1PWTA

Thermodynamic analysis of alpha-spectrin sh3 and two of its circular permutants with different loop lengths: discerning the reasons for rapid folding in proteins
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
MGTGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermodynamic analysis of alpha-spectrin SH3 and two of its circular permutants with different loop lengths: discerning the reasons for rapid folding in proteins.
pubmed doi rcsb
molecule tags Circular permutant
molecule keywords ALPHA SPECTRIN
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1998-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1pwtA00
1BB9A 2LQNA 2K6DA 2RQUA 1RLQC 4RTVA 2HCKA 2D8JA 4RTYA 4LE9A 1NLPC 1VYUA 1MUZA 1VA7A 2HDAA 1PRLC 2G6FX 1T0HA 3VS3A 2O88A 2CSIA 1X6BA 3JV3A 2CT3A 1Y0MA 5HCKA 3KFVA 2AKKA 3C0CA 3EGUA 2YSQA 2RQRA 3UF4A 3VRYA 2EYWA 2YUQA 1GRIA 1BK2A 2AK5A 2FG0A 2OJ2A 2LNHB 3UA6A 4A63B 4J9FA 1GFCA 3SHWA 2GNCA 5FWCA 2GTJA 2CSQA 1YWOA 2RMOA 3U23A 2YUPA 2DL4A 2CH4A 3NGPA 1M3BA 2EYXA 1U06A 2LJ1A 4ORZA 3VS7A 1HSQA 1TG0A 3VS4A 2ENMA 1OOTA 1MV3A 2FRYA 4QT7A 1T3SA 1K1ZA 1SRLA 1RLPC 1VYTA 2BZYA 2BTTA 4IIMA 1X6GA 2DRKA 1I1JA 1BU1A 1UJYA 4RTUA 2MOXA 1OPLA 1ABOA 4D8DA 3PVLA 2V1RA 2LX7A 2X3XD 2HBWA 2L0AA 1ZUKA 2VVKA 4JJDA 2D8HA 1N5ZA 2DMOA 1W6XA 3VS2A 2CUBA 1JO8A 1B3QA 3R6NA 2CT4A 1XOVA 2KXCA 1GCPA 2FO0A 2F2XA 4FSSA 1UGVA 2FPEA 4RUGA 1GFDA 1G83A 3UATA 2JS2A 1QCFA 1ZUUA 2CH4W 3REAB 2FEIA 3M0TA 4LNPA 3REBB 2J06A 2JM8A 1JXMA 2L3PA 4JZ3A 2MCNA 2DF6A 2J6OA 3NPFA 1TUCA 2LJ3A 2M0YA 2DL7A 2ED0A 4JJCA 2W0ZA 2CDTA 1QWEA 4J9HA 2L3QA 1WIEA 2O9SA 5ECAA 1WXTA 2EYYA 4AFSC 1H3HA 1EFNA 1YN8A 1YP5A 4AFZC 1UUEA 2AKLA 5I22A 1M8MA 1WI7A 4R0KA 2NWMA 1M3CA 3IQLA 1X43A 2MIOA 3I5SA 2EKHA 2K3BA 2J6KA 4Z89A 1KSWA 1K9AA 2V1QA 3FJ5A 4Z8AA 1AZEA 3H0IA 2DBMA 1FMKA 2QDLA 2KEAA 2FPDA 3VS6A 4ESRA 1ZSGA 2A28A 1AWJA 3QWXX 1UFFA 4CC3A 1PKTA 4D8KA 1JU5C 1SEMA 3VS1A 1X2KA 4Z88A 1I07A 4DEYA 3M0UA 1RUWA 3VS0A 2JMCA 2KRMA 1PHTA 2RPNA 2JS0A 5IHIA 2JMAA 4Y92A 3RNJA 2O31A 3THKA 2ROTA 1I0CA 1Z9ZA 2DILA 3EG3A 1AOJA 2A08A 4HVUA 1FYNA 2DL8A 2GBQA 2RQWA 3SEMA 2ECZA 4HCKA 1B07A 1KJWA 2EVRA 3ULRB 1CSKA 3TSWA 2BZ8A 2J6FA 2NUZA 2LZ6B 4OMOA 1V1CA 3O5ZA 2KRSA 2HEQA 3H0FA 4M4ZA 1UG1A 2DX1A 1ABQA 2D0NA 4CC4B 2K9GA 4OMPA 2ABLA 1AWWA 2KYBA 1YCSB 2E5KA 1W70A 1PWTA 2O9VA 5FW9A 2KR3A 3H0HA 2O2OA 1NYFA 3GBQA 1QWFA 2HSPA 2KYMA 4OMQA 2KNBB 1GBQA 4HXJA 2L2PA 4E6RA 2AZVA 2EQIA 2KT1A 2W10A 3TVTA 2EPDA 2YDLA 1K0XA 1VYVA 2LP5A 2YUNA 1WXBA 3CQTA 4JJBA 2RNAA 3EG1A 2M51A 4KRTA 1E6GA 1CKAA 4OMLA 5IXBA 4JPBW 2DLPA 1X69A 1PKSA 1UDLA 4LUEA 2EGEA 2A37A 1TUDA 5IH2A 3VS5A 2RQVA 1LCKA 2KT8A 3VRZA 2EGCA 4EIKA 1JXOA 1E6HA 4AG2C 2VWFA 2LJ0A 1ZBJA 1WX6A 1AWXA 2K7AA 1NEGA 2C0OA 1GCQA 1X27A 1GCQC 4GBQA 2J7IA 1CKBA 1GL5A 1YWPA 1T3LA 4GLMA 4OMMA 2LCSA 3I35A 2DE0X 2K2MA 2LQWA 3ZL7C 3QWYA 2JM9A 1AWOA 2AZSA 1OEBA 1YNZA 2YUOA 5I11A 1UTIA 5IXFA 4RTXA 3NMZC 3RBBB 4AFUC 4ZNXA 4F16A 3A98A 1ZLMA 3EG2A 2KXDA 4CC7A 1NM7A 2VKNA 2BZXA 1K76A 2FRWA 3PVQA 3H41A 2EGAA 1SPKA 4DEXA 1KIKA 2ROLA 1AD5A 4JZ4A 1PRMC 1X2QA 2JTEA 3EHQA 2D1XA 1H8KA 3I9QA 1S1NA 1UHFA 2B86A 2JT4A 4J9BA 1K0SA 2JW4A 2RN8A 1RI9A 2KGTA 3M0PA 1A0NB 2DJQA 5FWBA 2DRMA 2J05A 5GJVB 2RF0A 3NHNA 1IO6A 2LMJA 1AZGB 4AG1C 3PE0A 1NG2A 4J9CA 1UECA 1W1FA 1U3OA 4LN2A 2DL5A 2CREA 3I5RA 2F2VA 2X3WD 4J9EA 2A36A 4J9DA 2XMFA 2PNIA 5IHKA 4HVWA 4CC2A 2DBKA 4RTWA 1BBZA 2KBTA 1Y57A 2H8HA 4IIOA 1M30A 1K4US 1KFZA 1ZUYA 2KE9A 1T0JA 2EW3A 4WCIA 4F17A 4F14A 1WYXA 4J9IA 4OMNA 1JEGA 2YT6A 1AEYA 1AVZC 1ZX6A 2EBPA 3M0RA 2K79A 2PTKA 2GTOA 2DYBA 2DNUA 1WXUA 2OAWA 1WA7A 1SHGA 1J3TA 1GBRA 5EC7A 1MV0B 3EG0A 2ED1A 4RTZA 1UHCA 2JXBA 1NYGA 2KRNA 1NEBA 1QKXA 3LH5A 1SRMA 2DVJA 2F2WA 2SEMA 2SRCA 1H92A 2OI3A 1HD3A 1PNJA 1E7OA 1SHFA 5GJWB 4J9GA 4LUDA 3M0QA 1WFWA 1QLYA 4X1VA 2RQTA 2DL3A 3TSZA 4AFQC 1ARKA 1OV3A 1U5SA 5L23A 1G2BA 2GQIA 1UJ0A 1UE9A 2CUDA 2PZ1A 2GGRA 2KROA 1Z9QA 2P4RA 4K11A 3M0SA 2ESWA 2EYZA 3EHRA 2L3SA 3UA7A 1QKWA 4RTTA 2DM1A 2C0IA 1HJDA 1WLPB 5IHNA 1WDXA 1M27C 1NLOC 1JQQA 1SSHA 2FPFA 2DA9A 1OPKA 4HVVA 1M3AA 2IIMA 2I0NA 2C0TA
chains in the Genus database with same CATH superfamily
4EMGA 3JAME 1R77A 3PTAA 4RTYA 4LE9A 1VYUA 1MUZA 1D0YA 4J83A 2O88A 3CCSQ 4LXCA 2RM4A 2MI6A 3GF5A 5HCKA 3V8LA 1VQKT 3C0CA 4OB1B 4R56A 2O01E 3HHTB 2EYWA 2NUTB 2YUQA 1OQKA 3TCJA 1GRIA 1BK2A 2AK5A 4NL2A 1KQSA 1PCXA 3FDRA 1BYMA 2FVUA 1YJ9A 5GAN6 1VQMQ 4M78E 5FWCA 2QGGA 4KGXB 3FB9A 4FW1A 1G8XA 1IGUA 4PJOA 3CC7A 3QO3A 1VQOA 1HSQA 2ENMA 2K5IA 3E19A 2FRYA 1SRLA 2BZYA 1Q95G 1X6GA 2OTLQ 1OPLA 5LJ5d 1ABOA 3AHUA 2LX7A 2L0AA 3H8ZA 3TQ7P 2ATCB 1R0CB 1W4SA 3SD4A 3BY7A 3UATA 3RERA 1QCFA 1ZUUA 1TOVA 3QYGB 1TH7A 1VQ4Q 1JXMA 1WJRA 2L3PA 4E7KA 2MCNA 1QVFS 5KYYA 2FL7A 3EH1A 4Y91A 5HK0A 4RCCA 4LDXA 2CDTA 1QWEA 2COWA 3V7SA 4DOWA 1NJIU 4E7IA 1WQWA 3OQ5A 2RO0A 1YN8A 4N4IA 3VUZA 4F7UG 4E7JA 3GPLA 3CCRQ 2AKLA 2JZ2A 1VQ8A 2QGFB 1X43A 3TREA 2MIOA 1D3BB 3C94A 3S6WA 2E3HA 2VASA 2V1QA 2WSCE 2JOYA 2QDYB 5CR2A 1AZEA 4IUUA 1ZA2B 1KK7A 1M1KR 1VQ7A 4DQ2A 3CCUQ 1VQOT 5GMKe 3FEOA 2VYTA 2NLUA 2KEAA 4M7AG 3JB9G 2DIGA 4CC3A 2COZA 1PKTA 3G71Q 1KC8C 1VQ7Q 1SEMA 5FLXE 4JS4A 1X2KA 1ACMB 1I07A 3M0UA 4WF2A 2MK5A 2M16A 3A5ZB 3CCUA 1PHTA 1OI1A 4M7AD 1HK9A 4E7SA 1OYXA 3RNJA 2VXFA 1VQ9Q 4M78D 3S3OA 2DILA 4HVUA 2DL8A 2GBQA 2E6NA 3EG9A 1VUBA 3X25B 2J6FA 3RUXA 3O5ZA 2RB6A 2RA2A 4F7UA 1UG1A 5GAMj 4BY6C 2QA4T 2DAQA 1LOJA 4LDWA 1Q7YR 1AWWA 4C8QC 2KYBA 2PVOB 3QDRB 4XTYA 2JNGA 1NYFA 2A7YA 3GBQA 4ELYC 4OP0A 4OMQA 1BIAA 2KNBB 4M7DC 4M75D 2EJ9A 1BI3A 3CPFA 1Q82C 1N9SA 4FYWB 3TVTA 1VQ5T 3G6EA 2EPDA 3VYHB 1K0XA 1VYVA 3CC2A 3PGGA 1Q81C 3VJPA 2RNAA 1OU9A 3EG1A 4KRTA 3CCMT 4KULA 4B9WA 3KXTA 1YITQ 1BI0A 1R0BG 2DLPA 3CBOA 1IHWA 4Y28E 1UDLA 3JCMJ 1M90U 2HL5C 3C95A 1M1KC 2RQVA 5GAMf 1YJ9Q 4N0AA 4EIKA 3OYBA 1E6HA 4AG2C 2VWFA 2KY9A 3P8DA 1WX6A 3FRNA 3M57A 2CP2A 1BCMA 1VQMA 4NOYA 3LYIA 1EZZB 1GCQC 5FRNA 3HSBA 1KD1C 2K2VA 5KYNA 2D6FA 3OSVA 3M59A 1XQHA 2AIRB 2DE0X 3LGFA 3PT9A 3DLMA 2L3RA 3MCAB 3CCJA 4XK8E 4IUTA 1K8AU 1OEBA 4MDWA 5LL6S 4M75B 5IXFA 3RBBB 4F16A 3A98A 1UB4A 2YRVA 2DJZA 1HYOA 4CC7A 3CCLT 4C92D 4M77G 2AT1B 2I2LA 3OMGA 5A0DA 2IPOB 1SPKA 2QQSA 4C92C 1WNLA 1S72Q 1AD5A 3QDFA 2Y4YA 3EHQA 4AMCA 3OW2S 2D1XA 1H8KA 3I9QA 4DBQA 4MMKA 2JT4A 1JJ2S 1S72A 2P0QA 4DBFA 1PC0A 3BDUA 2R5AA 4PJLA 4EMKA 5KH6A 5I2SA 4M77A 3CCQQ 3VV0A 3LGLA 1K8AC 1IO6A 4M7AA 4XU1A 2QAZA 1NJIR 4JS5A 1I5LA 2XG8D 1UECA 2CREA 5IN1A 2G3RA 3INZA 4FU6A 1KD1U 3OSSC 3Q1JA 4OF1A 1QQJA 4E7ZA 2A0FB 1IREB 3EG9B 4RTWA 4IIOA 1YHQQ 2KE9A 4FSXA 1I4K1 4CI0C 2VV5A 3RMQA 5KYWA 4PJNA 4C92B 3VU3C 1NE8A 4FT2A 4F17A 2IG0A 1KC8R 4E7HA 1JEGA 5EG2A 1AVZC 2EBPA 1MNEA 3SDZA 2K79A 2DYBA 4M75C 3G6EQ 3OYIA 2L89A 2RK1A 5EC7A 1VQ8Q 4DBRA 2H3EB 2KRNA 1NEBA 1QKXA 1SRMA 2F2WA 2SEMA 5CKDA 1FWZA 1E7OA 1SHFA 1YFNA 2K5FA 2ZPHB 1QLYA 3GLXA 3L1AA 5GMKm 2CZ1B 4NS5A 2DL3A 4AFQC 4FM4B 1OV3A 5L23A 1WHMA 3GP8A 1G2BA 2GGRA 5KYWB 3OBWA 4K11A 2EYZA 2P4TA 3FC3A 1WDXA 1NLOC 1SSHA 5HKCA 1EX4A 3M54A 3X26B 1OPKA 2E65A 2RHXA 2XDDA 2IIMA 5CCAA 1M9SA 1O75A 1BB9A 3OYGA 2HCKA 3BE3A 1VQ9A 1VA7A 3GNFB 1PRLC 3JSCA 3VS3A 2CSIA 1X6BA 3EGDB 3WVDB 4IUPA 4HKEA 4BB7A 2AKKA 3EGXB 4A53A 4PLLA 3L2RA 4C0ZA 2OTJT 5CAIA 3M4GA 8AT1B 2LNHB 4C0GA 4A63B 4J9FA 5DM7R 1MHNA 4HCCA 4RMOA 3JCMP 4M77E 3PFSA 1YWOA 3G4SA 4JRPA 3S3MA 5GAOp 4JLIA 3NGPA 1M3BA 2V8IA 4M78C 5C6SA 2LJ1A 3V7CA 1TG0A 4M78F 4LD9K 1YI2T 2L5QA 2RHYA 1OOTA 3O8VA 2X4YA 1T3SA 1K1ZA 3JCMQ 3QXEB 3CD6T 3L2ZA 4M7AC 3OS0A 5KYYB 1Y96A 3RDVA 4C92A 1BU1A 3OS5A 4RTUA 1WPYA 5CQYA 4YTLA 5GAOq 1LJOA 3CMEA 3PVLA 2DK3A 2V1RA 2X3XD 2HBWA 4PL6A 1VQNA 3BFMA 2DEQA 1YI2A 2CT4A 1XOVA 1GCPA 2KVQG 2QQAA 1VQ6A 1UGVA 5IT9E 4KT0E 4RUGA 1GFDA 2DD4A 1K8AR 2JS2A 3OW2A 3L2QA 1I5OB 2CH4W 3REAB 2FEIA 2BUDA 2HNIA 3OYDA 1JJ2A 1B34A 2J6OA 2QTVA 2LJ3A 3X20B 2DL7A 2RHIA 1BIBA 2IVWA 4J9HA 1RAIB 4BDZA 2RJCA 5CK9A 2YRDA 1EFNA 2GFUA 1G3SA 2XD0A 1VQPT 2A3LA 1W2BS 4OB2B 2RI3A 9ATCB 3CXCA 4XQ3A 1WI7A 1I81A 1PD0A 1QCOA 4C0FA 4C0DB 2AHJB 1KSWA 1VQNT 1ZA1B 4IUVA 3I55T 4ATOA 4IKFA 3L42A 3OYMA 4FYVB 1YJWA 4M7DG 4C92F 3OYJA 2D0QB 2Z0WA 1RAFB 2DXCA 3CCUT 1VQOQ 4PJOB 5FU6B 2EJFA 2FPDA 1RAEB 1N8RR 4BE1A 2VUBA 4O5VA 3QWXX 4NL3A 5GANg 2EQMA 3E2UA 1UFFA 3QHSA 3CCEA 3JCMf 1KD1R 4D8KA 1VIEA 3HL8A 5CIUA 3CCEQ 2XK0A 2MAMA 3FLGA 2KRMA 4IURA 1RABB 2DVEA 2EYQA 3J80E 3CMAQ 3JB9D 3I55Q 3CC2Q 4KUDK 2DTHA 4EPCA 3THKA 1VQ6T 2ROTA 4F04B 1AOJA 4RG8A 3H9NA 3A8LB 2EVRA 3GNGA 2BZ8A 1Q81R 2LZ6B 4L6V5 1VIFA 4ZGJB 2KRSA 2HQHA 3CC7T 7AT1B 3JB9F 2HEQA 3JB9I 2DX1A 1K73C 3KUFA 2D0NA 4MDXA 3I56T 4PJOE 5GAN4 4OMPA 5LJ3g 2ABLA 3GOXA 3TEEA 3R6OA 1YCSB 1W70A 3PNWC 2K57A 2KR3A 2LDMA 3H0HA 3JCMV 2EAYA 1M1KU 3CC2T 1VQ6Q 5CVIA 2HSPA 3HKSA 1K73U 1M2VB 1D09B 2MWPA 4HXJA 4RCBA 2EFIA 4PJOF 4X9CA 3CMEQ 2LQKA 4KH1B 4ZGEB 4E6RA 1Y71A 2W10A 3RKXA 4M7DE 3RMSA 2CZ0B 5CQXA 2X4WA 2D9TA 3M55A 3JCMg 2V8JA 1KQ2A 2YUNA 1YHQT 3CQTA 2BE9B 1U8RA 4UC4A 2M51A 3CCJQ 3C4SA 4OMLA 2COYA 1YITT 2DTIA 1MMAA 2R58A 1PKSA 1TSFA 5FROA 2EGEA 2VC8A 3DB3A 2XDBA 5DLQE 5IH2A 1OX8A 2KT8A 5GAMg 5C0MA 5KCOA 2CP5A 1W2BA 1D1AA 2K7AA 2C0OA 3CXCS 3QJYA 1X6OA 1GCQA 4ELZC 3MHXA 1XTDA 4GBQA 2FHDA 2J7IA 4XAXB 5LJ5e 2FB7A 1CKBA 1GL5A 1T3LA 4M7AF 3I56A 1M5Q1 4OMMA 2LCSA 4C5EA 1Q86R 2YWWA 1HXDA 2MWOA 2CP0A 1NBEB 2B8AA 3CBPA 5LJ3f 3S3NA 1WGSA 3CCST 1VQLT 2MF2A 3E9GA 3NFCA 4RG2A 5FU7B 1VQKQ 4PNOA 2YRCA 1UTIA 4J7FA 5GAMd 3NMZC 2WACA 5CKEA 1YJNT 3EG2A 2E12A 3CCLQ 1BI1A 1NM7A 1K76A 5GAN8 2FRWA 4FW2A 3PVQA 2DYIA 1QVGA 1VQLA 2EGAA 3E9FA 1KIKA 4M75G 2ROLA 1F1BB 3SWNB 2DZCA 1WHLA 2DEUA 4ZTFA 5GANj 4E7LA 1VQMT 5KYXA 5AT1B 2XDPA 1IGQA 1S1NA 1UHFA 2B86A 2VXEA 1BCOA 1MMGA 2WSFE 2KGTA 4F7UB 4MZMA 1C6VX 3CCMA 1N6AA 2HQXA 3D7SB 1PSFA 2LMJA 5L8RE 3ZEHA 1JRIA 1N9RA 1Q82U 2DL5A 3I5RA 1D1CA 2F2VA 4PJJA 3DLLA 1RAAB 1VQPA 4O6JA 4J9EA 1XJWB 4E2FB 2PNIA 5IHKA 3OBYA 4HVWA 3AT1B 2MMPA 5GMKl 1WHKA 2KBTA 2HKQB 2H8HA 1M30A 1K4US 4ME7A 1OX9A 4RKUE 4PFOA 1LPLA 2HSEB 1VQ4T 2QI2A 4M7DA 1YHQA 3JB9H 1WYXA 2VGMA 2CYZB 3A8MB 1N8RU 4F7UE 3JRZA 2OX7A 2GTOA 2DNUA 1WXUA 2DPPB 2OAWA 3L2WA 1G3TA 4OGCA 5GMKj 4EMHA 3TU4K 1XNIA 2DERA 2ED1A 1UHCA 3SWNA 5KE3A 3BW1A 4J6YA 3LH5A 5GAMe 5GAOr 4ZN3A 4PFZA 4M75E 4C5HA 3HPWA 3JCMd 3QJ6A 1H92A 1IB8A 2OI3A 3QUIA 5GJWB 2PU9B 4HT9A 4J9GA 2YLCA 2QYZA 1WFWA 4X1VA 1K73R 1ARKA 1PM3A 3CEYA 1QVFA 2CUDA 2PZ1A 2RHZA 2P4RA 3T9NA 3M0SA 2ESWA 3QG1A 3CD6Q 1QKWA 4C8QF 2HL3A 4HVVA 2I0NA 2C0TA 1VQ9T 3UT1A 2LQNA 2RQUA 5CKHA 1RLQC 3FJPA 1C1AA 2MYSA 2D8JA 1QP2A 2G6FX 1C0MA 4N0AC 3JV3A 2CT3A 3CBMA 1Y0MA 3QPHA 1W2BP 2JVVA 2DO3A 2HQEA 2YSQA 2RQRA 3UF4A 1IZ6A 4OVAA 5D7UA 3VRYA 1N8RC 3JCMX 2FG0A 3QYHB 2OJ2A 3UA6A 1K9MR 4XU3A 3CC4Q 1GFCA 4PFPA 5KCHA 2CSQA 3BDLA 3A8OB 1NPPA 2RMOA 1PG5B 2LNVA 4DBHA 2M1HA 4EDUA 3U23A 4FIBA 1VQ5A 2YUPA 2YHTA 2CH4A 2E4HA 2BE7D 5LJ5h 3CC4A 4ZTJA 1Q81U 1U06A 4MZPA 1NPRA 4M77C 2OAUA 3CPWS 3KBGA 1M2VA 1RLPC 1VYTA 2PUKB 1YITA 1G3WA 1YIJQ 4IIMA 4J6WA 2DXUA 2DXBA 2DRKA 5DY9A 1UJYA 2MOXA 3M4YA 2CP7A 3VYGA 3A8HB 4JJDA 4L5GA 2D8HA 1FXXA 3HTRA 1QVGS 2DMOA 4J6XA 1W6XA 3R6NA 1RADB 2JUFA 2KXCA 3JCMc 3N5BB 4GY5A 2EQJA 4C8QG 3CCVA 2ZPBB 4FSSA 4ZGDB 2FPEA 2QEXT 4IUQA 4EMKC 5GAMh 3M0TA 3REBB 2JM8A 3MO8A 2DF6A 1KQSP 2F69A 1N27A 3A8GB 1TUCA 2M0YA 2ED0A 4JJCA 2W0ZA 2E5QA 2RH2A 2O9SA 2EYYA 4XTZA 1D1BA 2CP3A 4AFZC 3CCJT 1Q7YC 3MEAA 2LT1A 4R0KA 2NWMA 4LDVA 3I5SA 2K3BA 3MP1A 2LQ8A 1IRXA 3C12A 1QVGP 2KMTA 4KH0B 1K9AA 4QQDA 3I56Q 1QVPA 2R57A 3UWNA 4Z8AA 2DKGA 3H0IA 1G5VA 2DFUA 1TTHB 1GXIE 1TUGB 2DBMA 1AT1B 2DTOA 3VS6A 4J7IA 3EFOB 4ESRA 1ZSGA 1M4ZA 1B34B 2A28A 4P5NA 3EFRA 3OS2A 4MMLA 1I8FA 2P0KA 1JU5C 4WTOB 3VS1A 4DA4A 3F70A 1RUWA 3VS0A 1UGPB 2RPNA 1QP3A 2JMAA 4Y92A 3VUBA 3P8BB 3HRSA 1MGQA 1I0CA 3G7ZA 1RAGB 3OYLA 1FYNA 2OTLT 2RQWA 2ECZA 1SKUB 2FZKB 3CCQA 1B07A 2ZGWA 3ULRB 1TU0B 3TSWA 4FYYB 2NUZA 3CCRA 4OMOA 1V1CA 2M0OA 3H0FA 4M4ZA 1MMDA 2ZAEA 2FZCB 2RJEA 2QK0A 5J39A 3OYNA 2K9GA 2LCLA 2KK4A 5D6WA 2FYKA 2KAFA 5FRMA 5IAYA 1ZSZB 5LJ5f 2E5KA 3DB4A 1PWTA 5LJ3j 2JTFA 5FU6C 2O2OA 4PJOC 2P0PA 1VQLQ 3HP9A 5J26A 1FMWA 2K3YA 5KYUA 5GANe 3G6ET 2HKNA 1MMNA 5CKFA 2AZVA 2EQIA 2KT1A 2F5TX 1Q86C 4C0DC 2NYSA 1YIJA 2LP5A 5CKBA 1UGQB 2E10A 1U1SA 3OYEA 3P8HA 1CKAA 2LC4A 3I55A 5LJ5g 1Y7XA 2RI5A 3RR6A 2A37A 1X75C 3VS5A 3PMTA 3QBYA 1SF9A 2CGHA 3QIIA 4QQ6A 3H6ZA 2LJ0A 1ZBJA 3OB9A 1V76A 1AWXA 1NEGA 2GF7A 1TS9A 4EMKB 4HCZA 2EQUA 2HD0A 4GLMA 3LX7A 3V8JA 3I35A 2M02A 4BUGA 3ZL7C 4C92E 3NTKA 3RKWA 3V8KA 2AZSA 2NUPB 1VQ8T 1YJNA 1YJWT 4D6WA 4M7AB 4RTXA 4AFUC 2ZPGB 4ZNXA 1WHJA 1JBMA 3URGA 4M77B 1MNDA 2QA4Q 5GAN2 3EGDA 3H41A 4DEXA 2QTXA 3VKIA 2NUPA 2EQKA 5GAN7 1VQ7T 1PRMC 3CD6A 2ZPIB 1ZHIA 2JTEA 1X01A 1K0SA 2HMAA 4OB0B 2YXYA 2RN8A 3M0PA 4N4GA 5FWBA 1UGRB 2J05A 4XTXA 1VQNQ 2QA4A 1RAHB 6AT1B 1KHCA 2OTJA 3NHNA 1AZGB 2Y90A 3UDCA 2GFAA 2QQRA 3L2UA 3PE0A 2QQBA 1NG2A 3PMIA 4J9CA 1W1FA 4LN2A 2JN0A 1OZ3A 5M9OA 8ATCB 1FX7A 2XMFA 3PIOA 4N4HA 4CC2A 3JCMW 2DBKA 1K9MC 4B9XA 1Y57A 4AT1B 1M1FA 4JRQA 1KFZA 4F7UF 3CMAT 4BI8B 5GMKh 4M7DF 3J7AF 2DZ9A 3M56A 1WHHA 4V2SA 2H3JA 5D6XA 2E41A 2YT6A 1AEYA 1FMVA 1JJ2P 3LLRA 3J81E 1QW1A 4JLGA 3M0RA 2QEXA 1WA7A 1SHGA 3QKJA 5FU7C 3WVEB 4KGZB 3EG0A 3WXMB 2X51A 2JXBA 3LWHA 3EFOA 3EFSA 1WJQA 4KBMB 4BE0A 2SRCA 4X9DA 3CXCP 2EJGA 2DIQA 2HZYA 2PUOB 1K9MU 4LUDA 3CCMQ 3JCMh 1UGSB 4ANJA 1M2OA 3M9QA 1NZ9A 4A4FA 2RQTA 3TSZA 1U5SA 1VOMA 4M7AE 2EKOA 3HFOA 1M90R 4OB3B 1UJ0A 2C06A 4C5GA 3EHRA 3M5AA 2DM1A 3OYKA 1HJDA 1WLPB 3CCLA 2K4YA 1IXDA 1JQQA 2X9HA 4QVCA 5AYFA 1M90C 1U1TA 1TXQA 2Y4XA 4PLIA 4OMFB 2K6DA 4R55A 1QVFP 1LVKA 4RTVA 1NLPC 2QXFA 2HDAA 2F1LA 1T0HA 4PJOD 2QEXQ 3JCMb 3QZ5B 2RI2A 4JUVA 1Y96B 1G3YA 3KFVA 3CC7Q 3EGUA 4JRKA 2YLBA 4XU0A 3EAEA 2HBPA 1KHIA 1ZQ1A 2CS7A 2QASA 2DXTA 3SHWA 2GNCA 2GTJA 1QMCA 1ZSZC 4MZTA 3M58A 3SWNC 2DETA 2PVGB 4BE2A 1S72T 4HT8A 3G71A 1H641 2DL4A 3CCQT 2EYXA 5I2MA 5A2QE 4ORZA 3VS7A 4M78A 3VS4A 5A0GA 4JDSA 1MV3A 4QT7A 4XU2A 4LDUA 2F5KA 4M77F 2BTTA 3OYCA 3UPUA 2XICA 1I1JA 3OYFA 4QVZA 4A4HA 3OYAA 5GAOl 4D8DA 2VVKA 1ZUKA 4KUIA 1N5ZA 2FZGB 3VS2A 2CUBA 2CZ7B 1JO8A 1B3QA 3SFMA 1KC8U 2E64A 4LDYA 2FO0A 2F2XA 3SB2A 3MEVA 1G83A 3MKDA 2QQ9A 2LRQA 1WQ7A 1P92A 4LNPA 4KGVB 2J06A 3HRUA 4JZ3A 3FIFA 3NPFA 5I21A 3E1SA 1TWBA 3OA6A 4BI3A 3M53A 4HCBA 1AHJB 1WIEA 2L3QA 5CO7A 5KYUB 5ECAA 1WXTA 4AFSC 1WHGA 1RACB 1H3HA 3ZFJA 1YP5A 4M75F 1UUEA 5I22A 1M8MA 2CZ6B 4HA8A 5GANd 2JTMA 4J8OA 1M3CA 3IQLA 3RKYA 2M9UA 4FL6A 2EKHA 2J6KA 2CKKA 4Z89A 2XI9A 3OYYA 1YJNQ 1H3ZA 3CMAA 2VB6A 2R5MA 3MP6A 3FJ5A 2X4XA 2GCXA 3PIPA 2E70A 4M7DB 1Q86U 4BDYA 3RIRA 1FMKA 2QDLA 2E1HA 4A4GA 1D0ZA 1RI0A 1AWJA 4BI4A 3OY9A 4C8QB 2K5LA 2XU8A 1D3BA 3HRTA 4ZN1A 4M7DD 4QQGA 4Z88A 4DEYA 4OGEA 4PK4A 4BY6B 3NTIA 2JMCA 4QKUA 3V7RA 4FCYA 1YJWQ 5GMKi 1KQ1A 1NJIC 4DOVA 2JS0A 5IHIA 3X24B 1SSFA 5KE2A 3CCSA 4C8QD 2O31A 4M77D 3QSUA 1Z9ZA 3EG3A 2A08A 2GQVA 5GAOn 3SEMA 1WZOA 4HCKA 5GAOm 2XHCA 3CCRT 1KJWA 1CSKA 2EWNA 3G1JA 2OTJQ 5LJ3h 3HFNA 1OZ2A 3OMCA 4M78B 3DKMA 1IHVA 4M78G 1ABQA 4TVRA 4CC4B 1JB0E 1ZSZA 1Y07A 1D0XA 3JB9J 2O9VA 5FW9A 3QZ9B 3G4ST 1QWFA 2KYMA 4II1A 1GBQA 4X34A 2P84A 5A0LA 4E47A 1V29B 5GANh 1LNXA 3MP8A 2L2PA 4VUBA 1VQKA 3EGXA 2XKOC 2LCCA 1YI2Q 2L8DA 2LTOA 2ZCFB 4JRIA 4J5YA 4FYXB 2YDLA 2CP6A 2E6ZA 3OS1A 4QW2A 1WXBA 4JJBA 2X35A 1KQSS 5D6YA 4QVDA 3MJXA 4C8QE 1E6GA 4XTWA 4BD3A 2LVMA 5IXBA 1OU8A 4JPBW 1X69A 2KDSA 2LT4A 1EIFA 4LUEA 4A4KA 2ZPFB 1TUDA 3A1PA 3G4SQ 3MEUA 1LCKA 3VRZA 3ASKA 2EGCA 1JXOA 1YJ9T 2MPXC 2E3IA 2XIDA 2X4JA 3CCET 1X27A 4XTUA 1BI2A 4PJMA 1VQPQ 1YWPA 3ER0A 3RESA 2K2MA 2LQWA 3NTHA 3G71T 3QWYA 2VGNA 1KG1A 4CRIA 2JM9A 2O4XA 1AWOA 2RJFA 1YNZA 2YUOA 5I11A 4A54A 2RHUA 3GIBA 1ZLMA 2KXDA 4FT4A 4PKCC 2VKNA 3MEWA 2WSEE 2BZXA 3LW5E 2JJ9A 1QCNA 3L2VA 4L59A 1VQ4A 4JZ4A 4M75A 1X2QA 4Q5WA 3META 3CC4T 1M1GA 1OULA 3ZBDA 4B6MA 4LD6A 1M8VA 4J9BA 3CCVQ 2JW4A 1RI9A 1A0NB 2DJQA 5DLOA 2DRMA 1BKBA 5LJ3e 2HAXA 5GJVB 4BACA 2RF0A 2OTLA 4AG1C 3MPUB 2K3XA 3LWIA 4C5IA 3CPWA 4JJNK 1U3OA 3ME9A 2QG9B 2X3WD 2A36A 2V26A 4J9DA 3OW2P 2RJDA 1DJ7B 4Z02A 2KI7A 1VQ5Q 2RK2A 1BBZA 3CCVT 4PJOG 4C8QA 4A4EA 1ZUYA 5LJ3d 5GANf 1T0JA 2DD5A 2EW3A 5GAN5 2EIFA 3JCMe 4WCIA 4F14A 4J9IA 4OMNA 1RL2A 1ZX6A 1YBYA 2BKDN 3OYHA 1YIJT 3EH2A 2PTKA 4C92G 3CMET 4XTVA 1J3TA 1ZBXA 5KYXB 1GBRA 1MV0B 3X28B 4RTZA 1NYGA 4GLKA 1WJSA 2DVJA 1PD1A 2BIVA 5HK3A 1HD3A 1PNJA 2KQWA 2NUTA 3LH0A 3M0QA 2PQWA 1O9SA 2KSSA 1Q82R 3CPWP 1R8OB 1SG5A 5J3BA 5HY6A 5GAN3 2LX9A 1YCYA 1B7TA 2GQIA 2ZZDA 1UE9A 2KROA 1Z9QA 2PVDB 2O4XB 2L3SA 3UA7A 4RTTA 2C0IA 2ZPEB 1PSEA 5IHNA 1M27C 2RD1A 1UEBA 2DA9A 2V8KA 5LJ5j 1Q7YU 1M3AA 2FPFA
chains in the Genus database with same CATH topology
1BB9A 2LQNA 2K6DA 2RQUA 1RLQC 4RTVA 2HCKA 2D8JA 4RTYA 4LE9A 1NLPC 1VYUA 1MUZA 1VA7A 2HDAA 1PRLC 2G6FX 1T0HA 3VS3A 2O88A 2CSIA 1X6BA 3JV3A 2CT3A 1Y0MA 5HCKA 3KFVA 2AKKA 3C0CA 3EGUA 2YSQA 2RQRA 3UF4A 3VRYA 2EYWA 2YUQA 1GRIA 1BK2A 2AK5A 2FG0A 2OJ2A 2LNHB 3UA6A 4A63B 4J9FA 1GFCA 3SHWA 2GNCA 5FWCA 2GTJA 2CSQA 1YWOA 2RMOA 3U23A 2YUPA 2DL4A 2CH4A 3NGPA 1M3BA 2EYXA 1U06A 2LJ1A 4ORZA 3VS7A 1HSQA 1TG0A 3VS4A 2ENMA 1OOTA 1MV3A 2FRYA 4QT7A 1T3SA 1K1ZA 1SRLA 1RLPC 1VYTA 2BZYA 2BTTA 4IIMA 1X6GA 2DRKA 1I1JA 1BU1A 1UJYA 4RTUA 2MOXA 1OPLA 1ABOA 4D8DA 3PVLA 2V1RA 2LX7A 2X3XD 2HBWA 2L0AA 1ZUKA 2VVKA 4JJDA 2D8HA 1N5ZA 2DMOA 1W6XA 3VS2A 2CUBA 1JO8A 1B3QA 3R6NA 2CT4A 1XOVA 2KXCA 1GCPA 2FO0A 2F2XA 4FSSA 1UGVA 2FPEA 4RUGA 1GFDA 1G83A 3UATA 2JS2A 1QCFA 1ZUUA 2CH4W 3REAB 2FEIA 3M0TA 4LNPA 3REBB 2J06A 2JM8A 1JXMA 2L3PA 4JZ3A 2MCNA 2DF6A 2J6OA 3NPFA 1TUCA 2LJ3A 2M0YA 2DL7A 2ED0A 4JJCA 2W0ZA 2CDTA 1QWEA 4J9HA 2L3QA 1WIEA 2O9SA 5ECAA 1WXTA 2EYYA 4AFSC 1H3HA 1EFNA 1YN8A 1YP5A 4AFZC 1UUEA 2AKLA 5I22A 1M8MA 1WI7A 4R0KA 2NWMA 1M3CA 3IQLA 1X43A 2MIOA 3I5SA 2EKHA 2K3BA 2J6KA 4Z89A 1KSWA 1K9AA 2V1QA 3FJ5A 4Z8AA 1AZEA 3H0IA 2DBMA 1FMKA 2QDLA 2KEAA 2FPDA 3VS6A 4ESRA 1ZSGA 2A28A 1AWJA 3QWXX 1UFFA 4CC3A 1PKTA 4D8KA 1JU5C 1SEMA 3VS1A 1X2KA 4Z88A 1I07A 4DEYA 3M0UA 1RUWA 3VS0A 2JMCA 2KRMA 1PHTA 2RPNA 2JS0A 5IHIA 2JMAA 4Y92A 3RNJA 2O31A 3THKA 2ROTA 1I0CA 1Z9ZA 2DILA 3EG3A 1AOJA 2A08A 4HVUA 1FYNA 2DL8A 2GBQA 2RQWA 3SEMA 2ECZA 4HCKA 1B07A 1KJWA 2EVRA 3ULRB 1CSKA 3TSWA 2BZ8A 2J6FA 2NUZA 2LZ6B 4OMOA 1V1CA 3O5ZA 2KRSA 2HEQA 3H0FA 4M4ZA 1UG1A 2DX1A 1ABQA 2D0NA 4CC4B 2K9GA 4OMPA 2ABLA 1AWWA 2KYBA 1YCSB 2E5KA 1W70A 1PWTA 2O9VA 5FW9A 2KR3A 3H0HA 2O2OA 1NYFA 3GBQA 1QWFA 2HSPA 2KYMA 4OMQA 2KNBB 1GBQA 4HXJA 2L2PA 4E6RA 2AZVA 2EQIA 2KT1A 2W10A 3TVTA 2EPDA 2YDLA 1K0XA 1VYVA 2LP5A 2YUNA 1WXBA 3CQTA 4JJBA 2RNAA 3EG1A 2M51A 4KRTA 1E6GA 1CKAA 4OMLA 5IXBA 4JPBW 2DLPA 1X69A 1PKSA 1UDLA 4LUEA 2EGEA 2A37A 1TUDA 5IH2A 3VS5A 2RQVA 1LCKA 2KT8A 3VRZA 2EGCA 4EIKA 1JXOA 1E6HA 4AG2C 2VWFA 2LJ0A 1ZBJA 1WX6A 1AWXA 2K7AA 1NEGA 2C0OA 1GCQA 1X27A 1GCQC 4GBQA 2J7IA 1CKBA 1GL5A 1YWPA 1T3LA 4GLMA 4OMMA 2LCSA 3I35A 2DE0X 2K2MA 2LQWA 3ZL7C 3QWYA 2JM9A 1AWOA 2AZSA 1OEBA 1YNZA 2YUOA 5I11A 1UTIA 5IXFA 4RTXA 3NMZC 3RBBB 4AFUC 4ZNXA 4F16A 3A98A 1ZLMA 3EG2A 2KXDA 4CC7A 1NM7A 2VKNA 2BZXA 1K76A 2FRWA 3PVQA 3H41A 2EGAA 1SPKA 4DEXA 1KIKA 2ROLA 1AD5A 4JZ4A 1PRMC 1X2QA 2JTEA 3EHQA 2D1XA 1H8KA 3I9QA 1S1NA 1UHFA 2B86A 2JT4A 4J9BA 1K0SA 2JW4A 2RN8A 1RI9A 2KGTA 3M0PA 1A0NB 2DJQA 5FWBA 2DRMA 2J05A 5GJVB 2RF0A 3NHNA 1IO6A 2LMJA 1AZGB 4AG1C 3PE0A 1NG2A 4J9CA 1UECA 1W1FA 1U3OA 4LN2A 2DL5A 2CREA 3I5RA 2F2VA 2X3WD 4J9EA 2A36A 4J9DA 2XMFA 2PNIA 5IHKA 4HVWA 4CC2A 2DBKA 4RTWA 1BBZA 2KBTA 1Y57A 2H8HA 4IIOA 1M30A 1K4US 1KFZA 1ZUYA 2KE9A 1T0JA 2EW3A 4WCIA 4F17A 4F14A 1WYXA 4J9IA 4OMNA 1JEGA 2YT6A 1AEYA 1AVZC 1ZX6A 2EBPA 3M0RA 2K79A 2PTKA 2GTOA 2DYBA 2DNUA 1WXUA 2OAWA 1WA7A 1SHGA 1J3TA 1GBRA 5EC7A 1MV0B 3EG0A 2ED1A 4RTZA 1UHCA 2JXBA 1NYGA 2KRNA 1NEBA 1QKXA 3LH5A 1SRMA 2DVJA 2F2WA 2SEMA 2SRCA 1H92A 2OI3A 1HD3A 1PNJA 1E7OA 1SHFA 5GJWB 4J9GA 4LUDA 3M0QA 1WFWA 1QLYA 4X1VA 2RQTA 2DL3A 3TSZA 4AFQC 1ARKA 1OV3A 1U5SA 5L23A 1G2BA 2GQIA 1UJ0A 1UE9A 2CUDA 2PZ1A 2GGRA 2KROA 1Z9QA 2P4RA 4K11A 3M0SA 2ESWA 2EYZA 3EHRA 2L3SA 3UA7A 1QKWA 4RTTA 2DM1A 2C0IA 1HJDA 1WLPB 5IHNA 1WDXA 1M27C 1NLOC 1JQQA 1SSHA 2FPFA 2DA9A 1OPKA 4HVVA 1M3AA 2IIMA 2I0NA 2C0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BB9 A;  2LQN A;  2K6D A;  2RQU A;  1RLQ C;  4RTV A;  2HCK A;  2D8J A;  4RTY A;  4LE9 A;  1NLP C;  1VYU A;  1MUZ A;  1VA7 A;  2HDA A;  1PRL C;  2G6F X;  1T0H A;  3VS3 A;  2O88 A;  2CSI A;  1X6B A;  3JV3 A;  2CT3 A;  1Y0M A;  5HCK A;  3KFV A;  2AKK A;  3C0C A;  3EGU A;  2YSQ A;  2RQR A;  3UF4 A;  3VRY A;  2EYW A;  2YUQ A;  1GRI A;  1BK2 A;  2AK5 A;  2FG0 A;  2OJ2 A;  2LNH B;  3UA6 A;  4A63 B;  4J9F A;  1GFC A;  3SHW A;  2GNC A;  5FWC A;  2GTJ A;  2CSQ A;  1YWO A;  2RMO A;  3U23 A;  2YUP A;  2DL4 A;  2CH4 A;  3NGP A;  1M3B A;  2EYX A;  1U06 A;  2LJ1 A;  4ORZ A;  3VS7 A;  1HSQ A;  1TG0 A;  3VS4 A;  2ENM A;  1OOT A;  1MV3 A;  2FRY A;  4QT7 A;  1T3S A;  1K1Z A;  1SRL A;  1RLP C;  1VYT A;  2BZY A;  2BTT A;  4IIM A;  1X6G A;  2DRK A;  1I1J A;  1BU1 A;  1UJY A;  4RTU A;  2MOX A;  1OPL A;  1ABO A;  4D8D A;  3PVL A;  2V1R A;  2LX7 A;  2X3X D;  2HBW A;  2L0A A;  1ZUK A;  2VVK A;  4JJD A;  2D8H A;  1N5Z A;  2DMO A;  1W6X A;  3VS2 A;  2CUB A;  1JO8 A;  1B3Q A;  3R6N A;  2CT4 A;  1XOV A;  2KXC A;  1GCP A;  2FO0 A;  2F2X A;  4FSS A;  1UGV A;  2FPE A;  4RUG A;  1GFD A;  1G83 A;  3UAT A;  2JS2 A;  1QCF A;  1ZUU A;  2CH4 W;  3REA B;  2FEI A;  3M0T A;  4LNP A;  3REB B;  2J06 A;  2JM8 A;  1JXM A;  2L3P A;  4JZ3 A;  2MCN A;  2DF6 A;  2J6O A;  3NPF A;  1TUC A;  2LJ3 A;  2M0Y A;  2DL7 A;  2ED0 A;  4JJC A;  2W0Z A;  2CDT A;  1QWE A;  4J9H A;  2L3Q A;  1WIE A;  2O9S A;  5ECA A;  1WXT A;  2EYY A;  4AFS C;  1H3H A;  1EFN A;  1YN8 A;  1YP5 A;  4AFZ C;  1UUE A;  2AKL A;  5I22 A;  1M8M A;  1WI7 A;  4R0K A;  2NWM A;  1M3C A;  3IQL A;  1X43 A;  2MIO A;  3I5S A;  2EKH A;  2K3B A;  2J6K A;  4Z89 A;  1KSW A;  1K9A A;  2V1Q A;  3FJ5 A;  4Z8A A;  1AZE A;  3H0I A;  2DBM A;  1FMK A;  2QDL A;  2KEA A;  2FPD A;  3VS6 A;  4ESR A;  1ZSG A;  2A28 A;  1AWJ A;  3QWX X;  1UFF A;  4CC3 A;  1PKT A;  4D8K A;  1JU5 C;  1SEM A;  3VS1 A;  1X2K A;  4Z88 A;  1I07 A;  4DEY A;  3M0U A;  1RUW A;  3VS0 A;  2JMC A;  2KRM A;  1PHT A;  2RPN A;  2JS0 A;  5IHI A;  2JMA A;  4Y92 A;  3RNJ A;  2O31 A;  3THK A;  2ROT A;  1I0C A;  1Z9Z A;  2DIL A;  3EG3 A;  1AOJ A;  2A08 A;  4HVU A;  1FYN A;  2DL8 A;  2GBQ A;  2RQW A;  3SEM A;  2ECZ A;  4HCK A;  1B07 A;  1KJW A;  2EVR A;  3ULR B;  1CSK A;  3TSW A;  2BZ8 A;  2J6F A;  2NUZ A;  2LZ6 B;  4OMO A;  1V1C A;  3O5Z A;  2KRS A;  2HEQ A;  3H0F A;  4M4Z A;  1UG1 A;  2DX1 A;  1ABQ A;  2D0N A;  4CC4 B;  2K9G A;  4OMP A;  2ABL A;  1AWW A;  2KYB A;  1YCS B;  2E5K A;  1W70 A;  1PWT A;  2O9V A;  5FW9 A;  2KR3 A;  3H0H A;  2O2O A;  1NYF A;  3GBQ A;  1QWF A;  2HSP A;  2KYM A;  4OMQ A;  2KNB B;  1GBQ A;  4HXJ A;  2L2P A;  4E6R A;  2AZV A;  2EQI A;  2KT1 A;  2W10 A;  3TVT A;  2EPD A;  2YDL A;  1K0X A;  1VYV A;  2LP5 A;  2YUN A;  1WXB A;  3CQT A;  4JJB A;  2RNA A;  3EG1 A;  2M51 A;  4KRT A;  1E6G A;  1CKA A;  4OML A;  5IXB A;  4JPB W;  2DLP A;  1X69 A;  1PKS A;  1UDL A;  4LUE A;  2EGE A;  2A37 A;  1TUD A;  5IH2 A;  3VS5 A;  2RQV A;  1LCK A;  2KT8 A;  3VRZ A;  2EGC A;  4EIK A;  1JXO A;  1E6H A;  4AG2 C;  2VWF A;  2LJ0 A;  1ZBJ A;  1WX6 A;  1AWX A;  2K7A A;  1NEG A;  2C0O A;  1GCQ A;  1X27 A;  1GCQ C;  4GBQ A;  2J7I A;  1CKB A;  1GL5 A;  1YWP A;  1T3L A;  4GLM A;  4OMM A;  2LCS A;  3I35 A;  2DE0 X;  2K2M A;  2LQW A;  3ZL7 C;  3QWY A;  2JM9 A;  1AWO A;  2AZS A;  1OEB A;  1YNZ A;  2YUO A;  5I11 A;  1UTI A;  5IXF A;  4RTX A;  3NMZ C;  3RBB B;  4AFU C;  4ZNX A;  4F16 A;  3A98 A;  1ZLM A;  3EG2 A;  2KXD A;  4CC7 A;  1NM7 A;  2VKN A;  2BZX A;  1K76 A;  2FRW A;  3PVQ A;  3H41 A;  2EGA A;  1SPK A;  4DEX A;  1KIK A;  2ROL A;  1AD5 A;  4JZ4 A;  1PRM C;  1X2Q A;  2JTE A;  3EHQ A;  2D1X A;  1H8K A;  3I9Q A;  1S1N A;  1UHF A;  2B86 A;  2JT4 A;  4J9B A;  1K0S A;  2JW4 A;  2RN8 A;  1RI9 A;  2KGT A;  3M0P A;  1A0N B;  2DJQ A;  5FWB A;  2DRM A;  2J05 A;  5GJV B;  2RF0 A;  3NHN A;  1IO6 A;  2LMJ A;  1AZG B;  4AG1 C;  3PE0 A;  1NG2 A;  4J9C A;  1UEC A;  1W1F A;  1U3O A;  4LN2 A;  2DL5 A;  2CRE A;  3I5R A;  2F2V A;  2X3W D;  4J9E A;  2A36 A;  4J9D A;  2XMF A;  2PNI A;  5IHK A;  4HVW A;  4CC2 A;  2DBK A;  4RTW A;  1BBZ A;  2KBT A;  1Y57 A;  2H8H A;  4IIO A;  1M30 A;  1K4U S;  1KFZ A;  1ZUY A;  2KE9 A;  1T0J A;  2EW3 A;  4WCI A;  4F17 A;  4F14 A;  1WYX A;  4J9I A;  4OMN A;  1JEG A;  2YT6 A;  1AEY A;  1AVZ C;  1ZX6 A;  2EBP A;  3M0R A;  2K79 A;  2PTK A;  2GTO A;  2DYB A;  2DNU A;  1WXU A;  2OAW A;  1WA7 A;  1SHG A;  1J3T A;  1GBR A;  5EC7 A;  1MV0 B;  3EG0 A;  2ED1 A;  4RTZ A;  1UHC A;  2JXB A;  1NYG A;  2KRN A;  1NEB A;  1QKX A;  3LH5 A;  1SRM A;  2DVJ A;  2F2W A;  2SEM A;  2SRC A;  1H92 A;  2OI3 A;  1HD3 A;  1PNJ A;  1E7O A;  1SHF A;  5GJW B;  4J9G A;  4LUD A;  3M0Q A;  1WFW A;  1QLY A;  4X1V A;  2RQT A;  2DL3 A;  3TSZ A;  4AFQ C;  1ARK A;  1OV3 A;  1U5S A;  5L23 A;  1G2B A;  2GQI A;  1UJ0 A;  1UE9 A;  2CUD A;  2PZ1 A;  2GGR A;  2KRO A;  1Z9Q A;  2P4R A;  4K11 A;  3M0S A;  2ESW A;  2EYZ A;  3EHR A;  2L3S A;  3UA7 A;  1QKW A;  4RTT A;  2DM1 A;  2C0I A;  1HJD A;  1WLP B;  5IHN A;  1WDX A;  1M27 C;  1NLO C;  1JQQ A;  1SSH A;  2FPF A;  2DA9 A;  1OPK A;  4HVV A;  1M3A A;  2IIM A;  2I0N A;  2C0T A; 
#chains in the Genus database with same CATH topology
 4EMG A;  3JAM E;  1R77 A;  3PTA A;  4RTY A;  4LE9 A;  1VYU A;  1MUZ A;  1D0Y A;  4J83 A;  2O88 A;  3CCS Q;  4LXC A;  2RM4 A;  2MI6 A;  3GF5 A;  5HCK A;  3V8L A;  1VQK T;  3C0C A;  4OB1 B;  4R56 A;  2O01 E;  3HHT B;  2EYW A;  2NUT B;  2YUQ A;  1OQK A;  3TCJ A;  1GRI A;  1BK2 A;  2AK5 A;  4NL2 A;  1KQS A;  1PCX A;  3FDR A;  1BYM A;  2FVU A;  1YJ9 A;  5GAN 6;  1VQM Q;  4M78 E;  5FWC A;  2QGG A;  4KGX B;  3FB9 A;  4FW1 A;  1G8X A;  1IGU A;  4PJO A;  3CC7 A;  3QO3 A;  1VQO A;  1HSQ A;  2ENM A;  2K5I A;  3E19 A;  2FRY A;  1SRL A;  2BZY A;  1Q95 G;  1X6G A;  2OTL Q;  1OPL A;  5LJ5 d;  1ABO A;  3AHU A;  2LX7 A;  2L0A A;  3H8Z A;  3TQ7 P;  2ATC B;  1R0C B;  1W4S A;  3SD4 A;  3BY7 A;  3UAT A;  3RER A;  1QCF A;  1ZUU A;  1TOV A;  3QYG B;  1TH7 A;  1VQ4 Q;  1JXM A;  1WJR A;  2L3P A;  4E7K A;  2MCN A;  1QVF S;  5KYY A;  2FL7 A;  3EH1 A;  4Y91 A;  5HK0 A;  4RCC A;  4LDX A;  2CDT A;  1QWE A;  2COW A;  3V7S A;  4DOW A;  1NJI U;  4E7I A;  1WQW A;  3OQ5 A;  2RO0 A;  1YN8 A;  4N4I A;  3VUZ A;  4F7U G;  4E7J A;  3GPL A;  3CCR Q;  2AKL A;  2JZ2 A;  1VQ8 A;  2QGF B;  1X43 A;  3TRE A;  2MIO A;  1D3B B;  3C94 A;  3S6W A;  2E3H A;  2VAS A;  2V1Q A;  2WSC E;  2JOY A;  2QDY B;  5CR2 A;  1AZE A;  4IUU A;  1ZA2 B;  1KK7 A;  1M1K R;  1VQ7 A;  4DQ2 A;  3CCU Q;  1VQO T;  5GMK e;  3FEO A;  2VYT A;  2NLU A;  2KEA A;  4M7A G;  3JB9 G;  2DIG A;  4CC3 A;  2COZ A;  1PKT A;  3G71 Q;  1KC8 C;  1VQ7 Q;  1SEM A;  5FLX E;  4JS4 A;  1X2K A;  1ACM B;  1I07 A;  3M0U A;  4WF2 A;  2MK5 A;  2M16 A;  3A5Z B;  3CCU A;  1PHT A;  1OI1 A;  4M7A D;  1HK9 A;  4E7S A;  1OYX A;  3RNJ A;  2VXF A;  1VQ9 Q;  4M78 D;  3S3O A;  2DIL A;  4HVU A;  2DL8 A;  2GBQ A;  2E6N A;  3EG9 A;  1VUB A;  3X25 B;  2J6F A;  3RUX A;  3O5Z A;  2RB6 A;  2RA2 A;  4F7U A;  1UG1 A;  5GAM j;  4BY6 C;  2QA4 T;  2DAQ A;  1LOJ A;  4LDW A;  1Q7Y R;  1AWW A;  4C8Q C;  2KYB A;  2PVO B;  3QDR B;  4XTY A;  2JNG A;  1NYF A;  2A7Y A;  3GBQ A;  4ELY C;  4OP0 A;  4OMQ A;  1BIA A;  2KNB B;  4M7D C;  4M75 D;  2EJ9 A;  1BI3 A;  3CPF A;  1Q82 C;  1N9S A;  4FYW B;  3TVT A;  1VQ5 T;  3G6E A;  2EPD A;  3VYH B;  1K0X A;  1VYV A;  3CC2 A;  3PGG A;  1Q81 C;  3VJP A;  2RNA A;  1OU9 A;  3EG1 A;  4KRT A;  3CCM T;  4KUL A;  4B9W A;  3KXT A;  1YIT Q;  1BI0 A;  1R0B G;  2DLP A;  3CBO A;  1IHW A;  4Y28 E;  1UDL A;  3JCM J;  1M90 U;  2HL5 C;  3C95 A;  1M1K C;  2RQV A;  5GAM f;  1YJ9 Q;  4N0A A;  4EIK A;  3OYB A;  1E6H A;  4AG2 C;  2VWF A;  2KY9 A;  3P8D A;  1WX6 A;  3FRN A;  3M57 A;  2CP2 A;  1BCM A;  1VQM A;  4NOY A;  3LYI A;  1EZZ B;  1GCQ C;  5FRN A;  3HSB A;  1KD1 C;  2K2V A;  5KYN A;  2D6F A;  3OSV A;  3M59 A;  1XQH A;  2AIR B;  2DE0 X;  3LGF A;  3PT9 A;  3DLM A;  2L3R A;  3MCA B;  3CCJ A;  4XK8 E;  4IUT A;  1K8A U;  1OEB A;  4MDW A;  5LL6 S;  4M75 B;  5IXF A;  3RBB B;  4F16 A;  3A98 A;  1UB4 A;  2YRV A;  2DJZ A;  1HYO A;  4CC7 A;  3CCL T;  4C92 D;  4M77 G;  2AT1 B;  2I2L A;  3OMG A;  5A0D A;  2IPO B;  1SPK A;  2QQS A;  4C92 C;  1WNL A;  1S72 Q;  1AD5 A;  3QDF A;  2Y4Y A;  3EHQ A;  4AMC A;  3OW2 S;  2D1X A;  1H8K A;  3I9Q A;  4DBQ A;  4MMK A;  2JT4 A;  1JJ2 S;  1S72 A;  2P0Q A;  4DBF A;  1PC0 A;  3BDU A;  2R5A A;  4PJL A;  4EMK A;  5KH6 A;  5I2S A;  4M77 A;  3CCQ Q;  3VV0 A;  3LGL A;  1K8A C;  1IO6 A;  4M7A A;  4XU1 A;  2QAZ A;  1NJI R;  4JS5 A;  1I5L A;  2XG8 D;  1UEC A;  2CRE A;  5IN1 A;  2G3R A;  3INZ A;  4FU6 A;  1KD1 U;  3OSS C;  3Q1J A;  4OF1 A;  1QQJ A;  4E7Z A;  2A0F B;  1IRE B;  3EG9 B;  4RTW A;  4IIO A;  1YHQ Q;  2KE9 A;  4FSX A;  1I4K 1;  4CI0 C;  2VV5 A;  3RMQ A;  5KYW A;  4PJN A;  4C92 B;  3VU3 C;  1NE8 A;  4FT2 A;  4F17 A;  2IG0 A;  1KC8 R;  4E7H A;  1JEG A;  5EG2 A;  1AVZ C;  2EBP A;  1MNE A;  3SDZ A;  2K79 A;  2DYB A;  4M75 C;  3G6E Q;  3OYI A;  2L89 A;  2RK1 A;  5EC7 A;  1VQ8 Q;  4DBR A;  2H3E B;  2KRN A;  1NEB A;  1QKX A;  1SRM A;  2F2W A;  2SEM A;  5CKD A;  1FWZ A;  1E7O A;  1SHF A;  1YFN A;  2K5F A;  2ZPH B;  1QLY A;  3GLX A;  3L1A A;  5GMK m;  2CZ1 B;  4NS5 A;  2DL3 A;  4AFQ C;  4FM4 B;  1OV3 A;  5L23 A;  1WHM A;  3GP8 A;  1G2B A;  2GGR A;  5KYW B;  3OBW A;  4K11 A;  2EYZ A;  2P4T A;  3FC3 A;  1WDX A;  1NLO C;  1SSH A;  5HKC A;  1EX4 A;  3M54 A;  3X26 B;  1OPK A;  2E65 A;  2RHX A;  2XDD A;  2IIM A;  5CCA A;  1M9S A;  1O75 A;  1BB9 A;  3OYG A;  2HCK A;  3BE3 A;  1VQ9 A;  1VA7 A;  3GNF B;  1PRL C;  3JSC A;  3VS3 A;  2CSI A;  1X6B A;  3EGD B;  3WVD B;  4IUP A;  4HKE A;  4BB7 A;  2AKK A;  3EGX B;  4A53 A;  4PLL A;  3L2R A;  4C0Z A;  2OTJ T;  5CAI A;  3M4G A;  8AT1 B;  2LNH B;  4C0G A;  4A63 B;  4J9F A;  5DM7 R;  1MHN A;  4HCC A;  4RMO A;  3JCM P;  4M77 E;  3PFS A;  1YWO A;  3G4S A;  4JRP A;  3S3M A;  5GAO p;  4JLI A;  3NGP A;  1M3B A;  2V8I A;  4M78 C;  5C6S A;  2LJ1 A;  3V7C A;  1TG0 A;  4M78 F;  4LD9 K;  1YI2 T;  2L5Q A;  2RHY A;  1OOT A;  3O8V A;  2X4Y A;  1T3S A;  1K1Z A;  3JCM Q;  3QXE B;  3CD6 T;  3L2Z A;  4M7A C;  3OS0 A;  5KYY B;  1Y96 A;  3RDV A;  4C92 A;  1BU1 A;  3OS5 A;  4RTU A;  1WPY A;  5CQY A;  4YTL A;  5GAO q;  1LJO A;  3CME A;  3PVL A;  2DK3 A;  2V1R A;  2X3X D;  2HBW A;  4PL6 A;  1VQN A;  3BFM A;  2DEQ A;  1YI2 A;  2CT4 A;  1XOV A;  1GCP A;  2KVQ G;  2QQA A;  1VQ6 A;  1UGV A;  5IT9 E;  4KT0 E;  4RUG A;  1GFD A;  2DD4 A;  1K8A R;  2JS2 A;  3OW2 A;  3L2Q A;  1I5O B;  2CH4 W;  3REA B;  2FEI A;  2BUD A;  2HNI A;  3OYD A;  1JJ2 A;  1B34 A;  2J6O A;  2QTV A;  2LJ3 A;  3X20 B;  2DL7 A;  2RHI A;  1BIB A;  2IVW A;  4J9H A;  1RAI B;  4BDZ A;  2RJC A;  5CK9 A;  2YRD A;  1EFN A;  2GFU A;  1G3S A;  2XD0 A;  1VQP T;  2A3L A;  1W2B S;  4OB2 B;  2RI3 A;  9ATC B;  3CXC A;  4XQ3 A;  1WI7 A;  1I81 A;  1PD0 A;  1QCO A;  4C0F A;  4C0D B;  2AHJ B;  1KSW A;  1VQN T;  1ZA1 B;  4IUV A;  3I55 T;  4ATO A;  4IKF A;  3L42 A;  3OYM A;  4FYV B;  1YJW A;  4M7D G;  4C92 F;  3OYJ A;  2D0Q B;  2Z0W A;  1RAF B;  2DXC A;  3CCU T;  1VQO Q;  4PJO B;  5FU6 B;  2EJF A;  2FPD A;  1RAE B;  1N8R R;  4BE1 A;  2VUB A;  4O5V A;  3QWX X;  4NL3 A;  5GAN g;  2EQM A;  3E2U A;  1UFF A;  3QHS A;  3CCE A;  3JCM f;  1KD1 R;  4D8K A;  1VIE A;  3HL8 A;  5CIU A;  3CCE Q;  2XK0 A;  2MAM A;  3FLG A;  2KRM A;  4IUR A;  1RAB B;  2DVE A;  2EYQ A;  3J80 E;  3CMA Q;  3JB9 D;  3I55 Q;  3CC2 Q;  4KUD K;  2DTH A;  4EPC A;  3THK A;  1VQ6 T;  2ROT A;  4F04 B;  1AOJ A;  4RG8 A;  3H9N A;  3A8L B;  2EVR A;  3GNG A;  2BZ8 A;  1Q81 R;  2LZ6 B;  4L6V 5;  1VIF A;  4ZGJ B;  2KRS A;  2HQH A;  3CC7 T;  7AT1 B;  3JB9 F;  2HEQ A;  3JB9 I;  2DX1 A;  1K73 C;  3KUF A;  2D0N A;  4MDX A;  3I56 T;  4PJO E;  5GAN 4;  4OMP A;  5LJ3 g;  2ABL A;  3GOX A;  3TEE A;  3R6O A;  1YCS B;  1W70 A;  3PNW C;  2K57 A;  2KR3 A;  2LDM A;  3H0H A;  3JCM V;  2EAY A;  1M1K U;  3CC2 T;  1VQ6 Q;  5CVI A;  2HSP A;  3HKS A;  1K73 U;  1M2V B;  1D09 B;  2MWP A;  4HXJ A;  4RCB A;  2EFI A;  4PJO F;  4X9C A;  3CME Q;  2LQK A;  4KH1 B;  4ZGE B;  4E6R A;  1Y71 A;  2W10 A;  3RKX A;  4M7D E;  3RMS A;  2CZ0 B;  5CQX A;  2X4W A;  2D9T A;  3M55 A;  3JCM g;  2V8J A;  1KQ2 A;  2YUN A;  1YHQ T;  3CQT A;  2BE9 B;  1U8R A;  4UC4 A;  2M51 A;  3CCJ Q;  3C4S A;  4OML A;  2COY A;  1YIT T;  2DTI A;  1MMA A;  2R58 A;  1PKS A;  1TSF A;  5FRO A;  2EGE A;  2VC8 A;  3DB3 A;  2XDB A;  5DLQ E;  5IH2 A;  1OX8 A;  2KT8 A;  5GAM g;  5C0M A;  5KCO A;  2CP5 A;  1W2B A;  1D1A A;  2K7A A;  2C0O A;  3CXC S;  3QJY A;  1X6O A;  1GCQ A;  4ELZ C;  3MHX A;  1XTD A;  4GBQ A;  2FHD A;  2J7I A;  4XAX B;  5LJ5 e;  2FB7 A;  1CKB A;  1GL5 A;  1T3L A;  4M7A F;  3I56 A;  1M5Q 1;  4OMM A;  2LCS A;  4C5E A;  1Q86 R;  2YWW A;  1HXD A;  2MWO A;  2CP0 A;  1NBE B;  2B8A A;  3CBP A;  5LJ3 f;  3S3N A;  1WGS A;  3CCS T;  1VQL T;  2MF2 A;  3E9G A;  3NFC A;  4RG2 A;  5FU7 B;  1VQK Q;  4PNO A;  2YRC A;  1UTI A;  4J7F A;  5GAM d;  3NMZ C;  2WAC A;  5CKE A;  1YJN T;  3EG2 A;  2E12 A;  3CCL Q;  1BI1 A;  1NM7 A;  1K76 A;  5GAN 8;  2FRW A;  4FW2 A;  3PVQ A;  2DYI A;  1QVG A;  1VQL A;  2EGA A;  3E9F A;  1KIK A;  4M75 G;  2ROL A;  1F1B B;  3SWN B;  2DZC A;  1WHL A;  2DEU A;  4ZTF A;  5GAN j;  4E7L A;  1VQM T;  5KYX A;  5AT1 B;  2XDP A;  1IGQ A;  1S1N A;  1UHF A;  2B86 A;  2VXE A;  1BCO A;  1MMG A;  2WSF E;  2KGT A;  4F7U B;  4MZM A;  1C6V X;  3CCM A;  1N6A A;  2HQX A;  3D7S B;  1PSF A;  2LMJ A;  5L8R E;  3ZEH A;  1JRI A;  1N9R A;  1Q82 U;  2DL5 A;  3I5R A;  1D1C A;  2F2V A;  4PJJ A;  3DLL A;  1RAA B;  1VQP A;  4O6J A;  4J9E A;  1XJW B;  4E2F B;  2PNI A;  5IHK A;  3OBY A;  4HVW A;  3AT1 B;  2MMP A;  5GMK l;  1WHK A;  2KBT A;  2HKQ B;  2H8H A;  1M30 A;  1K4U S;  4ME7 A;  1OX9 A;  4RKU E;  4PFO A;  1LPL A;  2HSE B;  1VQ4 T;  2QI2 A;  4M7D A;  1YHQ A;  3JB9 H;  1WYX A;  2VGM A;  2CYZ B;  3A8M B;  1N8R U;  4F7U E;  3JRZ A;  2OX7 A;  2GTO A;  2DNU A;  1WXU A;  2DPP B;  2OAW A;  3L2W A;  1G3T A;  4OGC A;  5GMK j;  4EMH A;  3TU4 K;  1XNI A;  2DER A;  2ED1 A;  1UHC A;  3SWN A;  5KE3 A;  3BW1 A;  4J6Y A;  3LH5 A;  5GAM e;  5GAO r;  4ZN3 A;  4PFZ A;  4M75 E;  4C5H A;  3HPW A;  3JCM d;  3QJ6 A;  1H92 A;  1IB8 A;  2OI3 A;  3QUI A;  5GJW B;  2PU9 B;  4HT9 A;  4J9G A;  2YLC A;  2QYZ A;  1WFW A;  4X1V A;  1K73 R;  1ARK A;  1PM3 A;  3CEY A;  1QVF A;  2CUD A;  2PZ1 A;  2RHZ A;  2P4R A;  3T9N A;  3M0S A;  2ESW A;  3QG1 A;  3CD6 Q;  1QKW A;  4C8Q F;  2HL3 A;  4HVV A;  2I0N A;  2C0T A;  1VQ9 T;  3UT1 A;  2LQN A;  2RQU A;  5CKH A;  1RLQ C;  3FJP A;  1C1A A;  2MYS A;  2D8J A;  1QP2 A;  2G6F X;  1C0M A;  4N0A C;  3JV3 A;  2CT3 A;  3CBM A;  1Y0M A;  3QPH A;  1W2B P;  2JVV A;  2DO3 A;  2HQE A;  2YSQ A;  2RQR A;  3UF4 A;  1IZ6 A;  4OVA A;  5D7U A;  3VRY A;  1N8R C;  3JCM X;  2FG0 A;  3QYH B;  2OJ2 A;  3UA6 A;  1K9M R;  4XU3 A;  3CC4 Q;  1GFC A;  4PFP A;  5KCH A;  2CSQ A;  3BDL A;  3A8O B;  1NPP A;  2RMO A;  1PG5 B;  2LNV A;  4DBH A;  2M1H A;  4EDU A;  3U23 A;  4FIB A;  1VQ5 A;  2YUP A;  2YHT A;  2CH4 A;  2E4H A;  2BE7 D;  5LJ5 h;  3CC4 A;  4ZTJ A;  1Q81 U;  1U06 A;  4MZP A;  1NPR A;  4M77 C;  2OAU A;  3CPW S;  3KBG A;  1M2V A;  1RLP C;  1VYT A;  2PUK B;  1YIT A;  1G3W A;  1YIJ Q;  4IIM A;  4J6W A;  2DXU A;  2DXB A;  2DRK A;  5DY9 A;  1UJY A;  2MOX A;  3M4Y A;  2CP7 A;  3VYG A;  3A8H B;  4JJD A;  4L5G A;  2D8H A;  1FXX A;  3HTR A;  1QVG S;  2DMO A;  4J6X A;  1W6X A;  3R6N A;  1RAD B;  2JUF A;  2KXC A;  3JCM c;  3N5B B;  4GY5 A;  2EQJ A;  4C8Q G;  3CCV A;  2ZPB B;  4FSS A;  4ZGD B;  2FPE A;  2QEX T;  4IUQ A;  4EMK C;  5GAM h;  3M0T A;  3REB B;  2JM8 A;  3MO8 A;  2DF6 A;  1KQS P;  2F69 A;  1N27 A;  3A8G B;  1TUC A;  2M0Y A;  2ED0 A;  4JJC A;  2W0Z A;  2E5Q A;  2RH2 A;  2O9S A;  2EYY A;  4XTZ A;  1D1B A;  2CP3 A;  4AFZ C;  3CCJ T;  1Q7Y C;  3MEA A;  2LT1 A;  4R0K A;  2NWM A;  4LDV A;  3I5S A;  2K3B A;  3MP1 A;  2LQ8 A;  1IRX A;  3C12 A;  1QVG P;  2KMT A;  4KH0 B;  1K9A A;  4QQD A;  3I56 Q;  1QVP A;  2R57 A;  3UWN A;  4Z8A A;  2DKG A;  3H0I A;  1G5V A;  2DFU A;  1TTH B;  1GXI E;  1TUG B;  2DBM A;  1AT1 B;  2DTO A;  3VS6 A;  4J7I A;  3EFO B;  4ESR A;  1ZSG A;  1M4Z A;  1B34 B;  2A28 A;  4P5N A;  3EFR A;  3OS2 A;  4MML A;  1I8F A;  2P0K A;  1JU5 C;  4WTO B;  3VS1 A;  4DA4 A;  3F70 A;  1RUW A;  3VS0 A;  1UGP B;  2RPN A;  1QP3 A;  2JMA A;  4Y92 A;  3VUB A;  3P8B B;  3HRS A;  1MGQ A;  1I0C A;  3G7Z A;  1RAG B;  3OYL A;  1FYN A;  2OTL T;  2RQW A;  2ECZ A;  1SKU B;  2FZK B;  3CCQ A;  1B07 A;  2ZGW A;  3ULR B;  1TU0 B;  3TSW A;  4FYY B;  2NUZ A;  3CCR A;  4OMO A;  1V1C A;  2M0O A;  3H0F A;  4M4Z A;  1MMD A;  2ZAE A;  2FZC B;  2RJE A;  2QK0 A;  5J39 A;  3OYN A;  2K9G A;  2LCL A;  2KK4 A;  5D6W A;  2FYK A;  2KAF A;  5FRM A;  5IAY A;  1ZSZ B;  5LJ5 f;  2E5K A;  3DB4 A;  1PWT A;  5LJ3 j;  2JTF A;  5FU6 C;  2O2O A;  4PJO C;  2P0P A;  1VQL Q;  3HP9 A;  5J26 A;  1FMW A;  2K3Y A;  5KYU A;  5GAN e;  3G6E T;  2HKN A;  1MMN A;  5CKF A;  2AZV A;  2EQI A;  2KT1 A;  2F5T X;  1Q86 C;  4C0D C;  2NYS A;  1YIJ A;  2LP5 A;  5CKB A;  1UGQ B;  2E10 A;  1U1S A;  3OYE A;  3P8H A;  1CKA A;  2LC4 A;  3I55 A;  5LJ5 g;  1Y7X A;  2RI5 A;  3RR6 A;  2A37 A;  1X75 C;  3VS5 A;  3PMT A;  3QBY A;  1SF9 A;  2CGH A;  3QII A;  4QQ6 A;  3H6Z A;  2LJ0 A;  1ZBJ A;  3OB9 A;  1V76 A;  1AWX A;  1NEG A;  2GF7 A;  1TS9 A;  4EMK B;  4HCZ A;  2EQU A;  2HD0 A;  4GLM A;  3LX7 A;  3V8J A;  3I35 A;  2M02 A;  4BUG A;  3ZL7 C;  4C92 E;  3NTK A;  3RKW A;  3V8K A;  2AZS A;  2NUP B;  1VQ8 T;  1YJN A;  1YJW T;  4D6W A;  4M7A B;  4RTX A;  4AFU C;  2ZPG B;  4ZNX A;  1WHJ A;  1JBM A;  3URG A;  4M77 B;  1MND A;  2QA4 Q;  5GAN 2;  3EGD A;  3H41 A;  4DEX A;  2QTX A;  3VKI A;  2NUP A;  2EQK A;  5GAN 7;  1VQ7 T;  1PRM C;  3CD6 A;  2ZPI B;  1ZHI A;  2JTE A;  1X01 A;  1K0S A;  2HMA A;  4OB0 B;  2YXY A;  2RN8 A;  3M0P A;  4N4G A;  5FWB A;  1UGR B;  2J05 A;  4XTX A;  1VQN Q;  2QA4 A;  1RAH B;  6AT1 B;  1KHC A;  2OTJ A;  3NHN A;  1AZG B;  2Y90 A;  3UDC A;  2GFA A;  2QQR A;  3L2U A;  3PE0 A;  2QQB A;  1NG2 A;  3PMI A;  4J9C A;  1W1F A;  4LN2 A;  2JN0 A;  1OZ3 A;  5M9O A;  8ATC B;  1FX7 A;  2XMF A;  3PIO A;  4N4H A;  4CC2 A;  3JCM W;  2DBK A;  1K9M C;  4B9X A;  1Y57 A;  4AT1 B;  1M1F A;  4JRQ A;  1KFZ A;  4F7U F;  3CMA T;  4BI8 B;  5GMK h;  4M7D F;  3J7A F;  2DZ9 A;  3M56 A;  1WHH A;  4V2S A;  2H3J A;  5D6X A;  2E41 A;  2YT6 A;  1AEY A;  1FMV A;  1JJ2 P;  3LLR A;  3J81 E;  1QW1 A;  4JLG A;  3M0R A;  2QEX A;  1WA7 A;  1SHG A;  3QKJ A;  5FU7 C;  3WVE B;  4KGZ B;  3EG0 A;  3WXM B;  2X51 A;  2JXB A;  3LWH A;  3EFO A;  3EFS A;  1WJQ A;  4KBM B;  4BE0 A;  2SRC A;  4X9D A;  3CXC P;  2EJG A;  2DIQ A;  2HZY A;  2PUO B;  1K9M U;  4LUD A;  3CCM Q;  3JCM h;  1UGS B;  4ANJ A;  1M2O A;  3M9Q A;  1NZ9 A;  4A4F A;  2RQT A;  3TSZ A;  1U5S A;  1VOM A;  4M7A E;  2EKO A;  3HFO A;  1M90 R;  4OB3 B;  1UJ0 A;  2C06 A;  4C5G A;  3EHR A;  3M5A A;  2DM1 A;  3OYK A;  1HJD A;  1WLP B;  3CCL A;  2K4Y A;  1IXD A;  1JQQ A;  2X9H A;  4QVC A;  5AYF A;  1M90 C;  1U1T A;  1TXQ A;  2Y4X A;  4PLI A;  4OMF B;  2K6D A;  4R55 A;  1QVF P;  1LVK A;  4RTV A;  1NLP C;  2QXF A;  2HDA A;  2F1L A;  1T0H A;  4PJO D;  2QEX Q;  3JCM b;  3QZ5 B;  2RI2 A;  4JUV A;  1Y96 B;  1G3Y A;  3KFV A;  3CC7 Q;  3EGU A;  4JRK A;  2YLB A;  4XU0 A;  3EAE A;  2HBP A;  1KHI A;  1ZQ1 A;  2CS7 A;  2QAS A;  2DXT A;  3SHW A;  2GNC A;  2GTJ A;  1QMC A;  1ZSZ C;  4MZT A;  3M58 A;  3SWN C;  2DET A;  2PVG B;  4BE2 A;  1S72 T;  4HT8 A;  3G71 A;  1H64 1;  2DL4 A;  3CCQ T;  2EYX A;  5I2M A;  5A2Q E;  4ORZ A;  3VS7 A;  4M78 A;  3VS4 A;  5A0G A;  4JDS A;  1MV3 A;  4QT7 A;  4XU2 A;  4LDU A;  2F5K A;  4M77 F;  2BTT A;  3OYC A;  3UPU A;  2XIC A;  1I1J A;  3OYF A;  4QVZ A;  4A4H A;  3OYA A;  5GAO l;  4D8D A;  2VVK A;  1ZUK A;  4KUI A;  1N5Z A;  2FZG B;  3VS2 A;  2CUB A;  2CZ7 B;  1JO8 A;  1B3Q A;  3SFM A;  1KC8 U;  2E64 A;  4LDY A;  2FO0 A;  2F2X A;  3SB2 A;  3MEV A;  1G83 A;  3MKD A;  2QQ9 A;  2LRQ A;  1WQ7 A;  1P92 A;  4LNP A;  4KGV B;  2J06 A;  3HRU A;  4JZ3 A;  3FIF A;  3NPF A;  5I21 A;  3E1S A;  1TWB A;  3OA6 A;  4BI3 A;  3M53 A;  4HCB A;  1AHJ B;  1WIE A;  2L3Q A;  5CO7 A;  5KYU B;  5ECA A;  1WXT A;  4AFS C;  1WHG A;  1RAC B;  1H3H A;  3ZFJ A;  1YP5 A;  4M75 F;  1UUE A;  5I22 A;  1M8M A;  2CZ6 B;  4HA8 A;  5GAN d;  2JTM A;  4J8O A;  1M3C A;  3IQL A;  3RKY A;  2M9U A;  4FL6 A;  2EKH A;  2J6K A;  2CKK A;  4Z89 A;  2XI9 A;  3OYY A;  1YJN Q;  1H3Z A;  3CMA A;  2VB6 A;  2R5M A;  3MP6 A;  3FJ5 A;  2X4X A;  2GCX A;  3PIP A;  2E70 A;  4M7D B;  1Q86 U;  4BDY A;  3RIR A;  1FMK A;  2QDL A;  2E1H A;  4A4G A;  1D0Z A;  1RI0 A;  1AWJ A;  4BI4 A;  3OY9 A;  4C8Q B;  2K5L A;  2XU8 A;  1D3B A;  3HRT A;  4ZN1 A;  4M7D D;  4QQG A;  4Z88 A;  4DEY A;  4OGE A;  4PK4 A;  4BY6 B;  3NTI A;  2JMC A;  4QKU A;  3V7R A;  4FCY A;  1YJW Q;  5GMK i;  1KQ1 A;  1NJI C;  4DOV A;  2JS0 A;  5IHI A;  3X24 B;  1SSF A;  5KE2 A;  3CCS A;  4C8Q D;  2O31 A;  4M77 D;  3QSU A;  1Z9Z A;  3EG3 A;  2A08 A;  2GQV A;  5GAO n;  3SEM A;  1WZO A;  4HCK A;  5GAO m;  2XHC A;  3CCR T;  1KJW A;  1CSK A;  2EWN A;  3G1J A;  2OTJ Q;  5LJ3 h;  3HFN A;  1OZ2 A;  3OMC A;  4M78 B;  3DKM A;  1IHV A;  4M78 G;  1ABQ A;  4TVR A;  4CC4 B;  1JB0 E;  1ZSZ A;  1Y07 A;  1D0X A;  3JB9 J;  2O9V A;  5FW9 A;  3QZ9 B;  3G4S T;  1QWF A;  2KYM A;  4II1 A;  1GBQ A;  4X34 A;  2P84 A;  5A0L A;  4E47 A;  1V29 B;  5GAN h;  1LNX A;  3MP8 A;  2L2P A;  4VUB A;  1VQK A;  3EGX A;  2XKO C;  2LCC A;  1YI2 Q;  2L8D A;  2LTO A;  2ZCF B;  4JRI A;  4J5Y A;  4FYX B;  2YDL A;  2CP6 A;  2E6Z A;  3OS1 A;  4QW2 A;  1WXB A;  4JJB A;  2X35 A;  1KQS S;  5D6Y A;  4QVD A;  3MJX A;  4C8Q E;  1E6G A;  4XTW A;  4BD3 A;  2LVM A;  5IXB A;  1OU8 A;  4JPB W;  1X69 A;  2KDS A;  2LT4 A;  1EIF A;  4LUE A;  4A4K A;  2ZPF B;  1TUD A;  3A1P A;  3G4S Q;  3MEU A;  1LCK A;  3VRZ A;  3ASK A;  2EGC A;  1JXO A;  1YJ9 T;  2MPX C;  2E3I A;  2XID A;  2X4J A;  3CCE T;  1X27 A;  4XTU A;  1BI2 A;  4PJM A;  1VQP Q;  1YWP A;  3ER0 A;  3RES A;  2K2M A;  2LQW A;  3NTH A;  3G71 T;  3QWY A;  2VGN A;  1KG1 A;  4CRI A;  2JM9 A;  2O4X A;  1AWO A;  2RJF A;  1YNZ A;  2YUO A;  5I11 A;  4A54 A;  2RHU A;  3GIB A;  1ZLM A;  2KXD A;  4FT4 A;  4PKC C;  2VKN A;  3MEW A;  2WSE E;  2BZX A;  3LW5 E;  2JJ9 A;  1QCN A;  3L2V A;  4L59 A;  1VQ4 A;  4JZ4 A;  4M75 A;  1X2Q A;  4Q5W A;  3MET A;  3CC4 T;  1M1G A;  1OUL A;  3ZBD A;  4B6M A;  4LD6 A;  1M8V A;  4J9B A;  3CCV Q;  2JW4 A;  1RI9 A;  1A0N B;  2DJQ A;  5DLO A;  2DRM A;  1BKB A;  5LJ3 e;  2HAX A;  5GJV B;  4BAC A;  2RF0 A;  2OTL A;  4AG1 C;  3MPU B;  2K3X A;  3LWI A;  4C5I A;  3CPW A;  4JJN K;  1U3O A;  3ME9 A;  2QG9 B;  2X3W D;  2A36 A;  2V26 A;  4J9D A;  3OW2 P;  2RJD A;  1DJ7 B;  4Z02 A;  2KI7 A;  1VQ5 Q;  2RK2 A;  1BBZ A;  3CCV T;  4PJO G;  4C8Q A;  4A4E A;  1ZUY A;  5LJ3 d;  5GAN f;  1T0J A;  2DD5 A;  2EW3 A;  5GAN 5;  2EIF A;  3JCM e;  4WCI A;  4F14 A;  4J9I A;  4OMN A;  1RL2 A;  1ZX6 A;  1YBY A;  2BKD N;  3OYH A;  1YIJ T;  3EH2 A;  2PTK A;  4C92 G;  3CME T;  4XTV A;  1J3T A;  1ZBX A;  5KYX B;  1GBR A;  1MV0 B;  3X28 B;  4RTZ A;  1NYG A;  4GLK A;  1WJS A;  2DVJ A;  1PD1 A;  2BIV A;  5HK3 A;  1HD3 A;  1PNJ A;  2KQW A;  2NUT A;  3LH0 A;  3M0Q A;  2PQW A;  1O9S A;  2KSS A;  1Q82 R;  3CPW P;  1R8O B;  1SG5 A;  5J3B A;  5HY6 A;  5GAN 3;  2LX9 A;  1YCY A;  1B7T A;  2GQI A;  2ZZD A;  1UE9 A;  2KRO A;  1Z9Q A;  2PVD B;  2O4X B;  2L3S A;  3UA7 A;  4RTT A;  2C0I A;  2ZPE B;  1PSE A;  5IHN A;  1M27 C;  2RD1 A;  1UEB A;  2DA9 A;  2V8K A;  5LJ5 j;  1Q7Y U;  1M3A A;  2FPF A; 
#chains in the Genus database with same CATH homology
 1BB9 A;  2LQN A;  2K6D A;  2RQU A;  1RLQ C;  4RTV A;  2HCK A;  2D8J A;  4RTY A;  4LE9 A;  1NLP C;  1VYU A;  1MUZ A;  1VA7 A;  2HDA A;  1PRL C;  2G6F X;  1T0H A;  3VS3 A;  2O88 A;  2CSI A;  1X6B A;  3JV3 A;  2CT3 A;  1Y0M A;  5HCK A;  3KFV A;  2AKK A;  3C0C A;  3EGU A;  2YSQ A;  2RQR A;  3UF4 A;  3VRY A;  2EYW A;  2YUQ A;  1GRI A;  1BK2 A;  2AK5 A;  2FG0 A;  2OJ2 A;  2LNH B;  3UA6 A;  4A63 B;  4J9F A;  1GFC A;  3SHW A;  2GNC A;  5FWC A;  2GTJ A;  2CSQ A;  1YWO A;  2RMO A;  3U23 A;  2YUP A;  2DL4 A;  2CH4 A;  3NGP A;  1M3B A;  2EYX A;  1U06 A;  2LJ1 A;  4ORZ A;  3VS7 A;  1HSQ A;  1TG0 A;  3VS4 A;  2ENM A;  1OOT A;  1MV3 A;  2FRY A;  4QT7 A;  1T3S A;  1K1Z A;  1SRL A;  1RLP C;  1VYT A;  2BZY A;  2BTT A;  4IIM A;  1X6G A;  2DRK A;  1I1J A;  1BU1 A;  1UJY A;  4RTU A;  2MOX A;  1OPL A;  1ABO A;  4D8D A;  3PVL A;  2V1R A;  2LX7 A;  2X3X D;  2HBW A;  2L0A A;  1ZUK A;  2VVK A;  4JJD A;  2D8H A;  1N5Z A;  2DMO A;  1W6X A;  3VS2 A;  2CUB A;  1JO8 A;  1B3Q A;  3R6N A;  2CT4 A;  1XOV A;  2KXC A;  1GCP A;  2FO0 A;  2F2X A;  4FSS A;  1UGV A;  2FPE A;  4RUG A;  1GFD A;  1G83 A;  3UAT A;  2JS2 A;  1QCF A;  1ZUU A;  2CH4 W;  3REA B;  2FEI A;  3M0T A;  4LNP A;  3REB B;  2J06 A;  2JM8 A;  1JXM A;  2L3P A;  4JZ3 A;  2MCN A;  2DF6 A;  2J6O A;  3NPF A;  1TUC A;  2LJ3 A;  2M0Y A;  2DL7 A;  2ED0 A;  4JJC A;  2W0Z A;  2CDT A;  1QWE A;  4J9H A;  2L3Q A;  1WIE A;  2O9S A;  5ECA A;  1WXT A;  2EYY A;  4AFS C;  1H3H A;  1EFN A;  1YN8 A;  1YP5 A;  4AFZ C;  1UUE A;  2AKL A;  5I22 A;  1M8M A;  1WI7 A;  4R0K A;  2NWM A;  1M3C A;  3IQL A;  1X43 A;  2MIO A;  3I5S A;  2EKH A;  2K3B A;  2J6K A;  4Z89 A;  1KSW A;  1K9A A;  2V1Q A;  3FJ5 A;  4Z8A A;  1AZE A;  3H0I A;  2DBM A;  1FMK A;  2QDL A;  2KEA A;  2FPD A;  3VS6 A;  4ESR A;  1ZSG A;  2A28 A;  1AWJ A;  3QWX X;  1UFF A;  4CC3 A;  1PKT A;  4D8K A;  1JU5 C;  1SEM A;  3VS1 A;  1X2K A;  4Z88 A;  1I07 A;  4DEY A;  3M0U A;  1RUW A;  3VS0 A;  2JMC A;  2KRM A;  1PHT A;  2RPN A;  2JS0 A;  5IHI A;  2JMA A;  4Y92 A;  3RNJ A;  2O31 A;  3THK A;  2ROT A;  1I0C A;  1Z9Z A;  2DIL A;  3EG3 A;  1AOJ A;  2A08 A;  4HVU A;  1FYN A;  2DL8 A;  2GBQ A;  2RQW A;  3SEM A;  2ECZ A;  4HCK A;  1B07 A;  1KJW A;  2EVR A;  3ULR B;  1CSK A;  3TSW A;  2BZ8 A;  2J6F A;  2NUZ A;  2LZ6 B;  4OMO A;  1V1C A;  3O5Z A;  2KRS A;  2HEQ A;  3H0F A;  4M4Z A;  1UG1 A;  2DX1 A;  1ABQ A;  2D0N A;  4CC4 B;  2K9G A;  4OMP A;  2ABL A;  1AWW A;  2KYB A;  1YCS B;  2E5K A;  1W70 A;  1PWT A;  2O9V A;  5FW9 A;  2KR3 A;  3H0H A;  2O2O A;  1NYF A;  3GBQ A;  1QWF A;  2HSP A;  2KYM A;  4OMQ A;  2KNB B;  1GBQ A;  4HXJ A;  2L2P A;  4E6R A;  2AZV A;  2EQI A;  2KT1 A;  2W10 A;  3TVT A;  2EPD A;  2YDL A;  1K0X A;  1VYV A;  2LP5 A;  2YUN A;  1WXB A;  3CQT A;  4JJB A;  2RNA A;  3EG1 A;  2M51 A;  4KRT A;  1E6G A;  1CKA A;  4OML A;  5IXB A;  4JPB W;  2DLP A;  1X69 A;  1PKS A;  1UDL A;  4LUE A;  2EGE A;  2A37 A;  1TUD A;  5IH2 A;  3VS5 A;  2RQV A;  1LCK A;  2KT8 A;  3VRZ A;  2EGC A;  4EIK A;  1JXO A;  1E6H A;  4AG2 C;  2VWF A;  2LJ0 A;  1ZBJ A;  1WX6 A;  1AWX A;  2K7A A;  1NEG A;  2C0O A;  1GCQ A;  1X27 A;  1GCQ C;  4GBQ A;  2J7I A;  1CKB A;  1GL5 A;  1YWP A;  1T3L A;  4GLM A;  4OMM A;  2LCS A;  3I35 A;  2DE0 X;  2K2M A;  2LQW A;  3ZL7 C;  3QWY A;  2JM9 A;  1AWO A;  2AZS A;  1OEB A;  1YNZ A;  2YUO A;  5I11 A;  1UTI A;  5IXF A;  4RTX A;  3NMZ C;  3RBB B;  4AFU C;  4ZNX A;  4F16 A;  3A98 A;  1ZLM A;  3EG2 A;  2KXD A;  4CC7 A;  1NM7 A;  2VKN A;  2BZX A;  1K76 A;  2FRW A;  3PVQ A;  3H41 A;  2EGA A;  1SPK A;  4DEX A;  1KIK A;  2ROL A;  1AD5 A;  4JZ4 A;  1PRM C;  1X2Q A;  2JTE A;  3EHQ A;  2D1X A;  1H8K A;  3I9Q A;  1S1N A;  1UHF A;  2B86 A;  2JT4 A;  4J9B A;  1K0S A;  2JW4 A;  2RN8 A;  1RI9 A;  2KGT A;  3M0P A;  1A0N B;  2DJQ A;  5FWB A;  2DRM A;  2J05 A;  5GJV B;  2RF0 A;  3NHN A;  1IO6 A;  2LMJ A;  1AZG B;  4AG1 C;  3PE0 A;  1NG2 A;  4J9C A;  1UEC A;  1W1F A;  1U3O A;  4LN2 A;  2DL5 A;  2CRE A;  3I5R A;  2F2V A;  2X3W D;  4J9E A;  2A36 A;  4J9D A;  2XMF A;  2PNI A;  5IHK A;  4HVW A;  4CC2 A;  2DBK A;  4RTW A;  1BBZ A;  2KBT A;  1Y57 A;  2H8H A;  4IIO A;  1M30 A;  1K4U S;  1KFZ A;  1ZUY A;  2KE9 A;  1T0J A;  2EW3 A;  4WCI A;  4F17 A;  4F14 A;  1WYX A;  4J9I A;  4OMN A;  1JEG A;  2YT6 A;  1AEY A;  1AVZ C;  1ZX6 A;  2EBP A;  3M0R A;  2K79 A;  2PTK A;  2GTO A;  2DYB A;  2DNU A;  1WXU A;  2OAW A;  1WA7 A;  1SHG A;  1J3T A;  1GBR A;  5EC7 A;  1MV0 B;  3EG0 A;  2ED1 A;  4RTZ A;  1UHC A;  2JXB A;  1NYG A;  2KRN A;  1NEB A;  1QKX A;  3LH5 A;  1SRM A;  2DVJ A;  2F2W A;  2SEM A;  2SRC A;  1H92 A;  2OI3 A;  1HD3 A;  1PNJ A;  1E7O A;  1SHF A;  5GJW B;  4J9G A;  4LUD A;  3M0Q A;  1WFW A;  1QLY A;  4X1V A;  2RQT A;  2DL3 A;  3TSZ A;  4AFQ C;  1ARK A;  1OV3 A;  1U5S A;  5L23 A;  1G2B A;  2GQI A;  1UJ0 A;  1UE9 A;  2CUD A;  2PZ1 A;  2GGR A;  2KRO A;  1Z9Q A;  2P4R A;  4K11 A;  3M0S A;  2ESW A;  2EYZ A;  3EHR A;  2L3S A;  3UA7 A;  1QKW A;  4RTT A;  2DM1 A;  2C0I A;  1HJD A;  1WLP B;  5IHN A;  1WDX A;  1M27 C;  1NLO C;  1JQQ A;  1SSH A;  2FPF A;  2DA9 A;  1OPK A;  4HVV A;  1M3A A;  2IIM A;  2I0N A;  2C0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...