1PVSA

3-methyladenine glcosylase ii(alka) hypoxanthine complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosylase II
publication title 3-methyladenine-DNA glycosylase II: the crystal structure of an AlkA-hypoxanthine complex suggests the possibility of product inhibition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 89
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2003-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 1pvsA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 1pvsA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 1pvsA01
1YQRA 1M3QA 3OGDA 1LWWA 4EA5A 4OFAA 5KN9A 1N39A 3CWSA 2JG6A 1KG3A 4EW0A 5CHZA 4EJZA 3IH7A 4UOBA 3G0QA 3S6IA 2JHNA 4B24A 1P59A 1XG7A 3OH9A 2NOHA 1LWVA 3CVTA 1MUNA 1KG2A 2YG9A 5KN8A 2NOLA 4OFHA 1M3HA 1LWYA 4E9GA 3D4VA 2XHIA 4B23A 1VRLA 1XQPA 3FHGA 4YPRA 2NOEA 2OFIA 3CWUA 2ABKA 3F10A 3IHOA 5DPKA 2NOZA 1NKUA 1WEFA 2NOFA 1FN7A 3FHFA 4HSBA 3OH6A 2JHJA 4E9FA 1PU6A 3CWTA 4UNFA 1ORNA 1WEIA 1HU0A 2I5WA 3CVSA 1KG6A 1KG5A 3CWAA 1WEGA 4EW4A 3N5NX 3N0UA 1N3AA 4OFEA 4EJYA 1KG4A 1MPGA 3F0ZA 4AI5A 2OFKA 2NOIA 1MUYA 4B21A 3I0WA 1ORPA 2NOBA 1NGNA 4DK9A 1KO9A 1N3CA 4EVVA 4B22A 1YQLA 4AIAA 1EBMA 4YPHA 1P7MA 1PVSA 5AN4A 4YOQA 2YG8A 3I0XA 1RRQA 1KQJA 4E9EA 2H56A 4PIIA 3FSPA 1YQMA 1PU8A 3CW7A 4E9HA 1KG7A 1YQKA 3KTUA 1MUDA 1DIZA 4AI4A 1KEAA 1XQOA 1PU7A 1RRSA 1LMZA 3KNTA 4EA4A
chains in the Genus database with same CATH superfamily
2DKDA 1YQRA 1KYDA 3UW2A 3L2QA 1LWWA 2H4LX 1QNBA 4I8OA 1KG3A 2Z0FA 2MJ7A 3OY9A 3G0QA 3S6IA 5HSHA 2QRCA 1XG7A 1NH2A 2FUVA 2JPIA 2NOHA 1QN7A 1QN6A 2Y8QA 1P5GX 1MUNA 3OS1A 2YG9A 5KN8A 2QRDA 3PMGA 3OLPA 2V9JA 1C4GA 1UT7A 4TPSA 2FKMX 1TBAB 3ENCA 3FHGA 3F10A 5DPKA 3RSMA 3SNSA 3L2UA 4E7KA 2HZMA 1P5DX 1ORNA 1HU0A 3L2RA 4BDZA 2QREA 5FRMA 4EAIA 3N0UA 2G30A 4E7HA 2W04A 4AI5A 2OFKA 2PWWA 1KFQA 5BMNA 2OOYA 2O3OA 3EAYA 4ZTFA 1K35A 1VKLA 3OYIA 3OS2A 2HL8A 3D7QA 4B22A 1QN5A 3H1ZA 3EIKA 5AN4A 2YG8A 2DKAA 3OYHA 4BJUA 4EALA 1QTPA 1KY7A 1QNCA 1TBPA 4D7RA 3NA5A 5IYDP 3OS0A 1YQKA 1MUDA 2V75A 2D0BA 1RM1A 3L2VA 1RRQA 4EA4A 3OYAA 2YA3A 2FGTA 4EW0A 2QR1A 4UOBA 4WZSD 3LCNA 2VJ0A 2HL9A 4DULA 5IYCP 1WQAA 1B9KA 3CVTA 1KG2A 1CDWA 1K2YX 4E7IA 1LWYA 3DPTA 4B23A 4ROCB 1VRLA 1XQPA 5IYBP 2OFIA 2ABKA 1WEFA 3T4NA 4ZTJA 4HSBA 1FN7A 2JOIA 3OH6A 1C47A 4QG5A 1PU6A 5JN5A 3RPJA 1QN4A 2F7LA 3I0WA 1KY6A 2NOBA 4B0AA 1U84A 1NGNA 5BMPA 5F9CA 1PCMX 1VOLB 1V5SA 2IV8A 3OYNA 1KFIA 4EAGA 1P7MA 2V8QA 1W80A 3I0XA 2DKCA 1KQJA 2H56A 4PIIA 4Q11A 3PDKA 1D3UA 5FRNA 1YTFA 1QNEA 1QN3A 3CW7A 4E9HA 3VN5A 1KEAA 3I3WA 1XQOA 3OYEA 1YTBA 3OYLA 2V92A 1R4XA 1NVPA 4CFFA 1M5Q1 1M3QA 3OGDA 1JFIC 4EA5A 1QN8A 1KYFA 3OYBA 4BACA 3CWSA 3IH7A 1WJWA 3C04A 3N89A 2ZFDB 1QN9A 4WX8A 3OSTA 1C9BB 3OYDA 3TDHA 1M3HA 4E9GA 3OYKA 3HS8A 3ASMA 4YPRA 3CWUA 1JDYA 1NKUA 2NOFA 4D7QA 4E7LA 1XSZA 2JHJA 4E9FA 4UNFA 2YH5A 3CVSA 1KG6A 1KG5A 1WEGA 1N3AA 4IKFA 1QNAA 4OFEA 1MPGA 4MRQA 1TUOA 2NOIA 2QLVA 2NVMA 4E7JA 5JMVD 4DK9A 1KO9A 4EVVA 3L2WA 1YQLA 4AIAA 1EBMA 4YPHA 1J3MA 4EAJA 4YOQA 1PVSA 1NGMA 3KRMA 1QTSA 2NWVA 3OYMA 3FSPA 1KYUA 2EHBD 1EUVA 2OOXA 2JPSA 4PY5A 3KTUA 1DIZA 3ULXA 1PU7A 1RRSA 5KL0A 4BE1A 3TE5A 2D0CA 2NLVA 4OFAA 5KN9A 1N39A 3OCIA 2JG6A 1T6AA 1LXTA 5CHZA 4EJZA 3OSEA 1AISA 3NNQA 1UL7A 1UT4A 2D0AA 2JHNA 4B24A 1P59A 2H5AX 2Y8LA 3OYGA 3OH9A 3S3OA 1VTOA 2R5XA 1LWVA 3BKQX 3OC3C 3OYJA 3S3NA 2IV9A 2NOLA 4OFHA 3D4VA 2XHIA 2LAEA 3HS9A 1VOKA 2FKFA 3DPUA 2NOEA 3IHOA 2NOZA 3ENOC 3FHFA 4BDYA 4BE2A 2HKPA 2Z8UA 3CWTA 1WEIA 2I5WA 3CWAA 4EW4A 1PCZA 3N5NX 2W03A 4EJYA 1KG4A 3F0ZA 4EAKA 1MUYA 4B21A 3R2XC 5FROA 1ORPA 2HZSA 1PCJX 1N3CA 1MP9A 4ROEB 2MZ8A 4WXAA 3S3MA 3OSMA 3OYCA 1TGHA 4HJHA 4E9EA 3OYFA 4NZGA 3VW4A 1YQMA 4IL8A 1PU8A 1Q9UA 4RODB 4C7PA 1KG7A 1PZDA 4AI4A 5EPCA 4BE0A 1VTLE 1LMZA 3KNTA 1E42A
chains in the Genus database with same CATH topology
1YQRA 1M3QA 3OGDA 1LWWA 4EA5A 4OFAA 5KN9A 1N39A 3CWSA 2JG6A 1KG3A 4EW0A 5CHZA 4EJZA 3IH7A 4UOBA 3G0QA 3S6IA 2JHNA 4B24A 1P59A 1XG7A 3OH9A 2NOHA 1LWVA 3CVTA 1MUNA 1KG2A 2YG9A 5KN8A 2NOLA 4OFHA 1M3HA 1LWYA 4E9GA 3D4VA 2XHIA 4B23A 1VRLA 1XQPA 3FHGA 4YPRA 2NOEA 2OFIA 3CWUA 2ABKA 3F10A 3IHOA 5DPKA 2NOZA 1NKUA 1WEFA 2NOFA 1FN7A 3FHFA 4HSBA 3OH6A 2JHJA 4E9FA 1PU6A 3CWTA 4UNFA 1ORNA 1WEIA 1HU0A 2I5WA 3CVSA 1KG6A 1KG5A 3CWAA 1WEGA 4EW4A 3N5NX 3N0UA 1N3AA 4OFEA 4EJYA 1KG4A 1MPGA 3F0ZA 4AI5A 2OFKA 2NOIA 1MUYA 4B21A 3I0WA 1ORPA 2NOBA 1NGNA 4DK9A 1KO9A 1N3CA 4EVVA 4B22A 1YQLA 4AIAA 1EBMA 4YPHA 1P7MA 1PVSA 5AN4A 4YOQA 2YG8A 3I0XA 1RRQA 1KQJA 4E9EA 2H56A 4PIIA 3FSPA 1YQMA 1PU8A 3CW7A 4E9HA 1KG7A 1YQKA 3KTUA 1MUDA 1DIZA 4AI4A 1KEAA 1XQOA 1PU7A 1RRSA 1LMZA 3KNTA 4EA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQR A;  1M3Q A;  3OGD A;  1LWW A;  4EA5 A;  4OFA A;  5KN9 A;  1N39 A;  3CWS A;  2JG6 A;  1KG3 A;  4EW0 A;  5CHZ A;  4EJZ A;  3IH7 A;  4UOB A;  3G0Q A;  3S6I A;  2JHN A;  4B24 A;  1P59 A;  1XG7 A;  3OH9 A;  2NOH A;  1LWV A;  3CVT A;  1MUN A;  1KG2 A;  2YG9 A;  5KN8 A;  2NOL A;  4OFH A;  1M3H A;  1LWY A;  4E9G A;  3D4V A;  2XHI A;  4B23 A;  1VRL A;  1XQP A;  3FHG A;  4YPR A;  2NOE A;  2OFI A;  3CWU A;  2ABK A;  3F10 A;  3IHO A;  5DPK A;  2NOZ A;  1NKU A;  1WEF A;  2NOF A;  1FN7 A;  3FHF A;  4HSB A;  3OH6 A;  2JHJ A;  4E9F A;  1PU6 A;  3CWT A;  4UNF A;  1ORN A;  1WEI A;  1HU0 A;  2I5W A;  3CVS A;  1KG6 A;  1KG5 A;  3CWA A;  1WEG A;  4EW4 A;  3N5N X;  3N0U A;  1N3A A;  4OFE A;  4EJY A;  1KG4 A;  1MPG A;  3F0Z A;  4AI5 A;  2OFK A;  2NOI A;  1MUY A;  4B21 A;  3I0W A;  1ORP A;  2NOB A;  1NGN A;  4DK9 A;  1KO9 A;  1N3C A;  4EVV A;  4B22 A;  1YQL A;  4AIA A;  1EBM A;  4YPH A;  1P7M A;  1PVS A;  5AN4 A;  4YOQ A;  2YG8 A;  3I0X A;  1RRQ A;  1KQJ A;  4E9E A;  2H56 A;  4PII A;  3FSP A;  1YQM A;  1PU8 A;  3CW7 A;  4E9H A;  1KG7 A;  1YQK A;  3KTU A;  1MUD A;  1DIZ A;  4AI4 A;  1KEA A;  1XQO A;  1PU7 A;  1RRS A;  1LMZ A;  3KNT A;  4EA4 A; 
#chains in the Genus database with same CATH topology
 2DKD A;  1YQR A;  1KYD A;  3UW2 A;  3L2Q A;  1LWW A;  2H4L X;  1QNB A;  4I8O A;  1KG3 A;  2Z0F A;  2MJ7 A;  3OY9 A;  3G0Q A;  3S6I A;  5HSH A;  2QRC A;  1XG7 A;  1NH2 A;  2FUV A;  2JPI A;  2NOH A;  1QN7 A;  1QN6 A;  2Y8Q A;  1P5G X;  1MUN A;  3OS1 A;  2YG9 A;  5KN8 A;  2QRD A;  3PMG A;  3OLP A;  2V9J A;  1C4G A;  1UT7 A;  4TPS A;  2FKM X;  1TBA B;  3ENC A;  3FHG A;  3F10 A;  5DPK A;  3RSM A;  3SNS A;  3L2U A;  4E7K A;  2HZM A;  1P5D X;  1ORN A;  1HU0 A;  3L2R A;  4BDZ A;  2QRE A;  5FRM A;  4EAI A;  3N0U A;  2G30 A;  4E7H A;  2W04 A;  4AI5 A;  2OFK A;  2PWW A;  1KFQ A;  5BMN A;  2OOY A;  2O3O A;  3EAY A;  4ZTF A;  1K35 A;  1VKL A;  3OYI A;  3OS2 A;  2HL8 A;  3D7Q A;  4B22 A;  1QN5 A;  3H1Z A;  3EIK A;  5AN4 A;  2YG8 A;  2DKA A;  3OYH A;  4BJU A;  4EAL A;  1QTP A;  1KY7 A;  1QNC A;  1TBP A;  4D7R A;  3NA5 A;  5IYD P;  3OS0 A;  1YQK A;  1MUD A;  2V75 A;  2D0B A;  1RM1 A;  3L2V A;  1RRQ A;  4EA4 A;  3OYA A;  2YA3 A;  2FGT A;  4EW0 A;  2QR1 A;  4UOB A;  4WZS D;  3LCN A;  2VJ0 A;  2HL9 A;  4DUL A;  5IYC P;  1WQA A;  1B9K A;  3CVT A;  1KG2 A;  1CDW A;  1K2Y X;  4E7I A;  1LWY A;  3DPT A;  4B23 A;  4ROC B;  1VRL A;  1XQP A;  5IYB P;  2OFI A;  2ABK A;  1WEF A;  3T4N A;  4ZTJ A;  4HSB A;  1FN7 A;  2JOI A;  3OH6 A;  1C47 A;  4QG5 A;  1PU6 A;  5JN5 A;  3RPJ A;  1QN4 A;  2F7L A;  3I0W A;  1KY6 A;  2NOB A;  4B0A A;  1U84 A;  1NGN A;  5BMP A;  5F9C A;  1PCM X;  1VOL B;  1V5S A;  2IV8 A;  3OYN A;  1KFI A;  4EAG A;  1P7M A;  2V8Q A;  1W80 A;  3I0X A;  2DKC A;  1KQJ A;  2H56 A;  4PII A;  4Q11 A;  3PDK A;  1D3U A;  5FRN A;  1YTF A;  1QNE A;  1QN3 A;  3CW7 A;  4E9H A;  3VN5 A;  1KEA A;  3I3W A;  1XQO A;  3OYE A;  1YTB A;  3OYL A;  2V92 A;  1R4X A;  1NVP A;  4CFF A;  1M5Q 1;  1M3Q A;  3OGD A;  1JFI C;  4EA5 A;  1QN8 A;  1KYF A;  3OYB A;  4BAC A;  3CWS A;  3IH7 A;  1WJW A;  3C04 A;  3N89 A;  2ZFD B;  1QN9 A;  4WX8 A;  3OST A;  1C9B B;  3OYD A;  3TDH A;  1M3H A;  4E9G A;  3OYK A;  3HS8 A;  3ASM A;  4YPR A;  3CWU A;  1JDY A;  1NKU A;  2NOF A;  4D7Q A;  4E7L A;  1XSZ A;  2JHJ A;  4E9F A;  4UNF A;  2YH5 A;  3CVS A;  1KG6 A;  1KG5 A;  1WEG A;  1N3A A;  4IKF A;  1QNA A;  4OFE A;  1MPG A;  4MRQ A;  1TUO A;  2NOI A;  2QLV A;  2NVM A;  4E7J A;  5JMV D;  4DK9 A;  1KO9 A;  4EVV A;  3L2W A;  1YQL A;  4AIA A;  1EBM A;  4YPH A;  1J3M A;  4EAJ A;  4YOQ A;  1PVS A;  1NGM A;  3KRM A;  1QTS A;  2NWV A;  3OYM A;  3FSP A;  1KYU A;  2EHB D;  1EUV A;  2OOX A;  2JPS A;  4PY5 A;  3KTU A;  1DIZ A;  3ULX A;  1PU7 A;  1RRS A;  5KL0 A;  4BE1 A;  3TE5 A;  2D0C A;  2NLV A;  4OFA A;  5KN9 A;  1N39 A;  3OCI A;  2JG6 A;  1T6A A;  1LXT A;  5CHZ A;  4EJZ A;  3OSE A;  1AIS A;  3NNQ A;  1UL7 A;  1UT4 A;  2D0A A;  2JHN A;  4B24 A;  1P59 A;  2H5A X;  2Y8L A;  3OYG A;  3OH9 A;  3S3O A;  1VTO A;  2R5X A;  1LWV A;  3BKQ X;  3OC3 C;  3OYJ A;  3S3N A;  2IV9 A;  2NOL A;  4OFH A;  3D4V A;  2XHI A;  2LAE A;  3HS9 A;  1VOK A;  2FKF A;  3DPU A;  2NOE A;  3IHO A;  2NOZ A;  3ENO C;  3FHF A;  4BDY A;  4BE2 A;  2HKP A;  2Z8U A;  3CWT A;  1WEI A;  2I5W A;  3CWA A;  4EW4 A;  1PCZ A;  3N5N X;  2W03 A;  4EJY A;  1KG4 A;  3F0Z A;  4EAK A;  1MUY A;  4B21 A;  3R2X C;  5FRO A;  1ORP A;  2HZS A;  1PCJ X;  1N3C A;  1MP9 A;  4ROE B;  2MZ8 A;  4WXA A;  3S3M A;  3OSM A;  3OYC A;  1TGH A;  4HJH A;  4E9E A;  3OYF A;  4NZG A;  3VW4 A;  1YQM A;  4IL8 A;  1PU8 A;  1Q9U A;  4ROD B;  4C7P A;  1KG7 A;  1PZD A;  4AI4 A;  5EPC A;  4BE0 A;  1VTL E;  1LMZ A;  3KNT A;  1E42 A; 
#chains in the Genus database with same CATH homology
 1YQR A;  1M3Q A;  3OGD A;  1LWW A;  4EA5 A;  4OFA A;  5KN9 A;  1N39 A;  3CWS A;  2JG6 A;  1KG3 A;  4EW0 A;  5CHZ A;  4EJZ A;  3IH7 A;  4UOB A;  3G0Q A;  3S6I A;  2JHN A;  4B24 A;  1P59 A;  1XG7 A;  3OH9 A;  2NOH A;  1LWV A;  3CVT A;  1MUN A;  1KG2 A;  2YG9 A;  5KN8 A;  2NOL A;  4OFH A;  1M3H A;  1LWY A;  4E9G A;  3D4V A;  2XHI A;  4B23 A;  1VRL A;  1XQP A;  3FHG A;  4YPR A;  2NOE A;  2OFI A;  3CWU A;  2ABK A;  3F10 A;  3IHO A;  5DPK A;  2NOZ A;  1NKU A;  1WEF A;  2NOF A;  1FN7 A;  3FHF A;  4HSB A;  3OH6 A;  2JHJ A;  4E9F A;  1PU6 A;  3CWT A;  4UNF A;  1ORN A;  1WEI A;  1HU0 A;  2I5W A;  3CVS A;  1KG6 A;  1KG5 A;  3CWA A;  1WEG A;  4EW4 A;  3N5N X;  3N0U A;  1N3A A;  4OFE A;  4EJY A;  1KG4 A;  1MPG A;  3F0Z A;  4AI5 A;  2OFK A;  2NOI A;  1MUY A;  4B21 A;  3I0W A;  1ORP A;  2NOB A;  1NGN A;  4DK9 A;  1KO9 A;  1N3C A;  4EVV A;  4B22 A;  1YQL A;  4AIA A;  1EBM A;  4YPH A;  1P7M A;  1PVS A;  5AN4 A;  4YOQ A;  2YG8 A;  3I0X A;  1RRQ A;  1KQJ A;  4E9E A;  2H56 A;  4PII A;  3FSP A;  1YQM A;  1PU8 A;  3CW7 A;  4E9H A;  1KG7 A;  1YQK A;  3KTU A;  1MUD A;  1DIZ A;  4AI4 A;  1KEA A;  1XQO A;  1PU7 A;  1RRS A;  1LMZ A;  3KNT A;  4EA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...