIA 2W5UA 3G5LA 2IELA 1Z0AA 2X58A 3NDBB 3D9QX 5F5XA 3WQHA 2J0QA 1SHJA 5CR9A 3NANA 1L5QA 5LB4A 3TUJC 2I2BA 3DL2A 4IUYA 4N3BA 2AEEA 4ML3A 1ZCJA 2FPNA 2H51A 1OZHA 2A5FA 1YZ3A 3HN2A 5AOAA 1AX9A 4GS5A 4MRRA 1X8LA 4F0JA 3BXGA 1SVKA 2PX5A 3IJRA 1OH6A 4BFUA 2PUJA 4IOMA 2EEPA 4WNCA 3GA0A 4D3SA 4C07A 2VCYA 1FU4A 1U8TA 2C3UA 2IUSA 1QLHA 2X0RA 3LKVA 4ZRDA 5SY9A 3TLGA 2OEPA 4E1VA 3LHIA 3EIOA 3ETDA 3UHFA 2JCSA 3TLBA 1FOEB 5KBYA 3HCBA 1D8TA 4ZN6A 3DBVO 4B5LA 4AZ3A 1MABB 1I1OA 2EGUA 1AVTA 2FOLA 2NGRA 5FL7D 3PC7A 4PC3A 3HP4A 3DPSA 3OZFA 1Q0SA 1I5EA 1YR6A 2CLLB 2E21A 2OGUA 4ZQFA 2VHZA 1GVHA 1Y7TA 1ZM3A 3MGKA 4MWSA 5FOVA 3WLFA 2R0QC 5DEOA 4DHEA 2V96A 3FNHA 2WU8A 4PZPA 1GGHA 4DIUA 4XOUA 2GCEA 2XZPA 3NRBA 3WA6A 2BGWA 2HREA 3L8GA 4RSGA 5A5VA 1CUVA 2RG7A 1TF2A 3WZ2A 1FFGA 1HZZA 2QZ9A 3NT5A 1SM4A 3HYNA 2RGWA 3T3PB 1Z4NA 2AUNA 2C4NA 2ZIFA 4MS4B 4WZAA 1CVLA 4UU0A 1RJWA 3QKRB 1OLSB 1DAEA 1QYXA 2WJJA 1A9QA 5GGYA 1RYZA 5ITZB 3D7SA 3FGZA 1UMKA 2OECA 2Z4TA 1Z6TA 3GN2A 2F1IA 4ZKDA 1WULS 5JS8A 3WMEA 4OHWA 3COYA 4ZVOA 5A3RA 2C7VA 1QMPA 1KI9A 2BOVA 3NO4A 2P5YA 4FFVA 5FL3A 1XAGA 3ROEA 5JDCA 1W35A 3Q72A 3L0CA 1DE0A 1CY8A 3FVRA 3I9V6 4CRWB 1WZIA 1U3DA 4MVJG 2GN8A 3IEPA 1V4NA 3NR2A 3IQIX 5AWFC 2H2IA 2W6CX 4HY3A 4M6WB 4NZNA 3A1WA 4PZZA 4A0HA 2QUJA 1P75A 2OBNA 3ED5A 5FTLA 2XE4A 2QR3A 3AEKB 3EW7A 3KDSE 5AKZA 3H5OA 4FEAA 1NRIA 4PQRA 1AO0A 1RKBA 4WHMA 5B3JC 4MQ5A 3MUOA 3SEFA 2DFPA 1YCHA 2HXYA 3FCAA 3L1JA 4BQNA 4AKGA 2OORC 2XY4A 3IAS1 1Q5PA 4FYWA 2ZI9A 4K2HA 1W29A 4REQA 4ZGGA 3I1JA 1C9NA 3M1YA 4RFSA 4TTSA 4JENA 4V0NA 1ZGHA 2Q2NA 3GLHE 2X8JB 3IV9A 1TT7A 4RDIA 4WZZA 2PCLA 1JR3D 1FEZA 1F4LA 2RHHA 2DQSA 1U7XA 2I2XB 2IHVA 1QB8A 4A7PA 5L51A 5CA0F 4X1OA 3ADOA 5AJHA 1ETHA 1I5OA 1U5AA 1UP4A 3PITA 1I10A 4R2WA 1GNLA 1RXYA 2AOWA 4WL0A 1TW3A 3NVMB 3WYCA 1RM5A 1LVUA 1NULA 2JK1A 2RGDA 1KY3A 2ZWPA 2P9GA 4KEAA 4WD3A 5K03A 4XYEA 2PUFA 2XNHA 3U48A 5KX5B 4HDNB 2I9KA 4N3NA 3JASA 3ROGA 1A04A 3ITNA 3VKUA 1DCTA 3CJQA 3RADC 1YMQA 4PRKA 1DX4A 2NT4A 2E9SA 4R8RA 4W1PA 4CDRA 5FFNA 1B26A 3L7BA 3NYRA 1FCJA 3KJIA 1JWAB 3WLLA 4QG3A 1ZR4A 4IFIA 3LQYA 1LDYA 4FU0A 3ODGA 1QKKA 1MAWA 4Y6QA 1NJ6A 4BO5A 4EB8A 1L0BA 2C5HA 2QRVB 5BWOA 3E8MA 4GQBA 3SC6A 3I1IA 3KKMA 3QLVC 4AXXA 3TZ6A 4ND7A 4ZTZB 1PFVA 1ZJJA 3HDYA 1L7OA 1TCAA 2R1TB 2HMSA 2FR8C 1SCKA 4TXJA 1US8A 3W1VA 5FOQA 1W4RA 4G0UA 3FPSA 2I7DA 4UE3S 4Z7JA 1V3UA 4NZPA 5JPCA 2V3VA 3A2LA 4FGZA 1WLSA 2BLNA 4AO6A 4BNUA 4Q9DA 1YACA 2OBMA 3HJUA 3IT0A 4LTNA 4Q1VA 4LXHA 1A5ZA 3KUXA 1WXXA 4ZHQB 1DEOA 5AK3A 1F60A 1M1NA 4EPYA 2NUBA 3VU9A 1GIAA 2EKBA 2QWXA 1UOEA 4RK1A 5LPNA 3K2EA 3CX3A 1LLFA 5CTAA 3BGSA 5J2TF 1ZK1A 1O97C 2Z2YA 3NEYA 4FQ5A 4OIMA 2QVLA 1VMDA 2X8AA 3C7TA 3QK7A 1N0WA 3TLJA 1P0CA 3LD9A 1HC7A 1ISSA 3TQSA 1Z5PA 2RGCA 3KEMA 1DAMA 1NLFA 3NCTA 3PXUA 1STOA 3JQRA 1FMLA 4EFDA 1H2RS 1G8GA 1UEXC 4PLTA 2GMWA 5FL7A 5IBPA 2VHWA 3STTA 2QI9C 4H4CA 1YIDA 2WWXA 5FIUA 2ORYA 1ACMA 5DGTA 1DZ3A 1NBWB 2C4KA 2D1FA 3PXGA 1KEPA