1PUSA

Solution structure of the mutt pyrophosphohydrolase complexed with mg(2+) and 8-oxo-dgmp, a tightly-bound product
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
129
structure length
129
Chain Sequence
MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mutator mutT protein
publication title Solution structure and NH exchange studies of the MutT pyrophosphohydrolase complexed with Mg(2+) and 8-oxo-dGMP, a tightly bound product.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 16
structure length 129
sequence length 129
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2003-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1pusA00
3EESA 3Q93A 5LPGA 1IRYA 3CNGA 2CL3A 2FVVA 2J8QA 2YVNA 5GHMA 1MR2A 1PVFA 3DUPA 2FKBA 4V14A 3FSPA 3X0QA 2G74A 2QKMB 1I9AA 2XSQA 3O69A 5GHOA 2PNYA 2KDWA 2VNPA 3EEUA 4N1UA 3O61A 2A6TA 1XSAA 3ACAA 3WHWA 5C7QA 1K2EA 3SHDA 5CFIA 2B06A 3GWYA 3P5TA 2AZWA 1HX3A 2B0VA 2QJOA 3MGMA 3OGAA 5GHJA 3O6ZA 4C9WA 3F6AA 2O5WA 5GHQA 3O8SA 5ANSA 1PPVA 1V8IA 2A8TA 1VHGA 3FFUA 4HFQA 1V8SA 3X0OA 5DEQA 3ID9A 4ILQA 2RRKA 5GHPA 1V8TA 1K26A 1KT9A 4KTBA 3X0MA 1JKNA 5ANVA 1PUQA 3X0IA 1SU2A 5ANTA 1F3YA 2YYHA 3FCMA 2I8UA 2KDVA 1Q27A 3GZ8A 1RYAA 2Q9PA 1G0SA 2GT4A 2I8TA 1KHZA 1TUMA 1PUNA 1NFSA 5GHNA 3AC9A 1VC8A 2O5FA 1X84A 3HHJA 5FSLA 5DPKA 3A6VA 2W4EA 3H95A 3BAPA 2ICKA 2O1CA 4ZG0A 4YPRA 2PQVA 1VK6A 3G0QA 1VIQA 3BM4A 1R67A 1X51A 1NFZA 2GB5A 1Q54A 4IJXA 5DDGA 3ZR1A 5ANUA 3X0JA 1PPXA 3GG6A 5FSOA 1V8VA 2YVMA 2VNQA 5ISYA 1U20A 1XSBA 1G9QA 1MQEA 1XSCA 3O52A 1V8WA 1MK1A 3I7UA 2YVPA 3Q4IA 5DD4A 3FK9A 5GHIA 5BONA 5FSKA 3X0NA 3X0KA 3ZR0A 1JRKA 2A8PA 5FSNA 1V8RA 2YVOA 1MP2A 3A6TA 5I8UA 3SMDA 1QVJA 3COUA 2G73A 4ICKA 1V8UA 3A6UA 3E57A 3Q2SA 3X0LA 4K6EA 4C9XA 3GRNA 5BS6A 5ANWA 3X0SA 3DKUA 4JZUA 3Q1PA 3I7VA 3X0RA 3U53A 3F13A 3FJYA 4MPOA 4JZVA 1V8LA 1V8YA 3RH7A 5HZXA 3J7Ye 3MDGA 1OW2A 4S2VA 4HVYA 4NFWA 1GA7A 5CFJA 3EXQA 1PUSA 3I9XA 1VC9A 2DHOA 2GT2A 5FSIA 5IW5A 2DSCA 1V8MA 4S2YA 3P6YA 4KG3A 4S2XA 3Q2TA 1VRLA 1SJYA 2DSDA 4JZTA 2B2KA 3N9UA 3KVHA 4S2WA 3QSJA 3MDIA 2A8RA 1VCDA 3MCFA 1Q33A 2DSBA 2I6KA 5C7TA 1SZ3A 3HYQA 3GZ6A 3EF5A 1MQWA 1NQYA 1SOIA 3A6SA 2FMLA 1NQZA 1HZTA 3GZ5A 4JZSA 4KG4A 5IW4A 3L85A 1MUTA 2A8QA 1VHZA 2ICJA 4YOQA 1RRSA 4DYWA 1PPWA 3R03A 2JVBA 3X0PA 1X83A 2R5WA 2DUKA 1KTGA 5FSMA 3Q91A 4KYXA 1RRQA 2A8SA 1V8NA 2QJTA 4N1TA 3SONA 3BHOA 1VIUA 3N77A 4NFXA 5C8LA 4YPHA
chains in the Genus database with same CATH superfamily
3EESA 3Q93A 5LPGA 1IRYA 3CNGA 2CL3A 2FVVA 2J8QA 2YVNA 5GHMA 1MR2A 1PVFA 3DUPA 2FKBA 4V14A 3FSPA 3X0QA 2G74A 2QKMB 1I9AA 2XSQA 3O69A 5GHOA 2PNYA 2KDWA 2VNPA 3EEUA 4N1UA 3O61A 2A6TA 1XSAA 3ACAA 3WHWA 5C7QA 1K2EA 3SHDA 5CFIA 2B06A 3GWYA 3P5TA 2AZWA 1HX3A 2B0VA 2QJOA 3MGMA 3OGAA 5GHJA 3O6ZA 4C9WA 3F6AA 2O5WA 5GHQA 3O8SA 5ANSA 1PPVA 1V8IA 2A8TA 1VHGA 3FFUA 4HFQA 1V8SA 3X0OA 5DEQA 3ID9A 4ILQA 2RRKA 5GHPA 1V8TA 1K26A 1KT9A 4KTBA 3X0MA 1JKNA 5ANVA 1PUQA 3X0IA 1SU2A 5ANTA 1F3YA 2YYHA 3FCMA 2I8UA 2KDVA 1Q27A 3GZ8A 1RYAA 2Q9PA 1G0SA 2GT4A 2I8TA 2CZRA 1KHZA 1TUMA 1PUNA 1NFSA 5GHNA 3AC9A 1VC8A 2O5FA 1X84A 3HHJA 5FSLA 5DPKA 3A6VA 2W4EA 3H95A 3BAPA 2ICKA 2O1CA 4ZG0A 4YPRA 2PQVA 1VK6A 3G0QA 1VIQA 3BM4A 1R67A 1X51A 1NFZA 2GB5A 1Q54A 4IJXA 5DDGA 3ZR1A 5ANUA 3X0JA 1PPXA 3GG6A 4J7GA 5FSOA 1V8VA 2YVMA 2VNQA 5ISYA 1U20A 1XSBA 1G9QA 1MQEA 1XSCA 3O52A 1V8WA 1MK1A 3I7UA 2YVPA 3Q4IA 5DD4A 3FK9A 5GHIA 5BONA 5FSKA 3X0NA 3X0KA 3ZR0A 1JRKA 2A8PA 5FSNA 1V8RA 2YVOA 1MP2A 3A6TA 5I8UA 3SMDA 1QVJA 3COUA 2G73A 4J7HA 4ICKA 1V8UA 3A6UA 3E57A 3Q2SA 3X0LA 4K6EA 4C9XA 3GRNA 5BS6A 5ANWA 3X0SA 3DKUA 4JZUA 3Q1PA 3I7VA 3X0RA 3U53A 3F13A 3FJYA 4MPOA 4JZVA 1V8LA 1V8YA 3RH7A 5HZXA 3J7Ye 3MDGA 1OW2A 4S2VA 4HVYA 4NFWA 1GA7A 5CFJA 3EXQA 1PUSA 3I9XA 1VC9A 2DHOA 2GT2A 5FSIA 5IW5A 2DSCA 1V8MA 4S2YA 3P6YA 4KG3A 4S2XA 3Q2TA 1VRLA 1SJYA 2DSDA 4JZTA 2B2KA 3N9UA 3KVHA 4S2WA 3QSJA 3MDIA 2A8RA 1VCDA 3MCFA 1Q33A 2DSBA 2I6KA 5C7TA 1SZ3A 3HYQA 3GZ6A 3EF5A 1MQWA 1NQYA 1SOIA 3A6SA 2FMLA 1NQZA 1HZTA 3GZ5A 4JZSA 4KG4A 5IW4A 3L85A 1MUTA 2A8QA 1VHZA 2ICJA 4YOQA 1RRSA 4DYWA 1PPWA 3R03A 2JVBA 3X0PA 1X83A 2R5WA 2DUKA 1KTGA 5FSMA 3Q91A 4KYXA 1RRQA 2A8SA 1V8NA 2QJTA 4N1TA 3SONA 3BHOA 1VIUA 3N77A 4NFXA 5C8LA 4YPHA
chains in the Genus database with same CATH topology
3EESA 3Q93A 5LPGA 1IRYA 3CNGA 2CL3A 2FVVA 2J8QA 2YVNA 5GHMA 1MR2A 1PVFA 3DUPA 2FKBA 4V14A 3FSPA 3X0QA 2G74A 2QKMB 1I9AA 2XSQA 3O69A 5GHOA 2PNYA 2KDWA 2VNPA 3EEUA 4N1UA 3O61A 2A6TA 1XSAA 3ACAA 3WHWA 5C7QA 1K2EA 3SHDA 5CFIA 2B06A 3GWYA 3P5TA 2AZWA 1HX3A 2B0VA 2QJOA 3MGMA 3OGAA 5GHJA 3O6ZA 4C9WA 3F6AA 2O5WA 5GHQA 3O8SA 5ANSA 1PPVA 1V8IA 2A8TA 1VHGA 3FFUA 4HFQA 1V8SA 3X0OA 5DEQA 3ID9A 4ILQA 2RRKA 5GHPA 1V8TA 1K26A 1KT9A 4KTBA 3X0MA 1JKNA 5ANVA 1PUQA 3X0IA 1SU2A 5ANTA 1F3YA 2YYHA 3FCMA 2I8UA 2KDVA 1Q27A 3GZ8A 1RYAA 2Q9PA 1G0SA 2GT4A 2I8TA 2CZRA 1KHZA 1TUMA 1PUNA 1NFSA 5GHNA 3AC9A 1VC8A 2O5FA 1X84A 3HHJA 5FSLA 5DPKA 3A6VA 2W4EA 3H95A 3BAPA 2ICKA 2O1CA 4ZG0A 4YPRA 2PQVA 1VK6A 3G0QA 1VIQA 3BM4A 1R67A 1X51A 1NFZA 2GB5A 1Q54A 4IJXA 5DDGA 3ZR1A 5ANUA 3X0JA 1PPXA 3GG6A 4J7GA 5FSOA 1V8VA 2YVMA 2VNQA 5ISYA 1U20A 1XSBA 1G9QA 1MQEA 1XSCA 3O52A 1V8WA 1MK1A 3I7UA 2YVPA 3Q4IA 5DD4A 3FK9A 5GHIA 5BONA 5FSKA 3X0NA 3X0KA 3ZR0A 1JRKA 2A8PA 5FSNA 1V8RA 2YVOA 1MP2A 3A6TA 5I8UA 3SMDA 1QVJA 3COUA 2G73A 4J7HA 4ICKA 1V8UA 3A6UA 3E57A 3Q2SA 3X0LA 4K6EA 4C9XA 3GRNA 5BS6A 5ANWA 3X0SA 3DKUA 4JZUA 3Q1PA 3I7VA 3X0RA 3U53A 3F13A 3FJYA 4MPOA 4JZVA 1V8LA 1V8YA 3RH7A 5HZXA 3J7Ye 3MDGA 1OW2A 4S2VA 4HVYA 4NFWA 1GA7A 5CFJA 3EXQA 1PUSA 3I9XA 1VC9A 2DHOA 2GT2A 5FSIA 5IW5A 2DSCA 1V8MA 4S2YA 3P6YA 4KG3A 4S2XA 3Q2TA 1VRLA 1SJYA 2DSDA 4JZTA 2B2KA 3N9UA 3KVHA 4S2WA 3QSJA 3MDIA 2A8RA 1VCDA 3MCFA 1Q33A 2DSBA 2I6KA 5C7TA 1SZ3A 3HYQA 3GZ6A 3EF5A 1MQWA 1NQYA 1SOIA 3A6SA 2FMLA 1NQZA 1HZTA 3GZ5A 4JZSA 4KG4A 5IW4A 3L85A 1MUTA 2A8QA 1VHZA 2ICJA 4YOQA 1RRSA 4DYWA 1PPWA 3R03A 2JVBA 3X0PA 1X83A 2R5WA 2DUKA 1KTGA 5FSMA 3Q91A 4KYXA 1RRQA 2A8SA 1V8NA 2QJTA 4N1TA 3SONA 3BHOA 1VIUA 3N77A 4NFXA 5C8LA 4YPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EES A;  3Q93 A;  5LPG A;  1IRY A;  3CNG A;  2CL3 A;  2FVV A;  2J8Q A;  2YVN A;  5GHM A;  1MR2 A;  1PVF A;  3DUP A;  2FKB A;  4V14 A;  3FSP A;  3X0Q A;  2G74 A;  2QKM B;  1I9A A;  2XSQ A;  3O69 A;  5GHO A;  2PNY A;  2KDW A;  2VNP A;  3EEU A;  4N1U A;  3O61 A;  2A6T A;  1XSA A;  3ACA A;  3WHW A;  5C7Q A;  1K2E A;  3SHD A;  5CFI A;  2B06 A;  3GWY A;  3P5T A;  2AZW A;  1HX3 A;  2B0V A;  2QJO A;  3MGM A;  3OGA A;  5GHJ A;  3O6Z A;  4C9W A;  3F6A A;  2O5W A;  5GHQ A;  3O8S A;  5ANS A;  1PPV A;  1V8I A;  2A8T A;  1VHG A;  3FFU A;  4HFQ A;  1V8S A;  3X0O A;  5DEQ A;  3ID9 A;  4ILQ A;  2RRK A;  5GHP A;  1V8T A;  1K26 A;  1KT9 A;  4KTB A;  3X0M A;  1JKN A;  5ANV A;  1PUQ A;  3X0I A;  1SU2 A;  5ANT A;  1F3Y A;  2YYH A;  3FCM A;  2I8U A;  2KDV A;  1Q27 A;  3GZ8 A;  1RYA A;  2Q9P A;  1G0S A;  2GT4 A;  2I8T A;  1KHZ A;  1TUM A;  1PUN A;  1NFS A;  5GHN A;  3AC9 A;  1VC8 A;  2O5F A;  1X84 A;  3HHJ A;  5FSL A;  5DPK A;  3A6V A;  2W4E A;  3H95 A;  3BAP A;  2ICK A;  2O1C A;  4ZG0 A;  4YPR A;  2PQV A;  1VK6 A;  3G0Q A;  1VIQ A;  3BM4 A;  1R67 A;  1X51 A;  1NFZ A;  2GB5 A;  1Q54 A;  4IJX A;  5DDG A;  3ZR1 A;  5ANU A;  3X0J A;  1PPX A;  3GG6 A;  5FSO A;  1V8V A;  2YVM A;  2VNQ A;  5ISY A;  1U20 A;  1XSB A;  1G9Q A;  1MQE A;  1XSC A;  3O52 A;  1V8W A;  1MK1 A;  3I7U A;  2YVP A;  3Q4I A;  5DD4 A;  3FK9 A;  5GHI A;  5BON A;  5FSK A;  3X0N A;  3X0K A;  3ZR0 A;  1JRK A;  2A8P A;  5FSN A;  1V8R A;  2YVO A;  1MP2 A;  3A6T A;  5I8U A;  3SMD A;  1QVJ A;  3COU A;  2G73 A;  4ICK A;  1V8U A;  3A6U A;  3E57 A;  3Q2S A;  3X0L A;  4K6E A;  4C9X A;  3GRN A;  5BS6 A;  5ANW A;  3X0S A;  3DKU A;  4JZU A;  3Q1P A;  3I7V A;  3X0R A;  3U53 A;  3F13 A;  3FJY A;  4MPO A;  4JZV A;  1V8L A;  1V8Y A;  3RH7 A;  5HZX A;  3J7Y e;  3MDG A;  1OW2 A;  4S2V A;  4HVY A;  4NFW A;  1GA7 A;  5CFJ A;  3EXQ A;  1PUS A;  3I9X A;  1VC9 A;  2DHO A;  2GT2 A;  5FSI A;  5IW5 A;  2DSC A;  1V8M A;  4S2Y A;  3P6Y A;  4KG3 A;  4S2X A;  3Q2T A;  1VRL A;  1SJY A;  2DSD A;  4JZT A;  2B2K A;  3N9U A;  3KVH A;  4S2W A;  3QSJ A;  3MDI A;  2A8R A;  1VCD A;  3MCF A;  1Q33 A;  2DSB A;  2I6K A;  5C7T A;  1SZ3 A;  3HYQ A;  3GZ6 A;  3EF5 A;  1MQW A;  1NQY A;  1SOI A;  3A6S A;  2FML A;  1NQZ A;  1HZT A;  3GZ5 A;  4JZS A;  4KG4 A;  5IW4 A;  3L85 A;  1MUT A;  2A8Q A;  1VHZ A;  2ICJ A;  4YOQ A;  1RRS A;  4DYW A;  1PPW A;  3R03 A;  2JVB A;  3X0P A;  1X83 A;  2R5W A;  2DUK A;  1KTG A;  5FSM A;  3Q91 A;  4KYX A;  1RRQ A;  2A8S A;  1V8N A;  2QJT A;  4N1T A;  3SON A;  3BHO A;  1VIU A;  3N77 A;  4NFX A;  5C8L A;  4YPH A; 
#chains in the Genus database with same CATH topology
 3EES A;  3Q93 A;  5LPG A;  1IRY A;  3CNG A;  2CL3 A;  2FVV A;  2J8Q A;  2YVN A;  5GHM A;  1MR2 A;  1PVF A;  3DUP A;  2FKB A;  4V14 A;  3FSP A;  3X0Q A;  2G74 A;  2QKM B;  1I9A A;  2XSQ A;  3O69 A;  5GHO A;  2PNY A;  2KDW A;  2VNP A;  3EEU A;  4N1U A;  3O61 A;  2A6T A;  1XSA A;  3ACA A;  3WHW A;  5C7Q A;  1K2E A;  3SHD A;  5CFI A;  2B06 A;  3GWY A;  3P5T A;  2AZW A;  1HX3 A;  2B0V A;  2QJO A;  3MGM A;  3OGA A;  5GHJ A;  3O6Z A;  4C9W A;  3F6A A;  2O5W A;  5GHQ A;  3O8S A;  5ANS A;  1PPV A;  1V8I A;  2A8T A;  1VHG A;  3FFU A;  4HFQ A;  1V8S A;  3X0O A;  5DEQ A;  3ID9 A;  4ILQ A;  2RRK A;  5GHP A;  1V8T A;  1K26 A;  1KT9 A;  4KTB A;  3X0M A;  1JKN A;  5ANV A;  1PUQ A;  3X0I A;  1SU2 A;  5ANT A;  1F3Y A;  2YYH A;  3FCM A;  2I8U A;  2KDV A;  1Q27 A;  3GZ8 A;  1RYA A;  2Q9P A;  1G0S A;  2GT4 A;  2I8T A;  2CZR A;  1KHZ A;  1TUM A;  1PUN A;  1NFS A;  5GHN A;  3AC9 A;  1VC8 A;  2O5F A;  1X84 A;  3HHJ A;  5FSL A;  5DPK A;  3A6V A;  2W4E A;  3H95 A;  3BAP A;  2ICK A;  2O1C A;  4ZG0 A;  4YPR A;  2PQV A;  1VK6 A;  3G0Q A;  1VIQ A;  3BM4 A;  1R67 A;  1X51 A;  1NFZ A;  2GB5 A;  1Q54 A;  4IJX A;  5DDG A;  3ZR1 A;  5ANU A;  3X0J A;  1PPX A;  3GG6 A;  4J7G A;  5FSO A;  1V8V A;  2YVM A;  2VNQ A;  5ISY A;  1U20 A;  1XSB A;  1G9Q A;  1MQE A;  1XSC A;  3O52 A;  1V8W A;  1MK1 A;  3I7U A;  2YVP A;  3Q4I A;  5DD4 A;  3FK9 A;  5GHI A;  5BON A;  5FSK A;  3X0N A;  3X0K A;  3ZR0 A;  1JRK A;  2A8P A;  5FSN A;  1V8R A;  2YVO A;  1MP2 A;  3A6T A;  5I8U A;  3SMD A;  1QVJ A;  3COU A;  2G73 A;  4J7H A;  4ICK A;  1V8U A;  3A6U A;  3E57 A;  3Q2S A;  3X0L A;  4K6E A;  4C9X A;  3GRN A;  5BS6 A;  5ANW A;  3X0S A;  3DKU A;  4JZU A;  3Q1P A;  3I7V A;  3X0R A;  3U53 A;  3F13 A;  3FJY A;  4MPO A;  4JZV A;  1V8L A;  1V8Y A;  3RH7 A;  5HZX A;  3J7Y e;  3MDG A;  1OW2 A;  4S2V A;  4HVY A;  4NFW A;  1GA7 A;  5CFJ A;  3EXQ A;  1PUS A;  3I9X A;  1VC9 A;  2DHO A;  2GT2 A;  5FSI A;  5IW5 A;  2DSC A;  1V8M A;  4S2Y A;  3P6Y A;  4KG3 A;  4S2X A;  3Q2T A;  1VRL A;  1SJY A;  2DSD A;  4JZT A;  2B2K A;  3N9U A;  3KVH A;  4S2W A;  3QSJ A;  3MDI A;  2A8R A;  1VCD A;  3MCF A;  1Q33 A;  2DSB A;  2I6K A;  5C7T A;  1SZ3 A;  3HYQ A;  3GZ6 A;  3EF5 A;  1MQW A;  1NQY A;  1SOI A;  3A6S A;  2FML A;  1NQZ A;  1HZT A;  3GZ5 A;  4JZS A;  4KG4 A;  5IW4 A;  3L85 A;  1MUT A;  2A8Q A;  1VHZ A;  2ICJ A;  4YOQ A;  1RRS A;  4DYW A;  1PPW A;  3R03 A;  2JVB A;  3X0P A;  1X83 A;  2R5W A;  2DUK A;  1KTG A;  5FSM A;  3Q91 A;  4KYX A;  1RRQ A;  2A8S A;  1V8N A;  2QJT A;  4N1T A;  3SON A;  3BHO A;  1VIU A;  3N77 A;  4NFX A;  5C8L A;  4YPH A; 
#chains in the Genus database with same CATH homology
 3EES A;  3Q93 A;  5LPG A;  1IRY A;  3CNG A;  2CL3 A;  2FVV A;  2J8Q A;  2YVN A;  5GHM A;  1MR2 A;  1PVF A;  3DUP A;  2FKB A;  4V14 A;  3FSP A;  3X0Q A;  2G74 A;  2QKM B;  1I9A A;  2XSQ A;  3O69 A;  5GHO A;  2PNY A;  2KDW A;  2VNP A;  3EEU A;  4N1U A;  3O61 A;  2A6T A;  1XSA A;  3ACA A;  3WHW A;  5C7Q A;  1K2E A;  3SHD A;  5CFI A;  2B06 A;  3GWY A;  3P5T A;  2AZW A;  1HX3 A;  2B0V A;  2QJO A;  3MGM A;  3OGA A;  5GHJ A;  3O6Z A;  4C9W A;  3F6A A;  2O5W A;  5GHQ A;  3O8S A;  5ANS A;  1PPV A;  1V8I A;  2A8T A;  1VHG A;  3FFU A;  4HFQ A;  1V8S A;  3X0O A;  5DEQ A;  3ID9 A;  4ILQ A;  2RRK A;  5GHP A;  1V8T A;  1K26 A;  1KT9 A;  4KTB A;  3X0M A;  1JKN A;  5ANV A;  1PUQ A;  3X0I A;  1SU2 A;  5ANT A;  1F3Y A;  2YYH A;  3FCM A;  2I8U A;  2KDV A;  1Q27 A;  3GZ8 A;  1RYA A;  2Q9P A;  1G0S A;  2GT4 A;  2I8T A;  2CZR A;  1KHZ A;  1TUM A;  1PUN A;  1NFS A;  5GHN A;  3AC9 A;  1VC8 A;  2O5F A;  1X84 A;  3HHJ A;  5FSL A;  5DPK A;  3A6V A;  2W4E A;  3H95 A;  3BAP A;  2ICK A;  2O1C A;  4ZG0 A;  4YPR A;  2PQV A;  1VK6 A;  3G0Q A;  1VIQ A;  3BM4 A;  1R67 A;  1X51 A;  1NFZ A;  2GB5 A;  1Q54 A;  4IJX A;  5DDG A;  3ZR1 A;  5ANU A;  3X0J A;  1PPX A;  3GG6 A;  4J7G A;  5FSO A;  1V8V A;  2YVM A;  2VNQ A;  5ISY A;  1U20 A;  1XSB A;  1G9Q A;  1MQE A;  1XSC A;  3O52 A;  1V8W A;  1MK1 A;  3I7U A;  2YVP A;  3Q4I A;  5DD4 A;  3FK9 A;  5GHI A;  5BON A;  5FSK A;  3X0N A;  3X0K A;  3ZR0 A;  1JRK A;  2A8P A;  5FSN A;  1V8R A;  2YVO A;  1MP2 A;  3A6T A;  5I8U A;  3SMD A;  1QVJ A;  3COU A;  2G73 A;  4J7H A;  4ICK A;  1V8U A;  3A6U A;  3E57 A;  3Q2S A;  3X0L A;  4K6E A;  4C9X A;  3GRN A;  5BS6 A;  5ANW A;  3X0S A;  3DKU A;  4JZU A;  3Q1P A;  3I7V A;  3X0R A;  3U53 A;  3F13 A;  3FJY A;  4MPO A;  4JZV A;  1V8L A;  1V8Y A;  3RH7 A;  5HZX A;  3J7Y e;  3MDG A;  1OW2 A;  4S2V A;  4HVY A;  4NFW A;  1GA7 A;  5CFJ A;  3EXQ A;  1PUS A;  3I9X A;  1VC9 A;  2DHO A;  2GT2 A;  5FSI A;  5IW5 A;  2DSC A;  1V8M A;  4S2Y A;  3P6Y A;  4KG3 A;  4S2X A;  3Q2T A;  1VRL A;  1SJY A;  2DSD A;  4JZT A;  2B2K A;  3N9U A;  3KVH A;  4S2W A;  3QSJ A;  3MDI A;  2A8R A;  1VCD A;  3MCF A;  1Q33 A;  2DSB A;  2I6K A;  5C7T A;  1SZ3 A;  3HYQ A;  3GZ6 A;  3EF5 A;  1MQW A;  1NQY A;  1SOI A;  3A6S A;  2FML A;  1NQZ A;  1HZT A;  3GZ5 A;  4JZS A;  4KG4 A;  5IW4 A;  3L85 A;  1MUT A;  2A8Q A;  1VHZ A;  2ICJ A;  4YOQ A;  1RRS A;  4DYW A;  1PPW A;  3R03 A;  2JVB A;  3X0P A;  1X83 A;  2R5W A;  2DUK A;  1KTG A;  5FSM A;  3Q91 A;  4KYX A;  1RRQ A;  2A8S A;  1V8N A;  2QJT A;  4N1T A;  3SON A;  3BHO A;  1VIU A;  3N77 A;  4NFX A;  5C8L A;  4YPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...