1PVSA

3-methyladenine glcosylase ii(alka) hypoxanthine complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosylase II
publication title 3-methyladenine-DNA glycosylase II: the crystal structure of an AlkA-hypoxanthine complex suggests the possibility of product inhibition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 89
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2003-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 1pvsA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 1pvsA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 1pvsA01
3IH7A 1N3CA 1PU6A 1LMZA 2OFIA 1VRLA 1LWWA 2H56A 3KNTA 3F10A 3CWAA 1PVSA 3CWUA 1KEAA 4B23A 2YG9A 1XQPA 3FSPA 4YOQA 3G0QA 4B22A 1FN7A 4AIAA 2NOFA 4EA4A 2NOEA 4HSBA 4OFEA 2NOZA 2ABKA 3CWTA 4EJYA 1M3QA 1WEFA 3FHFA 1WEGA 2JG6A 1KO9A 1EBMA 4EW0A 1YQKA 1LWVA 3IHOA 1WEIA 5CHZA 1KG5A 3I0WA 4E9FA 4EJZA 2I5WA 4E9GA 2NOLA 2OFKA 1N3AA 3CVTA 4UOBA 2NOHA 1KG2A 1P7MA 1YQMA 4PIIA 4OFHA 1XQOA 3N0UA 1KG7A 5DPKA 1HU0A 1KQJA 1PU8A 3N5NX 3CWSA 1MPGA 1MUNA 4YPHA 3OGDA 1ORPA 4B21A 3S6IA 4B24A 3OH6A 4EVVA 3CW7A 4AI5A 1RRSA 3KTUA 4E9EA 4YPRA 1NGNA 4AI4A 3OH9A 1RRQA 3I0XA 3FHGA 1XG7A 1LWYA 2JHJA 1KG4A 3CVSA 1DIZA 1M3HA 1YQRA 3F0ZA 1MUDA 1KG6A 1KG3A 4E9HA 1ORNA 1NKUA 4DK9A 4OFAA 2NOBA 4EW4A 5AN4A 3D4VA 2NOIA 1MUYA 4EA5A 2JHNA 1P59A 1N39A 2XHIA 5KN8A 4UNFA 1YQLA 1PU7A 2YG8A 5KN9A
chains in the Genus database with same CATH superfamily
1Q9UA 2FKFA 2JOIA 1LMZA 2OFIA 1VRLA 1TGHA 3N89A 5F9CA 5IYCP 1QNCA 1XQPA 1C4GA 5IYDP 4EA4A 2FUVA 4MRQA 1WQAA 3PMGA 3OYEA 3CWTA 3ULXA 1YTBA 2Z8UA 3IHOA 1KG5A 3SNSA 2I5WA 4E9GA 2OFKA 1N3AA 4C7PA 1KG2A 2DKDA 1QN5A 1KG7A 3KRMA 1HU0A 3TE5A 4B0AA 4ZTJA 3OYMA 3OYAA 1QNAA 1ORPA 1UT7A 1VOKA 4B24A 4EVVA 3OYNA 2H4LX 2VJ0A 2QR1A 2HL9A 3TDHA 3OH9A 3I0XA 3FHGA 1XG7A 1R4XA 3CVSA 1PCZA 2YH5A 1M3HA 4ZTFA 3T4NA 1KG6A 4BACA 4BE0A 3OSTA 4DK9A 2QRDA 5AN4A 1MUYA 2OOYA 3RSMA 5KN8A 1LXTA 1QN8A 2Y8QA 2YG8A 4BE2A 3DPTA 4WXAA 4EAIA 2V92A 3HS9A 4DULA 4RODB 3OYKA 3CWAA 3CWUA 1EUVA 2HZSA 2YG9A 3FSPA 3OSMA 4WX8A 1T6AA 2NOEA 1PZDA 4OFEA 3EIKA 3OYLA 1M3QA 1WEGA 2JG6A 1CDWA 4BE1A 2NVMA 3OYCA 2QREA 3HS8A 1NVPA 3S3MA 1WEIA 5CHZA 1KY7A 2MJ7A 2IV8A 4E9FA 1D3UA 3CVTA 3UW2A 2IV9A 3C04A 1KFIA 1KYUA 3OS1A 2JPSA 2EHBD 4OFHA 1XQOA 5DPKA 4E7JA 1K2YX 1KQJA 3N5NX 2FKMX 3OYHA 1UL7A 1QN7A 1YTFA 1TBAB 1VTOA 3ASMA 3PDKA 1PCJX 4B21A 3OH6A 3S3OA 2O3OA 3OYFA 5FRMA 4E7IA 4E9EA 1NGNA 4AI4A 4Q11A 1VKLA 5JMVD 2NWVA 1KYFA 5BMNA 2D0BA 1KG4A 2QRCA 1MUDA 4QG5A 3OCIA 3OS0A 2NOBA 1NH2A 5FROA 2NOIA 2F7LA 4WZSD 1N39A 1M5Q1 3OY9A 5KL0A 1E42A 5KN9A 2ZFDB 3VN5A 1PU6A 2MZ8A 2D0CA 1QN3A 3ENOC 1LWWA 3KNTA 1KEAA 2NLVA 4YOQA 4BDZA 1C9BB 1TUOA 1FN7A 2NOFA 3L2QA 1QN6A 1UT4A 1TBPA 2D0AA 1P5DX 4BJUA 5BMPA 1NGMA 2QLVA 4EW0A 1YQKA 1LWVA 1QNEA 1XSZA 3I0WA 4UOBA 1JDYA 4NZGA 3OYJA 3NNQA 1PCMX 1VTLE 3OYGA 4PIIA 3EAYA 3ENCA 3N0UA 3CWSA 4YPHA 2OOXA 4ROEB 2V8QA 4EAGA 4PY5A 3OS2A 3VW4A 1U84A 4D7RA 3LCNA 2Z0FA 4E7KA 2JPIA 4ROCB 1LWYA 2DKCA 5JN5A 3DPUA 2Y8LA 1MP9A 2JHJA 2LAEA 1K35A 1P5GX 3L2UA 2HZMA 2W03A 1V5SA 3RPJA 1NKUA 3D4VA 4E7LA 3I3WA 2V9JA 4EAJA 4EA5A 1P59A 4UNFA 4HJHA 1YQLA 3H1ZA 4AIAA 1B9KA 3IH7A 1N3CA 1QN9A 2H56A 3F10A 4CFFA 1PVSA 4B23A 3L2WA 3G0QA 4B22A 4E7HA 2YA3A 1AISA 3L2VA 4HSBA 1KY6A 2PWWA 3OLPA 2NOZA 2ABKA 4EJYA 1W80A 1WEFA 3FHFA 1KO9A 2V75A 1EBMA 4TPSA 2R5XA 2G30A 5HSHA 4EAKA 2DKAA 4EJZA 2NOLA 5FRNA 5IYBP 2NOHA 1JFIC 1P7MA 1J3MA 1YQMA 3OYBA 1VOLB 1QTPA 4I8OA 1PU8A 3R2XC 1MPGA 1MUNA 2FGTA 3BKQX 1KYDA 3OGDA 3OC3C 2W04A 3NA5A 3S6IA 1RM1A 3L2RA 3CW7A 4AI5A 2HL8A 1RRSA 3KTUA 2H5AX 1WJWA 4YPRA 1KFQA 3OSEA 2HKPA 1RRQA 4BDYA 5EPCA 4IKFA 3OYDA 1DIZA 1C47A 1YQRA 3F0ZA 4EALA 1KG3A 4E9HA 1ORNA 4OFAA 4EW4A 1QTSA 3OYIA 3D7QA 3S3NA 2JHNA 4IL8A 2XHIA 1PU7A 4D7QA 1QN4A 1QNBA
chains in the Genus database with same CATH topology
3IH7A 1N3CA 1PU6A 1LMZA 2OFIA 1VRLA 1LWWA 2H56A 3KNTA 3F10A 3CWAA 1PVSA 3CWUA 1KEAA 4B23A 2YG9A 1XQPA 3FSPA 4YOQA 3G0QA 4B22A 1FN7A 4AIAA 2NOFA 4EA4A 2NOEA 4HSBA 4OFEA 2NOZA 2ABKA 3CWTA 4EJYA 1M3QA 1WEFA 3FHFA 1WEGA 2JG6A 1KO9A 1EBMA 4EW0A 1YQKA 1LWVA 3IHOA 1WEIA 5CHZA 1KG5A 3I0WA 4E9FA 4EJZA 2I5WA 4E9GA 2NOLA 2OFKA 1N3AA 3CVTA 4UOBA 2NOHA 1KG2A 1P7MA 1YQMA 4PIIA 4OFHA 1XQOA 3N0UA 1KG7A 5DPKA 1HU0A 1KQJA 1PU8A 3N5NX 3CWSA 1MPGA 1MUNA 4YPHA 3OGDA 1ORPA 4B21A 3S6IA 4B24A 3OH6A 4EVVA 3CW7A 4AI5A 1RRSA 3KTUA 4E9EA 4YPRA 1NGNA 4AI4A 3OH9A 1RRQA 3I0XA 3FHGA 1XG7A 1LWYA 2JHJA 1KG4A 3CVSA 1DIZA 1M3HA 1YQRA 3F0ZA 1MUDA 1KG6A 1KG3A 4E9HA 1ORNA 1NKUA 4DK9A 4OFAA 2NOBA 4EW4A 5AN4A 3D4VA 2NOIA 1MUYA 4EA5A 2JHNA 1P59A 1N39A 2XHIA 5KN8A 4UNFA 1YQLA 1PU7A 2YG8A 5KN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH7 A;  1N3C A;  1PU6 A;  1LMZ A;  2OFI A;  1VRL A;  1LWW A;  2H56 A;  3KNT A;  3F10 A;  3CWA A;  1PVS A;  3CWU A;  1KEA A;  4B23 A;  2YG9 A;  1XQP A;  3FSP A;  4YOQ A;  3G0Q A;  4B22 A;  1FN7 A;  4AIA A;  2NOF A;  4EA4 A;  2NOE A;  4HSB A;  4OFE A;  2NOZ A;  2ABK A;  3CWT A;  4EJY A;  1M3Q A;  1WEF A;  3FHF A;  1WEG A;  2JG6 A;  1KO9 A;  1EBM A;  4EW0 A;  1YQK A;  1LWV A;  3IHO A;  1WEI A;  5CHZ A;  1KG5 A;  3I0W A;  4E9F A;  4EJZ A;  2I5W A;  4E9G A;  2NOL A;  2OFK A;  1N3A A;  3CVT A;  4UOB A;  2NOH A;  1KG2 A;  1P7M A;  1YQM A;  4PII A;  4OFH A;  1XQO A;  3N0U A;  1KG7 A;  5DPK A;  1HU0 A;  1KQJ A;  1PU8 A;  3N5N X;  3CWS A;  1MPG A;  1MUN A;  4YPH A;  3OGD A;  1ORP A;  4B21 A;  3S6I A;  4B24 A;  3OH6 A;  4EVV A;  3CW7 A;  4AI5 A;  1RRS A;  3KTU A;  4E9E A;  4YPR A;  1NGN A;  4AI4 A;  3OH9 A;  1RRQ A;  3I0X A;  3FHG A;  1XG7 A;  1LWY A;  2JHJ A;  1KG4 A;  3CVS A;  1DIZ A;  1M3H A;  1YQR A;  3F0Z A;  1MUD A;  1KG6 A;  1KG3 A;  4E9H A;  1ORN A;  1NKU A;  4DK9 A;  4OFA A;  2NOB A;  4EW4 A;  5AN4 A;  3D4V A;  2NOI A;  1MUY A;  4EA5 A;  2JHN A;  1P59 A;  1N39 A;  2XHI A;  5KN8 A;  4UNF A;  1YQL A;  1PU7 A;  2YG8 A;  5KN9 A; 
#chains in the Genus database with same CATH topology
 1Q9U A;  2FKF A;  2JOI A;  1LMZ A;  2OFI A;  1VRL A;  1TGH A;  3N89 A;  5F9C A;  5IYC P;  1QNC A;  1XQP A;  1C4G A;  5IYD P;  4EA4 A;  2FUV A;  4MRQ A;  1WQA A;  3PMG A;  3OYE A;  3CWT A;  3ULX A;  1YTB A;  2Z8U A;  3IHO A;  1KG5 A;  3SNS A;  2I5W A;  4E9G A;  2OFK A;  1N3A A;  4C7P A;  1KG2 A;  2DKD A;  1QN5 A;  1KG7 A;  3KRM A;  1HU0 A;  3TE5 A;  4B0A A;  4ZTJ A;  3OYM A;  3OYA A;  1QNA A;  1ORP A;  1UT7 A;  1VOK A;  4B24 A;  4EVV A;  3OYN A;  2H4L X;  2VJ0 A;  2QR1 A;  2HL9 A;  3TDH A;  3OH9 A;  3I0X A;  3FHG A;  1XG7 A;  1R4X A;  3CVS A;  1PCZ A;  2YH5 A;  1M3H A;  4ZTF A;  3T4N A;  1KG6 A;  4BAC A;  4BE0 A;  3OST A;  4DK9 A;  2QRD A;  5AN4 A;  1MUY A;  2OOY A;  3RSM A;  5KN8 A;  1LXT A;  1QN8 A;  2Y8Q A;  2YG8 A;  4BE2 A;  3DPT A;  4WXA A;  4EAI A;  2V92 A;  3HS9 A;  4DUL A;  4ROD B;  3OYK A;  3CWA A;  3CWU A;  1EUV A;  2HZS A;  2YG9 A;  3FSP A;  3OSM A;  4WX8 A;  1T6A A;  2NOE A;  1PZD A;  4OFE A;  3EIK A;  3OYL A;  1M3Q A;  1WEG A;  2JG6 A;  1CDW A;  4BE1 A;  2NVM A;  3OYC A;  2QRE A;  3HS8 A;  1NVP A;  3S3M A;  1WEI A;  5CHZ A;  1KY7 A;  2MJ7 A;  2IV8 A;  4E9F A;  1D3U A;  3CVT A;  3UW2 A;  2IV9 A;  3C04 A;  1KFI A;  1KYU A;  3OS1 A;  2JPS A;  2EHB D;  4OFH A;  1XQO A;  5DPK A;  4E7J A;  1K2Y X;  1KQJ A;  3N5N X;  2FKM X;  3OYH A;  1UL7 A;  1QN7 A;  1YTF A;  1TBA B;  1VTO A;  3ASM A;  3PDK A;  1PCJ X;  4B21 A;  3OH6 A;  3S3O A;  2O3O A;  3OYF A;  5FRM A;  4E7I A;  4E9E A;  1NGN A;  4AI4 A;  4Q11 A;  1VKL A;  5JMV D;  2NWV A;  1KYF A;  5BMN A;  2D0B A;  1KG4 A;  2QRC A;  1MUD A;  4QG5 A;  3OCI A;  3OS0 A;  2NOB A;  1NH2 A;  5FRO A;  2NOI A;  2F7L A;  4WZS D;  1N39 A;  1M5Q 1;  3OY9 A;  5KL0 A;  1E42 A;  5KN9 A;  2ZFD B;  3VN5 A;  1PU6 A;  2MZ8 A;  2D0C A;  1QN3 A;  3ENO C;  1LWW A;  3KNT A;  1KEA A;  2NLV A;  4YOQ A;  4BDZ A;  1C9B B;  1TUO A;  1FN7 A;  2NOF A;  3L2Q A;  1QN6 A;  1UT4 A;  1TBP A;  2D0A A;  1P5D X;  4BJU A;  5BMP A;  1NGM A;  2QLV A;  4EW0 A;  1YQK A;  1LWV A;  1QNE A;  1XSZ A;  3I0W A;  4UOB A;  1JDY A;  4NZG A;  3OYJ A;  3NNQ A;  1PCM X;  1VTL E;  3OYG A;  4PII A;  3EAY A;  3ENC A;  3N0U A;  3CWS A;  4YPH A;  2OOX A;  4ROE B;  2V8Q A;  4EAG A;  4PY5 A;  3OS2 A;  3VW4 A;  1U84 A;  4D7R A;  3LCN A;  2Z0F A;  4E7K A;  2JPI A;  4ROC B;  1LWY A;  2DKC A;  5JN5 A;  3DPU A;  2Y8L A;  1MP9 A;  2JHJ A;  2LAE A;  1K35 A;  1P5G X;  3L2U A;  2HZM A;  2W03 A;  1V5S A;  3RPJ A;  1NKU A;  3D4V A;  4E7L A;  3I3W A;  2V9J A;  4EAJ A;  4EA5 A;  1P59 A;  4UNF A;  4HJH A;  1YQL A;  3H1Z A;  4AIA A;  1B9K A;  3IH7 A;  1N3C A;  1QN9 A;  2H56 A;  3F10 A;  4CFF A;  1PVS A;  4B23 A;  3L2W A;  3G0Q A;  4B22 A;  4E7H A;  2YA3 A;  1AIS A;  3L2V A;  4HSB A;  1KY6 A;  2PWW A;  3OLP A;  2NOZ A;  2ABK A;  4EJY A;  1W80 A;  1WEF A;  3FHF A;  1KO9 A;  2V75 A;  1EBM A;  4TPS A;  2R5X A;  2G30 A;  5HSH A;  4EAK A;  2DKA A;  4EJZ A;  2NOL A;  5FRN A;  5IYB P;  2NOH A;  1JFI C;  1P7M A;  1J3M A;  1YQM A;  3OYB A;  1VOL B;  1QTP A;  4I8O A;  1PU8 A;  3R2X C;  1MPG A;  1MUN A;  2FGT A;  3BKQ X;  1KYD A;  3OGD A;  3OC3 C;  2W04 A;  3NA5 A;  3S6I A;  1RM1 A;  3L2R A;  3CW7 A;  4AI5 A;  2HL8 A;  1RRS A;  3KTU A;  2H5A X;  1WJW A;  4YPR A;  1KFQ A;  3OSE A;  2HKP A;  1RRQ A;  4BDY A;  5EPC A;  4IKF A;  3OYD A;  1DIZ A;  1C47 A;  1YQR A;  3F0Z A;  4EAL A;  1KG3 A;  4E9H A;  1ORN A;  4OFA A;  4EW4 A;  1QTS A;  3OYI A;  3D7Q A;  3S3N A;  2JHN A;  4IL8 A;  2XHI A;  1PU7 A;  4D7Q A;  1QN4 A;  1QNB A; 
#chains in the Genus database with same CATH homology
 3IH7 A;  1N3C A;  1PU6 A;  1LMZ A;  2OFI A;  1VRL A;  1LWW A;  2H56 A;  3KNT A;  3F10 A;  3CWA A;  1PVS A;  3CWU A;  1KEA A;  4B23 A;  2YG9 A;  1XQP A;  3FSP A;  4YOQ A;  3G0Q A;  4B22 A;  1FN7 A;  4AIA A;  2NOF A;  4EA4 A;  2NOE A;  4HSB A;  4OFE A;  2NOZ A;  2ABK A;  3CWT A;  4EJY A;  1M3Q A;  1WEF A;  3FHF A;  1WEG A;  2JG6 A;  1KO9 A;  1EBM A;  4EW0 A;  1YQK A;  1LWV A;  3IHO A;  1WEI A;  5CHZ A;  1KG5 A;  3I0W A;  4E9F A;  4EJZ A;  2I5W A;  4E9G A;  2NOL A;  2OFK A;  1N3A A;  3CVT A;  4UOB A;  2NOH A;  1KG2 A;  1P7M A;  1YQM A;  4PII A;  4OFH A;  1XQO A;  3N0U A;  1KG7 A;  5DPK A;  1HU0 A;  1KQJ A;  1PU8 A;  3N5N X;  3CWS A;  1MPG A;  1MUN A;  4YPH A;  3OGD A;  1ORP A;  4B21 A;  3S6I A;  4B24 A;  3OH6 A;  4EVV A;  3CW7 A;  4AI5 A;  1RRS A;  3KTU A;  4E9E A;  4YPR A;  1NGN A;  4AI4 A;  3OH9 A;  1RRQ A;  3I0X A;  3FHG A;  1XG7 A;  1LWY A;  2JHJ A;  1KG4 A;  3CVS A;  1DIZ A;  1M3H A;  1YQR A;  3F0Z A;  1MUD A;  1KG6 A;  1KG3 A;  4E9H A;  1ORN A;  1NKU A;  4DK9 A;  4OFA A;  2NOB A;  4EW4 A;  5AN4 A;  3D4V A;  2NOI A;  1MUY A;  4EA5 A;  2JHN A;  1P59 A;  1N39 A;  2XHI A;  5KN8 A;  4UNF A;  1YQL A;  1PU7 A;  2YG8 A;  5KN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...