1PWTA

Thermodynamic analysis of alpha-spectrin sh3 and two of its circular permutants with different loop lengths: discerning the reasons for rapid folding in proteins
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
MGTGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermodynamic analysis of alpha-spectrin SH3 and two of its circular permutants with different loop lengths: discerning the reasons for rapid folding in proteins.
pubmed doi rcsb
molecule tags Circular permutant
molecule keywords ALPHA SPECTRIN
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1998-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1pwtA00
1WDXA 1M27C 1V1CA 1FYNA 2EVRA 2O88A 1CKBA 4J9BA 4GBQA 2DYBA 2CT3A 3RNJA 2BTTA 3UATA 3UA6A 1TG0A 1OEBA 4CC2A 1NG2A 4JZ4A 1AZGB 5GJVB 5IHIA 3VS7A 2CDTA 2RQVA 2RNAA 2L3PA 4RTYA 4CC7A 1Z9QA 1NLPC 4LNPA 2CH4A 2HEQA 4Y92A 1SEMA 4RTXA 5FWCA 1T0JA 1JQQA 2HSPA 1BU1A 2ROLA 2ECZA 3GBQA 2YT6A 1NLOC 3VS5A 4OMLA 3M0SA 5ECAA 2LCSA 2LQNA 2X3WD 4J9EA 1NM7A 4LN2A 3NHNA 1E7OA 1UJ0A 2LNHB 2MOXA 2O2OA 5IXBA 2DA9A 3SEMA 1TUCA 1T0HA 1HD3A 2KYBA 2FPFA 2KXCA 2J6FA 3KFVA 1KIKA 2YSQA 2H8HA 1QLYA 2AK5A 2KRMA 1FMKA 4WCIA 2EYYA 1M3BA 2V1QA 1WIEA 2JTEA 1T3LA 1GBRA 1YCSB 4RUGA 2DX1A 1PRLC 2F2VA 1ZUUA 4HVWA 1VYTA 2J7IA 2M51A 1B07A 2FRYA 3M0RA 2X3XD 1X43A 4QT7A 4AFQC 1U5SA 1A0NB 2AZSA 2K2MA 1MV3A 4M4ZA 3QWXX 2CH4W 2OJ2A 2VVKA 1UHCA 2PTKA 2DBMA 3TVTA 2DILA 3THKA 2ED1A 1QKXA 2A08A 2RMOA 1JO8A 2HBWA 4LUEA 2J6OA 1B3QA 1GCQA 1Y0MA 2L2PA 3C0CA 1K0XA 1PKSA 1G2BA 5HCKA 1UDLA 2JM8A 2L3SA 1AD5A 1AWXA 2GTOA 4IIOA 1X6GA 2D8JA 2GTJA 1CSKA 2CSIA 2EYWA 1AVZC 3I35A 1AWJA 2RN8A 4RTTA 3CQTA 1QWFA 3IQLA 3RBBB 1U06A 1WI7A 2JMAA 1W1FA 4E6RA 1JU5C 1GFDA 2JW4A 2A28A 1PRMC 2GNCA 1PKTA 1GFCA 3ZL7C 2FPDA 1AOJA 2DNUA 1QCFA 2YUNA 1AWOA 4RTWA 2PZ1A 3UF4A 1ZUKA 2A37A 3O5ZA 1NYFA 2SRCA 1E6GA 1VYUA 2JM9A 1AZEA 2CSQA 1K4US 2CREA 2A36A 4HXJA 2DL7A 1X6BA 1W70A 2IIMA 4GLMA 2HCKA 1OV3A 1MUZA 2ED0A 2F2XA 3H0FA 1WYXA 2DL5A 2EYZA 1RI9A 5IHNA 2CUBA 1VA7A 2KR3A 3VS0A 2KT8A 2DLPA 2P4RA 4JJDA 4A63B 2JS2A 2KROA 1GCPA 1ZLMA 2EQIA 2ESWA 1HJDA 5IH2A 2AKLA 1Z9ZA 4AFZC 1K0SA 3I5SA 3A98A 2KEAA 1LCKA 3EG2A 3UA7A 1ABOA 1K9AA 1RUWA 1AWWA 3M0PA 1OPKA 4AFUC 2VWFA 4EIKA 4D8DA 2RQWA 2JXBA 2W0ZA 4JZ3A 1I1JA 1JXMA 3NMZC 4J9DA 3TSZA 4ORZA 2DVJA 4RTZA 2GGRA 2K7AA 2LX7A 2BZ8A 4K11A 2LZ6B 4LE9A 2YUQA 4OMMA 1UECA 2YDLA 3H41A 1YNZA 1UG1A 2AKKA 2SEMA 2AZVA 1NEBA 1ZSGA 2DL3A 2CUDA 1YWPA 2FO0A 2DE0X 2NWMA 3EG0A 1H92A 1UE9A 3VS4A 1BBZA 1N5ZA 2W10A 1IO6A 2RF0A 4J9HA 2GQIA 2PNIA 3U23A 1T3SA 2O31A 1GRIA 2RQUA 4AG1C 4DEYA 4CC3A 2KRNA 4JJBA 3NGPA 1KJWA 4Z8AA 4FSSA 2D8HA 1PNJA 2G6FX 3EHRA 1WXBA 1M3AA 1GBQA 1NYGA 2KYMA 1QWEA 1BK2A 4OMPA 4F14A 1SHFA 1EFNA 1TUDA 1QKWA 1S1NA 4X1VA 3PVQA 5IXFA 2ENMA 1OOTA 2J06A 2L0AA 4OMNA 5FW9A 2DRMA 2KRSA 3VS1A 2RQTA 3EG1A 1W6XA 2EGCA 2GBQA 2K3BA 2VKNA 3I9QA 1WLPB 2XMFA 2YUOA 2KNBB 1ZX6A 1CKAA 4JPBW 2JT4A 2E5KA 2C0IA 4CC4B 3VRYA 5I22A 1UTIA 1H8KA 1M3CA 2J6KA 2LJ1A 3PVLA 4HVUA 1UUEA 1XOVA 2BZYA 4DEXA 5GJWB 2B86A 1YWOA 4JJCA 1H3HA 2ROTA 1SHGA 3R6NA 1VYVA 2O9VA 1SRMA 1RLPC 1PWTA 1WXTA 4F17A 3NPFA 1M30A 3H0HA 2CT4A 1UHFA 1KFZA 1I0CA 3I5RA 1WXUA 1X2QA 3TSWA 4AFSC 1HSQA 2FPEA 1BB9A 2C0TA 3M0UA 2L3QA 4OMOA 3VRZA 4RTUA 1E6HA 2DL4A 3H0IA 3EHQA 2DBKA 2KGTA 2KXDA 1YN8A 2FRWA 3FJ5A 3JV3A 1G83A 4RTVA 1WX6A 4J9FA 4AG2C 2DL8A 1K1ZA 2LJ0A 4HCKA 1GL5A 3LH5A 1WA7A 1GCQC 4J9CA 4J9IA 2EYXA 2V1RA 2DJQA 2OI3A 2D1XA 2JMCA 1MV0B 1PHTA 4ESRA 2LP5A 2EPDA 1SPKA 3VS2A 2EKHA 1UFFA 2NUZA 1I07A 1WFWA 5L23A 1SSHA 1NEGA 2KBTA 1U3OA 2K9GA 4D8KA 5IHKA 1ABQA 1YP5A 3REAB 5EC7A 3M0QA 4J9GA 3PE0A 2RQRA 2YUPA 2HDAA 1X2KA 2MIOA 1RLQC 2KT1A 3VS3A 2LJ3A 1ZUYA 2M0YA 4R0KA 1X27A 2FG0A 2BZXA 1K76A 2J05A 2EGEA 1X69A 4HVVA 3QWYA 4Z89A 4IIMA 1ARKA 2EBPA 1JXOA 1JEGA 2OAWA 2MCNA 2RPNA 1KSWA 1AEYA 1UGVA 2QDLA 4F16A 4Z88A 4OMQA 1UJYA 1M8MA 2EW3A 2DRKA 2FEIA 3REBB 5FWBA 2O9SA 2KE9A 2EGAA 1Y57A 2ABLA 3VS6A 2DMOA 2K6DA 3EG3A 3SHWA 2LMJA 1ZBJA 3EGUA 2DM1A 2C0OA 2F2WA 2JS0A 4LUDA 4KRTA 1OPLA 5I11A 3M0TA 4ZNXA 3ULRB 2DF6A 2K79A 2I0NA 1J3TA 2D0NA 2LQWA 1SRLA
chains in the Genus database with same CATH superfamily
1WDXA 3UT1A 2ZPGB 1V1CA 1LVKA 1Y96B 1RAAB 4N4HA 3OYMA 2Y4YA 2R58A 4J9BA 2DVEA 2K3YA 2K3XA 3RNJA 3UA6A 1TG0A 1OEBA 2DO3A 4M7AF 3PNWC 4LXCA 3CCJA 3TREA 2D9TA 2L3PA 5HKCA 4LNPA 1Q7YU 3BDUA 1JQQA 2HSPA 1KK7A 3QDRB 5CAIA 2ECZA 2YT6A 2YRVA 5ECAA 2EQUA 2LCSA 2LQNA 3JB9J 3JB9F 1NM7A 2PQWA 3NHNA 1E7OA 4JLIA 4A4HA 1UJ0A 2AIRB 2O2OA 1X01A 3G71A 1M1KU 4C92F 3P8HA 1T0HA 1HD3A 2KYBA 2QYZA 3HPWA 2J6FA 1VQKQ 1M90U 2PU9B 1KIKA 3EAEA 2YSQA 2H8HA 4C8QC 1FMKA 1N9SA 3VUBA 4N0AC 1Y7XA 2DKGA 2XKOC 2JTEA 1GBRA 1T3LA 4X34A 3CCJT 3URGA 2M51A 4XU1A 1D1AA 3CPWA 1RAHB 1YITA 2FRYA 5GAN7 2X3XD 1U5SA 4BY6C 4DOVA 3RERA 3CCEA 3QWXX 2VVKA 2L8DA 1K8AC 5FU7C 3X24B 3CD6Q 1VQ8A 1LJOA 2DBMA 3TVTA 3CCQQ 1QKXA 2K5IA 5C0MA 2RMOA 1JO8A 2HBWA 4B6MA 2ZPFB 2CYZB 3A5ZB 3C0CA 1K0XA 2L89A 4C92E 4FCYA 3RKYA 1OU9A 1BIAA 2RJEA 3NTIA 4EMHA 4IIOA 3G6EQ 5LJ5e 2HL5C 4V2SA 2KI7A 4AMCA 4M7AA 2QEXA 3CC4T 1QWFA 3IQLA 1PSEA 3RBBB 3CMEQ 1U06A 3CCVT 3CCVA 1W2BP 3OW2A 1RAIB 3CCET 1GFDA 1JRIA 1VQLQ 2A28A 3M56A 1PKTA 4IUUA 2FPDA 1WQWA 1AOJA 1FMWA 2MWOA 2R5MA 2PZ1A 2O4XB 3UF4A 1ZUKA 1NPRA 2SRCA 1E6GA 3GNGA 4ZN3A 3HP9A 1D1CA 4M7DB 1Y71A 1YHQT 2CREA 2DL7A 2LT1A 4RCBA 4M75G 1KD1R 2HCKA 3G71T 2F2XA 2E3HA 5LJ5j 4PJOC 2OTLT 5KCOA 2QQ9A 2RJCA 2DTHA 1KC8C 2CUBA 3OS1A 2KR3A 2QDYB 2P4RA 2DLPA 1FMVA 3EGDB 4A63B 4C8QD 3PFSA 1N8RR 3M4YA 4KGXB 3FJPA 1Z9ZA 4AFZC 4II1A 1K0SA 3EG9A 3P8DA 3RKWA 5GMKi 3EGXB 3I5SA 1OZ3A 4PK4A 1SSFA 2HMAA 1X6OA 4XK8E 1K9AA 3SFMA 3M0PA 5CO7A 3HFNA 2GQVA 2CZ7B 2QQSA 3DLLA 1M1FA 1Q81R 4C92C 1MMDA 1WHMA 4J9DA 3TSZA 2YRDA 3JCMd 1IZ6A 4HKEA 1RL2A 1WGSA 4K11A 4YTLA 3D7SB 2FB7A 3CXCP 3CCLQ 1GXIE 2EQJA 5GAN2 3I56A 2AKKA 2SEMA 3T9NA 2I2LA 3SD4A 3QBYA 2MPXC 2NWMA 3KBGA 1YJNA 3VS4A 3G71Q 2QA4Q 3G7ZA 1IO6A 2YXYA 3A8HB 4AG1C 3OYYA 4C8QA 2OAUA 2DXTA 5CKFA 4Z8AA 3RUXA 2P0KA 4FSSA 3OY9A 2D8HA 5A2QE 3EHRA 1WXBA 4KBMB 1M90C 1NYGA 3HL8A 1QWEA 1BK2A 5GAOq 2KDSA 4OMPA 4F14A 2QG9B 1QQJA 5GANj 4XTUA 4X1VA 2P84A 2ENMA 2DERA 2XK0A 4OMNA 2JVVA 1BI1A 2DRMA 2AT1B 4M77C 1G3SA 1TSFA 1NJIC 4PJOD 4M75B 1YI2Q 3DB4A 1N9RA 4HCZA 1Q7YC 4ELZC 2YUOA 2KNBB 1Q82U 1VQ6A 2JT4A 3LH0A 2C0IA 1H8KA 5FRNA 4R55A 4HCBA 1XOVA 2BZYA 3QJ6A 5GJWB 1YWOA 1M9SA 3CCQA 2ROTA 2XDBA 3JCMh 4VUBA 2NUPB 1I81A 3DLMA 3OYCA 1M30A 2ZZDA 1X2QA 2Z0WA 3TSWA 1HSQA 3QDFA 1I5LA 1K9MC 1BB9A 3CCUT 2C0TA 4M75A 1KQ2A 1VQNT 1VQMQ 2DL4A 3EHQA 3EH1A 5GMKe 1WX6A 2P4TA 1O75A 3LH5A 1Q81C 5FU6B 2KQWA 1D1BA 2PVOB 2RH2A 1I4K1 4ZGDB 2LP5A 2M16A 3CCRQ 3VS2A 1R77A 1NPPA 1PG5B 2KBTA 5KYUA 4ANJA 1ABQA 1VQ9T 4J9GA 2E65A 8ATCB 1VQLT 1XJWB 4NS5A 3V7SA 3G4ST 1Y96A 1ZUYA 3M53A 3MP6A 2YWWA 2PVDB 1K76A 2RHZA 1VQ9A 3ASKA 4Z89A 2YLBA 3QKJA 4IIMA 1YHQQ 4C92A 5GAMd 2EBPA 3MO8A 1JXOA 1JEGA 3HRUA 2OAWA 2MCNA 2K5FA 1QVGS 1VUBA 1UGVA 3O8VA 4C5GA 1Q86C 1G8XA 4C8QB 3M9QA 1M2OA 3GLXA 3HHTB 5CR2A 3S3MA 2DRKA 2FEIA 2FZCB 2O9SA 2EGAA 3PMTA 4M7AE 5KCHA 4J5YA 1PSFA 1FWZA 2QGFB 1O9SA 1W4SA 4A4GA 1VQ4A 2C0OA 1TS9A 3ULRB 4F7UA 2QTVA 3X20B 2BIVA 3CCUA 1G3YA 2O88A 1CKBA 5KYXB 4M75C 2E3IA 2RK1A 2HKQB 3KXTA 2CT3A 3ZBDA 2O4XA 3OB9A 3FDRA 5LJ5g 2ATCB 1K8AR 3OW2P 5GJVB 4GY5A 2RQVA 4XTZA 4CC7A 2EJ9A 5J3BA 2EWNA 2DTIA 3S6WA 2CH4A 3HRTA 3JB9H 4QVCA 3V8LA 1Y07A 2NUPA 1M1KC 4JRPA 2JOYA 1NLOC 2ZAEA 4UC4A 3HSBA 3VS5A 1JJ2S 4AT1B 3C94A 5C6SA 4LDYA 4RCCA 2LQKA 4JRQA 5IXBA 3VU3C 1TUCA 5GANg 3PGGA 4XTXA 1K9MR 1VQLA 3MEWA 2DEQA 3QIIA 2KXCA 3M5AA 1QP2A 1QVFA 3TU4K 4O5VA 3E2UA 2M1HA 4BD3A 2AK5A 2KRMA 3BFMA 3CCMT 3QSUA 2KMTA 3OS0A 2LCLA 2V1QA 1YCSB 5KYNA 3G6EA 4JS5A 4MMKA 4HVWA 1VYTA 2J7IA 5KE3A 4QT7A 1Q82C 2VXEA 4AFQC 4BDZA 5I2MA 1MV3A 4M4ZA 2Y4XA 4WF2A 3CCST 2CH4W 1C1AA 5KYUB 4XQ3A 1UHCA 2PTKA 2FYKA 4PJLA 2ED1A 4FW2A 4BB7A 4ELYC 3JCMV 4LUEA 1B3QA 3CPWS 1K8AU 2L2PA 5CQYA 1PKSA 4BE2A 3WVDB 1VQ4T 1UDLA 5FLXE 4Q5WA 1B34A 4KGVB 1AD5A 3HFOA 3RIRA 3ER0A 1AWXA 2FL7A 5A0LA 1LNXA 2NYSA 1VQ7A 1X6GA 2D8JA 2E1HA 2GTJA 2EYWA 1ZHIA 1AVZC 1AWJA 4M77F 4BI4A 3CMET 1HK9A 1NBEB 2DIQA 3CQTA 4M75D 1VQMT 4IUTA 1QP3A 1WI7A 3CC4Q 2JMAA 1W1FA 3UWNA 3QUIA 1OZ2A 5AYFA 1JU5C 1ZA2B 1PRMC 3P8BB 2HAXA 1YJ9Q 2FZGB 3MJXA 4E47A 3EFRA 2QXFA 2DNUA 3A8LB 2COWA 3PIPA 3OYIA 3OQ5A 3QYHB 2E4HA 2XI9A 2A37A 1NYFA 3FEOA 2LTOA 2D6FA 4J83A 1K4US 2GF7A 1WYXA 5KYXA 5LJ3f 3CMAQ 3JCMb 1QW1A 3OYDA 1QCNA 3G4SQ 2JS2A 5GAOn 1GCPA 1YIJA 2M02A 1KQSA 5LJ5d 2MI6A 2EQIA 2ESWA 1HJDA 4BE1A 5GAN4 2ZGWA 3CPWP 1UGPB 2FVUA 2HNIA 3TEEA 1S72T 2A3LA 4Y28E 3S3OA 3EG2A 2X35A 3UA7A 1ABOA 1MMGA 2VC8A 2CGHA 3SDZA 3LWIA 2VWFA 4EIKA 3I55A 1ZQ1A 4D8DA 2CP7A 4C5EA 2EYQA 2W0ZA 4M7AC 4JZ3A 3OMCA 4DBQA 1SG5A 2EKOA 5GAN6 1M2VA 4FYVB 3M59A 4FW1A 1JJ2A 1B7TA 2HL3A 2OX7A 4IKFA 4DBRA 4E7KA 1ZA1B 4IUQA 3GNFB 4OMMA 1MMAA 4J6WA 4PL6A 1NEBA 1P92A 2VXFA 4HCCA 1YWPA 3EG0A 2DE0X 1C0MA 4ZGEB 2DTOA 1WHLA 2W10A 2RF0A 2PNIA 3U23A 3CMEA 1T3SA 1GRIA 5GMKl 3EFSA 3LYIA 1KJWA 5CKHA 4CI0C 2DPPB 2G6FX 1VQKT 2RB6A 1GBQA 3UDCA 5GAMh 4R56A 3I56T 4L5GA 3V7RA 4A4KA 1JJ2P 1SHFA 5CVIA 2RO0A 4JRIA 1MGQA 1K73C 3PVQA 1YJ9A 1VQOA 1IREB 3R6OA 3EH2A 1YJWT 1YI2T 3GP8A 2X4XA 1W6XA 2EGCA 4Z02A 2VKNA 4HA8A 4PLLA 4F7UE 3CCSA 3I9QA 4L6V5 1ZX6A 4JPBW 9ATCB 2QEXQ 4MMLA 5I22A 4DA4A 2LJ1A 3PVLA 1UB4A 4DEXA 2B86A 4IUVA 4JJCA 3CC7A 1FXXA 4PJMA 3R6NA 1VYVA 2O9VA 1PWTA 1WXTA 3NPFA 4FT4A 3WXMB 2CT4A 1HXDA 1WXUA 2DFUA 2JJ9A 3CCSQ 4LDUA 1QVGP 2OTJQ 3JCMX 3HRSA 2FPEA 4OB1B 2JZ2A 2WSFE 4ME7A 4OMOA 3VRZA 1N8RC 1E6HA 4XU2A 1YN8A 4OB2B 4PFOA 1G83A 2HZYA 4C8QE 1Q86U 4AG2C 1LOJA 4RG2A 2LJ0A 4F7UF 1GL5A 4M77E 1MHNA 1VQPA 1GCQC 2EQMA 2EYXA 3VV0A 3UPUA 2DJQA 4X9DA 1MV0B 3PTAA 1PHTA 1SPKA 2DD5A 4M7DG 1UFFA 2CZ1B 4C0DB 5KYWB 2BE9B 4HT9A 1SSHA 4QKUA 2QEXT 1U3OA 2K9GA 1KC8U 2V26A 2QA4A 4EMKA 1MMNA 4DOWA 3PE0A 2EJGA 4PNOA 2RQRA 4FSXA 4E7JA 1EX4A 2ZPBB 1QVFP 2HDAA 4M7DF 2MIOA 1RLQC 1OYXA 3VS3A 2JTMA 4OB0B 4R0KA 2FG0A 4FM4B 5GANe 5D6YA 1RI0A 1WQ7A 4EDUA 2HD0A 1ZSZB 3MCAB 3QWYA 4E2FB 2X4YA 4N4IA 2F1LA 2COYA 1BCOA 1KSWA 1IGQA 2IG0A 3META 1XTDA 5FWBA 2KE9A 4DQ2A 2IVWA 5LJ5h 4Y91A 1W2BA 1MNEA 1K9MU 4J7IA 1RAEB 3EG3A 1C6VX 4M7DE 2LMJA 2CP6A 2CZ0B 3EGUA 3QYGB 2JS0A 4LUDA 3OYFA 4KRTA 3EFOB 4ZNXA 2K79A 1BI0A 3ZFJA 1SF9A 3CMAA 1V29B 4FYXB 1FYNA 2EVRA 2RHXA 1FX7A 3OYEA 4CRIA 1VQ8T 1OQKA 1UGSB 3SWNC 4KUDK 3LGFA 3UATA 3SB2A 4CC2A 3J80E 3CCQT 3M55A 3H8ZA 1UEBA 5IHIA 3VS7A 1YJNQ 4E7SA 4RTYA 2KVQG 2X4WA 1OX8A 2HEQA 3FRNA 3G1JA 1SEMA 4Y92A 5FWCA 1B34B 1T0JA 1BU1A 4M77G 3FB9A 5D7UA 1MNDA 2DYIA 3BY7A 1WJSA 1NJIU 2EIFA 5CKEA 1BCMA 2X3WD 4J9EA 5GMKj 3OYJA 4EMKC 3CC2T 2HKNA 1YJWA 2DA9A 1BYMA 2E41A 5CIUA 1N8RU 1VQOQ 2OTLA 2ZCFB 2G3RA 3CCUQ 3LLRA 5DM7R 1Q82R 1QLYA 3OYAA 3OW2S 1M3BA 4DBHA 2OTJA 1LPLA 1WIEA 4C8QG 1WHHA 4RUGA 3VJPA 2F2VA 2PUOB 2QASA 1X43A 1VQ6Q 5FROA 1A0NB 2LRQA 2K2MA 1YJWQ 1KD1C 4A4EA 3QZ5B 1HYOA 4C0DC 1IHWA 2OJ2A 3SWNB 4M7AB 1U8RA 1TWBA 1VIEA 2A08A 2RD1A 4C0ZA 2DK3A 3C95A 2BKDN 1PM3A 2J6OA 1Y0MA 4LDXA 2M0OA 1YI2A 1G2BA 3RKXA 2JM8A 7AT1B 1YFNA 2RI2A 3A8OB 2V8KA 5L8RE 1D3BB 2GTOA 4PKCC 3MEAA 2RHIA 5LJ3d 3E1SA 1CSKA 4KUIA 2RN8A 2E5QA 4RTTA 2DXCA 4BDYA 5LJ5f 4E6RA 1M1KR 4M78E 4NOYA 3CPFA 3BDLA 2NUTA 3OYLA 4FYYB 3E19A 4M78F 2JW4A 1Q95G 3M57A 3CCRA 5GAMj 1Q81U 1GFCA 3ZL7C 1VQPT 2HQXA 4MDWA 2QK0A 2RA2A 1QCFA 3MP8A 1AWOA 4RTWA 2OTJT 3EFOA 1VYUA 4IURA 3PMIA 1AZEA 2CSQA 1TTHB 2LX9A 2MYSA 2Y90A 4MZPA 1JB0E 3OS5A 4QQ6A 4RG8A 4HXJA 1KQSP 1X6BA 2IIMA 4GLMA 1OV3A 2QA4T 3JB9D 2EYZA 3EG9B 2X9HA 1M4ZA 5IHNA 3S3NA 2LCCA 2QQRA 3VS0A 1IHVA 4JRKA 4JJDA 3MEVA 2KROA 2MMPA 2AKLA 1KD1U 4C5IA 4MZTA 5LJ3g 3G6ET 3A98A 5LJ3e 4OF1A 4A54A 4M7DA 1Q86R 4IUPA 1OPKA 2CP0A 4AFUC 5FRMA 2JXBA 5CK9A 2F69A 5LJ3h 3X28B 5D6XA 1I1JA 3NMZC 3E9GA 2P0QA 4ORZA 4QW2A 4M7DC 4P5NA 4RTZA 2LX7A 3OMGA 4LE9A 2X51A 4MZMA 4PJOG 2VB6A 3JCMQ 1F1BB 1YNZA 1AHJB 2AZVA 1ZSGA 1EIFA 1NJIR 3CCMQ 4JJNK 2FO0A 2VGNA 1H92A 5GMKh 1M5Q1 4J8OA 1EZZB 1N5ZA 3JCMc 2EJFA 4J9HA 2GQIA 3F70A 3INZA 2YHTA 4TVRA 3A1PA 5IT9E 2WACA 4PJOF 1I5OB 5DLOA 2KRNA 4JJBA 4KGZB 2HQEA 3NGPA 5I2SA 1H3ZA 3L2RA 3NTHA 4F7UG 3I56Q 4PJOE 3CC4A 1RADB 4HT8A 4BUGA 4J7FA 3G4SA 3H9NA 2XDDA 3JCMJ 4M77D 3M4GA 4NL2A 1YBYA 1QKWA 4LDVA 2R5AA 3CCLA 3DKMA 4FL6A 5IXFA 1OOTA 2J06A 5D6WA 2KRSA 3VS1A 4OGEA 1DJ7B 2X4JA 2PUKB 2K3BA 2BE7D 3CBMA 5DLQE 2ZPEB 1CKAA 2EQKA 1S72A 4CC4B 3VRYA 1BI3A 1D09B 3TQ7P 1UTIA 4OGCA 4OP0A 1I8FA 2J6KA 5LJ3j 2MAMA 2LDMA 3FC3A 2QGGA 1H641 1R0CB 5GANf 2E6ZA 5CQXA 1RLPC 4F17A 3RMQA 4FIBA 3GIBA 1X75C 1U1TA 1I0CA 1NE8A 4AFSC 4N0AA 1VQOT 1M8VA 2QI2A 3QG1A 3JCMP 2M9UA 4RTUA 3OSVA 2DBKA 2KGTA 2KXDA 2FRWA 4XTVA 3JV3A 4RTVA 3PIOA 3JCMg 1K1ZA 3M58A 1G5VA 1BI2A 1XNIA 3JCMe 1VQ5T 1D0XA 4J9IA 3JSCA 1OULA 5A0GA 4BACA 4ESRA 3OYNA 2EPDA 3CD6T 5GAMe 1KG1A 2QAZA 5GAMg 1WFWA 1NEGA 3MKDA 4M7AG 2RHUA 1VQNA 3FIFA 1G3TA 3C12A 1VIFA 1K73R 3M0QA 2YUPA 2E6NA 2DJZA 4EPCA 1X2KA 1VQPQ 3VYHB 3HKSA 2KT1A 1VQKA 2LJ3A 1X27A 1WZOA 2BZXA 3OYKA 1D0YA 4ZTJA 3JB9G 2XD0A 1W2BS 1X69A 2JNGA 2E70A 4OB3B 2O01E 2VV5A 2E10A 4KT0E 1WJRA 1QMCA 1IB8A 4BI3A 2OTLQ 4RMOA 1AEYA 3CCEQ 4ATOA 4Z88A 2RJFA 1U1SA 3QJYA 4BI8B 2EW3A 4J6YA 5IN1A 4B9XA 3OS2A 2L5QA 5GMKm 4LD6A 1VQ7T 2DMOA 4C8QF 2JN0A 1YITQ 3LWHA 8AT1B 1OPLA 5I11A 3M0TA 1RAGB 2DAQA 3X25B 3HTRA 4M77A 4O6JA 2LQWA 1M27C 1VQ8Q 4QVZA 2VGMA 1VQ9Q 1ACMB 2DZ9A 1N27A 4GBQA 2KAFA 2DYBA 5GAOl 3H6ZA 2BTTA 1PC0A 4GLKA 3I55Q 1NG2A 4JZ4A 1AZGB 4D6WA 3E9FA 3CC7T 2CDTA 5GANh 2RNAA 5GAOr 4M78D 5AT1B 4B9WA 3AT1B 3OYHA 3SWNA 1Z9QA 1NLPC 2DXBA 3MPUB 4RTXA 3MEUA 2ROLA 3V7CA 1WNLA 3OYBA 1QVGA 2K4YA 3GBQA 2EFIA 3ME9A 3L2VA 3CXCA 4OMLA 3M0SA 2CS7A 5KE2A 2DXUA 4C0FA 2GCXA 4LN2A 2CP5A 4M75E 2LNHB 2MOXA 4M78G 3SEMA 1M1GA 3CC2Q 1BIBA 4XTWA 3JAME 3JB9I 2FPFA 3GPLA 5GAOm 3KFVA 1KHCA 3JRZA 4OMFB 5HY6A 3BE3A 5KYWA 3V8JA 1YHQA 1RAFB 4M78B 4WCIA 2RI5A 1YCYA 2ZPHB 3RR6A 2EYYA 3GOXA 3CCJQ 3X26B 3LW5E 2DX1A 1PRLC 1ZUUA 1VQ6T 1XQHA 1B07A 3M0RA 5EG2A 2LC4A 4PJNA 1YIJT 2AZSA 1VQ5A 1OU8A 2XICA 2R57A 1OX9A 1NZ9A 1RABB 2FZKB 2DILA 5LL6S 2COZA 3THKA 3CC7Q 2XIDA 2VASA 3NTKA 1AT1B 3OBYA 1GCQA 3CMAT 2CP3A 3VUZA 5HCKA 1UGRB 5KH6A 3A8GB 4E7ZA 1TXQA 2RI3A 2L3SA 1WHKA 4PJOA 2QQAA 3OA6A 1TU0B 3LX7A 2CSIA 1VOMA 4A4FA 5FU6C 2K2VA 3I35A 2E12A 2LQ8A 1S72Q 2LNVA 3L2ZA 5CKDA 3MHXA 5DY9A 1RACB 3OYGA 1SKUB 2CKKA 2WSCE 3CCVQ 5KYYA 2XG8D 3J81E 4L59A 4NL3A 2F5KA 4C92G 4M78C 3JCMW 2GNCA 2LT4A 3RESA 5GAMf 2HQHA 1R8OB 2RK2A 1YIJQ 2YUNA 4JDSA 5KYYB 5GAN3 5M9OA 3O5ZA 3CEYA 2JM9A 1BKBA 2B8AA 2QQBA 3CBOA 2A36A 2IPOB 1W70A 2ED0A 1MUZA 3H0FA 3V8KA 2LVMA 2DL5A 3N5BB 1RI9A 3QHSA 1IGUA 3QPHA 1VA7A 3CD6A 2KT8A 2FHDA 4XAXB 2MWPA 4LDWA 4ZTFA 1ZLMA 4J6XA 4PFZA 2DZCA 1WJQA 1PCXA 5IH2A 2KK4A 2V8IA 1QCOA 2K5LA 3CCRT 4QQGA 1YJNT 1KQSS 3KUFA 4EMKB 1M90R 4PLIA 4M7AD 3OSSC 3L2WA 2KEAA 1LCKA 2QTXA 3CCMA 1RUWA 2DD4A 3AHUA 1AWWA 4M7DD 5CKBA 5I21A 2KY9A 2PVGB 2MK5A 2RQWA 4C0GA 5FU7B 2DETA 2NUTB 1JXMA 3LGLA 5IAYA 3J7AF 2VYTA 4FU6A 3TCJA 1ZBXA 2DVJA 2GGRA 2K7AA 1Q7YR 2BZ8A 2KSSA 2LZ6B 3DB3A 4M78A 2YUQA 1UECA 2BUDA 4OVAA 2YDLA 3H41A 4WTOB 1UG1A 2DL3A 2NLUA 3Q1JA 2CUDA 2HBPA 2XDPA 4N4GA 2CZ6B 1UE9A 1BBZA 1KC8R 2MF2A 1VQMA 4EMGA 1IRXA 4FT2A 2EAYA 2O31A 1TUGB 2RQUA 4DEYA 4CC3A 2XHCA 4F04B 1K73U 4E7HA 2H3EB 4KULA 2VUBA 1V76A 4M75F 2C06A 1PNJA 1YITT 5GANd 1PD1A 1M3AA 2GFUA 3GF5A 1N6AA 1WPYA 5HK3A 2KYMA 1WHGA 3RMSA 2CP2A 1EFNA 3JCMf 1TUDA 1D0ZA 1S1NA 1PD0A 3EGXA 4C5HA 2L0AA 5FW9A 3CXCS 2RQTA 4XTYA 3EG1A 2GBQA 3I55T 2RHYA 1WLPB 4KH1B 2XMFA 3M54A 4PJOB 2WSEE 2A7YA 1UGQB 2E5KA 4F7UB 5HK0A 1M3CA 5J26A 4HVUA 1UUEA 2XU8A 3VKIA 3L1AA 5GAOp 2YLCA 2L3RA 2DEUA 1H3HA 1SHGA 4PFPA 2RJDA 1SRMA 4JLGA 5CCAA 1G3WA 2JUFA 3H0HA 3EGDA 1UHFA 1KFZA 4JS4A 3I5RA 3CC2A 4FYWB 4A53A 5GAN5 2D0QB 4QVDA 4ZN1A 2ZPIB 3M0UA 2L3QA 4C92D 5J39A 4MDXA 3H0IA 1TOVA 3PT9A 1VQNQ 2H3JA 3RDVA 3FJ5A 3CBPA 1ZSZC 4C92B 2DIGA 4J9FA 1KQ1A 2DL8A 1VQ4Q 2YRCA 4X9CA 4HCKA 2P0PA 1WA7A 3OBWA 4J9CA 1R0BG 1VQ5Q 2V1RA 3BW1A 3QO3A 3WVEB 2OI3A 4JUVA 2D1XA 2JMCA 4LD9K 1ZSZA 4BY6B 2A0FB 2EKHA 2NUZA 4DBFA 3VYGA 1I07A 5L23A 4QQDA 3ZEHA 3FLGA 4D8KA 5IHKA 1YP5A 3QXEB 3REAB 5EC7A 1D3BA 3L42A 1IXDA 2V8JA 4M77B 1TH7A 1YJ9T 2F5TX 3C4SA 2E64A 2M0YA 4RKUE 2J05A 2EGEA 2JTFA 4KH0B 6AT1B 1M2VB 4HVVA 3NFCA 3QZ9B 3MP1A 1ARKA 3L2UA 1QVPA 2HSEB 5A0DA 2RPNA 2QDLA 4F16A 4OMQA 1UJYA 4XU0A 1M8MA 3A8MB 2RM4A 3REBB 1QVFS 1KHIA 1Y57A 5GAN8 2GFAA 3L2QA 4BE0A 2ABLA 3VS6A 4PJJA 2K6DA 4XU3A 3SHWA 1VQ7Q 4ZGJB 3CCLT 1ZBJA 2DM1A 2F2WA 4E7IA 2AHJB 1WHJA 2K57A 2DF6A 1OI1A 2I0NA 1J3TA 2D0NA 4E7LA 1SRLA 1JBMA
chains in the Genus database with same CATH topology
1WDXA 1M27C 1V1CA 1FYNA 2EVRA 2O88A 1CKBA 4J9BA 4GBQA 2DYBA 2CT3A 3RNJA 2BTTA 3UATA 3UA6A 1TG0A 1OEBA 4CC2A 1NG2A 4JZ4A 1AZGB 5GJVB 5IHIA 3VS7A 2CDTA 2RQVA 2RNAA 2L3PA 4RTYA 4CC7A 1Z9QA 1NLPC 4LNPA 2CH4A 2HEQA 4Y92A 1SEMA 4RTXA 5FWCA 1T0JA 1JQQA 2HSPA 1BU1A 2ROLA 2ECZA 3GBQA 2YT6A 1NLOC 3VS5A 4OMLA 3M0SA 5ECAA 2LCSA 2LQNA 2X3WD 4J9EA 1NM7A 4LN2A 3NHNA 1E7OA 1UJ0A 2LNHB 2MOXA 2O2OA 5IXBA 2DA9A 3SEMA 1TUCA 1T0HA 1HD3A 2KYBA 2FPFA 2KXCA 2J6FA 3KFVA 1KIKA 2YSQA 2H8HA 1QLYA 2AK5A 2KRMA 1FMKA 4WCIA 2EYYA 1M3BA 2V1QA 1WIEA 2JTEA 1T3LA 1GBRA 1YCSB 4RUGA 2DX1A 1PRLC 2F2VA 1ZUUA 4HVWA 1VYTA 2J7IA 2M51A 1B07A 2FRYA 3M0RA 2X3XD 1X43A 4QT7A 4AFQC 1U5SA 1A0NB 2AZSA 2K2MA 1MV3A 4M4ZA 3QWXX 2CH4W 2OJ2A 2VVKA 1UHCA 2PTKA 2DBMA 3TVTA 2DILA 3THKA 2ED1A 1QKXA 2A08A 2RMOA 1JO8A 2HBWA 4LUEA 2J6OA 1B3QA 1GCQA 1Y0MA 2L2PA 3C0CA 1K0XA 1PKSA 1G2BA 5HCKA 1UDLA 2JM8A 2L3SA 1AD5A 1AWXA 2GTOA 4IIOA 1X6GA 2D8JA 2GTJA 1CSKA 2CSIA 2EYWA 1AVZC 3I35A 1AWJA 2RN8A 4RTTA 3CQTA 1QWFA 3IQLA 3RBBB 1U06A 1WI7A 2JMAA 1W1FA 4E6RA 1JU5C 1GFDA 2JW4A 2A28A 1PRMC 2GNCA 1PKTA 1GFCA 3ZL7C 2FPDA 1AOJA 2DNUA 1QCFA 2YUNA 1AWOA 4RTWA 2PZ1A 3UF4A 1ZUKA 2A37A 3O5ZA 1NYFA 2SRCA 1E6GA 1VYUA 2JM9A 1AZEA 2CSQA 1K4US 2CREA 2A36A 4HXJA 2DL7A 1X6BA 1W70A 2IIMA 4GLMA 2HCKA 1OV3A 1MUZA 2ED0A 2F2XA 3H0FA 1WYXA 2DL5A 2EYZA 1RI9A 5IHNA 2CUBA 1VA7A 2KR3A 3VS0A 2KT8A 2DLPA 2P4RA 4JJDA 4A63B 2JS2A 2KROA 1GCPA 1ZLMA 2EQIA 2ESWA 1HJDA 5IH2A 2AKLA 1Z9ZA 4AFZC 1K0SA 3I5SA 3A98A 2KEAA 1LCKA 3EG2A 3UA7A 1ABOA 1K9AA 1RUWA 1AWWA 3M0PA 1OPKA 4AFUC 2VWFA 4EIKA 4D8DA 2RQWA 2JXBA 2W0ZA 4JZ3A 1I1JA 1JXMA 3NMZC 4J9DA 3TSZA 4ORZA 2DVJA 4RTZA 2GGRA 2K7AA 2LX7A 2BZ8A 4K11A 2LZ6B 4LE9A 2YUQA 4OMMA 1UECA 2YDLA 3H41A 1YNZA 1UG1A 2AKKA 2SEMA 2AZVA 1NEBA 1ZSGA 2DL3A 2CUDA 1YWPA 2FO0A 2DE0X 2NWMA 3EG0A 1H92A 1UE9A 3VS4A 1BBZA 1N5ZA 2W10A 1IO6A 2RF0A 4J9HA 2GQIA 2PNIA 3U23A 1T3SA 2O31A 1GRIA 2RQUA 4AG1C 4DEYA 4CC3A 2KRNA 4JJBA 3NGPA 1KJWA 4Z8AA 4FSSA 2D8HA 1PNJA 2G6FX 3EHRA 1WXBA 1M3AA 1GBQA 1NYGA 2KYMA 1QWEA 1BK2A 4OMPA 4F14A 1SHFA 1EFNA 1TUDA 1QKWA 1S1NA 4X1VA 3PVQA 5IXFA 2ENMA 1OOTA 2J06A 2L0AA 4OMNA 5FW9A 2DRMA 2KRSA 3VS1A 2RQTA 3EG1A 1W6XA 2EGCA 2GBQA 2K3BA 2VKNA 3I9QA 1WLPB 2XMFA 2YUOA 2KNBB 1ZX6A 1CKAA 4JPBW 2JT4A 2E5KA 2C0IA 4CC4B 3VRYA 5I22A 1UTIA 1H8KA 1M3CA 2J6KA 2LJ1A 3PVLA 4HVUA 1UUEA 1XOVA 2BZYA 4DEXA 5GJWB 2B86A 1YWOA 4JJCA 1H3HA 2ROTA 1SHGA 3R6NA 1VYVA 2O9VA 1SRMA 1RLPC 1PWTA 1WXTA 4F17A 3NPFA 1M30A 3H0HA 2CT4A 1UHFA 1KFZA 1I0CA 3I5RA 1WXUA 1X2QA 3TSWA 4AFSC 1HSQA 2FPEA 1BB9A 2C0TA 3M0UA 2L3QA 4OMOA 3VRZA 4RTUA 1E6HA 2DL4A 3H0IA 3EHQA 2DBKA 2KGTA 2KXDA 1YN8A 2FRWA 3FJ5A 3JV3A 1G83A 4RTVA 1WX6A 4J9FA 4AG2C 2DL8A 1K1ZA 2LJ0A 4HCKA 1GL5A 3LH5A 1WA7A 1GCQC 4J9CA 4J9IA 2EYXA 2V1RA 2DJQA 2OI3A 2D1XA 2JMCA 1MV0B 1PHTA 4ESRA 2LP5A 2EPDA 1SPKA 3VS2A 2EKHA 1UFFA 2NUZA 1I07A 1WFWA 5L23A 1SSHA 1NEGA 2KBTA 1U3OA 2K9GA 4D8KA 5IHKA 1ABQA 1YP5A 3REAB 5EC7A 3M0QA 4J9GA 3PE0A 2RQRA 2YUPA 2HDAA 1X2KA 2MIOA 1RLQC 2KT1A 3VS3A 2LJ3A 1ZUYA 2M0YA 4R0KA 1X27A 2FG0A 2BZXA 1K76A 2J05A 2EGEA 1X69A 4HVVA 3QWYA 4Z89A 4IIMA 1ARKA 2EBPA 1JXOA 1JEGA 2OAWA 2MCNA 2RPNA 1KSWA 1AEYA 1UGVA 2QDLA 4F16A 4Z88A 4OMQA 1UJYA 1M8MA 2EW3A 2DRKA 2FEIA 3REBB 5FWBA 2O9SA 2KE9A 2EGAA 1Y57A 2ABLA 3VS6A 2DMOA 2K6DA 3EG3A 3SHWA 2LMJA 1ZBJA 3EGUA 2DM1A 2C0OA 2F2WA 2JS0A 4LUDA 4KRTA 1OPLA 5I11A 3M0TA 4ZNXA 3ULRB 2DF6A 2K79A 2I0NA 1J3TA 2D0NA 2LQWA 1SRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WDX A;  1M27 C;  1V1C A;  1FYN A;  2EVR A;  2O88 A;  1CKB A;  4J9B A;  4GBQ A;  2DYB A;  2CT3 A;  3RNJ A;  2BTT A;  3UAT A;  3UA6 A;  1TG0 A;  1OEB A;  4CC2 A;  1NG2 A;  4JZ4 A;  1AZG B;  5GJV B;  5IHI A;  3VS7 A;  2CDT A;  2RQV A;  2RNA A;  2L3P A;  4RTY A;  4CC7 A;  1Z9Q A;  1NLP C;  4LNP A;  2CH4 A;  2HEQ A;  4Y92 A;  1SEM A;  4RTX A;  5FWC A;  1T0J A;  1JQQ A;  2HSP A;  1BU1 A;  2ROL A;  2ECZ A;  3GBQ A;  2YT6 A;  1NLO C;  3VS5 A;  4OML A;  3M0S A;  5ECA A;  2LCS A;  2LQN A;  2X3W D;  4J9E A;  1NM7 A;  4LN2 A;  3NHN A;  1E7O A;  1UJ0 A;  2LNH B;  2MOX A;  2O2O A;  5IXB A;  2DA9 A;  3SEM A;  1TUC A;  1T0H A;  1HD3 A;  2KYB A;  2FPF A;  2KXC A;  2J6F A;  3KFV A;  1KIK A;  2YSQ A;  2H8H A;  1QLY A;  2AK5 A;  2KRM A;  1FMK A;  4WCI A;  2EYY A;  1M3B A;  2V1Q A;  1WIE A;  2JTE A;  1T3L A;  1GBR A;  1YCS B;  4RUG A;  2DX1 A;  1PRL C;  2F2V A;  1ZUU A;  4HVW A;  1VYT A;  2J7I A;  2M51 A;  1B07 A;  2FRY A;  3M0R A;  2X3X D;  1X43 A;  4QT7 A;  4AFQ C;  1U5S A;  1A0N B;  2AZS A;  2K2M A;  1MV3 A;  4M4Z A;  3QWX X;  2CH4 W;  2OJ2 A;  2VVK A;  1UHC A;  2PTK A;  2DBM A;  3TVT A;  2DIL A;  3THK A;  2ED1 A;  1QKX A;  2A08 A;  2RMO A;  1JO8 A;  2HBW A;  4LUE A;  2J6O A;  1B3Q A;  1GCQ A;  1Y0M A;  2L2P A;  3C0C A;  1K0X A;  1PKS A;  1G2B A;  5HCK A;  1UDL A;  2JM8 A;  2L3S A;  1AD5 A;  1AWX A;  2GTO A;  4IIO A;  1X6G A;  2D8J A;  2GTJ A;  1CSK A;  2CSI A;  2EYW A;  1AVZ C;  3I35 A;  1AWJ A;  2RN8 A;  4RTT A;  3CQT A;  1QWF A;  3IQL A;  3RBB B;  1U06 A;  1WI7 A;  2JMA A;  1W1F A;  4E6R A;  1JU5 C;  1GFD A;  2JW4 A;  2A28 A;  1PRM C;  2GNC A;  1PKT A;  1GFC A;  3ZL7 C;  2FPD A;  1AOJ A;  2DNU A;  1QCF A;  2YUN A;  1AWO A;  4RTW A;  2PZ1 A;  3UF4 A;  1ZUK A;  2A37 A;  3O5Z A;  1NYF A;  2SRC A;  1E6G A;  1VYU A;  2JM9 A;  1AZE A;  2CSQ A;  1K4U S;  2CRE A;  2A36 A;  4HXJ A;  2DL7 A;  1X6B A;  1W70 A;  2IIM A;  4GLM A;  2HCK A;  1OV3 A;  1MUZ A;  2ED0 A;  2F2X A;  3H0F A;  1WYX A;  2DL5 A;  2EYZ A;  1RI9 A;  5IHN A;  2CUB A;  1VA7 A;  2KR3 A;  3VS0 A;  2KT8 A;  2DLP A;  2P4R A;  4JJD A;  4A63 B;  2JS2 A;  2KRO A;  1GCP A;  1ZLM A;  2EQI A;  2ESW A;  1HJD A;  5IH2 A;  2AKL A;  1Z9Z A;  4AFZ C;  1K0S A;  3I5S A;  3A98 A;  2KEA A;  1LCK A;  3EG2 A;  3UA7 A;  1ABO A;  1K9A A;  1RUW A;  1AWW A;  3M0P A;  1OPK A;  4AFU C;  2VWF A;  4EIK A;  4D8D A;  2RQW A;  2JXB A;  2W0Z A;  4JZ3 A;  1I1J A;  1JXM A;  3NMZ C;  4J9D A;  3TSZ A;  4ORZ A;  2DVJ A;  4RTZ A;  2GGR A;  2K7A A;  2LX7 A;  2BZ8 A;  4K11 A;  2LZ6 B;  4LE9 A;  2YUQ A;  4OMM A;  1UEC A;  2YDL A;  3H41 A;  1YNZ A;  1UG1 A;  2AKK A;  2SEM A;  2AZV A;  1NEB A;  1ZSG A;  2DL3 A;  2CUD A;  1YWP A;  2FO0 A;  2DE0 X;  2NWM A;  3EG0 A;  1H92 A;  1UE9 A;  3VS4 A;  1BBZ A;  1N5Z A;  2W10 A;  1IO6 A;  2RF0 A;  4J9H A;  2GQI A;  2PNI A;  3U23 A;  1T3S A;  2O31 A;  1GRI A;  2RQU A;  4AG1 C;  4DEY A;  4CC3 A;  2KRN A;  4JJB A;  3NGP A;  1KJW A;  4Z8A A;  4FSS A;  2D8H A;  1PNJ A;  2G6F X;  3EHR A;  1WXB A;  1M3A A;  1GBQ A;  1NYG A;  2KYM A;  1QWE A;  1BK2 A;  4OMP A;  4F14 A;  1SHF A;  1EFN A;  1TUD A;  1QKW A;  1S1N A;  4X1V A;  3PVQ A;  5IXF A;  2ENM A;  1OOT A;  2J06 A;  2L0A A;  4OMN A;  5FW9 A;  2DRM A;  2KRS A;  3VS1 A;  2RQT A;  3EG1 A;  1W6X A;  2EGC A;  2GBQ A;  2K3B A;  2VKN A;  3I9Q A;  1WLP B;  2XMF A;  2YUO A;  2KNB B;  1ZX6 A;  1CKA A;  4JPB W;  2JT4 A;  2E5K A;  2C0I A;  4CC4 B;  3VRY A;  5I22 A;  1UTI A;  1H8K A;  1M3C A;  2J6K A;  2LJ1 A;  3PVL A;  4HVU A;  1UUE A;  1XOV A;  2BZY A;  4DEX A;  5GJW B;  2B86 A;  1YWO A;  4JJC A;  1H3H A;  2ROT A;  1SHG A;  3R6N A;  1VYV A;  2O9V A;  1SRM A;  1RLP C;  1PWT A;  1WXT A;  4F17 A;  3NPF A;  1M30 A;  3H0H A;  2CT4 A;  1UHF A;  1KFZ A;  1I0C A;  3I5R A;  1WXU A;  1X2Q A;  3TSW A;  4AFS C;  1HSQ A;  2FPE A;  1BB9 A;  2C0T A;  3M0U A;  2L3Q A;  4OMO A;  3VRZ A;  4RTU A;  1E6H A;  2DL4 A;  3H0I A;  3EHQ A;  2DBK A;  2KGT A;  2KXD A;  1YN8 A;  2FRW A;  3FJ5 A;  3JV3 A;  1G83 A;  4RTV A;  1WX6 A;  4J9F A;  4AG2 C;  2DL8 A;  1K1Z A;  2LJ0 A;  4HCK A;  1GL5 A;  3LH5 A;  1WA7 A;  1GCQ C;  4J9C A;  4J9I A;  2EYX A;  2V1R A;  2DJQ A;  2OI3 A;  2D1X A;  2JMC A;  1MV0 B;  1PHT A;  4ESR A;  2LP5 A;  2EPD A;  1SPK A;  3VS2 A;  2EKH A;  1UFF A;  2NUZ A;  1I07 A;  1WFW A;  5L23 A;  1SSH A;  1NEG A;  2KBT A;  1U3O A;  2K9G A;  4D8K A;  5IHK A;  1ABQ A;  1YP5 A;  3REA B;  5EC7 A;  3M0Q A;  4J9G A;  3PE0 A;  2RQR A;  2YUP A;  2HDA A;  1X2K A;  2MIO A;  1RLQ C;  2KT1 A;  3VS3 A;  2LJ3 A;  1ZUY A;  2M0Y A;  4R0K A;  1X27 A;  2FG0 A;  2BZX A;  1K76 A;  2J05 A;  2EGE A;  1X69 A;  4HVV A;  3QWY A;  4Z89 A;  4IIM A;  1ARK A;  2EBP A;  1JXO A;  1JEG A;  2OAW A;  2MCN A;  2RPN A;  1KSW A;  1AEY A;  1UGV A;  2QDL A;  4F16 A;  4Z88 A;  4OMQ A;  1UJY A;  1M8M A;  2EW3 A;  2DRK A;  2FEI A;  3REB B;  5FWB A;  2O9S A;  2KE9 A;  2EGA A;  1Y57 A;  2ABL A;  3VS6 A;  2DMO A;  2K6D A;  3EG3 A;  3SHW A;  2LMJ A;  1ZBJ A;  3EGU A;  2DM1 A;  2C0O A;  2F2W A;  2JS0 A;  4LUD A;  4KRT A;  1OPL A;  5I11 A;  3M0T A;  4ZNX A;  3ULR B;  2DF6 A;  2K79 A;  2I0N A;  1J3T A;  2D0N A;  2LQW A;  1SRL A; 
#chains in the Genus database with same CATH topology
 1WDX A;  3UT1 A;  2ZPG B;  1V1C A;  1LVK A;  1Y96 B;  1RAA B;  4N4H A;  3OYM A;  2Y4Y A;  2R58 A;  4J9B A;  2DVE A;  2K3Y A;  2K3X A;  3RNJ A;  3UA6 A;  1TG0 A;  1OEB A;  2DO3 A;  4M7A F;  3PNW C;  4LXC A;  3CCJ A;  3TRE A;  2D9T A;  2L3P A;  5HKC A;  4LNP A;  1Q7Y U;  3BDU A;  1JQQ A;  2HSP A;  1KK7 A;  3QDR B;  5CAI A;  2ECZ A;  2YT6 A;  2YRV A;  5ECA A;  2EQU A;  2LCS A;  2LQN A;  3JB9 J;  3JB9 F;  1NM7 A;  2PQW A;  3NHN A;  1E7O A;  4JLI A;  4A4H A;  1UJ0 A;  2AIR B;  2O2O A;  1X01 A;  3G71 A;  1M1K U;  4C92 F;  3P8H A;  1T0H A;  1HD3 A;  2KYB A;  2QYZ A;  3HPW A;  2J6F A;  1VQK Q;  1M90 U;  2PU9 B;  1KIK A;  3EAE A;  2YSQ A;  2H8H A;  4C8Q C;  1FMK A;  1N9S A;  3VUB A;  4N0A C;  1Y7X A;  2DKG A;  2XKO C;  2JTE A;  1GBR A;  1T3L A;  4X34 A;  3CCJ T;  3URG A;  2M51 A;  4XU1 A;  1D1A A;  3CPW A;  1RAH B;  1YIT A;  2FRY A;  5GAN 7;  2X3X D;  1U5S A;  4BY6 C;  4DOV A;  3RER A;  3CCE A;  3QWX X;  2VVK A;  2L8D A;  1K8A C;  5FU7 C;  3X24 B;  3CD6 Q;  1VQ8 A;  1LJO A;  2DBM A;  3TVT A;  3CCQ Q;  1QKX A;  2K5I A;  5C0M A;  2RMO A;  1JO8 A;  2HBW A;  4B6M A;  2ZPF B;  2CYZ B;  3A5Z B;  3C0C A;  1K0X A;  2L89 A;  4C92 E;  4FCY A;  3RKY A;  1OU9 A;  1BIA A;  2RJE A;  3NTI A;  4EMH A;  4IIO A;  3G6E Q;  5LJ5 e;  2HL5 C;  4V2S A;  2KI7 A;  4AMC A;  4M7A A;  2QEX A;  3CC4 T;  1QWF A;  3IQL A;  1PSE A;  3RBB B;  3CME Q;  1U06 A;  3CCV T;  3CCV A;  1W2B P;  3OW2 A;  1RAI B;  3CCE T;  1GFD A;  1JRI A;  1VQL Q;  2A28 A;  3M56 A;  1PKT A;  4IUU A;  2FPD A;  1WQW A;  1AOJ A;  1FMW A;  2MWO A;  2R5M A;  2PZ1 A;  2O4X B;  3UF4 A;  1ZUK A;  1NPR A;  2SRC A;  1E6G A;  3GNG A;  4ZN3 A;  3HP9 A;  1D1C A;  4M7D B;  1Y71 A;  1YHQ T;  2CRE A;  2DL7 A;  2LT1 A;  4RCB A;  4M75 G;  1KD1 R;  2HCK A;  3G71 T;  2F2X A;  2E3H A;  5LJ5 j;  4PJO C;  2OTL T;  5KCO A;  2QQ9 A;  2RJC A;  2DTH A;  1KC8 C;  2CUB A;  3OS1 A;  2KR3 A;  2QDY B;  2P4R A;  2DLP A;  1FMV A;  3EGD B;  4A63 B;  4C8Q D;  3PFS A;  1N8R R;  3M4Y A;  4KGX B;  3FJP A;  1Z9Z A;  4AFZ C;  4II1 A;  1K0S A;  3EG9 A;  3P8D A;  3RKW A;  5GMK i;  3EGX B;  3I5S A;  1OZ3 A;  4PK4 A;  1SSF A;  2HMA A;  1X6O A;  4XK8 E;  1K9A A;  3SFM A;  3M0P A;  5CO7 A;  3HFN A;  2GQV A;  2CZ7 B;  2QQS A;  3DLL A;  1M1F A;  1Q81 R;  4C92 C;  1MMD A;  1WHM A;  4J9D A;  3TSZ A;  2YRD A;  3JCM d;  1IZ6 A;  4HKE A;  1RL2 A;  1WGS A;  4K11 A;  4YTL A;  3D7S B;  2FB7 A;  3CXC P;  3CCL Q;  1GXI E;  2EQJ A;  5GAN 2;  3I56 A;  2AKK A;  2SEM A;  3T9N A;  2I2L A;  3SD4 A;  3QBY A;  2MPX C;  2NWM A;  3KBG A;  1YJN A;  3VS4 A;  3G71 Q;  2QA4 Q;  3G7Z A;  1IO6 A;  2YXY A;  3A8H B;  4AG1 C;  3OYY A;  4C8Q A;  2OAU A;  2DXT A;  5CKF A;  4Z8A A;  3RUX A;  2P0K A;  4FSS A;  3OY9 A;  2D8H A;  5A2Q E;  3EHR A;  1WXB A;  4KBM B;  1M90 C;  1NYG A;  3HL8 A;  1QWE A;  1BK2 A;  5GAO q;  2KDS A;  4OMP A;  4F14 A;  2QG9 B;  1QQJ A;  5GAN j;  4XTU A;  4X1V A;  2P84 A;  2ENM A;  2DER A;  2XK0 A;  4OMN A;  2JVV A;  1BI1 A;  2DRM A;  2AT1 B;  4M77 C;  1G3S A;  1TSF A;  1NJI C;  4PJO D;  4M75 B;  1YI2 Q;  3DB4 A;  1N9R A;  4HCZ A;  1Q7Y C;  4ELZ C;  2YUO A;  2KNB B;  1Q82 U;  1VQ6 A;  2JT4 A;  3LH0 A;  2C0I A;  1H8K A;  5FRN A;  4R55 A;  4HCB A;  1XOV A;  2BZY A;  3QJ6 A;  5GJW B;  1YWO A;  1M9S A;  3CCQ A;  2ROT A;  2XDB A;  3JCM h;  4VUB A;  2NUP B;  1I81 A;  3DLM A;  3OYC A;  1M30 A;  2ZZD A;  1X2Q A;  2Z0W A;  3TSW A;  1HSQ A;  3QDF A;  1I5L A;  1K9M C;  1BB9 A;  3CCU T;  2C0T A;  4M75 A;  1KQ2 A;  1VQN T;  1VQM Q;  2DL4 A;  3EHQ A;  3EH1 A;  5GMK e;  1WX6 A;  2P4T A;  1O75 A;  3LH5 A;  1Q81 C;  5FU6 B;  2KQW A;  1D1B A;  2PVO B;  2RH2 A;  1I4K 1;  4ZGD B;  2LP5 A;  2M16 A;  3CCR Q;  3VS2 A;  1R77 A;  1NPP A;  1PG5 B;  2KBT A;  5KYU A;  4ANJ A;  1ABQ A;  1VQ9 T;  4J9G A;  2E65 A;  8ATC B;  1VQL T;  1XJW B;  4NS5 A;  3V7S A;  3G4S T;  1Y96 A;  1ZUY A;  3M53 A;  3MP6 A;  2YWW A;  2PVD B;  1K76 A;  2RHZ A;  1VQ9 A;  3ASK A;  4Z89 A;  2YLB A;  3QKJ A;  4IIM A;  1YHQ Q;  4C92 A;  5GAM d;  2EBP A;  3MO8 A;  1JXO A;  1JEG A;  3HRU A;  2OAW A;  2MCN A;  2K5F A;  1QVG S;  1VUB A;  1UGV A;  3O8V A;  4C5G A;  1Q86 C;  1G8X A;  4C8Q B;  3M9Q A;  1M2O A;  3GLX A;  3HHT B;  5CR2 A;  3S3M A;  2DRK A;  2FEI A;  2FZC B;  2O9S A;  2EGA A;  3PMT A;  4M7A E;  5KCH A;  4J5Y A;  1PSF A;  1FWZ A;  2QGF B;  1O9S A;  1W4S A;  4A4G A;  1VQ4 A;  2C0O A;  1TS9 A;  3ULR B;  4F7U A;  2QTV A;  3X20 B;  2BIV A;  3CCU A;  1G3Y A;  2O88 A;  1CKB A;  5KYX B;  4M75 C;  2E3I A;  2RK1 A;  2HKQ B;  3KXT A;  2CT3 A;  3ZBD A;  2O4X A;  3OB9 A;  3FDR A;  5LJ5 g;  2ATC B;  1K8A R;  3OW2 P;  5GJV B;  4GY5 A;  2RQV A;  4XTZ A;  4CC7 A;  2EJ9 A;  5J3B A;  2EWN A;  2DTI A;  3S6W A;  2CH4 A;  3HRT A;  3JB9 H;  4QVC A;  3V8L A;  1Y07 A;  2NUP A;  1M1K C;  4JRP A;  2JOY A;  1NLO C;  2ZAE A;  4UC4 A;  3HSB A;  3VS5 A;  1JJ2 S;  4AT1 B;  3C94 A;  5C6S A;  4LDY A;  4RCC A;  2LQK A;  4JRQ A;  5IXB A;  3VU3 C;  1TUC A;  5GAN g;  3PGG A;  4XTX A;  1K9M R;  1VQL A;  3MEW A;  2DEQ A;  3QII A;  2KXC A;  3M5A A;  1QP2 A;  1QVF A;  3TU4 K;  4O5V A;  3E2U A;  2M1H A;  4BD3 A;  2AK5 A;  2KRM A;  3BFM A;  3CCM T;  3QSU A;  2KMT A;  3OS0 A;  2LCL A;  2V1Q A;  1YCS B;  5KYN A;  3G6E A;  4JS5 A;  4MMK A;  4HVW A;  1VYT A;  2J7I A;  5KE3 A;  4QT7 A;  1Q82 C;  2VXE A;  4AFQ C;  4BDZ A;  5I2M A;  1MV3 A;  4M4Z A;  2Y4X A;  4WF2 A;  3CCS T;  2CH4 W;  1C1A A;  5KYU B;  4XQ3 A;  1UHC A;  2PTK A;  2FYK A;  4PJL A;  2ED1 A;  4FW2 A;  4BB7 A;  4ELY C;  3JCM V;  4LUE A;  1B3Q A;  3CPW S;  1K8A U;  2L2P A;  5CQY A;  1PKS A;  4BE2 A;  3WVD B;  1VQ4 T;  1UDL A;  5FLX E;  4Q5W A;  1B34 A;  4KGV B;  1AD5 A;  3HFO A;  3RIR A;  3ER0 A;  1AWX A;  2FL7 A;  5A0L A;  1LNX A;  2NYS A;  1VQ7 A;  1X6G A;  2D8J A;  2E1H A;  2GTJ A;  2EYW A;  1ZHI A;  1AVZ C;  1AWJ A;  4M77 F;  4BI4 A;  3CME T;  1HK9 A;  1NBE B;  2DIQ A;  3CQT A;  4M75 D;  1VQM T;  4IUT A;  1QP3 A;  1WI7 A;  3CC4 Q;  2JMA A;  1W1F A;  3UWN A;  3QUI A;  1OZ2 A;  5AYF A;  1JU5 C;  1ZA2 B;  1PRM C;  3P8B B;  2HAX A;  1YJ9 Q;  2FZG B;  3MJX A;  4E47 A;  3EFR A;  2QXF A;  2DNU A;  3A8L B;  2COW A;  3PIP A;  3OYI A;  3OQ5 A;  3QYH B;  2E4H A;  2XI9 A;  2A37 A;  1NYF A;  3FEO A;  2LTO A;  2D6F A;  4J83 A;  1K4U S;  2GF7 A;  1WYX A;  5KYX A;  5LJ3 f;  3CMA Q;  3JCM b;  1QW1 A;  3OYD A;  1QCN A;  3G4S Q;  2JS2 A;  5GAO n;  1GCP A;  1YIJ A;  2M02 A;  1KQS A;  5LJ5 d;  2MI6 A;  2EQI A;  2ESW A;  1HJD A;  4BE1 A;  5GAN 4;  2ZGW A;  3CPW P;  1UGP B;  2FVU A;  2HNI A;  3TEE A;  1S72 T;  2A3L A;  4Y28 E;  3S3O A;  3EG2 A;  2X35 A;  3UA7 A;  1ABO A;  1MMG A;  2VC8 A;  2CGH A;  3SDZ A;  3LWI A;  2VWF A;  4EIK A;  3I55 A;  1ZQ1 A;  4D8D A;  2CP7 A;  4C5E A;  2EYQ A;  2W0Z A;  4M7A C;  4JZ3 A;  3OMC A;  4DBQ A;  1SG5 A;  2EKO A;  5GAN 6;  1M2V A;  4FYV B;  3M59 A;  4FW1 A;  1JJ2 A;  1B7T A;  2HL3 A;  2OX7 A;  4IKF A;  4DBR A;  4E7K A;  1ZA1 B;  4IUQ A;  3GNF B;  4OMM A;  1MMA A;  4J6W A;  4PL6 A;  1NEB A;  1P92 A;  2VXF A;  4HCC A;  1YWP A;  3EG0 A;  2DE0 X;  1C0M A;  4ZGE B;  2DTO A;  1WHL A;  2W10 A;  2RF0 A;  2PNI A;  3U23 A;  3CME A;  1T3S A;  1GRI A;  5GMK l;  3EFS A;  3LYI A;  1KJW A;  5CKH A;  4CI0 C;  2DPP B;  2G6F X;  1VQK T;  2RB6 A;  1GBQ A;  3UDC A;  5GAM h;  4R56 A;  3I56 T;  4L5G A;  3V7R A;  4A4K A;  1JJ2 P;  1SHF A;  5CVI A;  2RO0 A;  4JRI A;  1MGQ A;  1K73 C;  3PVQ A;  1YJ9 A;  1VQO A;  1IRE B;  3R6O A;  3EH2 A;  1YJW T;  1YI2 T;  3GP8 A;  2X4X A;  1W6X A;  2EGC A;  4Z02 A;  2VKN A;  4HA8 A;  4PLL A;  4F7U E;  3CCS A;  3I9Q A;  4L6V 5;  1ZX6 A;  4JPB W;  9ATC B;  2QEX Q;  4MML A;  5I22 A;  4DA4 A;  2LJ1 A;  3PVL A;  1UB4 A;  4DEX A;  2B86 A;  4IUV A;  4JJC A;  3CC7 A;  1FXX A;  4PJM A;  3R6N A;  1VYV A;  2O9V A;  1PWT A;  1WXT A;  3NPF A;  4FT4 A;  3WXM B;  2CT4 A;  1HXD A;  1WXU A;  2DFU A;  2JJ9 A;  3CCS Q;  4LDU A;  1QVG P;  2OTJ Q;  3JCM X;  3HRS A;  2FPE A;  4OB1 B;  2JZ2 A;  2WSF E;  4ME7 A;  4OMO A;  3VRZ A;  1N8R C;  1E6H A;  4XU2 A;  1YN8 A;  4OB2 B;  4PFO A;  1G83 A;  2HZY A;  4C8Q E;  1Q86 U;  4AG2 C;  1LOJ A;  4RG2 A;  2LJ0 A;  4F7U F;  1GL5 A;  4M77 E;  1MHN A;  1VQP A;  1GCQ C;  2EQM A;  2EYX A;  3VV0 A;  3UPU A;  2DJQ A;  4X9D A;  1MV0 B;  3PTA A;  1PHT A;  1SPK A;  2DD5 A;  4M7D G;  1UFF A;  2CZ1 B;  4C0D B;  5KYW B;  2BE9 B;  4HT9 A;  1SSH A;  4QKU A;  2QEX T;  1U3O A;  2K9G A;  1KC8 U;  2V26 A;  2QA4 A;  4EMK A;  1MMN A;  4DOW A;  3PE0 A;  2EJG A;  4PNO A;  2RQR A;  4FSX A;  4E7J A;  1EX4 A;  2ZPB B;  1QVF P;  2HDA A;  4M7D F;  2MIO A;  1RLQ C;  1OYX A;  3VS3 A;  2JTM A;  4OB0 B;  4R0K A;  2FG0 A;  4FM4 B;  5GAN e;  5D6Y A;  1RI0 A;  1WQ7 A;  4EDU A;  2HD0 A;  1ZSZ B;  3MCA B;  3QWY A;  4E2F B;  2X4Y A;  4N4I A;  2F1L A;  2COY A;  1BCO A;  1KSW A;  1IGQ A;  2IG0 A;  3MET A;  1XTD A;  5FWB A;  2KE9 A;  4DQ2 A;  2IVW A;  5LJ5 h;  4Y91 A;  1W2B A;  1MNE A;  1K9M U;  4J7I A;  1RAE B;  3EG3 A;  1C6V X;  4M7D E;  2LMJ A;  2CP6 A;  2CZ0 B;  3EGU A;  3QYG B;  2JS0 A;  4LUD A;  3OYF A;  4KRT A;  3EFO B;  4ZNX A;  2K79 A;  1BI0 A;  3ZFJ A;  1SF9 A;  3CMA A;  1V29 B;  4FYX B;  1FYN A;  2EVR A;  2RHX A;  1FX7 A;  3OYE A;  4CRI A;  1VQ8 T;  1OQK A;  1UGS B;  3SWN C;  4KUD K;  3LGF A;  3UAT A;  3SB2 A;  4CC2 A;  3J80 E;  3CCQ T;  3M55 A;  3H8Z A;  1UEB A;  5IHI A;  3VS7 A;  1YJN Q;  4E7S A;  4RTY A;  2KVQ G;  2X4W A;  1OX8 A;  2HEQ A;  3FRN A;  3G1J A;  1SEM A;  4Y92 A;  5FWC A;  1B34 B;  1T0J A;  1BU1 A;  4M77 G;  3FB9 A;  5D7U A;  1MND A;  2DYI A;  3BY7 A;  1WJS A;  1NJI U;  2EIF A;  5CKE A;  1BCM A;  2X3W D;  4J9E A;  5GMK j;  3OYJ A;  4EMK C;  3CC2 T;  2HKN A;  1YJW A;  2DA9 A;  1BYM A;  2E41 A;  5CIU A;  1N8R U;  1VQO Q;  2OTL A;  2ZCF B;  2G3R A;  3CCU Q;  3LLR A;  5DM7 R;  1Q82 R;  1QLY A;  3OYA A;  3OW2 S;  1M3B A;  4DBH A;  2OTJ A;  1LPL A;  1WIE A;  4C8Q G;  1WHH A;  4RUG A;  3VJP A;  2F2V A;  2PUO B;  2QAS A;  1X43 A;  1VQ6 Q;  5FRO A;  1A0N B;  2LRQ A;  2K2M A;  1YJW Q;  1KD1 C;  4A4E A;  3QZ5 B;  1HYO A;  4C0D C;  1IHW A;  2OJ2 A;  3SWN B;  4M7A B;  1U8R A;  1TWB A;  1VIE A;  2A08 A;  2RD1 A;  4C0Z A;  2DK3 A;  3C95 A;  2BKD N;  1PM3 A;  2J6O A;  1Y0M A;  4LDX A;  2M0O A;  1YI2 A;  1G2B A;  3RKX A;  2JM8 A;  7AT1 B;  1YFN A;  2RI2 A;  3A8O B;  2V8K A;  5L8R E;  1D3B B;  2GTO A;  4PKC C;  3MEA A;  2RHI A;  5LJ3 d;  3E1S A;  1CSK A;  4KUI A;  2RN8 A;  2E5Q A;  4RTT A;  2DXC A;  4BDY A;  5LJ5 f;  4E6R A;  1M1K R;  4M78 E;  4NOY A;  3CPF A;  3BDL A;  2NUT A;  3OYL A;  4FYY B;  3E19 A;  4M78 F;  2JW4 A;  1Q95 G;  3M57 A;  3CCR A;  5GAM j;  1Q81 U;  1GFC A;  3ZL7 C;  1VQP T;  2HQX A;  4MDW A;  2QK0 A;  2RA2 A;  1QCF A;  3MP8 A;  1AWO A;  4RTW A;  2OTJ T;  3EFO A;  1VYU A;  4IUR A;  3PMI A;  1AZE A;  2CSQ A;  1TTH B;  2LX9 A;  2MYS A;  2Y90 A;  4MZP A;  1JB0 E;  3OS5 A;  4QQ6 A;  4RG8 A;  4HXJ A;  1KQS P;  1X6B A;  2IIM A;  4GLM A;  1OV3 A;  2QA4 T;  3JB9 D;  2EYZ A;  3EG9 B;  2X9H A;  1M4Z A;  5IHN A;  3S3N A;  2LCC A;  2QQR A;  3VS0 A;  1IHV A;  4JRK A;  4JJD A;  3MEV A;  2KRO A;  2MMP A;  2AKL A;  1KD1 U;  4C5I A;  4MZT A;  5LJ3 g;  3G6E T;  3A98 A;  5LJ3 e;  4OF1 A;  4A54 A;  4M7D A;  1Q86 R;  4IUP A;  1OPK A;  2CP0 A;  4AFU C;  5FRM A;  2JXB A;  5CK9 A;  2F69 A;  5LJ3 h;  3X28 B;  5D6X A;  1I1J A;  3NMZ C;  3E9G A;  2P0Q A;  4ORZ A;  4QW2 A;  4M7D C;  4P5N A;  4RTZ A;  2LX7 A;  3OMG A;  4LE9 A;  2X51 A;  4MZM A;  4PJO G;  2VB6 A;  3JCM Q;  1F1B B;  1YNZ A;  1AHJ B;  2AZV A;  1ZSG A;  1EIF A;  1NJI R;  3CCM Q;  4JJN K;  2FO0 A;  2VGN A;  1H92 A;  5GMK h;  1M5Q 1;  4J8O A;  1EZZ B;  1N5Z A;  3JCM c;  2EJF A;  4J9H A;  2GQI A;  3F70 A;  3INZ A;  2YHT A;  4TVR A;  3A1P A;  5IT9 E;  2WAC A;  4PJO F;  1I5O B;  5DLO A;  2KRN A;  4JJB A;  4KGZ B;  2HQE A;  3NGP A;  5I2S A;  1H3Z A;  3L2R A;  3NTH A;  4F7U G;  3I56 Q;  4PJO E;  3CC4 A;  1RAD B;  4HT8 A;  4BUG A;  4J7F A;  3G4S A;  3H9N A;  2XDD A;  3JCM J;  4M77 D;  3M4G A;  4NL2 A;  1YBY A;  1QKW A;  4LDV A;  2R5A A;  3CCL A;  3DKM A;  4FL6 A;  5IXF A;  1OOT A;  2J06 A;  5D6W A;  2KRS A;  3VS1 A;  4OGE A;  1DJ7 B;  2X4J A;  2PUK B;  2K3B A;  2BE7 D;  3CBM A;  5DLQ E;  2ZPE B;  1CKA A;  2EQK A;  1S72 A;  4CC4 B;  3VRY A;  1BI3 A;  1D09 B;  3TQ7 P;  1UTI A;  4OGC A;  4OP0 A;  1I8F A;  2J6K A;  5LJ3 j;  2MAM A;  2LDM A;  3FC3 A;  2QGG A;  1H64 1;  1R0C B;  5GAN f;  2E6Z A;  5CQX A;  1RLP C;  4F17 A;  3RMQ A;  4FIB A;  3GIB A;  1X75 C;  1U1T A;  1I0C A;  1NE8 A;  4AFS C;  4N0A A;  1VQO T;  1M8V A;  2QI2 A;  3QG1 A;  3JCM P;  2M9U A;  4RTU A;  3OSV A;  2DBK A;  2KGT A;  2KXD A;  2FRW A;  4XTV A;  3JV3 A;  4RTV A;  3PIO A;  3JCM g;  1K1Z A;  3M58 A;  1G5V A;  1BI2 A;  1XNI A;  3JCM e;  1VQ5 T;  1D0X A;  4J9I A;  3JSC A;  1OUL A;  5A0G A;  4BAC A;  4ESR A;  3OYN A;  2EPD A;  3CD6 T;  5GAM e;  1KG1 A;  2QAZ A;  5GAM g;  1WFW A;  1NEG A;  3MKD A;  4M7A G;  2RHU A;  1VQN A;  3FIF A;  1G3T A;  3C12 A;  1VIF A;  1K73 R;  3M0Q A;  2YUP A;  2E6N A;  2DJZ A;  4EPC A;  1X2K A;  1VQP Q;  3VYH B;  3HKS A;  2KT1 A;  1VQK A;  2LJ3 A;  1X27 A;  1WZO A;  2BZX A;  3OYK A;  1D0Y A;  4ZTJ A;  3JB9 G;  2XD0 A;  1W2B S;  1X69 A;  2JNG A;  2E70 A;  4OB3 B;  2O01 E;  2VV5 A;  2E10 A;  4KT0 E;  1WJR A;  1QMC A;  1IB8 A;  4BI3 A;  2OTL Q;  4RMO A;  1AEY A;  3CCE Q;  4ATO A;  4Z88 A;  2RJF A;  1U1S A;  3QJY A;  4BI8 B;  2EW3 A;  4J6Y A;  5IN1 A;  4B9X A;  3OS2 A;  2L5Q A;  5GMK m;  4LD6 A;  1VQ7 T;  2DMO A;  4C8Q F;  2JN0 A;  1YIT Q;  3LWH A;  8AT1 B;  1OPL A;  5I11 A;  3M0T A;  1RAG B;  2DAQ A;  3X25 B;  3HTR A;  4M77 A;  4O6J A;  2LQW A;  1M27 C;  1VQ8 Q;  4QVZ A;  2VGM A;  1VQ9 Q;  1ACM B;  2DZ9 A;  1N27 A;  4GBQ A;  2KAF A;  2DYB A;  5GAO l;  3H6Z A;  2BTT A;  1PC0 A;  4GLK A;  3I55 Q;  1NG2 A;  4JZ4 A;  1AZG B;  4D6W A;  3E9F A;  3CC7 T;  2CDT A;  5GAN h;  2RNA A;  5GAO r;  4M78 D;  5AT1 B;  4B9W A;  3AT1 B;  3OYH A;  3SWN A;  1Z9Q A;  1NLP C;  2DXB A;  3MPU B;  4RTX A;  3MEU A;  2ROL A;  3V7C A;  1WNL A;  3OYB A;  1QVG A;  2K4Y A;  3GBQ A;  2EFI A;  3ME9 A;  3L2V A;  3CXC A;  4OML A;  3M0S A;  2CS7 A;  5KE2 A;  2DXU A;  4C0F A;  2GCX A;  4LN2 A;  2CP5 A;  4M75 E;  2LNH B;  2MOX A;  4M78 G;  3SEM A;  1M1G A;  3CC2 Q;  1BIB A;  4XTW A;  3JAM E;  3JB9 I;  2FPF A;  3GPL A;  5GAO m;  3KFV A;  1KHC A;  3JRZ A;  4OMF B;  5HY6 A;  3BE3 A;  5KYW A;  3V8J A;  1YHQ A;  1RAF B;  4M78 B;  4WCI A;  2RI5 A;  1YCY A;  2ZPH B;  3RR6 A;  2EYY A;  3GOX A;  3CCJ Q;  3X26 B;  3LW5 E;  2DX1 A;  1PRL C;  1ZUU A;  1VQ6 T;  1XQH A;  1B07 A;  3M0R A;  5EG2 A;  2LC4 A;  4PJN A;  1YIJ T;  2AZS A;  1VQ5 A;  1OU8 A;  2XIC A;  2R57 A;  1OX9 A;  1NZ9 A;  1RAB B;  2FZK B;  2DIL A;  5LL6 S;  2COZ A;  3THK A;  3CC7 Q;  2XID A;  2VAS A;  3NTK A;  1AT1 B;  3OBY A;  1GCQ A;  3CMA T;  2CP3 A;  3VUZ A;  5HCK A;  1UGR B;  5KH6 A;  3A8G B;  4E7Z A;  1TXQ A;  2RI3 A;  2L3S A;  1WHK A;  4PJO A;  2QQA A;  3OA6 A;  1TU0 B;  3LX7 A;  2CSI A;  1VOM A;  4A4F A;  5FU6 C;  2K2V A;  3I35 A;  2E12 A;  2LQ8 A;  1S72 Q;  2LNV A;  3L2Z A;  5CKD A;  3MHX A;  5DY9 A;  1RAC B;  3OYG A;  1SKU B;  2CKK A;  2WSC E;  3CCV Q;  5KYY A;  2XG8 D;  3J81 E;  4L59 A;  4NL3 A;  2F5K A;  4C92 G;  4M78 C;  3JCM W;  2GNC A;  2LT4 A;  3RES A;  5GAM f;  2HQH A;  1R8O B;  2RK2 A;  1YIJ Q;  2YUN A;  4JDS A;  5KYY B;  5GAN 3;  5M9O A;  3O5Z A;  3CEY A;  2JM9 A;  1BKB A;  2B8A A;  2QQB A;  3CBO A;  2A36 A;  2IPO B;  1W70 A;  2ED0 A;  1MUZ A;  3H0F A;  3V8K A;  2LVM A;  2DL5 A;  3N5B B;  1RI9 A;  3QHS A;  1IGU A;  3QPH A;  1VA7 A;  3CD6 A;  2KT8 A;  2FHD A;  4XAX B;  2MWP A;  4LDW A;  4ZTF A;  1ZLM A;  4J6X A;  4PFZ A;  2DZC A;  1WJQ A;  1PCX A;  5IH2 A;  2KK4 A;  2V8I A;  1QCO A;  2K5L A;  3CCR T;  4QQG A;  1YJN T;  1KQS S;  3KUF A;  4EMK B;  1M90 R;  4PLI A;  4M7A D;  3OSS C;  3L2W A;  2KEA A;  1LCK A;  2QTX A;  3CCM A;  1RUW A;  2DD4 A;  3AHU A;  1AWW A;  4M7D D;  5CKB A;  5I21 A;  2KY9 A;  2PVG B;  2MK5 A;  2RQW A;  4C0G A;  5FU7 B;  2DET A;  2NUT B;  1JXM A;  3LGL A;  5IAY A;  3J7A F;  2VYT A;  4FU6 A;  3TCJ A;  1ZBX A;  2DVJ A;  2GGR A;  2K7A A;  1Q7Y R;  2BZ8 A;  2KSS A;  2LZ6 B;  3DB3 A;  4M78 A;  2YUQ A;  1UEC A;  2BUD A;  4OVA A;  2YDL A;  3H41 A;  4WTO B;  1UG1 A;  2DL3 A;  2NLU A;  3Q1J A;  2CUD A;  2HBP A;  2XDP A;  4N4G A;  2CZ6 B;  1UE9 A;  1BBZ A;  1KC8 R;  2MF2 A;  1VQM A;  4EMG A;  1IRX A;  4FT2 A;  2EAY A;  2O31 A;  1TUG B;  2RQU A;  4DEY A;  4CC3 A;  2XHC A;  4F04 B;  1K73 U;  4E7H A;  2H3E B;  4KUL A;  2VUB A;  1V76 A;  4M75 F;  2C06 A;  1PNJ A;  1YIT T;  5GAN d;  1PD1 A;  1M3A A;  2GFU A;  3GF5 A;  1N6A A;  1WPY A;  5HK3 A;  2KYM A;  1WHG A;  3RMS A;  2CP2 A;  1EFN A;  3JCM f;  1TUD A;  1D0Z A;  1S1N A;  1PD0 A;  3EGX A;  4C5H A;  2L0A A;  5FW9 A;  3CXC S;  2RQT A;  4XTY A;  3EG1 A;  2GBQ A;  3I55 T;  2RHY A;  1WLP B;  4KH1 B;  2XMF A;  3M54 A;  4PJO B;  2WSE E;  2A7Y A;  1UGQ B;  2E5K A;  4F7U B;  5HK0 A;  1M3C A;  5J26 A;  4HVU A;  1UUE A;  2XU8 A;  3VKI A;  3L1A A;  5GAO p;  2YLC A;  2L3R A;  2DEU A;  1H3H A;  1SHG A;  4PFP A;  2RJD A;  1SRM A;  4JLG A;  5CCA A;  1G3W A;  2JUF A;  3H0H A;  3EGD A;  1UHF A;  1KFZ A;  4JS4 A;  3I5R A;  3CC2 A;  4FYW B;  4A53 A;  5GAN 5;  2D0Q B;  4QVD A;  4ZN1 A;  2ZPI B;  3M0U A;  2L3Q A;  4C92 D;  5J39 A;  4MDX A;  3H0I A;  1TOV A;  3PT9 A;  1VQN Q;  2H3J A;  3RDV A;  3FJ5 A;  3CBP A;  1ZSZ C;  4C92 B;  2DIG A;  4J9F A;  1KQ1 A;  2DL8 A;  1VQ4 Q;  2YRC A;  4X9C A;  4HCK A;  2P0P A;  1WA7 A;  3OBW A;  4J9C A;  1R0B G;  1VQ5 Q;  2V1R A;  3BW1 A;  3QO3 A;  3WVE B;  2OI3 A;  4JUV A;  2D1X A;  2JMC A;  4LD9 K;  1ZSZ A;  4BY6 B;  2A0F B;  2EKH A;  2NUZ A;  4DBF A;  3VYG A;  1I07 A;  5L23 A;  4QQD A;  3ZEH A;  3FLG A;  4D8K A;  5IHK A;  1YP5 A;  3QXE B;  3REA B;  5EC7 A;  1D3B A;  3L42 A;  1IXD A;  2V8J A;  4M77 B;  1TH7 A;  1YJ9 T;  2F5T X;  3C4S A;  2E64 A;  2M0Y A;  4RKU E;  2J05 A;  2EGE A;  2JTF A;  4KH0 B;  6AT1 B;  1M2V B;  4HVV A;  3NFC A;  3QZ9 B;  3MP1 A;  1ARK A;  3L2U A;  1QVP A;  2HSE B;  5A0D A;  2RPN A;  2QDL A;  4F16 A;  4OMQ A;  1UJY A;  4XU0 A;  1M8M A;  3A8M B;  2RM4 A;  3REB B;  1QVF S;  1KHI A;  1Y57 A;  5GAN 8;  2GFA A;  3L2Q A;  4BE0 A;  2ABL A;  3VS6 A;  4PJJ A;  2K6D A;  4XU3 A;  3SHW A;  1VQ7 Q;  4ZGJ B;  3CCL T;  1ZBJ A;  2DM1 A;  2F2W A;  4E7I A;  2AHJ B;  1WHJ A;  2K57 A;  2DF6 A;  1OI1 A;  2I0N A;  1J3T A;  2D0N A;  4E7L A;  1SRL A;  1JBM A; 
#chains in the Genus database with same CATH homology
 1WDX A;  1M27 C;  1V1C A;  1FYN A;  2EVR A;  2O88 A;  1CKB A;  4J9B A;  4GBQ A;  2DYB A;  2CT3 A;  3RNJ A;  2BTT A;  3UAT A;  3UA6 A;  1TG0 A;  1OEB A;  4CC2 A;  1NG2 A;  4JZ4 A;  1AZG B;  5GJV B;  5IHI A;  3VS7 A;  2CDT A;  2RQV A;  2RNA A;  2L3P A;  4RTY A;  4CC7 A;  1Z9Q A;  1NLP C;  4LNP A;  2CH4 A;  2HEQ A;  4Y92 A;  1SEM A;  4RTX A;  5FWC A;  1T0J A;  1JQQ A;  2HSP A;  1BU1 A;  2ROL A;  2ECZ A;  3GBQ A;  2YT6 A;  1NLO C;  3VS5 A;  4OML A;  3M0S A;  5ECA A;  2LCS A;  2LQN A;  2X3W D;  4J9E A;  1NM7 A;  4LN2 A;  3NHN A;  1E7O A;  1UJ0 A;  2LNH B;  2MOX A;  2O2O A;  5IXB A;  2DA9 A;  3SEM A;  1TUC A;  1T0H A;  1HD3 A;  2KYB A;  2FPF A;  2KXC A;  2J6F A;  3KFV A;  1KIK A;  2YSQ A;  2H8H A;  1QLY A;  2AK5 A;  2KRM A;  1FMK A;  4WCI A;  2EYY A;  1M3B A;  2V1Q A;  1WIE A;  2JTE A;  1T3L A;  1GBR A;  1YCS B;  4RUG A;  2DX1 A;  1PRL C;  2F2V A;  1ZUU A;  4HVW A;  1VYT A;  2J7I A;  2M51 A;  1B07 A;  2FRY A;  3M0R A;  2X3X D;  1X43 A;  4QT7 A;  4AFQ C;  1U5S A;  1A0N B;  2AZS A;  2K2M A;  1MV3 A;  4M4Z A;  3QWX X;  2CH4 W;  2OJ2 A;  2VVK A;  1UHC A;  2PTK A;  2DBM A;  3TVT A;  2DIL A;  3THK A;  2ED1 A;  1QKX A;  2A08 A;  2RMO A;  1JO8 A;  2HBW A;  4LUE A;  2J6O A;  1B3Q A;  1GCQ A;  1Y0M A;  2L2P A;  3C0C A;  1K0X A;  1PKS A;  1G2B A;  5HCK A;  1UDL A;  2JM8 A;  2L3S A;  1AD5 A;  1AWX A;  2GTO A;  4IIO A;  1X6G A;  2D8J A;  2GTJ A;  1CSK A;  2CSI A;  2EYW A;  1AVZ C;  3I35 A;  1AWJ A;  2RN8 A;  4RTT A;  3CQT A;  1QWF A;  3IQL A;  3RBB B;  1U06 A;  1WI7 A;  2JMA A;  1W1F A;  4E6R A;  1JU5 C;  1GFD A;  2JW4 A;  2A28 A;  1PRM C;  2GNC A;  1PKT A;  1GFC A;  3ZL7 C;  2FPD A;  1AOJ A;  2DNU A;  1QCF A;  2YUN A;  1AWO A;  4RTW A;  2PZ1 A;  3UF4 A;  1ZUK A;  2A37 A;  3O5Z A;  1NYF A;  2SRC A;  1E6G A;  1VYU A;  2JM9 A;  1AZE A;  2CSQ A;  1K4U S;  2CRE A;  2A36 A;  4HXJ A;  2DL7 A;  1X6B A;  1W70 A;  2IIM A;  4GLM A;  2HCK A;  1OV3 A;  1MUZ A;  2ED0 A;  2F2X A;  3H0F A;  1WYX A;  2DL5 A;  2EYZ A;  1RI9 A;  5IHN A;  2CUB A;  1VA7 A;  2KR3 A;  3VS0 A;  2KT8 A;  2DLP A;  2P4R A;  4JJD A;  4A63 B;  2JS2 A;  2KRO A;  1GCP A;  1ZLM A;  2EQI A;  2ESW A;  1HJD A;  5IH2 A;  2AKL A;  1Z9Z A;  4AFZ C;  1K0S A;  3I5S A;  3A98 A;  2KEA A;  1LCK A;  3EG2 A;  3UA7 A;  1ABO A;  1K9A A;  1RUW A;  1AWW A;  3M0P A;  1OPK A;  4AFU C;  2VWF A;  4EIK A;  4D8D A;  2RQW A;  2JXB A;  2W0Z A;  4JZ3 A;  1I1J A;  1JXM A;  3NMZ C;  4J9D A;  3TSZ A;  4ORZ A;  2DVJ A;  4RTZ A;  2GGR A;  2K7A A;  2LX7 A;  2BZ8 A;  4K11 A;  2LZ6 B;  4LE9 A;  2YUQ A;  4OMM A;  1UEC A;  2YDL A;  3H41 A;  1YNZ A;  1UG1 A;  2AKK A;  2SEM A;  2AZV A;  1NEB A;  1ZSG A;  2DL3 A;  2CUD A;  1YWP A;  2FO0 A;  2DE0 X;  2NWM A;  3EG0 A;  1H92 A;  1UE9 A;  3VS4 A;  1BBZ A;  1N5Z A;  2W10 A;  1IO6 A;  2RF0 A;  4J9H A;  2GQI A;  2PNI A;  3U23 A;  1T3S A;  2O31 A;  1GRI A;  2RQU A;  4AG1 C;  4DEY A;  4CC3 A;  2KRN A;  4JJB A;  3NGP A;  1KJW A;  4Z8A A;  4FSS A;  2D8H A;  1PNJ A;  2G6F X;  3EHR A;  1WXB A;  1M3A A;  1GBQ A;  1NYG A;  2KYM A;  1QWE A;  1BK2 A;  4OMP A;  4F14 A;  1SHF A;  1EFN A;  1TUD A;  1QKW A;  1S1N A;  4X1V A;  3PVQ A;  5IXF A;  2ENM A;  1OOT A;  2J06 A;  2L0A A;  4OMN A;  5FW9 A;  2DRM A;  2KRS A;  3VS1 A;  2RQT A;  3EG1 A;  1W6X A;  2EGC A;  2GBQ A;  2K3B A;  2VKN A;  3I9Q A;  1WLP B;  2XMF A;  2YUO A;  2KNB B;  1ZX6 A;  1CKA A;  4JPB W;  2JT4 A;  2E5K A;  2C0I A;  4CC4 B;  3VRY A;  5I22 A;  1UTI A;  1H8K A;  1M3C A;  2J6K A;  2LJ1 A;  3PVL A;  4HVU A;  1UUE A;  1XOV A;  2BZY A;  4DEX A;  5GJW B;  2B86 A;  1YWO A;  4JJC A;  1H3H A;  2ROT A;  1SHG A;  3R6N A;  1VYV A;  2O9V A;  1SRM A;  1RLP C;  1PWT A;  1WXT A;  4F17 A;  3NPF A;  1M30 A;  3H0H A;  2CT4 A;  1UHF A;  1KFZ A;  1I0C A;  3I5R A;  1WXU A;  1X2Q A;  3TSW A;  4AFS C;  1HSQ A;  2FPE A;  1BB9 A;  2C0T A;  3M0U A;  2L3Q A;  4OMO A;  3VRZ A;  4RTU A;  1E6H A;  2DL4 A;  3H0I A;  3EHQ A;  2DBK A;  2KGT A;  2KXD A;  1YN8 A;  2FRW A;  3FJ5 A;  3JV3 A;  1G83 A;  4RTV A;  1WX6 A;  4J9F A;  4AG2 C;  2DL8 A;  1K1Z A;  2LJ0 A;  4HCK A;  1GL5 A;  3LH5 A;  1WA7 A;  1GCQ C;  4J9C A;  4J9I A;  2EYX A;  2V1R A;  2DJQ A;  2OI3 A;  2D1X A;  2JMC A;  1MV0 B;  1PHT A;  4ESR A;  2LP5 A;  2EPD A;  1SPK A;  3VS2 A;  2EKH A;  1UFF A;  2NUZ A;  1I07 A;  1WFW A;  5L23 A;  1SSH A;  1NEG A;  2KBT A;  1U3O A;  2K9G A;  4D8K A;  5IHK A;  1ABQ A;  1YP5 A;  3REA B;  5EC7 A;  3M0Q A;  4J9G A;  3PE0 A;  2RQR A;  2YUP A;  2HDA A;  1X2K A;  2MIO A;  1RLQ C;  2KT1 A;  3VS3 A;  2LJ3 A;  1ZUY A;  2M0Y A;  4R0K A;  1X27 A;  2FG0 A;  2BZX A;  1K76 A;  2J05 A;  2EGE A;  1X69 A;  4HVV A;  3QWY A;  4Z89 A;  4IIM A;  1ARK A;  2EBP A;  1JXO A;  1JEG A;  2OAW A;  2MCN A;  2RPN A;  1KSW A;  1AEY A;  1UGV A;  2QDL A;  4F16 A;  4Z88 A;  4OMQ A;  1UJY A;  1M8M A;  2EW3 A;  2DRK A;  2FEI A;  3REB B;  5FWB A;  2O9S A;  2KE9 A;  2EGA A;  1Y57 A;  2ABL A;  3VS6 A;  2DMO A;  2K6D A;  3EG3 A;  3SHW A;  2LMJ A;  1ZBJ A;  3EGU A;  2DM1 A;  2C0O A;  2F2W A;  2JS0 A;  4LUD A;  4KRT A;  1OPL A;  5I11 A;  3M0T A;  4ZNX A;  3ULR B;  2DF6 A;  2K79 A;  2I0N A;  1J3T A;  2D0N A;  2LQW A;  1SRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...