1PWTA

Thermodynamic analysis of alpha-spectrin sh3 and two of its circular permutants with different loop lengths: discerning the reasons for rapid folding in proteins
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
b'MGTGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA SPECTRIN
publication title Thermodynamic analysis of alpha-spectrin SH3 and two of its circular permutants with different loop lengths: discerning the reasons for rapid folding in proteins.
pubmed doi rcsb
molecule tags Circular permutant
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1998-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1pwtA00
1E6HA 1V1CA 4DEYA 1BK2A 2K3BA 2J7IA 1PHTA 2RQRA 2AKKA 4RUGA 2YUPA 1FYNA 4RTTA 1XOVA 2BZ8A 2EQIA 1BBZA 2M0YA 5I22A 2ROLA 1AZGB 1NYGA 2OJ2A 1WI7A 2D1XA 1RUWA 1X6BA 2DE0X 2DL4A 4J9FA 2V1QA 3QWXX 3R6NA 2EYXA 2RN8A 1HSQA 3I35A 1AEYA 4F14A 3VS5A 4WCIA 2FPFA 1E7OA 2GBQA 4ORZA 1I07A 4AFZC 1NEGA 1ZX6A 2KRSA 4RTXA 3U23A 2DBMA 1UDLA 2ED1A 1BU1A 2J6KA 2EGAA 1GBQA 1Y57A 2DNUA 1M30A 2F2XA 2I0NA 2D8HA 2RQUA 1NG2A 3VRZA 2KYBA 2AZVA 1KSWA 1CKAA 2C0TA 4Z89A 4RTZA 3NPFA 4OMOA 2EYYA 2KT1A 4Y92A 1GCQA 3VS4A 1PNJA 2KGTA 1KIKA 2GGRA 4ZNXA 1RI9A 1X6GA 2ESWA 1H92A 2KRMA 4OMMA 1Z9QA 2JTEA 3KFVA 4J9IA 2JMAA 2ABLA 1WDXA 4LNPA 1M3CA 1JO8A 1Z9ZA 3EG2A 1FMKA 2GTJA 1K0XA 5IH2A 4D8DA 3VRYA 3VS1A 2FPEA 2RQWA 1GL5A 3PVQA 1EFNA 3IQLA 1X43A 1QKXA 3TSZA 1K0SA 1NM7A 1UJYA 2JM8A 1TUCA 2CREA 3PE0A 4J9EA 1QWFA 4JJCA 2LQNA 1WXUA 2DRMA 2GTOA 2KE9A 5FW9A 2A37A 2DL3A 2L0AA 1U06A 2J6OA 2MCNA 3UATA 2FG0A 1RLQC 1GFCA 1UHCA 4CC7A 1K76A 2F2VA 2EGEA 1T0JA 2H8HA 1UG1A 1UFFA 4F16A 2AK5A 4LUEA 2OI3A 4AG2C 1PKSA 1GCPA 3M0TA 2YUNA 1OPKA 1U5SA 2PNIA 2EW3A 2J6FA 1QWEA 1GCQC 2KXDA 1WLPB 2LNHB 3CQTA 1TUDA 1OEBA 1UE9A 2ROTA 1AVZC 2LX7A 2DL5A 3SHWA 5IHIA 2L3QA 1ABQA 1PRMC 1UHFA 3VS2A 2XMFA 2VKNA 1X27A 2BZYA 4J9CA 1VYTA 1JEGA 2VVKA 5FWCA 1ZUYA 1A0NB 1ARKA 1M3AA 4K11A 2G6FX 1W6XA 1MV0B 3REBB 2K9GA 2EPDA 3ULRB 3I5RA 4FSSA 2HCKA 4J9HA 1W1FA 2EVRA 2DLPA 1UJ0A 1KJWA 1SHFA 1VYUA 1JXMA 1X2KA 1CSKA 1WIEA 2JMCA 1UTIA 1K9AA 2CT4A 4J9GA 1GBRA 4HVWA 2KXCA 4AFQC 1B3QA 1ZUKA 2K2MA 2LJ0A 2B86A 2RMOA 4JZ4A 3H41A 2P4RA 1MV3A 2MIOA 1K1ZA 4Z88A 1I0CA 2YDLA 2O2OA 1AOJA 2EYWA 3EG3A 4JPBW 3ZL7C 1OPLA 2JM9A 2PTKA 2DRKA 3EG1A 4J9DA 4RTYA 2CSQA 2JT4A 2RQVA 2DX1A 2X3XD 3VS3A 2CSIA 1N5ZA 5IHNA 2L3PA 3M0SA 2ECZA 1JXOA 2ED0A 4HVUA 1J3TA 1ZBJA 1G83A 1NLOC 1M27C 3NGPA 2M51A 1AWWA 1SEMA 4F17A 2SRCA 1W70A 1UECA 3UF4A 2E5KA 5I11A 2JS0A 3NMZC 2JXBA 2NWMA 4DEXA 1ZUUA 3PVLA 4Z8AA 3VS6A 3I5SA 2DL7A 2AZSA 1RLPC 2GNCA 5EC7A 2KRNA 4OMNA 3GBQA 4J9BA 4IIOA 4AG1C 4ESRA 1WFWA 1OV3A 5IHKA 4OMLA 1T3LA 2HDAA 2K79A 3JV3A 2A28A 2LMJA 1QLYA 2IIMA 5L23A 2A36A 3EGUA 2O31A 1K4US 2EBPA 1WYXA 4A63B 1YCSB 3QWYA 4HCKA 1WXBA 1YWPA 2MOXA 4OMQA 1QKWA 1HJDA 4KRTA 1QCFA 2J05A 2LZ6B 2X3WD 1LCKA 3I9QA 1PWTA 2YUQA 4JZ3A 1JQQA 1X2QA 2DVJA 2FRYA 5IXBA 1E6GA 1G2BA 1AD5A 2V1RA 3RNJA 3VS0A 2KNBB 2FO0A 3LH5A 1NLPC 2BTTA 1ZSGA 2VWFA 1GFDA 2O9VA 1YP5A 2RPNA 3NHNA 1T0HA 2D8JA 3M0PA 4AFUC 3M0UA 1ABOA 5GJVB 1SSHA 4RTVA 4QT7A 1KFZA 2CH4A 2RNAA 1S1NA 3EHRA 1SHGA 2DMOA 2LP5A 1AWXA 2RF0A 4GLMA 1VA7A 2LJ3A 4R0KA 2ENMA 3H0IA 5IXFA 1Y0MA 4E6RA 1VYVA 4JJDA 1U3OA 2JW4A 2OAWA 2YUOA 3UA6A 2CT3A 2CH4W 3TVTA 2A08A 2RQTA 4LUDA 2DBKA 1CKBA 1B07A 3THKA 1OOTA 1YNZA 4CC3A 1T3SA 2EGCA 2EYZA 3EG0A 1AZEA 5HCKA 1MUZA 2C0OA 2KROA 2HBWA 2L2PA 1BB9A 2F2WA 1NEBA 4HVVA 3VS7A 4X1VA 2DILA 2W10A 5FWBA 2FRWA 3RBBB 2O9SA 3A98A 2FPDA 1HD3A 3M0RA 1I1JA 1JU5C 2AKLA 2YSQA 4OMPA 3H0HA 5GJWB 2LCSA 1TG0A 2BZXA 4IIMA 2KR3A 2DA9A 2YT6A 2K6DA 2QDLA 1WXTA 2K7AA 1IO6A 1X69A 2LQWA 2PZ1A 3FJ5A 2HSPA 4RTWA 3TSWA 1SRMA 3UA7A 1M3BA 4JJBA 3REAB 3O5ZA 2CUDA 1PKTA 1AWJA 1YN8A 2EKHA 1SPKA 4M4ZA 2KT8A 1SRLA 2J06A 2CUBA 2DJQA 1WA7A 3EHQA 4HXJA 2KYMA 2DM1A 2SEMA 1UUEA 2W0ZA 2DYBA 2DF6A 2FEIA 2L3SA 1NYFA 4LN2A 4LE9A 4CC4B 1UGVA 4D8KA 1GRIA 1AWOA 2C0IA 1PRLC 1WX6A 2LJ1A 2O88A 2KBTA 2D0NA 2HEQA 2KEAA 2CDTA 2NUZA 4AFSC 4EIKA 3SEMA 4GBQA 3M0QA 1M8MA 1ZLMA 3H0FA 4RTUA 1H8KA 1YWOA 2GQIA 3C0CA 2DL8A 2JS2A 4CC2A 5ECAA 1H3HA
chains in the Genus database with same CATH superfamily
3EFOA 1IRXA 3DB3A 9ATCB 1YIJQ 2AKKA 2DZ9A 3RMQA 1KD1C 1MMGA 2RB6A 3CCJT 4RTTA 1RI0A 2EJ9A 1C0MA 1ZSZB 3G6EQ 1K73R 4NOYA 4KBMB 4Y91A 1M4ZA 3OYJA 3C95A 1EZZB 4XAXB 1KC8U 4J7FA 2DE0X 1B34B 2V1QA 2Y4YA 3O8VA 2D0QB 4F14A 3TCJA 4WCIA 2MWPA 1BI2A 1K9MC 3CCQQ 1NEGA 2COYA 1ZX6A 2KRSA 4RTXA 1UDLA 2FVUA 1IREB 2J6KA 4B6MA 1YITA 2DXBA 1Y57A 4ANJA 5CR2A 4QQGA 2DNUA 4M7AA 5LJ5e 1YIJA 1VQ8T 2KYBA 4MMKA 4Z89A 3TU4K 2COWA 4RTZA 1M90U 3NPFA 4OMOA 3CMET 2KT1A 3SWNB 3TQ7P 2JTMA 3QYHB 3RIRA 3L2WA 2LNVA 1RI9A 4PK4A 3H8ZA 2KRMA 5GANh 4ZTJA 2V8IA 3KFVA 2ABLA 1FMWA 4LNPA 1M3CA 1VQLQ 1Z9ZA 1VIFA 5J26A 2XK0A 1KHCA 5GANj 1X43A 4FIBA 2JM8A 2CREA 4J9EA 4WF2A 3F70A 3H9NA 3M55A 4JJCA 4M77B 3MKDA 3JB9D 3VU3C 2GTOA 2KE9A 3CCLT 2LX9A 1XQHA 5GAMd 2MCNA 3UATA 5J3BA 1RLQC 1GFCA 4CC7A 2F2VA 2EGEA 2OI3A 4F7UE 1GCPA 1QVFS 3M0TA 2BE9B 2PNIA 2FZKB 1I4K1 1WJQA 3CD6Q 1WLPB 2CZ1B 3CCVT 1OEBA 5GAOn 4PJNA 1M2VB 4RKUE 2L3QA 3CC4Q 2WSCE 2YLCA 1VYTA 2VV5A 2M9UA 5KE2A 1ZUYA 2P0KA 4XTVA 3BDUA 1A0NB 5KYXB 5GANg 2L8DA 1WPYA 1IHWA 5GAN7 1W6XA 2GFAA 5KCOA 1OULA 4KUIA 4PJOE 4IUTA 3I5RA 4KH1B 4JS4A 2NUTA 3JCMW 2KK4A 2JMCA 5D6XA 4M7DG 1UTIA 4X34A 1QP2A 4M7DC 4HVWA 4AFQC 5GMKi 3CC4A 2E5QA 3QDRB 3MP6A 4ATOA 2LJ0A 2B86A 4M77E 1VQPA 1I0CA 4N4IA 2OTLT 3HRUA 5GAN3 4QW2A 3RDVA 3CCEQ 3EG1A 4RTYA 4IUVA 2JT4A 1BCMA 2CSIA 1N5ZA 2HD0A 3CC7Q 3CPWS 5FU7C 4QVZA 3NFCA 2RD1A 3VYGA 3L1AA 4BY6C 2QQAA 3CC2T 1OYXA 3A1PA 2RHYA 1KC8C 1AWWA 2V8JA 1BKBA 1VQ7T 4J6YA 4C8QG 1WHKA 2QDYB 2WSFE 4C8QC 2Y90A 1YJ9T 3RKYA 1JB0E 4Z8AA 3I5SA 4DBQA 3M5AA 5LL6S 2GNCA 5EC7A 3GBQA 4J9BA 3E9FA 2EFIA 4FYYB 2QK0A 4M75B 3X20B 4F04B 4M7DA 4OMLA 3A8LB 2K79A 2A28A 1OX8A 4TVRA 3S6WA 2XDPA 1K8AU 1WGSA 3OS0A 1M90C 3DLLA 3HFNA 1Y96A 5L23A 4EMKA 2A0FB 3S3OA 1YI2T 3PNWC 2EBPA 3CC7A 1WYXA 4QQ6A 1YCSB 3QWYA 3HL8A 1YWPA 3NTIA 4F7UF 2MOXA 3OY9A 1HJDA 3JCMb 4HCBA 3OA6A 1N9SA 4VUBA 4M78D 4XTZA 1PM3A 3MEAA 1N8RU 2RO0A 2GCXA 2DVJA 2PQWA 3E19A 3LH0A 5CCAA 1G2BA 2EJFA 3M57A 3RNJA 4C8QA 1MMNA 3X25B 1NLPC 3OMCA 2BTTA 1ZSGA 3V7SA 2DEQA 3HTRA 1YP5A 3NHNA 1T0HA 4AFUC 3EGDA 2DTOA 1ABOA 4C0DB 4OGCA 1QVGS 1SSHA 1VQOQ 1RAFB 4EMHA 4FYXB 2MYSA 3EHRA 4PJOF 1SHGA 2DMOA 2K5IA 1JJ2A 5CKFA 1AWXA 5GAMh 2LJ3A 4JRPA 4NL2A 1W2BS 3OYAA 3OQ5A 1KQSA 2DXUA 4Z02A 2OAWA 3UA6A 2DXCA 2CT3A 3RUXA 1HYOA 1TTHB 3TVTA 5LJ5d 3JCMe 2A08A 4PL6A 1TOVA 2DBKA 4LUDA 2CZ6B 4QQDA 1W2BA 2EQKA 1Q86C 3BE3A 5KH6A 4LXCA 4M75E 1MHNA 1WHMA 4BI3A 3OYEA 1UEBA 5HCKA 4M77F 4C5HA 1NEBA 1KQ1A 3CMEQ 1NJIU 5FWBA 1BI0A 3HHTB 3FRNA 3RBBB 1VQOA 2FPDA 2QA4T 1MNDA 2AKLA 1BIAA 2YSQA 4X9CA 4OMPA 4E7JA 2HQXA 2BZXA 3HRSA 3QZ9B 1KHIA 4M78A 2KR3A 4LDXA 1S72A 1Q7YR 1WXTA 2K7AA 1IO6A 2E3HA 3NTHA 3V7RA 2NUPB 4RTWA 3TSWA 5I2SA 2D6FA 3UA7A 1D0ZA 4JJBA 1BIBA 1QQJA 2CUDA 4A53A 3GPLA 1VQ4A 1I81A 1YN8A 1SPKA 4M4ZA 1VOMA 3MJXA 2HSEB 3E2UA 3LYIA 2J06A 4PLLA 4KGZB 4A4KA 1RABB 3EHQA 4E7ZA 2KYMA 1H641 4OB3B 1QCNA 5GANf 1Q95G 3GNFB 4DA4A 5GAOq 1IGUA 2M1HA 3KUFA 4D8KA 3OYKA 2VXEA 3VKIA 3C12A 2JTFA 2D0NA 4N0AA 2CDTA 2NUZA 4IKFA 4GBQA 1Q81U 3EH1A 2VXFA 4RTUA 2GQIA 3C0CA 2DL8A 4BUGA 2QAZA 1NZ9A 6AT1B 1E6HA 2AT1B 1G3WA 1BK2A 1YJWA 2J7IA 2DFUA 3OYMA 3HRTA 5LJ3j 4FT2A 1SKUB 2RJFA 1PD0A 5A2QE 1XOVA 3CCRA 1LJOA 3CCSA 1BBZA 3P8HA 2M0YA 1AZGB 1D1AA 1NYGA 1Q82R 5FU6B 1BI1A 1RUWA 3MP1A 2Z0WA 3R6NA 2RN8A 1HSQA 1Y07A 1AEYA 1K8AC 4ORZA 3V8KA 5CQXA 1Y71A 4J6WA 1B7TA 1Y7XA 1IXDA 2EGAA 2FYKA 3SD4A 2MK5A 1VQNQ 2CGHA 4XQ3A 2F2XA 1M5Q1 4JLGA 1NG2A 2AZVA 2ZPBB 4HCZA 3X28B 2C0TA 3PMTA 1VQ5T 2YRDA 4LDWA 5CKEA 5GMKm 2EYYA 4FU6A 1D0YA 3OYBA 3HP9A 5CKHA 1GCQA 2ZCFB 4J8OA 4N4GA 1KD1R 1N8RC 1KIKA 4BDZA 4XTXA 2LQ8A 5GAOm 4PJOD 3MPUB 2X51A 4E7HA 1LPLA 4J9IA 2JMAA 3I56T 1ACMB 3MEVA 3JCMV 2RI3A 1JO8A 3GLXA 2ZPEB 1PG5B 1YJNQ 1FMKA 1K0XA 5CK9A 5LJ3e 5IH2A 1M1KU 3UDCA 4C92B 2RQWA 1K9MR 1VQNA 1QKXA 1VQ7Q 3TSZA 5GMKe 1RL2A 1K0SA 3SB2A 1UJYA 4E2FB 3EFSA 1QWFA 4M77D 1B34A 2G3RA 1WQ7A 2DRMA 3N5BB 5FW9A 1VQ9Q 4XTUA 2DL3A 1G3YA 5LJ5h 3BW1A 3M9QA 1ZQ1A 5GAN5 1KK7A 3JSCA 2XDDA 4MZMA 4A4HA 1K76A 2XD0A 3X26B 3RESA 2H8HA 1OZ2A 2AK5A 3CMAT 1NJIC 1YJNA 2E12A 4YTLA 1QWEA 3JCMf 3QKJA 1UE9A 4BI4A 1AVZC 5HKCA 5IHIA 3SWNA 2MPXC 2QEXT 3VS2A 1UGSB 4J7IA 2VKNA 4DOWA 3D7SB 2RI2A 1VQ9A 3QJYA 1ARKA 1M3AA 1WHJA 2DEUA 5KYUB 4K11A 3VJPA 1MV0B 3REBB 4F7UB 2KSSA 4DBRA 2HCKA 3PIPA 1W1FA 4J5YA 2FB7A 3TEEA 1RAHB 3G4SA 1SHFA 3QIIA 3FC3A 1X2KA 3PTAA 1YHQQ 2HKNA 1EIFA 1WIEA 2K5LA 4C92E 1GBRA 2HQEA 1ZUKA 1NPRA 2QTVA 3G6EA 2ZGWA 1Q81C 2YWWA 2RMOA 1MV3A 4CI0C 5GAN8 1YBYA 2GF7A 2IPOB 3RERA 3EG3A 3ZL7C 4PJOB 1OPLA 2IVWA 4A4EA 4O6JA 2JZ2A 2RQVA 1KG1A 2DX1A 1OU8A 2X3XD 4UC4A 3CCQA 1BCOA 4J83A 3VS3A 1SSFA 1IB8A 1PSFA 1JXOA 3A5ZB 1G83A 1N27A 1M27C 1M2VA 2X4WA 1H3ZA 3BFMA 1QW1A 1W70A 1YHQA 4FYWB 2RHXA 2HZYA 3FDRA 2JXBA 2OTJQ 2K4YA 1JRIA 2NWMA 2OX7A 4DEXA 5A0LA 4LDUA 1VQMT 5KYXA 2AZSA 2KRNA 4OMNA 3E9GA 3OYNA 4AG1C 4ESRA 2EQUA 4M75D 1WFWA 3G71T 5IHKA 1D1CA 3LWIA 3FJPA 3JV3A 3CCRT 1SG5A 4M7AB 3CCST 4KULA 4DOVA 2MF2A 1VQLA 1WJSA 1QMCA 3FEOA 3M4GA 4OMQA 2VB6A 4KRTA 1QCFA 3ASKA 4RG2A 3RR6A 2L89A 3LWHA 1KC8R 3I9QA 1PWTA 3OS5A 3CXCP 2R5MA 5I2MA 3WXMB 1M1KC 3QDFA 1X2QA 5IXBA 3KBGA 1E6GA 2K3YA 3CCUQ 1AD5A 1VUBA 3EG9B 2RK2A 2KNBB 2DERA 3LH5A 4FM4B 4C0FA 3V8LA 1GFDA 2O9VA 2RPNA 2PUKB 3M0PA 4KGVB 1UB4A 2XICA 5GJVB 5GANe 4QVCA 1KFZA 4FYVB 2RNAA 1WHHA 1X75C 2LP5A 3G4SQ 5LJ3f 3CD6A 2RF0A 3I55Q 1VA7A 1M90R 3H0IA 1VYVA 4LD6A 3CCMQ 4E7LA 2DD5A 2VGMA 2JW4A 3C4SA 4C0DC 4M75A 2CH4W 1RAEB 4E7KA 4C92F 4L59A 5DLOA 2E4HA 4EMKC 3G7ZA 3VUZA 8ATCB 4BACA 1X01A 3CCUA 2EGCA 3EG0A 2C0OA 3SDZA 2HBWA 1VQ6T 4HVVA 2F2WA 3M54A 2HKQB 1P92A 2CZ0B 5FROA 3J7AF 2DILA 2QASA 4M7AE 1LOJA 2FRWA 2K57A 4PJLA 2QGFB 2DPPB 2KI7A 2RJEA 1I1JA 5GAN2 2LCSA 4BDYA 2CZ7B 4IIMA 3I55A 4PJMA 5IT9E 3CCMA 2K6DA 2QDLA 2PZ1A 2LQWA 1RAIB 3V8JA 4HCCA 1SRMA 5CQYA 5GMKl 3UPUA 1BI3A 3O5ZA 2FZGB 3DB4A 5KYNA 1SRLA 3JCMc 3QXEB 3BY7A 5KYYB 3LLRA 3PFSA 5GAOl 2CUBA 2DJQA 3L2QA 3CCEA 1WA7A 1R77A 1Q7YU 1Q86R 2DF6A 4MZTA 4IUQA 1MNEA 2FEIA 4LE9A 3JB9I 3OSSC 2C0IA 3A8GB 1PRLC 1VQKQ 1D1BA 2O88A 2KBTA 3EAEA 2HEQA 2KEAA 3AT1B 4EIKA 3SEMA 1PC0A 2LTOA 1FWZA 1H8KA 2K2VA 1YITT 3G4ST 1AT1B 1V1CA 4DEYA 2XKOC 3META 1YIJT 2RQRA 3LGFA 3OYHA 5EG2A 2YUPA 1BYMA 5KYWB 1JJ2S 1FYNA 3CCJQ 3OS2A 4M78G 4J6XA 3OW2A 4M78C 4NS5A 2JVVA 1PD1A 2BZ8A 2EQIA 4OP0A 1KQSS 5I22A 1O9SA 3HPWA 2DL4A 4J9FA 3QWXX 2E6NA 1VQKA 3VS5A 3CCQT 1E7OA 2GBQA 4M7DB 3RKWA 3OMGA 1C6VX 2DBMA 2ED1A 5GAMj 3JAME 5CIUA 1Y96B 2MI6A 4Y28E 1QCOA 3UT1A 4E7SA 1Q82U 4C5EA 2I0NA 2D8HA 2RQUA 1VQ8Q 1CKAA 2YRCA 3CCJA 1WQWA 2DIGA 4C0ZA 5D6YA 4LDYA 5D7UA 1QVFP 4N0AC 1PCXA 2R5AA 2GGRA 4ZNXA 4BY6B 4KH0B 3Q1JA 4M7AF 4KGXB 1WNLA 4OMMA 1TU0B 1Z9QA 2Y4XA 2JTEA 2LQKA 4C8QB 1WDXA 3ER0A 2LT4A 3EG2A 4BE1A 7AT1B 1D3BB 1I8FA 4D8DA 3LW5E 2BKDN 1TUGB 1M2OA 3VS1A 1IHVA 1TXQA 4C92D 1K8AR 1R8OB 1GL5A 2EKOA 2DTHA 1VQ8A 4GY5A 4XU2A 1TUCA 2M16A 3OYGA 2L3RA 3QO3A 4MDWA 4DBFA 3CMEA 4A4GA 2QQRA 2A37A 3CCLQ 2L0AA 5GAMg 2WACA 3QSUA 1U06A 3A8HB 3JCMQ 3G71Q 4BB7A 2E70A 2FHDA 3V7CA 3OYYA 2DO3A 1UFFA 4F16A 2H3EB 3OS1A 1JBMA 4LUEA 1N8RR 4AG2C 4M7DE 2YUNA 2HBPA 3UWNA 4BE0A 2O4XA 1UGPB 2EW3A 1GCQC 2KXDA 1N6AA 1TUDA 3OB9A 2V26A 1G3SA 3CCVQ 1QVPA 2DL5A 3SHWA 3CC4T 3L2RA 2VUBA 4DQ2A 3SFMA 4O5VA 4GLKA 2X9HA 4OF1A 2ZPHB 2XMFA 1X27A 3CPWP 1VQPT 3CCLA 5FWCA 2P4TA 4ZN3A 5GMKh 1I5LA 5KE3A 4WTOB 4PFOA 5GANd 2CYZB 1ZSZC 2E6ZA 2YLBA 2K9GA 2RM4A 3ULRB 5GAOr 4FSSA 1ZHIA 4J9HA 2DVEA 2EVRA 2DLPA 3QJ6A 4C8QE 2HAXA 1X6OA 1K73U 3OYCA 3PGGA 4JRKA 1UJ0A 5DLQE 1KJWA 1VYUA 4E7IA 1CSKA 1LVKA 4J9GA 2KXCA 1TH7A 1B3QA 3EGXA 2K2MA 3QHSA 1UGRB 4XU1A 3DLMA 1DJ7B 2PVOB 4JZ4A 3OW2P 3H41A 3VYHB 4Z88A 5CKBA 3QPHA 2O2OA 2JS2A 2OTLQ 4FL6A 2CP3A 3CCET 1V76A 2PTKA 3FB9A 2DRKA 2DJZA 1C1AA 3QUIA 2CSQA 1WJRA 1VQ6Q 4ZN1A 1ZA2B 3SWNC 5IHNA 3L2UA 3CC7T 1OI1A 5CAIA 2OAUA 2ED0A 1NLOC 2ZPGB 3WVEB 3CC2Q 1ZSZA 4PJOC 1SEMA 2QQBA 1SF9A 2SRCA 3RMSA 2E5KA 4R56A 3NMZC 3CXCA 2WSEE 1YJ9Q 5GAN6 4IUUA 3PVLA 2MMPA 3VS6A 2QQ9A 2K3XA 3GOXA 2DL7A 1QVGP 4FW2A 4JJNK 3GIBA 4IIOA 4F7UA 1OV3A 2OTLA 1T3LA 2HDAA 2F1LA 2EJGA 1Q82C 4M77G 1YCYA 2LMJA 1QLYA 2CP0A 2IG0A 4M77C 4M7AD 2IIMA 5LJ5j 1HK9A 2A36A 3EGUA 1YI2Q 2R57A 4HCKA 4ZGEB 1WXBA 2JJ9A 3CC2A 4IURA 3JRZA 4C5IA 1QKWA 1R0BG 4M7DF 4XK8E 1VQ7A 1I5OB 3S3NA 2X3WD 1YJ9A 2E1HA 4FSXA 2QG9B 4PJOA 3MO8A 3MCAB 4RCCA 1KQ2A 3RKXA 2FRYA 3ZFJA 3M4YA 5J39A 2VWFA 3VUBA 3FLGA 2D8JA 3P8BB 1VQOT 3CBOA 4RTVA 1ZBXA 2AHJB 1WHLA 1YI2A 3INZA 3LGLA 1RACB 3A8MB 1M1GA 4PJJA 2LC4A 4M77A 3C94A 2YHTA 4C8QF 3JB9J 1S72T 4JJDA 3NTKA 3JCMd 2VGNA 1U3OA 2F5TX 2YUOA 2DKGA 4OVAA 5LJ5g 1VQ4T 4NL3A 4PLIA 2CS7A 2RQTA 5DY9A 3MEWA 1FXXA 1YNZA 4CC3A 1WHGA 3OYFA 3EFOB 2KROA 1NPPA 2L2PA 3JCMP 1BB9A 2JNGA 4ZTFA 5GAMf 1M1KR 2W10A 3E1SA 3A98A 2PU9B 1HD3A 2QA4Q 1JU5C 1AHJB 2EWNA 3H0HA 5GJWB 1TG0A 2DA9A 2YXYA 2NYSA 1X69A 3FJ5A 4A4FA 4XTWA 5IN1A 4JUVA 2RH2A 3EG9A 2P84A 3L2VA 1AWJA 1FX7A 1K73C 1YJWT 2EKHA 2BE7D 4D6WA 4PFZA 2HNIA 2K5FA 5A0GA 1G5VA 4P5NA 5AT1B 4M78F 3JB9G 2L5QA 3AHUA 4C5GA 4M75G 4KT0E 2W0ZA 3ME9A 4M75C 2QA4A 2L3SA 3QYGB 4L5GA 4MZPA 2ZZDA 1UGVA 1AWOA 4BE2A 4OB1B 1O75A 2F69A 2OTJA 3FIFA 2VASA 4II1A 4L6V5 4X1VA 3OYIA 4CC2A 3GP8A 1H3HA 3OBYA 2DK3A 1Q86U 2K3BA 1PHTA 4RUGA 3DKMA 1QVFA 5HY6A 2DTIA 1OU9A 5HK3A 2FL7A 3T9NA 4OB0B 2ROLA 3M59A 2OJ2A 1VQPQ 1WI7A 3KXTA 2D1XA 1X6BA 4EPCA 1OX9A 2EYXA 3I35A 2KDSA 2FPFA 2MAMA 4DBHA 1I07A 4M7DD 4AFZC 3QG1A 5L8RE 3U23A 3JCMX 1N9RA 1BU1A 5KYYA 1GBQA 2GFUA 2RJCA 1VQNT 4ELZC 1M30A 2QXFA 3VRZA 2CKKA 2E65A 1KSWA 4XTYA 2B8AA 1VQ5Q 2RI5A 2BIVA 4LD9K 4V2SA 4Y92A 3TREA 3VS4A 1PNJA 4B9XA 2KGTA 4EMGA 1PSEA 1XTDA 5GAN4 3CPFA 1X6GA 5I21A 2ESWA 1H92A 4AMCA 5LJ3d 3L2ZA 2RA2A 4CRIA 1U1SA 4C8QD 3I56Q 1M9SA 1YJNT 2HMAA 2RHUA 2GTJA 3OSVA 3R6OA 4ELYC 5KYWA 2QTXA 2YRVA 3VRYA 2C06A 4OGEA 2X4XA 2FPEA 5A0DA 3PVQA 1EFNA 3IQLA 2NUTB 4JRQA 1NM7A 2EIFA 2LCCA 3CPWA 3PE0A 1VQ5A 3JCMh 1VQ9T 2HL3A 2LQNA 1WXUA 4HT9A 3P8DA 4HA8A 4OMFB 2X35A 2XDBA 2J6OA 2FG0A 1UGQB 1UHCA 3HSBA 3J81E 1F1BB 1T0JA 4JS5A 1UG1A 1EX4A 2KAFA 4X9DA 1PKSA 3I56A 3CMAQ 4A54A 2HQHA 4RG8A 1OPKA 4MMLA 1U5SA 3OW2S 3JB9H 4RMOA 2J6FA 5C6SA 3CQTA 2LNHB 5HK0A 2DYIA 2KY9A 2ROTA 1W4SA 3G1JA 5M9OA 1G3TA 2NLUA 2LX7A 5CO7A 5LJ5f 5FLXE 1ABQA 3G6ET 2E41A 2RK1A 2E64A 2QEXQ 1PRMC 3WVDB 1UHFA 2XIDA 4PNOA 3PIOA 2LDMA 2BZYA 4J9CA 1JEGA 1IGQA 2VVKA 3QZ5B 3LX7A 2EYQA 3JCMJ 1NBEB 4RCBA 1OQKA 2NUPA 1G8XA 2G6FX 2DIQA 1D3BA 2JN0A 2EPDA 2EQMA 4B9WA 2CP6A 4OB2B 3CMAA 4Q5WA 5FU6C 2H3JA 3CBPA 2QI2A 2DAQA 4EMKB 1YHQT 1JXMA 4PKCC 4ZGJB 2GQVA 2RHZA 4BI8B 1K9AA 3JCMg 1S72Q 2CT4A 1QVGA 5AYFA 1D0XA 4E47A 2EAYA 2MWOA 2QEXA 2CP2A 1TSFA 1VQ4Q 5CKDA 2P4RA 2MIOA 2VC8A 1K1ZA 5FU7B 3VV0A 1TWBA 2DETA 1AOJA 2EYWA 4JPBW 2JM9A 2M0OA 4J9DA 3H6ZA 2DD4A 5C0MA 2EQJA 1VQLT 4IUPA 2L3PA 3M0SA 3EH2A 2PUOB 2ECZA 4XU0A 4HVUA 1J3TA 1ZBJA 2ZPIB 3EGDB 3NGPA 2M51A 3X24B 1D09B 4F17A 2A7YA 4HT8A 2ZAEA 3URGA 1UECA 1KD1U 3UF4A 5I11A 2JS0A 2OTJT 3CEYA 3ZEHA 3ZBDA 4C0GA 1ZUUA 2X4YA 4R55A 4FT4A 4LDVA 1M1FA 2X4JA 3MP8A 1VQMQ 4HKEA 1RLPC 4C92G 3OYDA 1XNIA 4C92C 1YJWQ 1V29B 3HKSA 1U1TA 5FRMA 2QYZA 5GAMe 1K9MU 2M02A 3CCRQ 2A3LA 3M56A 2E10A 3CCSQ 5FRNA 2FZCB 1HXDA 2O31A 2QGGA 1K4US 4A63B 2QQSA 1R0CB 4ME7A 3CD6T 2KMTA 2XHCA 4XU3A 2HL5C 3MHXA 3OBWA 2DZCA 1NE8A 2J05A 2LZ6B 4N4HA 3EFRA 5IAYA 2KQWA 5LJ3h 1LCKA 4QVDA 4M78B 1ZA1B 1OZ3A 2YUQA 1VQMA 3L42A 2LVMA 4JZ3A 1JQQA 2LRQA 3CCUT 3OYLA 2JOYA 2V1RA 3VS0A 1RADB 3G71A 2FO0A 4EDUA 2JUFA 1M8VA 3M0UA 4C92A 3GNGA 4QT7A 1Q7YC 5GMKj 2ATCB 1RAAB 2CH4A 5CVIA 1U8RA 2LCLA 1S1NA 3QBYA 3I55T 4F7UG 2DXTA 4GLMA 2VYTA 4R0KA 2ENMA 5IXFA 4BD3A 3CCVA 1Y0MA 4E6RA 1MMDA 3CCMT 1NJIR 4PFPA 2CP7A 5KCHA 1GXIE 1IZ6A 4JRIA 2I2LA 1VIEA 8AT1B 5GAOp 2E3IA 3HFOA 2RHIA 3PMIA 2PVDB 1CKBA 2XI9A 1B07A 3THKA 1LNXA 3MEUA 1OOTA 2AIRB 1T3SA 2D9TA 2O4XB 2EYZA 1AZEA 2O01E 1MUZA 3CBMA 4KUDK 4FCYA 4ZGDB 3JB9F 3VS7A 4AT1B 1RAGB 3CXCS 4M75F 2XG8D 2O9SA 4JDSA 4PJOG 3M0RA 4MDXA 3M58A 2CP5A 1JJ2P 2PVGB 1MMAA 5LJ3g 2YT6A 3J80E 2HSPA 2P0PA 3M53A 2F5KA 1WZOA 3PT9A 1KQSP 1M3BA 3REAB 5KYUA 4M78E 1PKTA 1MGQA 2BUDA 4JLIA 3A8OB 2RJDA 2KT8A 1W2BP 2KVQG 1Q81R 1FMVA 2COZA 4QKUA 5D6WA 4HXJA 1VQ6A 2DM1A 2SEMA 1TS9A 5DM7R 1UUEA 3EGXB 2DYBA 1NYFA 4LN2A 2P0QA 4CC4B 1YFNA 3BDLA 1QP3A 1GRIA 4M7AG 2ZPFB 4FW1A 1VQKT 2R58A 1WX6A 2LJ1A 4M7AC 2LT1A 3S3MA 2V8KA 1XJWB 4AFSC 3M0QA 3H0FA 1M8MA 1ZLMA 2XU8A 1YWOA 2YDLA 1YITQ 3GF5A 5ECAA
chains in the Genus database with same CATH topology
1E6HA 1V1CA 4DEYA 1BK2A 2K3BA 2J7IA 1PHTA 2RQRA 2AKKA 4RUGA 2YUPA 1FYNA 4RTTA 1XOVA 2BZ8A 2EQIA 1BBZA 2M0YA 5I22A 2ROLA 1AZGB 1NYGA 2OJ2A 1WI7A 2D1XA 1RUWA 1X6BA 2DE0X 2DL4A 4J9FA 2V1QA 3QWXX 3R6NA 2EYXA 2RN8A 1HSQA 3I35A 1AEYA 4F14A 3VS5A 4WCIA 2FPFA 1E7OA 2GBQA 4ORZA 1I07A 4AFZC 1NEGA 1ZX6A 2KRSA 4RTXA 3U23A 2DBMA 1UDLA 2ED1A 1BU1A 2J6KA 2EGAA 1GBQA 1Y57A 2DNUA 1M30A 2F2XA 2I0NA 2D8HA 2RQUA 1NG2A 3VRZA 2KYBA 2AZVA 1KSWA 1CKAA 2C0TA 4Z89A 4RTZA 3NPFA 4OMOA 2EYYA 2KT1A 4Y92A 1GCQA 3VS4A 1PNJA 2KGTA 1KIKA 2GGRA 4ZNXA 1RI9A 1X6GA 2ESWA 1H92A 2KRMA 4OMMA 1Z9QA 2JTEA 3KFVA 4J9IA 2JMAA 2ABLA 1WDXA 4LNPA 1M3CA 1JO8A 1Z9ZA 3EG2A 1FMKA 2GTJA 1K0XA 5IH2A 4D8DA 3VRYA 3VS1A 2FPEA 2RQWA 1GL5A 3PVQA 1EFNA 3IQLA 1X43A 1QKXA 3TSZA 1K0SA 1NM7A 1UJYA 2JM8A 1TUCA 2CREA 3PE0A 4J9EA 1QWFA 4JJCA 2LQNA 1WXUA 2DRMA 2GTOA 2KE9A 5FW9A 2A37A 2DL3A 2L0AA 1U06A 2J6OA 2MCNA 3UATA 2FG0A 1RLQC 1GFCA 1UHCA 4CC7A 1K76A 2F2VA 2EGEA 1T0JA 2H8HA 1UG1A 1UFFA 4F16A 2AK5A 4LUEA 2OI3A 4AG2C 1PKSA 1GCPA 3M0TA 2YUNA 1OPKA 1U5SA 2PNIA 2EW3A 2J6FA 1QWEA 1GCQC 2KXDA 1WLPB 2LNHB 3CQTA 1TUDA 1OEBA 1UE9A 2ROTA 1AVZC 2LX7A 2DL5A 3SHWA 5IHIA 2L3QA 1ABQA 1PRMC 1UHFA 3VS2A 2XMFA 2VKNA 1X27A 2BZYA 4J9CA 1VYTA 1JEGA 2VVKA 5FWCA 1ZUYA 1A0NB 1ARKA 1M3AA 4K11A 2G6FX 1W6XA 1MV0B 3REBB 2K9GA 2EPDA 3ULRB 3I5RA 4FSSA 2HCKA 4J9HA 1W1FA 2EVRA 2DLPA 1UJ0A 1KJWA 1SHFA 1VYUA 1JXMA 1X2KA 1CSKA 1WIEA 2JMCA 1UTIA 1K9AA 2CT4A 4J9GA 1GBRA 4HVWA 2KXCA 4AFQC 1B3QA 1ZUKA 2K2MA 2LJ0A 2B86A 2RMOA 4JZ4A 3H41A 2P4RA 1MV3A 2MIOA 1K1ZA 4Z88A 1I0CA 2YDLA 2O2OA 1AOJA 2EYWA 3EG3A 4JPBW 3ZL7C 1OPLA 2JM9A 2PTKA 2DRKA 3EG1A 4J9DA 4RTYA 2CSQA 2JT4A 2RQVA 2DX1A 2X3XD 3VS3A 2CSIA 1N5ZA 5IHNA 2L3PA 3M0SA 2ECZA 1JXOA 2ED0A 4HVUA 1J3TA 1ZBJA 1G83A 1NLOC 1M27C 3NGPA 2M51A 1AWWA 1SEMA 4F17A 2SRCA 1W70A 1UECA 3UF4A 2E5KA 5I11A 2JS0A 3NMZC 2JXBA 2NWMA 4DEXA 1ZUUA 3PVLA 4Z8AA 3VS6A 3I5SA 2DL7A 2AZSA 1RLPC 2GNCA 5EC7A 2KRNA 4OMNA 3GBQA 4J9BA 4IIOA 4AG1C 4ESRA 1WFWA 1OV3A 5IHKA 4OMLA 1T3LA 2HDAA 2K79A 3JV3A 2A28A 2LMJA 1QLYA 2IIMA 5L23A 2A36A 3EGUA 2O31A 1K4US 2EBPA 1WYXA 4A63B 1YCSB 3QWYA 4HCKA 1WXBA 1YWPA 2MOXA 4OMQA 1QKWA 1HJDA 4KRTA 1QCFA 2J05A 2LZ6B 2X3WD 1LCKA 3I9QA 1PWTA 2YUQA 4JZ3A 1JQQA 1X2QA 2DVJA 2FRYA 5IXBA 1E6GA 1G2BA 1AD5A 2V1RA 3RNJA 3VS0A 2KNBB 2FO0A 3LH5A 1NLPC 2BTTA 1ZSGA 2VWFA 1GFDA 2O9VA 1YP5A 2RPNA 3NHNA 1T0HA 2D8JA 3M0PA 4AFUC 3M0UA 1ABOA 5GJVB 1SSHA 4RTVA 4QT7A 1KFZA 2CH4A 2RNAA 1S1NA 3EHRA 1SHGA 2DMOA 2LP5A 1AWXA 2RF0A 4GLMA 1VA7A 2LJ3A 4R0KA 2ENMA 3H0IA 5IXFA 1Y0MA 4E6RA 1VYVA 4JJDA 1U3OA 2JW4A 2OAWA 2YUOA 3UA6A 2CT3A 2CH4W 3TVTA 2A08A 2RQTA 4LUDA 2DBKA 1CKBA 1B07A 3THKA 1OOTA 1YNZA 4CC3A 1T3SA 2EGCA 2EYZA 3EG0A 1AZEA 5HCKA 1MUZA 2C0OA 2KROA 2HBWA 2L2PA 1BB9A 2F2WA 1NEBA 4HVVA 3VS7A 4X1VA 2DILA 2W10A 5FWBA 2FRWA 3RBBB 2O9SA 3A98A 2FPDA 1HD3A 3M0RA 1I1JA 1JU5C 2AKLA 2YSQA 4OMPA 3H0HA 5GJWB 2LCSA 1TG0A 2BZXA 4IIMA 2KR3A 2DA9A 2YT6A 2K6DA 2QDLA 1WXTA 2K7AA 1IO6A 1X69A 2LQWA 2PZ1A 3FJ5A 2HSPA 4RTWA 3TSWA 1SRMA 3UA7A 1M3BA 4JJBA 3REAB 3O5ZA 2CUDA 1PKTA 1AWJA 1YN8A 2EKHA 1SPKA 4M4ZA 2KT8A 1SRLA 2J06A 2CUBA 2DJQA 1WA7A 3EHQA 4HXJA 2KYMA 2DM1A 2SEMA 1UUEA 2W0ZA 2DYBA 2DF6A 2FEIA 2L3SA 1NYFA 4LN2A 4LE9A 4CC4B 1UGVA 4D8KA 1GRIA 1AWOA 2C0IA 1PRLC 1WX6A 2LJ1A 2O88A 2KBTA 2D0NA 2HEQA 2KEAA 2CDTA 2NUZA 4AFSC 4EIKA 3SEMA 4GBQA 3M0QA 1M8MA 1ZLMA 3H0FA 4RTUA 1H8KA 1YWOA 2GQIA 3C0CA 2DL8A 2JS2A 4CC2A 5ECAA 1H3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E6H A;  1V1C A;  4DEY A;  1BK2 A;  2K3B A;  2J7I A;  1PHT A;  2RQR A;  2AKK A;  4RUG A;  2YUP A;  1FYN A;  4RTT A;  1XOV A;  2BZ8 A;  2EQI A;  1BBZ A;  2M0Y A;  5I22 A;  2ROL A;  1AZG B;  1NYG A;  2OJ2 A;  1WI7 A;  2D1X A;  1RUW A;  1X6B A;  2DE0 X;  2DL4 A;  4J9F A;  2V1Q A;  3QWX X;  3R6N A;  2EYX A;  2RN8 A;  1HSQ A;  3I35 A;  1AEY A;  4F14 A;  3VS5 A;  4WCI A;  2FPF A;  1E7O A;  2GBQ A;  4ORZ A;  1I07 A;  4AFZ C;  1NEG A;  1ZX6 A;  2KRS A;  4RTX A;  3U23 A;  2DBM A;  1UDL A;  2ED1 A;  1BU1 A;  2J6K A;  2EGA A;  1GBQ A;  1Y57 A;  2DNU A;  1M30 A;  2F2X A;  2I0N A;  2D8H A;  2RQU A;  1NG2 A;  3VRZ A;  2KYB A;  2AZV A;  1KSW A;  1CKA A;  2C0T A;  4Z89 A;  4RTZ A;  3NPF A;  4OMO A;  2EYY A;  2KT1 A;  4Y92 A;  1GCQ A;  3VS4 A;  1PNJ A;  2KGT A;  1KIK A;  2GGR A;  4ZNX A;  1RI9 A;  1X6G A;  2ESW A;  1H92 A;  2KRM A;  4OMM A;  1Z9Q A;  2JTE A;  3KFV A;  4J9I A;  2JMA A;  2ABL A;  1WDX A;  4LNP A;  1M3C A;  1JO8 A;  1Z9Z A;  3EG2 A;  1FMK A;  2GTJ A;  1K0X A;  5IH2 A;  4D8D A;  3VRY A;  3VS1 A;  2FPE A;  2RQW A;  1GL5 A;  3PVQ A;  1EFN A;  3IQL A;  1X43 A;  1QKX A;  3TSZ A;  1K0S A;  1NM7 A;  1UJY A;  2JM8 A;  1TUC A;  2CRE A;  3PE0 A;  4J9E A;  1QWF A;  4JJC A;  2LQN A;  1WXU A;  2DRM A;  2GTO A;  2KE9 A;  5FW9 A;  2A37 A;  2DL3 A;  2L0A A;  1U06 A;  2J6O A;  2MCN A;  3UAT A;  2FG0 A;  1RLQ C;  1GFC A;  1UHC A;  4CC7 A;  1K76 A;  2F2V A;  2EGE A;  1T0J A;  2H8H A;  1UG1 A;  1UFF A;  4F16 A;  2AK5 A;  4LUE A;  2OI3 A;  4AG2 C;  1PKS A;  1GCP A;  3M0T A;  2YUN A;  1OPK A;  1U5S A;  2PNI A;  2EW3 A;  2J6F A;  1QWE A;  1GCQ C;  2KXD A;  1WLP B;  2LNH B;  3CQT A;  1TUD A;  1OEB A;  1UE9 A;  2ROT A;  1AVZ C;  2LX7 A;  2DL5 A;  3SHW A;  5IHI A;  2L3Q A;  1ABQ A;  1PRM C;  1UHF A;  3VS2 A;  2XMF A;  2VKN A;  1X27 A;  2BZY A;  4J9C A;  1VYT A;  1JEG A;  2VVK A;  5FWC A;  1ZUY A;  1A0N B;  1ARK A;  1M3A A;  4K11 A;  2G6F X;  1W6X A;  1MV0 B;  3REB B;  2K9G A;  2EPD A;  3ULR B;  3I5R A;  4FSS A;  2HCK A;  4J9H A;  1W1F A;  2EVR A;  2DLP A;  1UJ0 A;  1KJW A;  1SHF A;  1VYU A;  1JXM A;  1X2K A;  1CSK A;  1WIE A;  2JMC A;  1UTI A;  1K9A A;  2CT4 A;  4J9G A;  1GBR A;  4HVW A;  2KXC A;  4AFQ C;  1B3Q A;  1ZUK A;  2K2M A;  2LJ0 A;  2B86 A;  2RMO A;  4JZ4 A;  3H41 A;  2P4R A;  1MV3 A;  2MIO A;  1K1Z A;  4Z88 A;  1I0C A;  2YDL A;  2O2O A;  1AOJ A;  2EYW A;  3EG3 A;  4JPB W;  3ZL7 C;  1OPL A;  2JM9 A;  2PTK A;  2DRK A;  3EG1 A;  4J9D A;  4RTY A;  2CSQ A;  2JT4 A;  2RQV A;  2DX1 A;  2X3X D;  3VS3 A;  2CSI A;  1N5Z A;  5IHN A;  2L3P A;  3M0S A;  2ECZ A;  1JXO A;  2ED0 A;  4HVU A;  1J3T A;  1ZBJ A;  1G83 A;  1NLO C;  1M27 C;  3NGP A;  2M51 A;  1AWW A;  1SEM A;  4F17 A;  2SRC A;  1W70 A;  1UEC A;  3UF4 A;  2E5K A;  5I11 A;  2JS0 A;  3NMZ C;  2JXB A;  2NWM A;  4DEX A;  1ZUU A;  3PVL A;  4Z8A A;  3VS6 A;  3I5S A;  2DL7 A;  2AZS A;  1RLP C;  2GNC A;  5EC7 A;  2KRN A;  4OMN A;  3GBQ A;  4J9B A;  4IIO A;  4AG1 C;  4ESR A;  1WFW A;  1OV3 A;  5IHK A;  4OML A;  1T3L A;  2HDA A;  2K79 A;  3JV3 A;  2A28 A;  2LMJ A;  1QLY A;  2IIM A;  5L23 A;  2A36 A;  3EGU A;  2O31 A;  1K4U S;  2EBP A;  1WYX A;  4A63 B;  1YCS B;  3QWY A;  4HCK A;  1WXB A;  1YWP A;  2MOX A;  4OMQ A;  1QKW A;  1HJD A;  4KRT A;  1QCF A;  2J05 A;  2LZ6 B;  2X3W D;  1LCK A;  3I9Q A;  1PWT A;  2YUQ A;  4JZ3 A;  1JQQ A;  1X2Q A;  2DVJ A;  2FRY A;  5IXB A;  1E6G A;  1G2B A;  1AD5 A;  2V1R A;  3RNJ A;  3VS0 A;  2KNB B;  2FO0 A;  3LH5 A;  1NLP C;  2BTT A;  1ZSG A;  2VWF A;  1GFD A;  2O9V A;  1YP5 A;  2RPN A;  3NHN A;  1T0H A;  2D8J A;  3M0P A;  4AFU C;  3M0U A;  1ABO A;  5GJV B;  1SSH A;  4RTV A;  4QT7 A;  1KFZ A;  2CH4 A;  2RNA A;  1S1N A;  3EHR A;  1SHG A;  2DMO A;  2LP5 A;  1AWX A;  2RF0 A;  4GLM A;  1VA7 A;  2LJ3 A;  4R0K A;  2ENM A;  3H0I A;  5IXF A;  1Y0M A;  4E6R A;  1VYV A;  4JJD A;  1U3O A;  2JW4 A;  2OAW A;  2YUO A;  3UA6 A;  2CT3 A;  2CH4 W;  3TVT A;  2A08 A;  2RQT A;  4LUD A;  2DBK A;  1CKB A;  1B07 A;  3THK A;  1OOT A;  1YNZ A;  4CC3 A;  1T3S A;  2EGC A;  2EYZ A;  3EG0 A;  1AZE A;  5HCK A;  1MUZ A;  2C0O A;  2KRO A;  2HBW A;  2L2P A;  1BB9 A;  2F2W A;  1NEB A;  4HVV A;  3VS7 A;  4X1V A;  2DIL A;  2W10 A;  5FWB A;  2FRW A;  3RBB B;  2O9S A;  3A98 A;  2FPD A;  1HD3 A;  3M0R A;  1I1J A;  1JU5 C;  2AKL A;  2YSQ A;  4OMP A;  3H0H A;  5GJW B;  2LCS A;  1TG0 A;  2BZX A;  4IIM A;  2KR3 A;  2DA9 A;  2YT6 A;  2K6D A;  2QDL A;  1WXT A;  2K7A A;  1IO6 A;  1X69 A;  2LQW A;  2PZ1 A;  3FJ5 A;  2HSP A;  4RTW A;  3TSW A;  1SRM A;  3UA7 A;  1M3B A;  4JJB A;  3REA B;  3O5Z A;  2CUD A;  1PKT A;  1AWJ A;  1YN8 A;  2EKH A;  1SPK A;  4M4Z A;  2KT8 A;  1SRL A;  2J06 A;  2CUB A;  2DJQ A;  1WA7 A;  3EHQ A;  4HXJ A;  2KYM A;  2DM1 A;  2SEM A;  1UUE A;  2W0Z A;  2DYB A;  2DF6 A;  2FEI A;  2L3S A;  1NYF A;  4LN2 A;  4LE9 A;  4CC4 B;  1UGV A;  4D8K A;  1GRI A;  1AWO A;  2C0I A;  1PRL C;  1WX6 A;  2LJ1 A;  2O88 A;  2KBT A;  2D0N A;  2HEQ A;  2KEA A;  2CDT A;  2NUZ A;  4AFS C;  4EIK A;  3SEM A;  4GBQ A;  3M0Q A;  1M8M A;  1ZLM A;  3H0F A;  4RTU A;  1H8K A;  1YWO A;  2GQI A;  3C0C A;  2DL8 A;  2JS2 A;  4CC2 A;  5ECA A;  1H3H A; 
#chains in the Genus database with same CATH topology
 3EFO A;  1IRX A;  3DB3 A;  9ATC B;  1YIJ Q;  2AKK A;  2DZ9 A;  3RMQ A;  1KD1 C;  1MMG A;  2RB6 A;  3CCJ T;  4RTT A;  1RI0 A;  2EJ9 A;  1C0M A;  1ZSZ B;  3G6E Q;  1K73 R;  4NOY A;  4KBM B;  4Y91 A;  1M4Z A;  3OYJ A;  3C95 A;  1EZZ B;  4XAX B;  1KC8 U;  4J7F A;  2DE0 X;  1B34 B;  2V1Q A;  2Y4Y A;  3O8V A;  2D0Q B;  4F14 A;  3TCJ A;  4WCI A;  2MWP A;  1BI2 A;  1K9M C;  3CCQ Q;  1NEG A;  2COY A;  1ZX6 A;  2KRS A;  4RTX A;  1UDL A;  2FVU A;  1IRE B;  2J6K A;  4B6M A;  1YIT A;  2DXB A;  1Y57 A;  4ANJ A;  5CR2 A;  4QQG A;  2DNU A;  4M7A A;  5LJ5 e;  1YIJ A;  1VQ8 T;  2KYB A;  4MMK A;  4Z89 A;  3TU4 K;  2COW A;  4RTZ A;  1M90 U;  3NPF A;  4OMO A;  3CME T;  2KT1 A;  3SWN B;  3TQ7 P;  2JTM A;  3QYH B;  3RIR A;  3L2W A;  2LNV A;  1RI9 A;  4PK4 A;  3H8Z A;  2KRM A;  5GAN h;  4ZTJ A;  2V8I A;  3KFV A;  2ABL A;  1FMW A;  4LNP A;  1M3C A;  1VQL Q;  1Z9Z A;  1VIF A;  5J26 A;  2XK0 A;  1KHC A;  5GAN j;  1X43 A;  4FIB A;  2JM8 A;  2CRE A;  4J9E A;  4WF2 A;  3F70 A;  3H9N A;  3M55 A;  4JJC A;  4M77 B;  3MKD A;  3JB9 D;  3VU3 C;  2GTO A;  2KE9 A;  3CCL T;  2LX9 A;  1XQH A;  5GAM d;  2MCN A;  3UAT A;  5J3B A;  1RLQ C;  1GFC A;  4CC7 A;  2F2V A;  2EGE A;  2OI3 A;  4F7U E;  1GCP A;  1QVF S;  3M0T A;  2BE9 B;  2PNI A;  2FZK B;  1I4K 1;  1WJQ A;  3CD6 Q;  1WLP B;  2CZ1 B;  3CCV T;  1OEB A;  5GAO n;  4PJN A;  1M2V B;  4RKU E;  2L3Q A;  3CC4 Q;  2WSC E;  2YLC A;  1VYT A;  2VV5 A;  2M9U A;  5KE2 A;  1ZUY A;  2P0K A;  4XTV A;  3BDU A;  1A0N B;  5KYX B;  5GAN g;  2L8D A;  1WPY A;  1IHW A;  5GAN 7;  1W6X A;  2GFA A;  5KCO A;  1OUL A;  4KUI A;  4PJO E;  4IUT A;  3I5R A;  4KH1 B;  4JS4 A;  2NUT A;  3JCM W;  2KK4 A;  2JMC A;  5D6X A;  4M7D G;  1UTI A;  4X34 A;  1QP2 A;  4M7D C;  4HVW A;  4AFQ C;  5GMK i;  3CC4 A;  2E5Q A;  3QDR B;  3MP6 A;  4ATO A;  2LJ0 A;  2B86 A;  4M77 E;  1VQP A;  1I0C A;  4N4I A;  2OTL T;  3HRU A;  5GAN 3;  4QW2 A;  3RDV A;  3CCE Q;  3EG1 A;  4RTY A;  4IUV A;  2JT4 A;  1BCM A;  2CSI A;  1N5Z A;  2HD0 A;  3CC7 Q;  3CPW S;  5FU7 C;  4QVZ A;  3NFC A;  2RD1 A;  3VYG A;  3L1A A;  4BY6 C;  2QQA A;  3CC2 T;  1OYX A;  3A1P A;  2RHY A;  1KC8 C;  1AWW A;  2V8J A;  1BKB A;  1VQ7 T;  4J6Y A;  4C8Q G;  1WHK A;  2QDY B;  2WSF E;  4C8Q C;  2Y90 A;  1YJ9 T;  3RKY A;  1JB0 E;  4Z8A A;  3I5S A;  4DBQ A;  3M5A A;  5LL6 S;  2GNC A;  5EC7 A;  3GBQ A;  4J9B A;  3E9F A;  2EFI A;  4FYY B;  2QK0 A;  4M75 B;  3X20 B;  4F04 B;  4M7D A;  4OML A;  3A8L B;  2K79 A;  2A28 A;  1OX8 A;  4TVR A;  3S6W A;  2XDP A;  1K8A U;  1WGS A;  3OS0 A;  1M90 C;  3DLL A;  3HFN A;  1Y96 A;  5L23 A;  4EMK A;  2A0F B;  3S3O A;  1YI2 T;  3PNW C;  2EBP A;  3CC7 A;  1WYX A;  4QQ6 A;  1YCS B;  3QWY A;  3HL8 A;  1YWP A;  3NTI A;  4F7U F;  2MOX A;  3OY9 A;  1HJD A;  3JCM b;  4HCB A;  3OA6 A;  1N9S A;  4VUB A;  4M78 D;  4XTZ A;  1PM3 A;  3MEA A;  1N8R U;  2RO0 A;  2GCX A;  2DVJ A;  2PQW A;  3E19 A;  3LH0 A;  5CCA A;  1G2B A;  2EJF A;  3M57 A;  3RNJ A;  4C8Q A;  1MMN A;  3X25 B;  1NLP C;  3OMC A;  2BTT A;  1ZSG A;  3V7S A;  2DEQ A;  3HTR A;  1YP5 A;  3NHN A;  1T0H A;  4AFU C;  3EGD A;  2DTO A;  1ABO A;  4C0D B;  4OGC A;  1QVG S;  1SSH A;  1VQO Q;  1RAF B;  4EMH A;  4FYX B;  2MYS A;  3EHR A;  4PJO F;  1SHG A;  2DMO A;  2K5I A;  1JJ2 A;  5CKF A;  1AWX A;  5GAM h;  2LJ3 A;  4JRP A;  4NL2 A;  1W2B S;  3OYA A;  3OQ5 A;  1KQS A;  2DXU A;  4Z02 A;  2OAW A;  3UA6 A;  2DXC A;  2CT3 A;  3RUX A;  1HYO A;  1TTH B;  3TVT A;  5LJ5 d;  3JCM e;  2A08 A;  4PL6 A;  1TOV A;  2DBK A;  4LUD A;  2CZ6 B;  4QQD A;  1W2B A;  2EQK A;  1Q86 C;  3BE3 A;  5KH6 A;  4LXC A;  4M75 E;  1MHN A;  1WHM A;  4BI3 A;  3OYE A;  1UEB A;  5HCK A;  4M77 F;  4C5H A;  1NEB A;  1KQ1 A;  3CME Q;  1NJI U;  5FWB A;  1BI0 A;  3HHT B;  3FRN A;  3RBB B;  1VQO A;  2FPD A;  2QA4 T;  1MND A;  2AKL A;  1BIA A;  2YSQ A;  4X9C A;  4OMP A;  4E7J A;  2HQX A;  2BZX A;  3HRS A;  3QZ9 B;  1KHI A;  4M78 A;  2KR3 A;  4LDX A;  1S72 A;  1Q7Y R;  1WXT A;  2K7A A;  1IO6 A;  2E3H A;  3NTH A;  3V7R A;  2NUP B;  4RTW A;  3TSW A;  5I2S A;  2D6F A;  3UA7 A;  1D0Z A;  4JJB A;  1BIB A;  1QQJ A;  2CUD A;  4A53 A;  3GPL A;  1VQ4 A;  1I81 A;  1YN8 A;  1SPK A;  4M4Z A;  1VOM A;  3MJX A;  2HSE B;  3E2U A;  3LYI A;  2J06 A;  4PLL A;  4KGZ B;  4A4K A;  1RAB B;  3EHQ A;  4E7Z A;  2KYM A;  1H64 1;  4OB3 B;  1QCN A;  5GAN f;  1Q95 G;  3GNF B;  4DA4 A;  5GAO q;  1IGU A;  2M1H A;  3KUF A;  4D8K A;  3OYK A;  2VXE A;  3VKI A;  3C12 A;  2JTF A;  2D0N A;  4N0A A;  2CDT A;  2NUZ A;  4IKF A;  4GBQ A;  1Q81 U;  3EH1 A;  2VXF A;  4RTU A;  2GQI A;  3C0C A;  2DL8 A;  4BUG A;  2QAZ A;  1NZ9 A;  6AT1 B;  1E6H A;  2AT1 B;  1G3W A;  1BK2 A;  1YJW A;  2J7I A;  2DFU A;  3OYM A;  3HRT A;  5LJ3 j;  4FT2 A;  1SKU B;  2RJF A;  1PD0 A;  5A2Q E;  1XOV A;  3CCR A;  1LJO A;  3CCS A;  1BBZ A;  3P8H A;  2M0Y A;  1AZG B;  1D1A A;  1NYG A;  1Q82 R;  5FU6 B;  1BI1 A;  1RUW A;  3MP1 A;  2Z0W A;  3R6N A;  2RN8 A;  1HSQ A;  1Y07 A;  1AEY A;  1K8A C;  4ORZ A;  3V8K A;  5CQX A;  1Y71 A;  4J6W A;  1B7T A;  1Y7X A;  1IXD A;  2EGA A;  2FYK A;  3SD4 A;  2MK5 A;  1VQN Q;  2CGH A;  4XQ3 A;  2F2X A;  1M5Q 1;  4JLG A;  1NG2 A;  2AZV A;  2ZPB B;  4HCZ A;  3X28 B;  2C0T A;  3PMT A;  1VQ5 T;  2YRD A;  4LDW A;  5CKE A;  5GMK m;  2EYY A;  4FU6 A;  1D0Y A;  3OYB A;  3HP9 A;  5CKH A;  1GCQ A;  2ZCF B;  4J8O A;  4N4G A;  1KD1 R;  1N8R C;  1KIK A;  4BDZ A;  4XTX A;  2LQ8 A;  5GAO m;  4PJO D;  3MPU B;  2X51 A;  4E7H A;  1LPL A;  4J9I A;  2JMA A;  3I56 T;  1ACM B;  3MEV A;  3JCM V;  2RI3 A;  1JO8 A;  3GLX A;  2ZPE B;  1PG5 B;  1YJN Q;  1FMK A;  1K0X A;  5CK9 A;  5LJ3 e;  5IH2 A;  1M1K U;  3UDC A;  4C92 B;  2RQW A;  1K9M R;  1VQN A;  1QKX A;  1VQ7 Q;  3TSZ A;  5GMK e;  1RL2 A;  1K0S A;  3SB2 A;  1UJY A;  4E2F B;  3EFS A;  1QWF A;  4M77 D;  1B34 A;  2G3R A;  1WQ7 A;  2DRM A;  3N5B B;  5FW9 A;  1VQ9 Q;  4XTU A;  2DL3 A;  1G3Y A;  5LJ5 h;  3BW1 A;  3M9Q A;  1ZQ1 A;  5GAN 5;  1KK7 A;  3JSC A;  2XDD A;  4MZM A;  4A4H A;  1K76 A;  2XD0 A;  3X26 B;  3RES A;  2H8H A;  1OZ2 A;  2AK5 A;  3CMA T;  1NJI C;  1YJN A;  2E12 A;  4YTL A;  1QWE A;  3JCM f;  3QKJ A;  1UE9 A;  4BI4 A;  1AVZ C;  5HKC A;  5IHI A;  3SWN A;  2MPX C;  2QEX T;  3VS2 A;  1UGS B;  4J7I A;  2VKN A;  4DOW A;  3D7S B;  2RI2 A;  1VQ9 A;  3QJY A;  1ARK A;  1M3A A;  1WHJ A;  2DEU A;  5KYU B;  4K11 A;  3VJP A;  1MV0 B;  3REB B;  4F7U B;  2KSS A;  4DBR A;  2HCK A;  3PIP A;  1W1F A;  4J5Y A;  2FB7 A;  3TEE A;  1RAH B;  3G4S A;  1SHF A;  3QII A;  3FC3 A;  1X2K A;  3PTA A;  1YHQ Q;  2HKN A;  1EIF A;  1WIE A;  2K5L A;  4C92 E;  1GBR A;  2HQE A;  1ZUK A;  1NPR A;  2QTV A;  3G6E A;  2ZGW A;  1Q81 C;  2YWW A;  2RMO A;  1MV3 A;  4CI0 C;  5GAN 8;  1YBY A;  2GF7 A;  2IPO B;  3RER A;  3EG3 A;  3ZL7 C;  4PJO B;  1OPL A;  2IVW A;  4A4E A;  4O6J A;  2JZ2 A;  2RQV A;  1KG1 A;  2DX1 A;  1OU8 A;  2X3X D;  4UC4 A;  3CCQ A;  1BCO A;  4J83 A;  3VS3 A;  1SSF A;  1IB8 A;  1PSF A;  1JXO A;  3A5Z B;  1G83 A;  1N27 A;  1M27 C;  1M2V A;  2X4W A;  1H3Z A;  3BFM A;  1QW1 A;  1W70 A;  1YHQ A;  4FYW B;  2RHX A;  2HZY A;  3FDR A;  2JXB A;  2OTJ Q;  2K4Y A;  1JRI A;  2NWM A;  2OX7 A;  4DEX A;  5A0L A;  4LDU A;  1VQM T;  5KYX A;  2AZS A;  2KRN A;  4OMN A;  3E9G A;  3OYN A;  4AG1 C;  4ESR A;  2EQU A;  4M75 D;  1WFW A;  3G71 T;  5IHK A;  1D1C A;  3LWI A;  3FJP A;  3JV3 A;  3CCR T;  1SG5 A;  4M7A B;  3CCS T;  4KUL A;  4DOV A;  2MF2 A;  1VQL A;  1WJS A;  1QMC A;  3FEO A;  3M4G A;  4OMQ A;  2VB6 A;  4KRT A;  1QCF A;  3ASK A;  4RG2 A;  3RR6 A;  2L89 A;  3LWH A;  1KC8 R;  3I9Q A;  1PWT A;  3OS5 A;  3CXC P;  2R5M A;  5I2M A;  3WXM B;  1M1K C;  3QDF A;  1X2Q A;  5IXB A;  3KBG A;  1E6G A;  2K3Y A;  3CCU Q;  1AD5 A;  1VUB A;  3EG9 B;  2RK2 A;  2KNB B;  2DER A;  3LH5 A;  4FM4 B;  4C0F A;  3V8L A;  1GFD A;  2O9V A;  2RPN A;  2PUK B;  3M0P A;  4KGV B;  1UB4 A;  2XIC A;  5GJV B;  5GAN e;  4QVC A;  1KFZ A;  4FYV B;  2RNA A;  1WHH A;  1X75 C;  2LP5 A;  3G4S Q;  5LJ3 f;  3CD6 A;  2RF0 A;  3I55 Q;  1VA7 A;  1M90 R;  3H0I A;  1VYV A;  4LD6 A;  3CCM Q;  4E7L A;  2DD5 A;  2VGM A;  2JW4 A;  3C4S A;  4C0D C;  4M75 A;  2CH4 W;  1RAE B;  4E7K A;  4C92 F;  4L59 A;  5DLO A;  2E4H A;  4EMK C;  3G7Z A;  3VUZ A;  8ATC B;  4BAC A;  1X01 A;  3CCU A;  2EGC A;  3EG0 A;  2C0O A;  3SDZ A;  2HBW A;  1VQ6 T;  4HVV A;  2F2W A;  3M54 A;  2HKQ B;  1P92 A;  2CZ0 B;  5FRO A;  3J7A F;  2DIL A;  2QAS A;  4M7A E;  1LOJ A;  2FRW A;  2K57 A;  4PJL A;  2QGF B;  2DPP B;  2KI7 A;  2RJE A;  1I1J A;  5GAN 2;  2LCS A;  4BDY A;  2CZ7 B;  4IIM A;  3I55 A;  4PJM A;  5IT9 E;  3CCM A;  2K6D A;  2QDL A;  2PZ1 A;  2LQW A;  1RAI B;  3V8J A;  4HCC A;  1SRM A;  5CQY A;  5GMK l;  3UPU A;  1BI3 A;  3O5Z A;  2FZG B;  3DB4 A;  5KYN A;  1SRL A;  3JCM c;  3QXE B;  3BY7 A;  5KYY B;  3LLR A;  3PFS A;  5GAO l;  2CUB A;  2DJQ A;  3L2Q A;  3CCE A;  1WA7 A;  1R77 A;  1Q7Y U;  1Q86 R;  2DF6 A;  4MZT A;  4IUQ A;  1MNE A;  2FEI A;  4LE9 A;  3JB9 I;  3OSS C;  2C0I A;  3A8G B;  1PRL C;  1VQK Q;  1D1B A;  2O88 A;  2KBT A;  3EAE A;  2HEQ A;  2KEA A;  3AT1 B;  4EIK A;  3SEM A;  1PC0 A;  2LTO A;  1FWZ A;  1H8K A;  2K2V A;  1YIT T;  3G4S T;  1AT1 B;  1V1C A;  4DEY A;  2XKO C;  3MET A;  1YIJ T;  2RQR A;  3LGF A;  3OYH A;  5EG2 A;  2YUP A;  1BYM A;  5KYW B;  1JJ2 S;  1FYN A;  3CCJ Q;  3OS2 A;  4M78 G;  4J6X A;  3OW2 A;  4M78 C;  4NS5 A;  2JVV A;  1PD1 A;  2BZ8 A;  2EQI A;  4OP0 A;  1KQS S;  5I22 A;  1O9S A;  3HPW A;  2DL4 A;  4J9F A;  3QWX X;  2E6N A;  1VQK A;  3VS5 A;  3CCQ T;  1E7O A;  2GBQ A;  4M7D B;  3RKW A;  3OMG A;  1C6V X;  2DBM A;  2ED1 A;  5GAM j;  3JAM E;  5CIU A;  1Y96 B;  2MI6 A;  4Y28 E;  1QCO A;  3UT1 A;  4E7S A;  1Q82 U;  4C5E A;  2I0N A;  2D8H A;  2RQU A;  1VQ8 Q;  1CKA A;  2YRC A;  3CCJ A;  1WQW A;  2DIG A;  4C0Z A;  5D6Y A;  4LDY A;  5D7U A;  1QVF P;  4N0A C;  1PCX A;  2R5A A;  2GGR A;  4ZNX A;  4BY6 B;  4KH0 B;  3Q1J A;  4M7A F;  4KGX B;  1WNL A;  4OMM A;  1TU0 B;  1Z9Q A;  2Y4X A;  2JTE A;  2LQK A;  4C8Q B;  1WDX A;  3ER0 A;  2LT4 A;  3EG2 A;  4BE1 A;  7AT1 B;  1D3B B;  1I8F A;  4D8D A;  3LW5 E;  2BKD N;  1TUG B;  1M2O A;  3VS1 A;  1IHV A;  1TXQ A;  4C92 D;  1K8A R;  1R8O B;  1GL5 A;  2EKO A;  2DTH A;  1VQ8 A;  4GY5 A;  4XU2 A;  1TUC A;  2M16 A;  3OYG A;  2L3R A;  3QO3 A;  4MDW A;  4DBF A;  3CME A;  4A4G A;  2QQR A;  2A37 A;  3CCL Q;  2L0A A;  5GAM g;  2WAC A;  3QSU A;  1U06 A;  3A8H B;  3JCM Q;  3G71 Q;  4BB7 A;  2E70 A;  2FHD A;  3V7C A;  3OYY A;  2DO3 A;  1UFF A;  4F16 A;  2H3E B;  3OS1 A;  1JBM A;  4LUE A;  1N8R R;  4AG2 C;  4M7D E;  2YUN A;  2HBP A;  3UWN A;  4BE0 A;  2O4X A;  1UGP B;  2EW3 A;  1GCQ C;  2KXD A;  1N6A A;  1TUD A;  3OB9 A;  2V26 A;  1G3S A;  3CCV Q;  1QVP A;  2DL5 A;  3SHW A;  3CC4 T;  3L2R A;  2VUB A;  4DQ2 A;  3SFM A;  4O5V A;  4GLK A;  2X9H A;  4OF1 A;  2ZPH B;  2XMF A;  1X27 A;  3CPW P;  1VQP T;  3CCL A;  5FWC A;  2P4T A;  4ZN3 A;  5GMK h;  1I5L A;  5KE3 A;  4WTO B;  4PFO A;  5GAN d;  2CYZ B;  1ZSZ C;  2E6Z A;  2YLB A;  2K9G A;  2RM4 A;  3ULR B;  5GAO r;  4FSS A;  1ZHI A;  4J9H A;  2DVE A;  2EVR A;  2DLP A;  3QJ6 A;  4C8Q E;  2HAX A;  1X6O A;  1K73 U;  3OYC A;  3PGG A;  4JRK A;  1UJ0 A;  5DLQ E;  1KJW A;  1VYU A;  4E7I A;  1CSK A;  1LVK A;  4J9G A;  2KXC A;  1TH7 A;  1B3Q A;  3EGX A;  2K2M A;  3QHS A;  1UGR B;  4XU1 A;  3DLM A;  1DJ7 B;  2PVO B;  4JZ4 A;  3OW2 P;  3H41 A;  3VYH B;  4Z88 A;  5CKB A;  3QPH A;  2O2O A;  2JS2 A;  2OTL Q;  4FL6 A;  2CP3 A;  3CCE T;  1V76 A;  2PTK A;  3FB9 A;  2DRK A;  2DJZ A;  1C1A A;  3QUI A;  2CSQ A;  1WJR A;  1VQ6 Q;  4ZN1 A;  1ZA2 B;  3SWN C;  5IHN A;  3L2U A;  3CC7 T;  1OI1 A;  5CAI A;  2OAU A;  2ED0 A;  1NLO C;  2ZPG B;  3WVE B;  3CC2 Q;  1ZSZ A;  4PJO C;  1SEM A;  2QQB A;  1SF9 A;  2SRC A;  3RMS A;  2E5K A;  4R56 A;  3NMZ C;  3CXC A;  2WSE E;  1YJ9 Q;  5GAN 6;  4IUU A;  3PVL A;  2MMP A;  3VS6 A;  2QQ9 A;  2K3X A;  3GOX A;  2DL7 A;  1QVG P;  4FW2 A;  4JJN K;  3GIB A;  4IIO A;  4F7U A;  1OV3 A;  2OTL A;  1T3L A;  2HDA A;  2F1L A;  2EJG A;  1Q82 C;  4M77 G;  1YCY A;  2LMJ A;  1QLY A;  2CP0 A;  2IG0 A;  4M77 C;  4M7A D;  2IIM A;  5LJ5 j;  1HK9 A;  2A36 A;  3EGU A;  1YI2 Q;  2R57 A;  4HCK A;  4ZGE B;  1WXB A;  2JJ9 A;  3CC2 A;  4IUR A;  3JRZ A;  4C5I A;  1QKW A;  1R0B G;  4M7D F;  4XK8 E;  1VQ7 A;  1I5O B;  3S3N A;  2X3W D;  1YJ9 A;  2E1H A;  4FSX A;  2QG9 B;  4PJO A;  3MO8 A;  3MCA B;  4RCC A;  1KQ2 A;  3RKX A;  2FRY A;  3ZFJ A;  3M4Y A;  5J39 A;  2VWF A;  3VUB A;  3FLG A;  2D8J A;  3P8B B;  1VQO T;  3CBO A;  4RTV A;  1ZBX A;  2AHJ B;  1WHL A;  1YI2 A;  3INZ A;  3LGL A;  1RAC B;  3A8M B;  1M1G A;  4PJJ A;  2LC4 A;  4M77 A;  3C94 A;  2YHT A;  4C8Q F;  3JB9 J;  1S72 T;  4JJD A;  3NTK A;  3JCM d;  2VGN A;  1U3O A;  2F5T X;  2YUO A;  2DKG A;  4OVA A;  5LJ5 g;  1VQ4 T;  4NL3 A;  4PLI A;  2CS7 A;  2RQT A;  5DY9 A;  3MEW A;  1FXX A;  1YNZ A;  4CC3 A;  1WHG A;  3OYF A;  3EFO B;  2KRO A;  1NPP A;  2L2P A;  3JCM P;  1BB9 A;  2JNG A;  4ZTF A;  5GAM f;  1M1K R;  2W10 A;  3E1S A;  3A98 A;  2PU9 B;  1HD3 A;  2QA4 Q;  1JU5 C;  1AHJ B;  2EWN A;  3H0H A;  5GJW B;  1TG0 A;  2DA9 A;  2YXY A;  2NYS A;  1X69 A;  3FJ5 A;  4A4F A;  4XTW A;  5IN1 A;  4JUV A;  2RH2 A;  3EG9 A;  2P84 A;  3L2V A;  1AWJ A;  1FX7 A;  1K73 C;  1YJW T;  2EKH A;  2BE7 D;  4D6W A;  4PFZ A;  2HNI A;  2K5F A;  5A0G A;  1G5V A;  4P5N A;  5AT1 B;  4M78 F;  3JB9 G;  2L5Q A;  3AHU A;  4C5G A;  4M75 G;  4KT0 E;  2W0Z A;  3ME9 A;  4M75 C;  2QA4 A;  2L3S A;  3QYG B;  4L5G A;  4MZP A;  2ZZD A;  1UGV A;  1AWO A;  4BE2 A;  4OB1 B;  1O75 A;  2F69 A;  2OTJ A;  3FIF A;  2VAS A;  4II1 A;  4L6V 5;  4X1V A;  3OYI A;  4CC2 A;  3GP8 A;  1H3H A;  3OBY A;  2DK3 A;  1Q86 U;  2K3B A;  1PHT A;  4RUG A;  3DKM A;  1QVF A;  5HY6 A;  2DTI A;  1OU9 A;  5HK3 A;  2FL7 A;  3T9N A;  4OB0 B;  2ROL A;  3M59 A;  2OJ2 A;  1VQP Q;  1WI7 A;  3KXT A;  2D1X A;  1X6B A;  4EPC A;  1OX9 A;  2EYX A;  3I35 A;  2KDS A;  2FPF A;  2MAM A;  4DBH A;  1I07 A;  4M7D D;  4AFZ C;  3QG1 A;  5L8R E;  3U23 A;  3JCM X;  1N9R A;  1BU1 A;  5KYY A;  1GBQ A;  2GFU A;  2RJC A;  1VQN T;  4ELZ C;  1M30 A;  2QXF A;  3VRZ A;  2CKK A;  2E65 A;  1KSW A;  4XTY A;  2B8A A;  1VQ5 Q;  2RI5 A;  2BIV A;  4LD9 K;  4V2S A;  4Y92 A;  3TRE A;  3VS4 A;  1PNJ A;  4B9X A;  2KGT A;  4EMG A;  1PSE A;  1XTD A;  5GAN 4;  3CPF A;  1X6G A;  5I21 A;  2ESW A;  1H92 A;  4AMC A;  5LJ3 d;  3L2Z A;  2RA2 A;  4CRI A;  1U1S A;  4C8Q D;  3I56 Q;  1M9S A;  1YJN T;  2HMA A;  2RHU A;  2GTJ A;  3OSV A;  3R6O A;  4ELY C;  5KYW A;  2QTX A;  2YRV A;  3VRY A;  2C06 A;  4OGE A;  2X4X A;  2FPE A;  5A0D A;  3PVQ A;  1EFN A;  3IQL A;  2NUT B;  4JRQ A;  1NM7 A;  2EIF A;  2LCC A;  3CPW A;  3PE0 A;  1VQ5 A;  3JCM h;  1VQ9 T;  2HL3 A;  2LQN A;  1WXU A;  4HT9 A;  3P8D A;  4HA8 A;  4OMF B;  2X35 A;  2XDB A;  2J6O A;  2FG0 A;  1UGQ B;  1UHC A;  3HSB A;  3J81 E;  1F1B B;  1T0J A;  4JS5 A;  1UG1 A;  1EX4 A;  2KAF A;  4X9D A;  1PKS A;  3I56 A;  3CMA Q;  4A54 A;  2HQH A;  4RG8 A;  1OPK A;  4MML A;  1U5S A;  3OW2 S;  3JB9 H;  4RMO A;  2J6F A;  5C6S A;  3CQT A;  2LNH B;  5HK0 A;  2DYI A;  2KY9 A;  2ROT A;  1W4S A;  3G1J A;  5M9O A;  1G3T A;  2NLU A;  2LX7 A;  5CO7 A;  5LJ5 f;  5FLX E;  1ABQ A;  3G6E T;  2E41 A;  2RK1 A;  2E64 A;  2QEX Q;  1PRM C;  3WVD B;  1UHF A;  2XID A;  4PNO A;  3PIO A;  2LDM A;  2BZY A;  4J9C A;  1JEG A;  1IGQ A;  2VVK A;  3QZ5 B;  3LX7 A;  2EYQ A;  3JCM J;  1NBE B;  4RCB A;  1OQK A;  2NUP A;  1G8X A;  2G6F X;  2DIQ A;  1D3B A;  2JN0 A;  2EPD A;  2EQM A;  4B9W A;  2CP6 A;  4OB2 B;  3CMA A;  4Q5W A;  5FU6 C;  2H3J A;  3CBP A;  2QI2 A;  2DAQ A;  4EMK B;  1YHQ T;  1JXM A;  4PKC C;  4ZGJ B;  2GQV A;  2RHZ A;  4BI8 B;  1K9A A;  3JCM g;  1S72 Q;  2CT4 A;  1QVG A;  5AYF A;  1D0X A;  4E47 A;  2EAY A;  2MWO A;  2QEX A;  2CP2 A;  1TSF A;  1VQ4 Q;  5CKD A;  2P4R A;  2MIO A;  2VC8 A;  1K1Z A;  5FU7 B;  3VV0 A;  1TWB A;  2DET A;  1AOJ A;  2EYW A;  4JPB W;  2JM9 A;  2M0O A;  4J9D A;  3H6Z A;  2DD4 A;  5C0M A;  2EQJ A;  1VQL T;  4IUP A;  2L3P A;  3M0S A;  3EH2 A;  2PUO B;  2ECZ A;  4XU0 A;  4HVU A;  1J3T A;  1ZBJ A;  2ZPI B;  3EGD B;  3NGP A;  2M51 A;  3X24 B;  1D09 B;  4F17 A;  2A7Y A;  4HT8 A;  2ZAE A;  3URG A;  1UEC A;  1KD1 U;  3UF4 A;  5I11 A;  2JS0 A;  2OTJ T;  3CEY A;  3ZEH A;  3ZBD A;  4C0G A;  1ZUU A;  2X4Y A;  4R55 A;  4FT4 A;  4LDV A;  1M1F A;  2X4J A;  3MP8 A;  1VQM Q;  4HKE A;  1RLP C;  4C92 G;  3OYD A;  1XNI A;  4C92 C;  1YJW Q;  1V29 B;  3HKS A;  1U1T A;  5FRM A;  2QYZ A;  5GAM e;  1K9M U;  2M02 A;  3CCR Q;  2A3L A;  3M56 A;  2E10 A;  3CCS Q;  5FRN A;  2FZC B;  1HXD A;  2O31 A;  2QGG A;  1K4U S;  4A63 B;  2QQS A;  1R0C B;  4ME7 A;  3CD6 T;  2KMT A;  2XHC A;  4XU3 A;  2HL5 C;  3MHX A;  3OBW A;  2DZC A;  1NE8 A;  2J05 A;  2LZ6 B;  4N4H A;  3EFR A;  5IAY A;  2KQW A;  5LJ3 h;  1LCK A;  4QVD A;  4M78 B;  1ZA1 B;  1OZ3 A;  2YUQ A;  1VQM A;  3L42 A;  2LVM A;  4JZ3 A;  1JQQ A;  2LRQ A;  3CCU T;  3OYL A;  2JOY A;  2V1R A;  3VS0 A;  1RAD B;  3G71 A;  2FO0 A;  4EDU A;  2JUF A;  1M8V A;  3M0U A;  4C92 A;  3GNG A;  4QT7 A;  1Q7Y C;  5GMK j;  2ATC B;  1RAA B;  2CH4 A;  5CVI A;  1U8R A;  2LCL A;  1S1N A;  3QBY A;  3I55 T;  4F7U G;  2DXT A;  4GLM A;  2VYT A;  4R0K A;  2ENM A;  5IXF A;  4BD3 A;  3CCV A;  1Y0M A;  4E6R A;  1MMD A;  3CCM T;  1NJI R;  4PFP A;  2CP7 A;  5KCH A;  1GXI E;  1IZ6 A;  4JRI A;  2I2L A;  1VIE A;  8AT1 B;  5GAO p;  2E3I A;  3HFO A;  2RHI A;  3PMI A;  2PVD B;  1CKB A;  2XI9 A;  1B07 A;  3THK A;  1LNX A;  3MEU A;  1OOT A;  2AIR B;  1T3S A;  2D9T A;  2O4X B;  2EYZ A;  1AZE A;  2O01 E;  1MUZ A;  3CBM A;  4KUD K;  4FCY A;  4ZGD B;  3JB9 F;  3VS7 A;  4AT1 B;  1RAG B;  3CXC S;  4M75 F;  2XG8 D;  2O9S A;  4JDS A;  4PJO G;  3M0R A;  4MDX A;  3M58 A;  2CP5 A;  1JJ2 P;  2PVG B;  1MMA A;  5LJ3 g;  2YT6 A;  3J80 E;  2HSP A;  2P0P A;  3M53 A;  2F5K A;  1WZO A;  3PT9 A;  1KQS P;  1M3B A;  3REA B;  5KYU A;  4M78 E;  1PKT A;  1MGQ A;  2BUD A;  4JLI A;  3A8O B;  2RJD A;  2KT8 A;  1W2B P;  2KVQ G;  1Q81 R;  1FMV A;  2COZ A;  4QKU A;  5D6W A;  4HXJ A;  1VQ6 A;  2DM1 A;  2SEM A;  1TS9 A;  5DM7 R;  1UUE A;  3EGX B;  2DYB A;  1NYF A;  4LN2 A;  2P0Q A;  4CC4 B;  1YFN A;  3BDL A;  1QP3 A;  1GRI A;  4M7A G;  2ZPF B;  4FW1 A;  1VQK T;  2R58 A;  1WX6 A;  2LJ1 A;  4M7A C;  2LT1 A;  3S3M A;  2V8K A;  1XJW B;  4AFS C;  3M0Q A;  3H0F A;  1M8M A;  1ZLM A;  2XU8 A;  1YWO A;  2YDL A;  1YIT Q;  3GF5 A;  5ECA A; 
#chains in the Genus database with same CATH homology
 1E6H A;  1V1C A;  4DEY A;  1BK2 A;  2K3B A;  2J7I A;  1PHT A;  2RQR A;  2AKK A;  4RUG A;  2YUP A;  1FYN A;  4RTT A;  1XOV A;  2BZ8 A;  2EQI A;  1BBZ A;  2M0Y A;  5I22 A;  2ROL A;  1AZG B;  1NYG A;  2OJ2 A;  1WI7 A;  2D1X A;  1RUW A;  1X6B A;  2DE0 X;  2DL4 A;  4J9F A;  2V1Q A;  3QWX X;  3R6N A;  2EYX A;  2RN8 A;  1HSQ A;  3I35 A;  1AEY A;  4F14 A;  3VS5 A;  4WCI A;  2FPF A;  1E7O A;  2GBQ A;  4ORZ A;  1I07 A;  4AFZ C;  1NEG A;  1ZX6 A;  2KRS A;  4RTX A;  3U23 A;  2DBM A;  1UDL A;  2ED1 A;  1BU1 A;  2J6K A;  2EGA A;  1GBQ A;  1Y57 A;  2DNU A;  1M30 A;  2F2X A;  2I0N A;  2D8H A;  2RQU A;  1NG2 A;  3VRZ A;  2KYB A;  2AZV A;  1KSW A;  1CKA A;  2C0T A;  4Z89 A;  4RTZ A;  3NPF A;  4OMO A;  2EYY A;  2KT1 A;  4Y92 A;  1GCQ A;  3VS4 A;  1PNJ A;  2KGT A;  1KIK A;  2GGR A;  4ZNX A;  1RI9 A;  1X6G A;  2ESW A;  1H92 A;  2KRM A;  4OMM A;  1Z9Q A;  2JTE A;  3KFV A;  4J9I A;  2JMA A;  2ABL A;  1WDX A;  4LNP A;  1M3C A;  1JO8 A;  1Z9Z A;  3EG2 A;  1FMK A;  2GTJ A;  1K0X A;  5IH2 A;  4D8D A;  3VRY A;  3VS1 A;  2FPE A;  2RQW A;  1GL5 A;  3PVQ A;  1EFN A;  3IQL A;  1X43 A;  1QKX A;  3TSZ A;  1K0S A;  1NM7 A;  1UJY A;  2JM8 A;  1TUC A;  2CRE A;  3PE0 A;  4J9E A;  1QWF A;  4JJC A;  2LQN A;  1WXU A;  2DRM A;  2GTO A;  2KE9 A;  5FW9 A;  2A37 A;  2DL3 A;  2L0A A;  1U06 A;  2J6O A;  2MCN A;  3UAT A;  2FG0 A;  1RLQ C;  1GFC A;  1UHC A;  4CC7 A;  1K76 A;  2F2V A;  2EGE A;  1T0J A;  2H8H A;  1UG1 A;  1UFF A;  4F16 A;  2AK5 A;  4LUE A;  2OI3 A;  4AG2 C;  1PKS A;  1GCP A;  3M0T A;  2YUN A;  1OPK A;  1U5S A;  2PNI A;  2EW3 A;  2J6F A;  1QWE A;  1GCQ C;  2KXD A;  1WLP B;  2LNH B;  3CQT A;  1TUD A;  1OEB A;  1UE9 A;  2ROT A;  1AVZ C;  2LX7 A;  2DL5 A;  3SHW A;  5IHI A;  2L3Q A;  1ABQ A;  1PRM C;  1UHF A;  3VS2 A;  2XMF A;  2VKN A;  1X27 A;  2BZY A;  4J9C A;  1VYT A;  1JEG A;  2VVK A;  5FWC A;  1ZUY A;  1A0N B;  1ARK A;  1M3A A;  4K11 A;  2G6F X;  1W6X A;  1MV0 B;  3REB B;  2K9G A;  2EPD A;  3ULR B;  3I5R A;  4FSS A;  2HCK A;  4J9H A;  1W1F A;  2EVR A;  2DLP A;  1UJ0 A;  1KJW A;  1SHF A;  1VYU A;  1JXM A;  1X2K A;  1CSK A;  1WIE A;  2JMC A;  1UTI A;  1K9A A;  2CT4 A;  4J9G A;  1GBR A;  4HVW A;  2KXC A;  4AFQ C;  1B3Q A;  1ZUK A;  2K2M A;  2LJ0 A;  2B86 A;  2RMO A;  4JZ4 A;  3H41 A;  2P4R A;  1MV3 A;  2MIO A;  1K1Z A;  4Z88 A;  1I0C A;  2YDL A;  2O2O A;  1AOJ A;  2EYW A;  3EG3 A;  4JPB W;  3ZL7 C;  1OPL A;  2JM9 A;  2PTK A;  2DRK A;  3EG1 A;  4J9D A;  4RTY A;  2CSQ A;  2JT4 A;  2RQV A;  2DX1 A;  2X3X D;  3VS3 A;  2CSI A;  1N5Z A;  5IHN A;  2L3P A;  3M0S A;  2ECZ A;  1JXO A;  2ED0 A;  4HVU A;  1J3T A;  1ZBJ A;  1G83 A;  1NLO C;  1M27 C;  3NGP A;  2M51 A;  1AWW A;  1SEM A;  4F17 A;  2SRC A;  1W70 A;  1UEC A;  3UF4 A;  2E5K A;  5I11 A;  2JS0 A;  3NMZ C;  2JXB A;  2NWM A;  4DEX A;  1ZUU A;  3PVL A;  4Z8A A;  3VS6 A;  3I5S A;  2DL7 A;  2AZS A;  1RLP C;  2GNC A;  5EC7 A;  2KRN A;  4OMN A;  3GBQ A;  4J9B A;  4IIO A;  4AG1 C;  4ESR A;  1WFW A;  1OV3 A;  5IHK A;  4OML A;  1T3L A;  2HDA A;  2K79 A;  3JV3 A;  2A28 A;  2LMJ A;  1QLY A;  2IIM A;  5L23 A;  2A36 A;  3EGU A;  2O31 A;  1K4U S;  2EBP A;  1WYX A;  4A63 B;  1YCS B;  3QWY A;  4HCK A;  1WXB A;  1YWP A;  2MOX A;  4OMQ A;  1QKW A;  1HJD A;  4KRT A;  1QCF A;  2J05 A;  2LZ6 B;  2X3W D;  1LCK A;  3I9Q A;  1PWT A;  2YUQ A;  4JZ3 A;  1JQQ A;  1X2Q A;  2DVJ A;  2FRY A;  5IXB A;  1E6G A;  1G2B A;  1AD5 A;  2V1R A;  3RNJ A;  3VS0 A;  2KNB B;  2FO0 A;  3LH5 A;  1NLP C;  2BTT A;  1ZSG A;  2VWF A;  1GFD A;  2O9V A;  1YP5 A;  2RPN A;  3NHN A;  1T0H A;  2D8J A;  3M0P A;  4AFU C;  3M0U A;  1ABO A;  5GJV B;  1SSH A;  4RTV A;  4QT7 A;  1KFZ A;  2CH4 A;  2RNA A;  1S1N A;  3EHR A;  1SHG A;  2DMO A;  2LP5 A;  1AWX A;  2RF0 A;  4GLM A;  1VA7 A;  2LJ3 A;  4R0K A;  2ENM A;  3H0I A;  5IXF A;  1Y0M A;  4E6R A;  1VYV A;  4JJD A;  1U3O A;  2JW4 A;  2OAW A;  2YUO A;  3UA6 A;  2CT3 A;  2CH4 W;  3TVT A;  2A08 A;  2RQT A;  4LUD A;  2DBK A;  1CKB A;  1B07 A;  3THK A;  1OOT A;  1YNZ A;  4CC3 A;  1T3S A;  2EGC A;  2EYZ A;  3EG0 A;  1AZE A;  5HCK A;  1MUZ A;  2C0O A;  2KRO A;  2HBW A;  2L2P A;  1BB9 A;  2F2W A;  1NEB A;  4HVV A;  3VS7 A;  4X1V A;  2DIL A;  2W10 A;  5FWB A;  2FRW A;  3RBB B;  2O9S A;  3A98 A;  2FPD A;  1HD3 A;  3M0R A;  1I1J A;  1JU5 C;  2AKL A;  2YSQ A;  4OMP A;  3H0H A;  5GJW B;  2LCS A;  1TG0 A;  2BZX A;  4IIM A;  2KR3 A;  2DA9 A;  2YT6 A;  2K6D A;  2QDL A;  1WXT A;  2K7A A;  1IO6 A;  1X69 A;  2LQW A;  2PZ1 A;  3FJ5 A;  2HSP A;  4RTW A;  3TSW A;  1SRM A;  3UA7 A;  1M3B A;  4JJB A;  3REA B;  3O5Z A;  2CUD A;  1PKT A;  1AWJ A;  1YN8 A;  2EKH A;  1SPK A;  4M4Z A;  2KT8 A;  1SRL A;  2J06 A;  2CUB A;  2DJQ A;  1WA7 A;  3EHQ A;  4HXJ A;  2KYM A;  2DM1 A;  2SEM A;  1UUE A;  2W0Z A;  2DYB A;  2DF6 A;  2FEI A;  2L3S A;  1NYF A;  4LN2 A;  4LE9 A;  4CC4 B;  1UGV A;  4D8K A;  1GRI A;  1AWO A;  2C0I A;  1PRL C;  1WX6 A;  2LJ1 A;  2O88 A;  2KBT A;  2D0N A;  2HEQ A;  2KEA A;  2CDT A;  2NUZ A;  4AFS C;  4EIK A;  3SEM A;  4GBQ A;  3M0Q A;  1M8M A;  1ZLM A;  3H0F A;  4RTU A;  1H8K A;  1YWO A;  2GQI A;  3C0C A;  2DL8 A;  2JS2 A;  4CC2 A;  5ECA A;  1H3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...