1PVHB

Crystal structure of leukemia inhibitory factor in complex with gp130
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
169
structure length
169
Chain Sequence
b'CAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-6 receptor beta chain
publication title Convergent mechanisms for recognition of divergent cytokines by the shared signaling receptor gp130.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/cytokine
total genus 58
structure length 169
sequence length 169
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01291 LIF_OSM LIF / OSM family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1pvhB00
1HUWA 1RCBA 2B5IA 4O9HA 5E4EA 3NCEA 4YQXA 1F45B 1M4BA 1M49A 3D48P 3N06A 5D22A 2O26A 1M47A 3S9DA 1EXZA 1BGCA 2B90A 2ERJD 1IRLA 2D48A 3NCFA 4J4LC 1KF9A 1RFBA 3MZGA 3DLQI 1CNT1 3L5XA 3SE4B 1I1RB 3UEZE 1NBPA 2L3OA 1FYHA 1LK3A 1ITMA 1BGDA 1ITLA 1AX8A 1HULA 1VLKA 3QB7A 5D72A 4MHLA 3PIWA 3UX9A 2E9WC 2Q98A 1PY2A 5FHXA 3HHRA 1IJZA 1BGEA 1D9CA 2LAGA 5D28B 3OQ3A 1ETEA 1V7NV 1ALUA 2INTA 3G9VB 2Q7NB 1IL6A 1HIKA 4YUEC 4ZS7A 1ILKA 1FG9A 2CYKA 5D70A 4O6KA 4NI9A 1HGUA 1CN4C 2GMFA 3PIVA 3D85C 1QVNA 3Q1SI 4GRWA 4CNIC 3B5KA 3QAZA 5KNHI 1Z7CA 3QB1A 1B5LA 3QWRB 3INKC 1PW6A 2D9QA 1BP3A 1F6FA 3HMXB 2B8ZA 3DGCL 1N1FA 1BBNA 4NKQC 5C7XA 1RW5A 1HWHA 1RHGA 1HWGA 2KZ1A 1INRA 3SE3B 5D71A 1V7MV 5L6YC 1CSGA 2LMSA 3L5WI 1PVHB 4WRLB 1ITFA 3N0PA 3NPZA 2B8XA 3BPOA 2B8YA 1Y6KL 1EMRA 3DUHC 3NCCA 1CD9A 1Z92A 3BESL 3NCBA 5LQBA 3EJJA 3VA2A 2IL6A 1JLIA 3WCYI 1WU3I 2L3YA 1HZIA 3QT2C 1LQSL 2ILKA 1A22A 3LB6A 4X51A 4ZF7A 3G6DA 4YPGC 1M48A 1M4AA 1AXIA 3BPNA 2HYMB 4RS1A 1P9MB 1ITIA 1D9GA 4PS4A 1Y6ML 4YDYI 1LKIA 1IK0A 3UF5A 1A7MA 1EKUA 1M4CA 3EW3A 3D87A 1GA3A 2H24A 3BPLA 1BUYA 1YKBA 5FUCA 4Z5RD 1AU1A 1J7VL 1PGRA 2O27A 4DOHA 2B91A 4FA8E 3LB6B 3UF2A 1EERA 4NEMA 4NEJA 1BCNA 1CYLA 4I77Z 1Y6NL 1HIJA 1SCFA 1EVSA 2B8UA 1GNCA 1IARA 4NI7A 1M4RA
chains in the Genus database with same CATH superfamily
2B5IA 4O9HA 3HHCA 2O26A 4A3CD 2VUMD 4QIQA 3UEZE 1FYHA 1LK3A 1ITMA 4BBRD 3HOYD 3UX9A 2E9WC 1PY2A 3O7QA 2JA6D 4A3ID 4A3ED 3OQ3A 1V7NV 4NN5A 4OAAA 4ZS7A 1FG9A 4APSA 2CYKA 4NN6A 2GMFA 3D85C 4ZW9A 5D59A 4GRWA 3QAZA 3QB1A 1B5LA 3QWRB 4DKFA 1BP3A 2B8ZA 5IYBD 4NKQC 4DKDA 4J05A 5L6YC 1WCMD 2B8YA 1Y6KL 1EMRA 1CD9A 3BESL 1WU3I 3QT2C 4OH3A 4ZWBA 5C4XD 3O7PA 1PV7A 3UF5A 4D2DA 1EKUA 2Q14A 1GA3A 2O6IA 3BPLA 4EXNA 4Z5RD 2B91A 3PO2D 1BCNA 1CYLA 4U4TA 1IARA 4PYPA 1RCBA 5E4EA 4W6VA 3D48P 3N06A 5D22A 4GBZA 3H0GD 1M47A 3HOXD 2D48A 2XQBA 3NCFA 3WDOA 3DLQI 1CNT1 3SE4B 1I1RB 1BGDA 1HULA 4BXXD 1D9CA 4Q65A 4GBYA 5D70A 4O6KA 1HGUA 1CN4C 4NN7A 3Q1SI 4IKWA 3DI2A 1Y1VD 2D9QA 2Y5YA 4EXPA 3HOZD 3HMXB 3FKID 1RW5A 4U4WA 5C7XA 1HWHA 1RHGA 1CSGA 4WRLB 5IP7D 3AYHA 2B8XA 3BPOA 1Y14A 3EJJA 1JLIA 3WCYI 2V8NA 3LB6A 4IKYA 5EQIA 1PW4A 5IYCD 4X51A 1AXIA 2HYMB 4A3LD 4JR9A 1P9MB 1D9GA 4D2CA 4YDYI 3H3VE 4LDSA 1M4CA 3D87A 1Y1WD 1BUYA 1AU1A 2Z3QA 1SCFA 1GNCA 4IKXA 4NI7A 4GS7A 1HUWA 4YQXA 1M4BA 1M49A 4LEPA 3OG6A 3S9DA 1EXZA 1BGCA 2B90A 1IRLA 2OQPA 2R93D 1PV6A 4YB9D 4LRLA 2Z3RA 1ITLA 1AX8A 1VLKA 3PIWA 4BBSD 3HOVD 4YBQA 1IJZA 1BGEA 2LAGA 5D28B 2INTA 1ALUA 3PO3D 4YUEC 4NI9A 3PIVA 1QVNA 4D2BA 4CNIC 4ZWCA 1PW6A 4BY7D 1F6FA 3DGCL 1N1FA 2CFPA 3DI3A 2C35A 1INRA 3IRHA 3L5WI 1PVHB 4TPGA 2PSMA 3NCCA 4U4VA 5EQHA 3I4ND 2IL6A 3TGXB 1LQSL 2ILKA 1A22A 2R7ZD 4YPGC 2R92D 2B63D 3BPNA 5D6KA 1ITIA 4PS4A 4DKEA 4IU9A 4ZYRA 5IYDD 1A7MA 5C3ED 2H24A 3HOUD 4IKVA 2JA5D 4TPHA 5FUCA 1J7VL 1PGRA 3OG4A 4NEJA 1Y6NL 4IU8A 5A2OA 1M4RA 4A3FD 3NCEA 1F45B 2ERJD 4J4LC 4UVMA 1KF9A 4XNJA 1RFBA 3MZGA 3L5XA 5TS9A 4DKCA 5IP9D 1NBPA 2L3OA 2JA8D 3QB7A 5D72A 3HOWD 4MHLA 4TPJA 2Q98A 5FHXA 4BY1D 3HHRA 1ETEA 3G9VB 2Q7NB 4GC0A 1IL6A 2XUTA 1HIKA 1ILKA 4XNIA 4JREA 4A3BD 5KNHI 3B5KA 1Z7CA 2CFQA 5C44D 3INKC 1BBNA 2KZ1A 1HWGA 3I4MD 3SE3B 4A3KD 5D71A 1V7MV 5FLMD 2LMSA 2JA7D 1ITFA 3N0PA 3NPZA 5A2NA 3DUHC 3NCBA 1Z92A 5LQBA 3VA2A 2L3YA 1HZIA 4IKZA 4A3MD 4A93D 4ZF7A 5EQGA 3G6DA 1M48A 1M4AA 4A3DD 4RS1A 1Y6ML 1LKIA 1IK0A 4A3JD 3EW3A 5GXBA 4A3GD 4JA3A 1YKBA 2O27A 4FA8E 4DOHA 3LB6B 3UF2A 1EERA 4NEMA 4I77Z 1HIJA 1EVSA 2B8UA 5D58A 5C65A
chains in the Genus database with same CATH topology
1HUWA 1RCBA 2B5IA 4O9HA 5E4EA 3NCEA 3HHCA 4YQXA 1F45B 1M4BA 1M49A 3D48P 3N06A 3OG6A 5D22A 2O26A 3H0GD 1M47A 3HOXD 3S9DA 1EXZA 1BGCA 2B90A 2ERJD 4A3CD 1IRLA 2VUMD 2D48A 2XQBA 3NCFA 4J4LC 2OQPA 1KF9A 1RFBA 3MZGA 2R93D 3DLQI 1CNT1 3L5XA 4LRLA 5TS9A 4DKCA 3SE4B 1I1RB 3UEZE 1NBPA 2L3OA 1FYHA 1LK3A 2Z3RA 5IP9D 1ITMA 1BGDA 2JA8D 1ITLA 1AX8A 1HULA 4BBRD 1VLKA 3QB7A 5D72A 3HOWD 4BXXD 3HOYD 4MHLA 3PIWA 3UX9A 4BBSD 3HOVD 2E9WC 2Q98A 1PY2A 5FHXA 4BY1D 3HHRA 1IJZA 1BGEA 1D9CA 2LAGA 2JA6D 5D28B 4A3ID 4A3ED 3OQ3A 1ETEA 1V7NV 1ALUA 2INTA 3PO3D 3G9VB 4NN5A 2Q7NB 1IL6A 1HIKA 4YUEC 4ZS7A 1ILKA 1FG9A 2CYKA 5D70A 4O6KA 4NI9A 1HGUA 1CN4C 4NN7A 4NN6A 2GMFA 4A3BD 3PIVA 3D85C 1QVNA 3Q1SI 4GRWA 4CNIC 3B5KA 3QAZA 5KNHI 1Z7CA 3QB1A 5C44D 1B5LA 3DI2A 1Y1VD 3INKC 3QWRB 4DKFA 1PW6A 2D9QA 1BP3A 4BY7D 4EXPA 1F6FA 3HMXB 3HOZD 2B8ZA 3DGCL 5IYBD 1N1FA 1BBNA 4NKQC 3FKID 1RW5A 3DI3A 5C7XA 1HWHA 2C35A 1RHGA 1HWGA 2KZ1A 4DKDA 3I4MD 1INRA 3SE3B 4A3KD 5D71A 1V7MV 3IRHA 5FLMD 5L6YC 1CSGA 2LMSA 3L5WI 1PVHB 4WRLB 2JA7D 5IP7D 1ITFA 3AYHA 3N0PA 1WCMD 3NPZA 2B8XA 3BPOA 2B8YA 1Y6KL 2PSMA 1EMRA 3DUHC 3NCCA 1CD9A 1Z92A 3BESL 1Y14A 3NCBA 5LQBA 3EJJA 3VA2A 3I4ND 2IL6A 3TGXB 1JLIA 3WCYI 1WU3I 2L3YA 1HZIA 3QT2C 1LQSL 2ILKA 4A3MD 1A22A 3LB6A 5IYCD 4A93D 5C4XD 4X51A 4ZF7A 2R7ZD 3G6DA 4YPGC 1M48A 1M4AA 2R92D 2B63D 1AXIA 3BPNA 2HYMB 4A3DD 4A3LD 4RS1A 1P9MB 1ITIA 1D9GA 4PS4A 1Y6ML 4YDYI 1LKIA 3H3VE 4DKEA 1IK0A 3UF5A 4A3JD 1A7MA 1EKUA 1M4CA 2Q14A 3EW3A 5IYDD 3D87A 5C3ED 1GA3A 4A3GD 2H24A 2O6IA 3HOUD 1Y1WD 2JA5D 3BPLA 1BUYA 4EXNA 1YKBA 5FUCA 4Z5RD 1AU1A 1J7VL 1PGRA 2O27A 4DOHA 2B91A 2Z3QA 3OG4A 4FA8E 3LB6B 3UF2A 1EERA 4NEMA 4NEJA 3PO2D 1BCNA 1CYLA 4I77Z 1Y6NL 1HIJA 1SCFA 1EVSA 2B8UA 1GNCA 1IARA 4NI7A 1M4RA 4A3FD 4GS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUW A;  1RCB A;  2B5I A;  4O9H A;  5E4E A;  3NCE A;  4YQX A;  1F45 B;  1M4B A;  1M49 A;  3D48 P;  3N06 A;  5D22 A;  2O26 A;  1M47 A;  3S9D A;  1EXZ A;  1BGC A;  2B90 A;  2ERJ D;  1IRL A;  2D48 A;  3NCF A;  4J4L C;  1KF9 A;  1RFB A;  3MZG A;  3DLQ I;  1CNT 1;  3L5X A;  3SE4 B;  1I1R B;  3UEZ E;  1NBP A;  2L3O A;  1FYH A;  1LK3 A;  1ITM A;  1BGD A;  1ITL A;  1AX8 A;  1HUL A;  1VLK A;  3QB7 A;  5D72 A;  4MHL A;  3PIW A;  3UX9 A;  2E9W C;  2Q98 A;  1PY2 A;  5FHX A;  3HHR A;  1IJZ A;  1BGE A;  1D9C A;  2LAG A;  5D28 B;  3OQ3 A;  1ETE A;  1V7N V;  1ALU A;  2INT A;  3G9V B;  2Q7N B;  1IL6 A;  1HIK A;  4YUE C;  4ZS7 A;  1ILK A;  1FG9 A;  2CYK A;  5D70 A;  4O6K A;  4NI9 A;  1HGU A;  1CN4 C;  2GMF A;  3PIV A;  3D85 C;  1QVN A;  3Q1S I;  4GRW A;  4CNI C;  3B5K A;  3QAZ A;  5KNH I;  1Z7C A;  3QB1 A;  1B5L A;  3QWR B;  3INK C;  1PW6 A;  2D9Q A;  1BP3 A;  1F6F A;  3HMX B;  2B8Z A;  3DGC L;  1N1F A;  1BBN A;  4NKQ C;  5C7X A;  1RW5 A;  1HWH A;  1RHG A;  1HWG A;  2KZ1 A;  1INR A;  3SE3 B;  5D71 A;  1V7M V;  5L6Y C;  1CSG A;  2LMS A;  3L5W I;  1PVH B;  4WRL B;  1ITF A;  3N0P A;  3NPZ A;  2B8X A;  3BPO A;  2B8Y A;  1Y6K L;  1EMR A;  3DUH C;  3NCC A;  1CD9 A;  1Z92 A;  3BES L;  3NCB A;  5LQB A;  3EJJ A;  3VA2 A;  2IL6 A;  1JLI A;  3WCY I;  1WU3 I;  2L3Y A;  1HZI A;  3QT2 C;  1LQS L;  2ILK A;  1A22 A;  3LB6 A;  4X51 A;  4ZF7 A;  3G6D A;  4YPG C;  1M48 A;  1M4A A;  1AXI A;  3BPN A;  2HYM B;  4RS1 A;  1P9M B;  1ITI A;  1D9G A;  4PS4 A;  1Y6M L;  4YDY I;  1LKI A;  1IK0 A;  3UF5 A;  1A7M A;  1EKU A;  1M4C A;  3EW3 A;  3D87 A;  1GA3 A;  2H24 A;  3BPL A;  1BUY A;  1YKB A;  5FUC A;  4Z5R D;  1AU1 A;  1J7V L;  1PGR A;  2O27 A;  4DOH A;  2B91 A;  4FA8 E;  3LB6 B;  3UF2 A;  1EER A;  4NEM A;  4NEJ A;  1BCN A;  1CYL A;  4I77 Z;  1Y6N L;  1HIJ A;  1SCF A;  1EVS A;  2B8U A;  1GNC A;  1IAR A;  4NI7 A;  1M4R A; 
#chains in the Genus database with same CATH topology
 2B5I A;  4O9H A;  3HHC A;  2O26 A;  4A3C D;  2VUM D;  4QIQ A;  3UEZ E;  1FYH A;  1LK3 A;  1ITM A;  4BBR D;  3HOY D;  3UX9 A;  2E9W C;  1PY2 A;  3O7Q A;  2JA6 D;  4A3I D;  4A3E D;  3OQ3 A;  1V7N V;  4NN5 A;  4OAA A;  4ZS7 A;  1FG9 A;  4APS A;  2CYK A;  4NN6 A;  2GMF A;  3D85 C;  4ZW9 A;  5D59 A;  4GRW A;  3QAZ A;  3QB1 A;  1B5L A;  3QWR B;  4DKF A;  1BP3 A;  2B8Z A;  5IYB D;  4NKQ C;  4DKD A;  4J05 A;  5L6Y C;  1WCM D;  2B8Y A;  1Y6K L;  1EMR A;  1CD9 A;  3BES L;  1WU3 I;  3QT2 C;  4OH3 A;  4ZWB A;  5C4X D;  3O7P A;  1PV7 A;  3UF5 A;  4D2D A;  1EKU A;  2Q14 A;  1GA3 A;  2O6I A;  3BPL A;  4EXN A;  4Z5R D;  2B91 A;  3PO2 D;  1BCN A;  1CYL A;  4U4T A;  1IAR A;  4PYP A;  1RCB A;  5E4E A;  4W6V A;  3D48 P;  3N06 A;  5D22 A;  4GBZ A;  3H0G D;  1M47 A;  3HOX D;  2D48 A;  2XQB A;  3NCF A;  3WDO A;  3DLQ I;  1CNT 1;  3SE4 B;  1I1R B;  1BGD A;  1HUL A;  4BXX D;  1D9C A;  4Q65 A;  4GBY A;  5D70 A;  4O6K A;  1HGU A;  1CN4 C;  4NN7 A;  3Q1S I;  4IKW A;  3DI2 A;  1Y1V D;  2D9Q A;  2Y5Y A;  4EXP A;  3HOZ D;  3HMX B;  3FKI D;  1RW5 A;  4U4W A;  5C7X A;  1HWH A;  1RHG A;  1CSG A;  4WRL B;  5IP7 D;  3AYH A;  2B8X A;  3BPO A;  1Y14 A;  3EJJ A;  1JLI A;  3WCY I;  2V8N A;  3LB6 A;  4IKY A;  5EQI A;  1PW4 A;  5IYC D;  4X51 A;  1AXI A;  2HYM B;  4A3L D;  4JR9 A;  1P9M B;  1D9G A;  4D2C A;  4YDY I;  3H3V E;  4LDS A;  1M4C A;  3D87 A;  1Y1W D;  1BUY A;  1AU1 A;  2Z3Q A;  1SCF A;  1GNC A;  4IKX A;  4NI7 A;  4GS7 A;  1HUW A;  4YQX A;  1M4B A;  1M49 A;  4LEP A;  3OG6 A;  3S9D A;  1EXZ A;  1BGC A;  2B90 A;  1IRL A;  2OQP A;  2R93 D;  1PV6 A;  4YB9 D;  4LRL A;  2Z3R A;  1ITL A;  1AX8 A;  1VLK A;  3PIW A;  4BBS D;  3HOV D;  4YBQ A;  1IJZ A;  1BGE A;  2LAG A;  5D28 B;  2INT A;  1ALU A;  3PO3 D;  4YUE C;  4NI9 A;  3PIV A;  1QVN A;  4D2B A;  4CNI C;  4ZWC A;  1PW6 A;  4BY7 D;  1F6F A;  3DGC L;  1N1F A;  2CFP A;  3DI3 A;  2C35 A;  1INR A;  3IRH A;  3L5W I;  1PVH B;  4TPG A;  2PSM A;  3NCC A;  4U4V A;  5EQH A;  3I4N D;  2IL6 A;  3TGX B;  1LQS L;  2ILK A;  1A22 A;  2R7Z D;  4YPG C;  2R92 D;  2B63 D;  3BPN A;  5D6K A;  1ITI A;  4PS4 A;  4DKE A;  4IU9 A;  4ZYR A;  5IYD D;  1A7M A;  5C3E D;  2H24 A;  3HOU D;  4IKV A;  2JA5 D;  4TPH A;  5FUC A;  1J7V L;  1PGR A;  3OG4 A;  4NEJ A;  1Y6N L;  4IU8 A;  5A2O A;  1M4R A;  4A3F D;  3NCE A;  1F45 B;  2ERJ D;  4J4L C;  4UVM A;  1KF9 A;  4XNJ A;  1RFB A;  3MZG A;  3L5X A;  5TS9 A;  4DKC A;  5IP9 D;  1NBP A;  2L3O A;  2JA8 D;  3QB7 A;  5D72 A;  3HOW D;  4MHL A;  4TPJ A;  2Q98 A;  5FHX A;  4BY1 D;  3HHR A;  1ETE A;  3G9V B;  2Q7N B;  4GC0 A;  1IL6 A;  2XUT A;  1HIK A;  1ILK A;  4XNI A;  4JRE A;  4A3B D;  5KNH I;  3B5K A;  1Z7C A;  2CFQ A;  5C44 D;  3INK C;  1BBN A;  2KZ1 A;  1HWG A;  3I4M D;  3SE3 B;  4A3K D;  5D71 A;  1V7M V;  5FLM D;  2LMS A;  2JA7 D;  1ITF A;  3N0P A;  3NPZ A;  5A2N A;  3DUH C;  3NCB A;  1Z92 A;  5LQB A;  3VA2 A;  2L3Y A;  1HZI A;  4IKZ A;  4A3M D;  4A93 D;  4ZF7 A;  5EQG A;  3G6D A;  1M48 A;  1M4A A;  4A3D D;  4RS1 A;  1Y6M L;  1LKI A;  1IK0 A;  4A3J D;  3EW3 A;  5GXB A;  4A3G D;  4JA3 A;  1YKB A;  2O27 A;  4FA8 E;  4DOH A;  3LB6 B;  3UF2 A;  1EER A;  4NEM A;  4I77 Z;  1HIJ A;  1EVS A;  2B8U A;  5D58 A;  5C65 A; 
#chains in the Genus database with same CATH homology
 1HUW A;  1RCB A;  2B5I A;  4O9H A;  5E4E A;  3NCE A;  3HHC A;  4YQX A;  1F45 B;  1M4B A;  1M49 A;  3D48 P;  3N06 A;  3OG6 A;  5D22 A;  2O26 A;  3H0G D;  1M47 A;  3HOX D;  3S9D A;  1EXZ A;  1BGC A;  2B90 A;  2ERJ D;  4A3C D;  1IRL A;  2VUM D;  2D48 A;  2XQB A;  3NCF A;  4J4L C;  2OQP A;  1KF9 A;  1RFB A;  3MZG A;  2R93 D;  3DLQ I;  1CNT 1;  3L5X A;  4LRL A;  5TS9 A;  4DKC A;  3SE4 B;  1I1R B;  3UEZ E;  1NBP A;  2L3O A;  1FYH A;  1LK3 A;  2Z3R A;  5IP9 D;  1ITM A;  1BGD A;  2JA8 D;  1ITL A;  1AX8 A;  1HUL A;  4BBR D;  1VLK A;  3QB7 A;  5D72 A;  3HOW D;  4BXX D;  3HOY D;  4MHL A;  3PIW A;  3UX9 A;  4BBS D;  3HOV D;  2E9W C;  2Q98 A;  1PY2 A;  5FHX A;  4BY1 D;  3HHR A;  1IJZ A;  1BGE A;  1D9C A;  2LAG A;  2JA6 D;  5D28 B;  4A3I D;  4A3E D;  3OQ3 A;  1ETE A;  1V7N V;  1ALU A;  2INT A;  3PO3 D;  3G9V B;  4NN5 A;  2Q7N B;  1IL6 A;  1HIK A;  4YUE C;  4ZS7 A;  1ILK A;  1FG9 A;  2CYK A;  5D70 A;  4O6K A;  4NI9 A;  1HGU A;  1CN4 C;  4NN7 A;  4NN6 A;  2GMF A;  4A3B D;  3PIV A;  3D85 C;  1QVN A;  3Q1S I;  4GRW A;  4CNI C;  3B5K A;  3QAZ A;  5KNH I;  1Z7C A;  3QB1 A;  5C44 D;  1B5L A;  3DI2 A;  1Y1V D;  3INK C;  3QWR B;  4DKF A;  1PW6 A;  2D9Q A;  1BP3 A;  4BY7 D;  4EXP A;  1F6F A;  3HMX B;  3HOZ D;  2B8Z A;  3DGC L;  5IYB D;  1N1F A;  1BBN A;  4NKQ C;  3FKI D;  1RW5 A;  3DI3 A;  5C7X A;  1HWH A;  2C35 A;  1RHG A;  1HWG A;  2KZ1 A;  4DKD A;  3I4M D;  1INR A;  3SE3 B;  4A3K D;  5D71 A;  1V7M V;  3IRH A;  5FLM D;  5L6Y C;  1CSG A;  2LMS A;  3L5W I;  1PVH B;  4WRL B;  2JA7 D;  5IP7 D;  1ITF A;  3AYH A;  3N0P A;  1WCM D;  3NPZ A;  2B8X A;  3BPO A;  2B8Y A;  1Y6K L;  2PSM A;  1EMR A;  3DUH C;  3NCC A;  1CD9 A;  1Z92 A;  3BES L;  1Y14 A;  3NCB A;  5LQB A;  3EJJ A;  3VA2 A;  3I4N D;  2IL6 A;  3TGX B;  1JLI A;  3WCY I;  1WU3 I;  2L3Y A;  1HZI A;  3QT2 C;  1LQS L;  2ILK A;  4A3M D;  1A22 A;  3LB6 A;  5IYC D;  4A93 D;  5C4X D;  4X51 A;  4ZF7 A;  2R7Z D;  3G6D A;  4YPG C;  1M48 A;  1M4A A;  2R92 D;  2B63 D;  1AXI A;  3BPN A;  2HYM B;  4A3D D;  4A3L D;  4RS1 A;  1P9M B;  1ITI A;  1D9G A;  4PS4 A;  1Y6M L;  4YDY I;  1LKI A;  3H3V E;  4DKE A;  1IK0 A;  3UF5 A;  4A3J D;  1A7M A;  1EKU A;  1M4C A;  2Q14 A;  3EW3 A;  5IYD D;  3D87 A;  5C3E D;  1GA3 A;  4A3G D;  2H24 A;  2O6I A;  3HOU D;  1Y1W D;  2JA5 D;  3BPL A;  1BUY A;  4EXN A;  1YKB A;  5FUC A;  4Z5R D;  1AU1 A;  1J7V L;  1PGR A;  2O27 A;  4DOH A;  2B91 A;  2Z3Q A;  3OG4 A;  4FA8 E;  3LB6 B;  3UF2 A;  1EER A;  4NEM A;  4NEJ A;  3PO2 D;  1BCN A;  1CYL A;  4I77 Z;  1Y6N L;  1HIJ A;  1SCF A;  1EVS A;  2B8U A;  1GNC A;  1IAR A;  4NI7 A;  1M4R A;  4A3F D;  4GS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...