1PWYE

Crystal structure of human pnp complexed with acyclovir
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
288
structure length
288
Chain Sequence
b'ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Crystal structure of human purine nucleoside phosphorylase complexed with acyclovir.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pwyE00
4YJKA 1V48A 4TXJA 4GLFA 4R2XA 1TCVA 2OXFA 4IP0A 4L6IA 1PR2A 4QEZA 1OVGA 4M1EA 5KB3A 4EB8A 4TXHA 2ISCA 3P0EA 3PHCA 3BSFA 1A9QA 2IQ5A 1Y1RA 3E9RA 4QARA 2I4TA 1TGVA 2HN9A 4L5CA 4DAEA 1V4NA 1OTYA 1YQQA 2OECA 4E1VA 4OGKA 3SCZA 3BL6A 1V3QE 4QFBA 3IOMA 3LBAA 3TL6A 4GLJA 3LGSA 1NC3A 1T8YA 3T94A 1JP7A 3EUEA 2QPLA 2AI3A 3OZCA 3NM5A 1ULAA 4GMHA 4H1TA 3INYA 4YO8A 1JE1A 1RR6A 1PR1A 1PR0A 4TXLA 2ON6A 3OZEA 3UAZA 2Q7OE 1PBNA 4G41A 4F3KA 4WKNA 3DDOA 5JPCA 4OJTA 3KUKA 1Y1QA 1V45E 4QASA 4D8XA 1RXSA 1YRYE 4GKAA 4QATA 1JE0A 3UAXA 2AI2A 4G8JA 4D8VA 1T8SA 4EARA 1SJ9A 1OUMA 1YQUA 2GUWA 3IEXA 4DARA 4I2VA 4OY3A 4ECEA 3UAWA 2BSXA 3F8WA 3O4VA 3C74A 5F7XA 1G2OA 5B7GA 1K27A 1V2HE 4WKOA 1U1GA 3K8QA 3NM4A 4NY1A 4P54A 4OEHA 4LDNA 4K6OA 1PR6A 3UAYA 1RXUA 3OPVA 5DK6A 5CYGA 1SQ6A 1LV8A 1NC1A 4KN5A 5F73A 5CXQA 1RCTE 5F7OA 4X24A 1JDVA 3ONVA 2A0XA 3E9ZA 3OCCA 2B94A 1CB0A 3KVYA 1SD1A 1PWYE 4JOSA 4DA8A 1NW4A 3KVVA 5B7QA 5F77A 3BGSA 1CG6A 1Z34A 4BMXA 1T8RA 2AI1A 4R31A 3FWPA 1RFGE 3QPBA 2RJ3A 1Y1TA 1PW7A 1Z5OA 4BMYA 3BJEA 1U1DA 5F78A 5F7ZA 1WTAA 3P0FA 4JWTA 5IFKA 3D1VA 1A9TA 4RJ2A 2HRDA 1A9OA 1JDTA 5ETJA 4DA0A 1OU4A 4WKBA 1Z38A 3KU4A 3EEIA 1FXUA 3FUCA 1JDSA 2QTGA 1RYZA 3DJFA 1I80A 4LZWA 4NS1A 1Y6RA 1RXYA 3OF3A 3U40A 3DPSA 3FOWA 2OC4A 4DAOA 1LX7A 3PNSA 1N3IA 4OGLA 1A9PA 3EMVA 1PF7E 1RT9A 4FFSA 4F1WA 4TTIA 4LNHA 2HSWA 5EFOA 1TGYA 5B7NA 4DABA 5CCEA 1ODIA 3DF9A 3DP9A 4BN0A 1A9SA 3PHBE 4WKPA 1V41E 2QDKA 1TD1A 2OC9A 1XE3A 3E0QA 2P4SA 3MB8A 4L0MA 2XRFA 1YBFA 2QSUA 4DANA 1VHWA 4F2WA 1ODJA 1U1CA 1U1EA 1ZOSA 4YNBA 1Z39A 1Q1GA 1JDZA 3MMSA 4MCHA 1JYSA 2I8AA 3LA8A 1VHJA 1M73E 2A0WA 1RXCA 1ZL2A 2H8GA 4TS9A 1PR4A 1QE5A 1PK7A 4NSNA 1OTXA 1Y1SA 4U2KA 4TXNA 3EUFA 5F76A 1TCUA 3GGSA 4TTAA 3KHSA 5EPUA 3K8OE 1U1FA 2A8YA 1T8WA 3NM6B 4M3NA 4M7WA 4TS3A 1PKEA 1A9RA 4TTJA 4PR3A 4PNPA 1C3XA 2HWUA 3OOHA 3OZBA 1B8NA 4G89A 4L5AA 3UT6A 4OF4A 5IU6A 2PGAA 1Y6QA 4QAQA 4TYMA 1ULBA 1JDUA 1Z5PA 4DA6A 1K9SA 1ODLA 2QTTA 1PR5A 1ODKA 4F2PA 1Z36A 1JPVA 1RSZA 1SD2A 4JP5A 5EUBA 1T0UA 1B8OA 1A69A 5C80A 1Z37A 3GB9A 4LKRA 1Z5NA 1YR3A 3O6VA 4LNAA 3PNPA 4MCIA 4L5YA 5CXSA 1PK9A 1OV6A 3FAZA 1Z35A 5CYFA 5CCDA 3OOEA 3NBQA 4D8YA 4D9HA 4DA7A 5F7JA 3FNQA 2A0YA 2AC7A 4WKCA 4F3CA 5K1ZA 5B7PA 4D98A 3FB1A 3KVRA 4YMLA 3ODGA 1VMKA 5I3CA 1ECPA 4MARA 4UC0A 1VFNA 3ENZA 3OZDA 1Z33A 4BMZA 1LVUA 1K3FA 5FAKA 3UAVA 4TXMA 4R2WA
chains in the Genus database with same CATH superfamily
4I08A 1DXQA 2X76A 3O38A 1RTTA 5JFTA 4FMDB 1H05A 3MTJA 3QE9Y 1CK4A 2QTFA 2ZWOA 1WPXA 5NLLA 3RUEA 1NVVR 1T9BA 1N2JA 3IIIA 1Z5ZA 2BKVA 2D1QA 3UB4A 4DWWA 4HAYA 1EVJA 2O2DA 1DC6A 2R6HA 4G1UC 5AXAA 3TLMA 5IT5A 3AONB 4IZHA 1E9RA 2J31A 3E1KA 4D79A 3VSDA 4GZ3A 4Z7QB 4YMWA 4O4IF 1DX4A 4LYAA 4G36A 1JA0A 3B5EA 4TMXA 1GRRA 2IE8A 3KDAA 1UKEA 2ZR7A 2G7ZA 1JVSA 2OCIA 3LC7O 2R6CA 4RD2A 5EKTA 4HWOA 4V38A 4P8RA 2OO7A 1NFFA 3OIUA 4JL8A 3FZQA 4S2UA 2B25A 1XU9A 1QFZA 2C8VA 3BAZA 1UJ4A 4P83A 1DQSA 2FE4A 4QOGA 5ALUA 4BO5A 1JSCA 5AI8A 2I3AA 1Y1LA 1Y1RA 2ADOA 2P9QA 1IBCA 2DPXA 2G5CA 4G25A 3CBQA 3DDNA 1AHNA 3L4BA 4PTYA 4ZO8A 1UK8A 1M9NA 3VO1A 1J70A 1ZGAA 2ZQ5A 5KU1A 4EP1A 1TGVA 2D00A 3CWCA 1O9BA 4BFVA 4BEVA 1ORVA 3S28A 4RDXA 1RIFA 3OPYA 4C7MA 4KWTA 1E1QD 2JEOA 4YK7A 3QIAA 1N2CE 1WEKA 3HQ4O 3N0VA 3OTWA 4OQEA 3PUKA 2JLUA 4QFBA 5JG7A 2Q5FA 4AZ0A 2Q8QA 3ZI4A 1BMFD 1JU4A 1M74A 1T3LA 3H9EO 4I9HA 4O1IA 1QYVA 2P7IA 1ONNA 5TV2A 4PRYA 4GPEA 3W8NA 4PZYA 2M6SA 3FKJA 3QMWA 5E6RA 2QYTA 3TXAA 2VP2A 1J2TA 1UKBA 3DVRX 4Q00A 5ELXA 2F1RA 3MK31 1S8OA 3F3SA 1DJNA 1CY4A 2ZZKA 3SSAA 1QR6A 3CM0A 1XTPA 3QYPA 5FWYA 5LOVB 2HSEA 1W19A 2FVYA 4ZVRA 5JU6A 1RLTA 4JXJA 3GRRA 4RAQA 2JFZA 4IYRA 1SVLA 2O2CA 4UCXA 1S7GA 2J0VA 1OYYA 3HYLA 4I9UA 4IWYA 1GVNB 2QVZX 1GL3A 2UVQA 1MNQA 2FRDC 1QP7A 2GERA 3KAKA 2O3JA 4NG4A 1TC2A 3HU1A 3SYTA 1Q15A 3HJGA 3P4XA 3D2CA 4EWLA 3LFHA 1LI7A 2WVAA 4N7JA 2RHMA 4ENWA 2QD3A 3B12A 2XNCA 3CRRA 3TZKA 3EOZA 4CMCA 4MWOA 3DT8A 4G9GA 3O8DA 5HKKD 1UQTA 3S1SA 1TAUA 1WXWA 4QVGA 4BKPA 4WN9A 1PUXA 3DR5A 1JLLB 2P67A 2AMFA 2ZIGA 2VNIA 2ZKLA 4OHVA 5FLYA 2P4EA 4ID9A 2WJIA 1TUGA 3NB0A 4V02A 4JLVA 4ZU6X 4IV8A 5FTWA 5FI3A 1VMIA 4HDSB 2OUIA 4JHXA 3PXBA 1OXTA 2V65A 2ONKA 3PNLA 1N1GA 4JLWA 2ONJA 3JQDA 4TL7A 3TQCA 1Z06A 4FC6A 5BQXA 4WK6A 1QVZA 2C5AA 4TSFD 1E64A 2WWRA 4KNVA 4WZZA 2Y2VA 3D8BA 5K0SA 1E5XA 1GPJA 1KFJB 4L4XA 3U3OA 4UTNA 1MIHA 3KHUA 5TDHA 2K87A 3PDWA 3ROQA 3WIVA 2PGOA 1THZA 3JQFA 3OEHD 4QREA 4LZNA 4R40A 4X8OA 3W3AD 4I14A 2JGMA 2H16A 5JZMA 4PGAA 3QLVA 1ZA1A 3GT3A 5D8DA 4RK7A 1U28A 3T1VA 5CB4B 3BILA 1PNQA 4K0KB 1XVUA 1DIHA 4G5GA 2E55A 4Z3DA 5K0TA 1VCIA 3FCCA 1EE9A 1N92A 1VE1A 4FE3A 4N6NA 2QK4A 2GARA 3EXEB 1W5AA 4XWYA 4ZU3A 2A5JA 1V3VA 1Q12A 4CKYA 3PFFA 4DM3A 1DTWA 3VKUA 1F0PA 1PT5A 4EG5A 3H8VA 5F9HA 4NHOA 4OJNA 1AZLA 1U1GA 1UMBA 1GT6A 1KK3A 1W2HA 4PS0A 2G0TA 3KSDO 5AXDA 1I4EB 3K5IA 2PUHA 5K0BA 3K30A 3OD1A 1G5PA 4DB4A 2XDQB 1EDBA 5KTTA 1O96B 3R40A 3K71B 2AE2A 1L6RA 1QP4A 1I2CA 5GTDA 2BGLA 4RY8A 4EW3A 2ALJA 1HFJA 3TJMA 1YS4A 3AQIA 3UMRA 1ZD9A 2R1TA 3DE6X 5J2TF 1DCTA 1NU6A 1G7RA 4TVSA 4OQZA 1DARA 1E3QA 3GAMA 4RSMA 3VR3D 1EE2A 1T29A 2MOKA 3OOWA 4G0NA 1IRXA 1DINA 1RD4A 3GNLA 4MP8A 4G5QA 3F3MA 1G0OA 2JCXA 3BB4A 4II2A 4TKZA 2IYLD 4PHFA 3OMLA 3ZJVA 3RAJA 1CRPA 5J5CA 1TF7A 4DMCA 2ZUFA 3UMYA 4FOPA 3PNMA 3OAAD 4OHKA 3R3UA 1ZH8A 4L5BA 1MX1A 1Z4IA 4L3OA 1SVUA 5GONB 4ALJA 3KVYA 5ED0A 2ZXFA 7ADHA 4MQ6A 3AZOA 4IQ4A 3CUTA 2GFHA 4E5NA 4D4HA 1LLCA 3QKWA 3OKCA 3RHFA 3NTLA 4DDWA 2PSFA 1UJNA 4KR0A 1W4BA 2E0IA 1NULA 1L5MA 3FWPA 4CM8A 3ETLA 3GOHA 1FQOA 3NAMA 3AEKB 4RK6A 1KARA 1KPIA 2P4HX 4XM0A 3RSOA 4C2TA 3CR7A 3PHHA 1ZGBA 1DMRA 1U94A 1F2TA 2BFBA 3BE6A 4MQ5A 4ZC1A 5IS2A 1AZSC 1IM8A 2ZBQA 3OU7A 1U4SA 5JATA 2WYHA 3QHPA 1ZESA 1A9XA 4L95C 3S70A 1UKAA 4ZQCB 3W04A 3W2HA 1VP3A 3ASUA 1E1DA 1L5SA 4P53A 2YV3A 3TBKA 1WTAA 4JWTA 4DV7B 3EIXA 3EZGA 5HIJA 4D4LA 1TAHA 4BB0A 1ZVQA 4BQIA 5FPSA 5EYPB 3ITDA 3WC4A 1FDWA 1NJGA 1BQ4A 1N5OX 2IQIA 3W6NA 2O4UX 5HE9A 3EZNA 4QJ4A 2JBWA 3M5CA 2BGNA 3V1YA 1AUVA 4RS3A 5KVQA 5LQSA 1QHGA 3KWMA 5I7AA 5HCIA 4FEGA 4YJ3A 5C4GB 5DN6D 2IZZA 4LRWA 3M1YA 4PTZA 3DT6A 4FHGA 4L8WB 1ESZA 1ISMA 1E79D 4IOMA 9LDBA 1RYZA 5ICCA 1WP4A 2HMAA 4XD2A 1E77A 1NI4B 2QQFA 3BXFA 3EE6A 4HQNA 5H4GA 2F3SA 2GQ0A 1EBFA 1IN6A 2XUIA 4C4TA 5HQ3B 4WFQA 3GFGA 4L27A 3D1JA 3ZGVA 2C03A 3LHSA 4NESA 3RS3A 4JLMA 4DZTA 2IEZA 4KYUA 4W82A 1MJ5A 3E58A 1EFHA 3CX6A 1COZA 1SN7A 1QRTA 1JDNA 1MO3A 5IAEA 2OC4A 4HUJA 4PC7A 3RW9A 3OWHA 3GJ0A 3OE1A 1C3OA 2AJ8A 2HWKA 3A9CA 4NEGA 3OCUA 3RK4A 4YMSA 2JVKA 2WHQA 1ZCAA 1IOWA 2YYSA 4PYOA 3ESYA 2DR3A 2QZPA 3UHAA 5A4KA 4XLTA 3ZWXA 5AVSA 3DBHB 2RH4A 4YRFA 4EB6B 1ZIDA 4C0KA 4LHVA 1Y6JA 4JDPA 4QECA 1TIPA 3QGMA 3W6OA 2O59A 3OFSA 4E03A 2BISA 1TZCA 4AD8A 4JUAA 3GRUA 4M1OA 4XUDA 1GQSA 2BFEA 5FFFA 1QFMA 4HJRA 4N41A 3AETB 1JECA 3MWDB 3ZVKA 1T24A 2AR0A 2ZTVA 2QTBA 1RRKA 3DOJA 5T57A 4Z9BA 1QSGA 1YCDA 3TR5A 1RRMA 2YC4C 1OT5A 4WW0A 3PXEA 3ZTWA 3G9UA 4ZGWA 1E2UA 2I1VB 1UBEA 2VBFA 3SJCA 4BZXA 2Q4TA 4DDTA 4AJ1A 2X7JA 1LRJA 3NH9A 4RV4A 3B1VA 3TOCA 2VRCD 1ZO8A 4P3KA 2UUAB 4HXYA 1DKMA 1VHWA 2XDYA 2P9GA 1JHDA 2ROQA 3PEVA 4IVPA 1E7RA 3RVNA 3FOEC 3EG9B 2NSDA 3HHEA 4LXTA 2AA3A 2TECE 3U61B 1FTNA 3SE0A 3MMSA 3CXUA 1YJBA 2WWTA 4R2HA 1JYSA 4JI3B 1KYWA 1IUNA 1IOZA 3GN1A 3TUJC 3O2JA 1N2BA 2I8AA 4MRVA 1QRUA 1C14A 5DRYA 1M73E 1PGJA 2D1TA 2BI8A 1IG3A 1SHKA 2MWMA 5KAMA 5JCZA 4AMYA 2CE7A 4G63A 1OAKA 4L74A 3UW3A 1AKNA 4QLBA 2CUNA 1QP0A 4K9OA 1XL0A 3QXCA 5AOVA 2LW7A 2G9QA 4BAUA 3ZIAD 1F8UA 3JQ6A 4HGQA 3KJEA 1OTXA 3GDWA 3G2KA 1CQWA 5EKDA 5CVTA 1Z8DA 1J07A 3W5DA 4R8MA 4I5FA 3IUNA 1XQYA 4MI3A 5DGXA 1ECGA 1VSVA 1W0KA 3GMSA 4RJIA 5HIMA 3TOZA 5BQ5A 2F17A 3DH0A 3MOIA 1LPAB 4AKSA 3SZMA 1H2RS 1BVUA 3G5LA 1NKVA 4G0ZA 1B4DA 3KWLA 4UW9A 3ZY2A 4CNBA 2OMKA 1JFLA 5KO2A 1M8FA 2Y4NA 3RLFA 3WHLA 4JXZA 5DXFA 4WEQA 1U1FA 1VBMA 2BEJA 2PN1A 3OPMA 3H5LA 4G09A 1FCJA 2C96A 4UJ3A 2DT8A 5ITZA 3LLCA 4GG1A 4W99A 1E7QA 2VF2A 4BGUA 3FDZB 2JD2A 3AI1A 3MINA 3IRVA 8ADHA 2NQ2C 4R5HA 1QV6A 2OFFA 5CFNA 3TRFA 2LXNA 5HR5A 4TKUB 1E6LA 1W35A 3OC6A 1MO6A 2C5GA 1X1AA 1GADO 4UQPA 3TTVA 3VU3A 3PV0A 2P41A 4OF4A 1GTSA 2QM0A 5ALSA 5IU6A 2C88A 2QUAA 2C4NA 3FPEA 1AKQA 1CZKA 1Y3FE 3CZ5A 2DERA 2QZSA 2XMCA 4XDHA 5DNAA 2HEIA 1SQ0A 2P69A 3TG2A 2QMQA 1U8AA 3ANXA 2V9CA 4L28A 1HE2A 3TDNA 3TSOA 2W4IA 3AIKA 3V8NA 5KWJA 1VPWA 3IIMA 2WJZB 4NABA 4KN8A 4BHTA 4F5EA 2J4DA 5AVWA 1ELOA 1VE3A 2JFQA 2NU7A 3Q3JB 5THQA 5J2TB 1T4CA 3ZQKA 5H3CA 4P0QB 3WA6A 3TQHA 1RSZA 4LRTB 2UVDA 2BFDB 3AY6A 3FMFA 3EHDA 2IWHA 1II8B 5EUBA 1PHRA 2EJVA 2F1IA 2W6OA 3SF8B 4KWHA 1OH7A 1QCYA 2Q7XA 2PX3A 1MABA 1XMJA 3QNUA 4URUR 3D3EA 3GIWA 1E0JA 2ZUBA 4EHJA 3V1MA 1E5QA 3HRHA 1U9ZA 4CEJA 2HXYA 3ZY3A 3ZCRA 2FXIA 2I4LA 1HTTA 1WSDA 3O6VA 2Y8EA 3Q8MA 3FMGA 4HNRA 4IDEA 2IGBA 3C0KA 4CETA 3A6GA 4R4JA 3NWJA 1XMOB 4NE7A 1A77A 1OAOC 2QJRA 3F9IA 1YA6A 5F3WB 1U90A 3GV0A 1A9YA 4ZJYA 2XE8A 2GBLA 3D0KA 1T2CA 2PT5A 2XTZA 4BQRA 3N7TA 3FAZA 1M2OA 3C7TA 3NWEA 1G2QA 4TQ9A 3RVBA 4EA9A 4FDMA 1NJ6A 3RG8A 3PNQA 4ZPJA 2A9RA 5EXTA 3AXSA 4XD7D 2CNDA 2EC5A 1CY6A 3TFWA 4D8YA 2A0UA 2CYAA 1T2AA 1TYAE 3PC3A 1F8XA 3FCYA 4Q03A 4ARVA 5F7JA 3EDRA 4NDNE 3NNNA 1S2IA 3T3PB 3VISA 5L53A 3GRPA 1NMZA 1J8FA 1R0WA 1KI6B 1GAEO 1WO8A 3QI2A 1GPNA 1AGXA 1DCMA 1JMYA 1K68A 1Q0PA 2XUHA 3MWKA 3GA7A 3PLNA 3R6DA 4R9SA 1Z29A 3SZRA 3TKAA 3R3XA 4FSDA 5I01A 2RCNA 4BUZA 4GLOA 3PGVA 1R12A 5DEIA 3AB3A 2Q3DA 4FWTA 3HXKA 1LQUA 4B1FA 3CX7A 2Q3JA 4UFOA 3K4PA 2RHWA 3DF7A 4MK4A 5GZ1A 1LPOA 1F38A 3A10A 3M3HA 3G8AA 4FZ3A 4XQGA 3G7SA 2OV8A 2UUPA 1XU7A 4I5DA 4CG0A 3EDMA 5BNIA 1GARA 4NZZA 5I3CA 3CUUA 5KYWB 2V7BA 3IP9A 4MARA 2VUHB 5E1MA 3QVGA 2I6XA 2YJ3A 4B84A 4NWIA 4FNAA 1Y3CE 4B4WA 2PUDA 4TWAA 4C0BA 2WTNA 2BD0A 3HV0A 2WB2A 3CNOA 3H6GA 3PVZA 2YWHA 4H0FA 1FSPA 3QV2A 3DLPX 4QUAA 1XTRA 1FDOA 3GHHA 4UNSA 8MHTA 5I4BA 2PFGA 2C9CA 1ZK4A 4FFWA 1WCXA 4JLPA 4UMDA 3U9LA 3UWPA 1L2TA 1VL1A 3L5OA 2EW2A 1PEKE 4NCBA 1R9GA 1DBWA 3RV3A 1VP9A 1Y1KE 1K4KA 5EIHA 3KBBA 1PJ2A 3ORYA 1EG2A 5AVKA 1GPLA 2GJAA 2B82A 3D6AA 2ZGVA 2P7HA 1J7JA 4IP0A 1L8QA 4Z2AA 3NTUA 2ETVA 4RGQA 4HVTA 5FV4A 1M34A 3QFHA 3HCBA 1Z0SA 5A3SA 3TI9A 4EECA 3OESA 3ZNNA 4XX1A 1CHNA 4JLNA 1W88B 4F9GA 1EFLA 1LBIA 4X20B 4KODA 3JWHA 5H9WA 3M5WA 4FQ7A 3VHQA 2O2IA 3PSHA 1X80A 5U1PA 3EDYA 2I4NA 4HZGA 4GYKA 3OOJA 4AP5A 4DB2A 2VBGA 3RRMA 3HCCA 3PF9A 2IQ5A 4HYEA 1E9SA 4BNKA 3ETHA 4IEEA 1JRLA 3A05A 4PSVA 3W6ZA 3PQ2A 2FPLA 3D8NA 1L7BA 1AB5A 2I4TA 4FHCA 5A7GA 1Q7RA 1IVSA 1D8AA 2B1IA 3O5AA 1ISSA 2ZSFA 4LVOA 3HRIA 3KKKA 4NPAA 3IP3A 4BNLA 1XMSA 3H8SA 4GOND 1W4LA 5CNIA 2JCGA 2GYVA 2XYQA 1V6CA 3DAGA 1UWKA 5D5QA 2M6RA 1KFKB 3HJFA 2V6JA 3UFXB 2YWJA 3IHWA 2P6UA 2SCUA 4X6UA 2CT8A 3GGDA 3ZDBA 3G88A 1RZVA 4U7WA 1I2ZA 4TV8A 3H42B 1GZ5A 1T8YA 2I67A 4BO2A 3LBIA 4KXVA 2B2XA 3UW1A 3FFTA 4W7IA 4F1KA 4WT7A 4GEKA 2YJ6A 1GCIA 3W77A 1E1NA 4HQ0A 4C88A 1ZOPA 3QE4A 1YDMA 4NFSA 4WLOA 1P1RA 3HDGA 3JYQA 4DVGA 1EDEA 4XRGA 3FNHA 3VNAA 3F1KA 5CP8A 2VLBA 3K35A 3C7KA 2XEXA 3BKWA 1F5SA 3GRZA 1WLYA 3L0OA 4V24A 1A8IA 1CUIA 2AG0A 2JEZA 2RHLA 3PVCA 2I62A 5T7BA 4FCTA 4R9NA 3I8OA 3UBMA 5SZIA 2CXHA 3R0XA 3VVCA 4EAQA 2BTOA 2YW9A 3F4LA 4U8HA 3OF2A 5DHTA 4F3KA 1IXZA 5E3JA 5DIZA 2QD2A 1N2EA 2BKAA 2IH2A 3T7RA 4F4HA 3NRCA 3K8ZA 3GPCA 3PX3A 4JBHA 5I8WA 4FN5A 4FYYA 1IXYA 2WFMA 4KKVA 4LKOA 3L82B 5DM60 4BBZA 4AJ9A 2YRWA 1VYTA 3CF2A 1F06A 2R44A 3A6DA 2D2FA 3P9SA 4YCMA 4YCCA 2B8TA 2WJVA 1IVYA 1EQUA 1PWEA 2AJDA 2LWIA 4ARBA 1MAWA 4HNSA 3SX2A 1DJMA 3OHSX 3BJMA 3OPQA 4H1HA 2IUYA 4WY8A 1C30A 3IT0A 3OEEA 1Q19A 4BWFB 3DKRA 4M8NE 3TLBA 3PFGA 1NVFA 1MC4A 4P3NA 1F2UA 1OLXB 2M1ZA 3PE4A 3KYCA 1GGFA 2ZPUA 1XN4A 4NKRA 3FGOA 1FFXA 2VSXA 3V3KA 4MVJH 4ARZA 5JQGB 1V16A 3UGJA 3KT0A 1F8FA 1KQPA 2ASVA 5JAZA 3GRAA 4R8VA 4HH3C 1P1CA 2O23A 4MSUA 1EXNA 4NE2A 2V8BA 1X7ZA 4FTWA 4RYDA 4JU8A 4PQGA 4ALIA 2BGUA 1FYEA 5CJPA 1YZVA 2FN7A 3TSWA 4A23A 4KOAA 5FB3A 1RLJA 3SS8A 4C3ZA 3AGPA 1KEEA 5FTNA 2QWXA 5ER6A 3GMTA 1T9AA 4L5JA 2AC4A 3VPXA 3LYLA 5HS6A 4NYIQ 2FQYA 1L7OA 1UJBA 1B41A 2A58A 5AD1A 3C5VA 4IQ8A 4TPKA 2I8LA 5HMLA 3T0FA 4QG3A 3EXFA 4C0QC 3N0RA 1CR2A 3G8CA 1XQ9A 2F9LA 1JU9A 2VWHA 3BWEA 5HQJA 2R00C 5DYWA 2C9OA 2GPTA 3PK0A 3SBDA 1W0JA 4C6TB 3RS9A 5E2IA 1EGVB 1Z15A 2A92A 2R2AA 3VOTA 1TM5E 1I01A 2ABWA 2DFLA 2XWPA 1W8IA 2YHIB 2R6FA 2WMOB 2Z95A 3D81A 2VLIA 1PL7A 1U0TA 4PGHA 4UDXX 4X84A 1HE3A 1W5EA 1QRRA 4OEHA 3JQAA 2C0QA 3VYVA 4C3VA 2P2GA 4UXJA 4H35A 1S9DA 2Q5JA 2CY0A 1E3IA 4DUYB 4ZOAA 4Y9RA 3ZD9A 1MPXA 3UHJA 3S2YA 5MN5A 3F1LA 4AY5A 2V1UA 5DBEX 5SYAA 4CCSA 2H0QA 5LBIA 4DG5A 5K8UA 1C8KA 3LPDA 4U2GA 2G71A 2C8KA 1PT7A 4TGLA 1HH4A 3H8JA 2P9ZA 5J58A 3A28A 3THXA 3CNQS 3VR6A 4LJKA 1YS2X 3WMGA 2BI7A 4MA5A 1QJCA 1GV1A 2Y9MB 4YCDA 1N6LA 1JSXA 5B2FA 1SCUA 3R9IA 1QS0A 1QZ3A 3AIIA 4C07A 5GPBA 3I1JA 2I33A 2JEYA 4AJHA 5CM9C 2GZ1A 3VO9A 1N2XA 2A0XA 1TCBA 4KWIA 1NP6A 3G7NA 1OA1A 5G0TA 4W9NC 3F73A 1HTBA 2SECE 5EHZA 4YFVA 5KQPA 2RC6A 2ZRCA 1RQRA 2P0AA 3TECE 3MHTA 1GDDA 3MQFA 2OD2A 4GOOD 1WULS 3WRXC 3LZDA 3TZQA 3UTDA 4HO1X 4PO9A 1KBOA 3Q8LA 3HY3A 5FYQA 3RVRA 2GN8A 1H42A 2C5LA 1FX0B 3OIWA 3CLUC 5FQOA 3TW8A 5BV1A 5F2NA 5I45A 4IS3A 2R96A 2HK6A 3WX0A 3ZDEA 2XOKA 1E6WA 2G6BA 4UOQA 4CMHA 4ZOQI 3SJAA 1VKOA 2J0QA 4I1UA 1JHAA 1F6WA 3KQWA 2GCEA 1MQSA 2IPOA 4ENPA 3F0TA 1TUEA 3G9QA 2X3FA 2PV0A 3E7FA 2XY4A 3HJRA 2Y1EA 4JLDA 4BATA 1O97D 2WF5A 3HDVA 1Z63A 4RHCA 5EJMA 1TAGA 4QTUB 3H9BA 3KB8A 5I7VA 4BFCA 2KM1A 1ZM3A 2DKOA 1O94A 1CF9A 1LLFA 1OXKB 2FP4A 3UMVA 4MQLA 3HU5A 1Y1PA 2J48A 3AX6A 4PR0A 3N86A 1WB9A 4B75A 4E2YA 2VXYA 3BIJA 3FCXA 4OFWA 5ALYA 1XTIA 2VZ8A 3DMTA 5IMBA 3NS7A 2VUSA 5TPWB 4B3IA 5H68A 3KU4A 1KK2A 5K2MA 1K5PA 4KFCA 3L8HA 2V6GA 1GNLA 1UJCA 1MA3A 2XMSA 4DSTA 2HHJA 2ONCA 3NJRA 1XF9A 3IP5A 3NJ8A 1CEYA 1PSWA 2GI4A 3EZXA 3N8IA 3HL4A 5CK4A 3QUAA 3OZAA 1ZHOA 4KRGA 4B0PA 3EZLA 1YUNA 1P77A 3OFVA 3TDMA 3QKRA 4CIVA 3L41A 3O9MA 1TVKB 4N49A 5G02A 4RK0A 4HB4A 2IELA 2ZVDA 3E35A 3FOWA 2ZRAA 2D13A 3F97A 4NBKA 5FNVA 4EFKA 1JW9B 4FGJA 4PE5B 2CSUA 1U8FO 1QR2A 2XNSA 3VH1A 4PN7A 2QUBA 2OXIA 2X5NA 2V7WA 2XUJA 4MWGA 3RWMB 2VSOA 3BXEA 4BMPB 3LQFA 2I9PA 1N6NA 4XW2A 4I4LA 2OE2A 6LDHA 2GS9A 1IM5A 5TEVA 3D6JA 4C7KA 3OVMA 3TQIA 2PRJA 4ALNA 3MJ4A 621PA 1U4NA 2CF6A 1ZOOA 1LDMA 3O8NA 3D6HA 4XVQA 2LRHA 2QA5A 5BSEA 4OIMA 4LECA 2X4IA 1A9SA 1ODCA 2H2DA 3PRJA 1NNEA 1WRBA 4WADA 1GVHA 3IEUA 4U4AA 2DLCX 3MWFA 1U2TA 3G8DA 4PSDA 3LI2A 4GX2A 2OC9A 4BFTA 1TU3A 2JA1A 3DNFA 3U6KA 3JQBC 2GHRA 1P9LA 1HL7A 2XVMA 3ICCA 4LXYA 4YCAA 5DWDA 1KYYA 1DAPA 1Q0UA 3GPIA 1JR3D 3FTQA 4IZ6A 4PC1A 4F4DA 3PXUA 3RYIA 3N3BC 2EVWX 1E0AA 3VU1A 1DLJA 3A11A 2W6JA 3ZZ0A 4LXIA 4EHAA 2I1QA 2H18A 4KXNA 2GRUA 2W4QA 5DW3A 4RZQA 1BXKA 2EBHX 4D41A 4MLDA 2OM6A 3G2MA 3QE0A 3TRHA 1N5JA 3DDZX 1OKKA 2QS9A 1U0NA 1CWUA 3DFUA 4OA5A 1MAUA 1SK8A 4RM2A 5AVYA 2V4UA 4ZAGA 1RQPA 2NZ8A 1NI5A 3KUCA 2FN3A 4S0XA 5TS2A 3CLHA 2PH3A 3BD6A 2WU1A 4UVDA 4NYJQ 2R97A 5KVSA 1FW8A 1XHFA 3QX3A 4KIJA 3QVOA 4TMTA 1ZUWA 1C9KA 2R66A 2YBDA 4OLFA 1RYBA 2IYUA 3A25A 4RXMA 1CDOA 1JDJA 3L7CA 4U1RA 3CF4A 2VK2A 1OA0A 1GIAA 1ETHA 5EJGA 7AT1A 4D3ZA 1DELA 1L7XA 1ZL2A 5D3KA 4E5DA 5BV2P 3GUUA 2GCNA 1ZGJA 2AN1A 2W2TA 2B4AA 3K9QO 4OUDA 3MXTA 1QNLA 1LW6E 3RQIA 4DMRA 2PUCA 1CDZA 3IC5A 3DZCA 4Q9NA 1AQLA 1WZ2A 4GM4A 4HI0E 4KDEA 4JELA 1QUEA 3CEPB 5DGTA 3IV9A 1LC0A 2OENG 1EH5A 2P4QA 5TGDA 3T1OA 3OU2A 4LIPD 3K53A 2Z0MA 2V0NA 3ANTA 3M83A 4LQLA 3SPXA 2JC3A 4HWSA 1QB7A 3GGOA 3I64A 1NHGA 3ESZA 3VYSB 2V3CC 3TTTA 2QSZA 4BLSA 4PBSA 2BBOA 2A9FA 4WLNA 3VGJA 4C7JA 5FYDA 2J5RA 1I8TA 1FLNA 4XARA 4ZTBA 1Z8FA 4GGPA 3RAFC 3CNLA 4CDGA 1PJ8A 4RPIA 2WWYA 5B1SA 1RABA 1VL8A 5I8ZA 4IWXA 1DMSA 1HLFA 2Z2KA 4GUAA 1J24A 1JTFA 2Z2YA 2ZWMA 2XUFA 4OX9B 4G4GA 4DT1B 2HDHA 2BF7A 4R01A 2WE8A 2R1VB 3ZE8A 4CQMA 1KMNA 4H3VA 4YX9A 2JS7A 4EZIA 5B1EA 4TV9F 2FLVA 1SXJD 2VDQB 1XXHB 4KVGA 4C4OA 2IYRA 2Z5LA 1JJBA 2CL0X 4PIVA 5JWRA 1Y7TA 1ZYUA 5C8YF 1N9KA 1OBVA 1Q1QA 4XXHA 3ND5A 4D3DA 4Z0HO 1XXLA 1BXRA 2R7LA 3EF3A 4WPGA 1K9SA 1MW9X 1XRNA 5A1JA 5IDQA 2GILA 4I4TA 2RC5A 1V1RB 5DOZA 4LC9A 4QU8A 1Z36A 4LCBA 2GXUA 1UPBA 3KQHA 1XK6A 3L6UA 2EW8A 3R76A 4BJHB 1B8OA 3EFHA 4PS1A 5D6OA 2IU4A 5H0IA 2DULA 4KDFA 1Z37A 4DVJA 1EFUA 2VT3A 1P5HA 1P91A 2B7BA 2ZZMA 3CZRA 1MC8A 2D1SA 5FTJA 1YHNA 3N8HA 1AD2A 4YMUA 3SVTA 1KO7A 4FYXA 2BVNA 5LQJA 1WW3A 5DV9A 2CNBA 3AHGA 3JRXA 4ND3A 4RLFA 3I1FA 3IAS6 2FRDA 4YMIA 2WPDD 4WECA 2VJQA 1RYEA 2GAIA 2C42A 1T6XA 5DNCA 5DI3B 3WY9A 5MN6A 4II3A 4MO9A 4A73A 3KTAB 4LOKA 4D6XA 1XJQA 4EJSB 2Q2NA 2NPOA 3FSGD 3NDJA 1P7YA 4Y2YA 5FFMA 4WXEA 1N3YA 2PKRA 4K81B 1ZISA 1J1ZA 3ME5A 2ZBEA 1DFGA 3VV2A 5ALVA 2NW6A 2RGNC 4P84A 3TVYA 3O74A 4HDNA 1M0SA 3RVQA 1IXKA 2FRXA 4P4GA 4DMGA 1B23P 3E5HA 4PFSA 2XB6A 4WOKA 4EJFA 4N0DA 3DAFA 3WGIA 4IQ0A 4A0HA 5SV2A 4H7DA 4K9DA 4DPKA 2NYAA 3CV3A 3KSUA 4JD5A 4LCEA 1Z83A 2A9VA 4HFRA 5IFLA 1M5RA 1YBVA 2BY4A 1ZUNB 4DA9A 1C1XB 1Z13A 2RHCA 4HZIA 4TUYF 1U99A 3WTBA 1E98A 1IHOA 1SVSA 4CKEA 4ZYYA 4TQAA 3DEHA 3PXCX 4UVIA 1QGUB 4IS2A 3LYUA 2C92A 2W00A 1TOAA 3H5IA 5TQ2B 3IE1A 2XOEA 2EBFX 2ZR0A 1U0RA 3N1UA 1VFNA 1ZMBA 4R3NA 3CX3A 5AM1A 3R7AA 1JJAA 4H77A 4YRPA 1YR2A 3RJ9A 3I9V6 1AF4A 4G3XA 4MI9A 2I3GA 3IRUA 2G72A 1HUQA 3FG9A 5FAKA 3HYNA 1XLUA 3IOEA 3WHKA 1QYWA 1K7FB 4NZYA 2CF5A 4JT9A 4LY9A 2TMGA 2WYWA 4JBYA 1V71A 5C53B 2PYZA 1R4NB 2J41A 2JJYA 5I9LA 3SSMA 4YJKA 5JEDA 3MPOA 3UJ7A 2YXDA 4F4JA 5IT4A 2V6FA 1Z08A 3A3YA 3OURA 4X91A 2IKSA 5FWAA 1QQ6A 1I4TD 2JGNA 1P19A 2II6A 2KBFA 3BWCA 2E2WA 4Q3BA 2HA0A 2I1WA 4IIHA 2I66A 3VNBA 2EFHB 4GPBA 4KXYA 1A9ZA 5KDOA 5DX1A 3H2KA 1W94A 4NE9A 5KTMA 3C3WA 3N7UA 3RUIA 2OV4A 4EFMA 2IX9A 2QYHA 4YDQA 3W06A 3WL5A 2CL6X 1FFDA 2GRAA 1LJ8A 2IT1A 1NVKA 2AOUB 2Z9BA 1K89A 2ZYSA 4KLZA 2A2ZA 1AO0A 1ABFA 1S8AA 2ECFA 1XHEA 4X9XA 5A4DA 2ZAYA 4TM7A 3F3KA 2H5EA 2FPOA 3NHWA 4AVYA 2CLCX 1G8HA 1R88A 1WXXA 3P52A 1KZ9A 3HUUA 5J2UF 1LXCA 2C7PA 3EUWA 3T9BA 2FMFA 4X45A 4IGEA 1WMSA 4RQAA 4ZAZA 1SKUA 4NNOA 2BHTA 1JJFA 1VBKA 1WHTA 1ZJ5A 4R41A 5HF9A 3U4QA 3GNSA 1T5LA 3LQ2A 4PXYA 3ZU2A 5JNUA 4IG4A 4BZPA 3GMDA 2C7OA 1U2PA 1P81A 2FMIA 1U04A 2GHIA 1GCOA 2Y2UA 4A2WA 1MB4A 3FVRA 4DAEA 3DC2A 1U6IA 1V4NA 2CXUA 4ZWNA 4D5EA 1BX0A 4PZLA 1IH8A 1OXMA 5ALFA 1O0BA 1SA0B 1YQDA 2NSJA 3E27A 4WXPA 3VDRA 4W1RA 1SOVA 2E9SA 3OZTA 3ZQ4A 1ZJ4A 4U02A 4A1FA 1LV7A 1CZHA 4LHZA 4C4SA 1H5QA 3L1KA 4BVGA 1QGAA 2IE0A 4X1YA 3RFTA 3WYAA 5JSHA 1D2NA 3FYHA 2CVFA 1I33A 3BZUA 4AMZA 3RTGA 3ZGZA 5EE5B 3IP1A 4KCGA 4KTVE 1TD9A 2IXGA 3H16A 3LCMA 4QIHA 1WOYA 5FI0B 3SBOA 3TVDA 4L15A 4ZV4A 4YECA 1H0SA 3WZMA 4HEJA 4DG8A 3P9RA 2G9NA 5CPFA 4JVLA 3HN6A 2WYOA 3UMGA 3W34A 1NZDA 1ULAA 1XLVA 3BQMB 3DDWA 2IYNA 4N6OA 7MDHA 3GLGB 4AWXA 2XNDA 2GXAA 3FLMA 2Z9CA 4MKGA 3AM3A 3EA0A 5FUMA 1AGRA 2AOXA 1MPTA 3H6HA 5IHXA 2HPZA 3QPCA 1IBKB 2BSQA 3U7HB 4NBTA 4DE5A 3EGOA 2ZUTA 4NCXA 4BVHA 2CHEA 3F98A 1K5GA 3I39X 3QBEA 4MWTA 2ON6A 5IK2A 2QR5A 5D00A 3KKOA 4AN1A 2VTEA 3E2PA 3OZEA 4UUBA 3WDMA 4E3ZA 1PAUA 2XXBA 4GOLD 3V55A 3K70B 1CXZA 3RIMA 2WQZA 5MF6A 2VQFB 3CYFA 4F93B 3B3AA 4EEXA 1ZAYA 1KAEA 1V11A 4JC5A 4AKIA 3ICQB 1TC1A 1V4VA 4GR4A 3NXKA 4M0CA 4TZKA 3VR0A 1IZ8A 1NQXA 1GAWA 2NVUB 3HADA 4M37A 4PWZA 1BFUA 1RPNA 4OHPA 1MO5A 5L7TA 5AM4A 1VTKA 1Q3HA 3DNPA 3P1JA 3HH8A 4IO1A 5A2GA 1X7YA 5IDYA 3P5SA 4MGYR 4HAIA 1W5TA 3WLLA 3GCXA 3Q5DA 4CCWA 5L3QB 1JE0A 1DP4A 4OYRA 5G1PA 3K5WA 4NRDA 5C8VA 2XT0A 5MFZA 3D8UA 5J47A 3F4BA 2OTCA 2YVQA 5JH7A 2NUPA 3UHOA 4PYMA 2XJ9A 4L8GA 3ELDA 1IY0A 1I3NA 1JXAA 2AI2A 4IIJA 2QTAA 1EVZA 4D8VA 1FP7A 1GZ7A 2XZOA 1J2RA 4QXAA 4MDFA 1AZTA 1NR7A 3EIEA 3PFHA 2GESA 5I7RA 3ENQA 2N0SA 4FT4A 1UK9A 2Q1UA 5JD3A 4KPUB 4FDLA 5C2JB 2P78A 5C8YB 3NKFA 3WLEA 1X8KA 1RM4A 2RGGA 3B6JA 4BO3A 1S2DA 5DNWA 4G8CA 4Y0VA 3F49S 2R5NA 3AVOA 1HR0B 3LRPA 4RVGA 1LVGA 1XR3A 1L4KA 3BOSA 4D4MA 2IEGA 2P30A 3FVQA 4X85A 2EWVA 4EIWA 4X7RA 3L05A 4EHFA 3PTAA 1U0BB 1V8OA 3IQWA 1MH1A 2C77A 2PL9A 2RJOA 2YWEA 3EQ8A 4CI9A 3SQXA 3V7YA 3SM9A 1RBZA 3QXHA 3IULA 3C1TA 1GUBA 1K86A 4MLPA 5B7GA 1PZGA 1SIWA 1FUUA 3OJFA 4ZJPA 4Y1EA 4B2IA 2JI9A 1Q77A 4IMPA 4BMCA 4F85A 4CKCB 1PBTA 3FCAA 2H52A 4HAZA 1X92A 3AR9A 2QX4A 3EGXB 5F1OA 4PGFA 3ZJ4A 2WNSA 4ZCPA 3CRNA 1KKUA 4IG9A 3N28A 2QTCA 4LVCA 4DJDC 4X71A 3W5BA 3CTMA 3CCCA 1BGXT 2XQGA 3ILVA 3P9ZA 1T5IA 2DWPA 5FJJA 3FJYA 1T36B 3HFRA 1UBOS 1EEXB 3NGLA 1H9CA 2OCYC 4E12A 2DCUA 2JLQA 3EG5A 3HDQA 4X3CA 2XOXA 2JAXA 3PYMA 1JG7A 3NVMB 1SAYA 3P4YA 5HM8A 2OGWA 1C4XA 4V0OA 1MF7A 5IARA 4A0GA 3L92A 2J3LA 1Q11A 1QIHA 2YOGA 4KPEC 1ZUHA 4OBBA 3QE3A 5FX2A 4L8YA 2IL1A 4Z4FA 4GT1A 5GOTA 1JDVA 1E61A 1EZ1A 1R50A 5E38A 5AOAA 5EIFA 2B94A 4MVXA 1LDEA 1O6ZA 2FWIA 2HLDD 1L0BA 2H7VA 1SEPA 2W6CX 2XJ4A 3LP5A 1VI2A 5FOUA 4DA8A 2VT6A 3OY2A 4M1ZA 1BC5A 2BFOA 1E2GA 3K9HA 1NW7A 3MSXA 1YZYA 2PTHA 3EC1A 2AOVA 5F77A 3O4GA 3ZNQA 3BGSA 2SNIE 5I48A 3AR6A 3NBYC 3MA0A 4JX8A 1DHTA 3CB4A 3FPBA 4DRYA 1S89A 2PSHA 3U9TA 1ZEJA 1X6VA 2VDUE 3H05A 4UEWA 4AO7A 3GCZA 3NTXA 1CQXA 4TRJA 4J0GA 2BMDA 2VFAA 2WZCA 4KI7A 1QAQA 3QPBA 4FGKA 1VKRA 4H3SA 3K94A 3PQ4A 4K6GA 3E4CA 1MC5A 2VCHA 5LZ2A 3MAJA 3E1GA 5BURA 2MSDB 3HLTA 4UVHA 4L51A 4MUIA 3R8CA 3ED1A 2BCEA 1XEAA 1TQ8A 4NJMB 2HJWA 2MINB 3NDIA 4WXRA 1IY1A 2O3TA 4RJLA 5C8ZA 1EZ4A 4PLWA 4PPFA 1QVRA 4PF1A 3K6SA 1IQRA 1JIKA 4R2LA 3W4JA 3QVTA 1XWWA 4MAAA 3LJKA 2Q1XA 3M3PA 2XRZA 2B1QA 1VG8A 1ZGCA 3DUFA 1UIRA 4BNVA 1IOVA 1B42A 1NXTA 2ECKA 3HHPA 5KTSA 5KPDA 2ENUA 2JJ8A 3IE2A 3DMPA 5LYJF 3KJFA 1E2IA 2P1RA 2X2EA 3LHFA 2VUIB 1B3RA 5DTRA 5EXXA 2Q49A 1C0LA 1TQ4A 1PL0A 4Z0NA 4EJ6A 1ZRHA 3FPGA 2G4LA 1J0AA 2NZXA 2VH5R 1UBFA 2JLSA 4MGKR 5B3JC 4UHCA 1GZ6A 1NY5A 1UOOA 1E60A 2UYQA 4FOTA 3C8ZA 4RY2A 1CDEA 1N9GB 1OAOA 1FVFA 1IIBA 4H59A 4FT2A 1RHMA 4CMIA 1NVMB 3BMCB 3K9CA 4C22A 1IM2A 1EFKA 1FEZA 4ZQEA 2HHCA 2FLWA 1L3BA 1ZHHA 3NAGA 3R3SA 3BZBA 3C43A 4BLTA 4S05A 2GEFA 1R0BA 4JI7B 4BMSA 3P0RA 4XQ9A 1S5PA 3FRJA 4DLWA 2CMGA 5HRAA 3TF5A 2TS1A 2DY0A 2RGWA 3IERA 4ND1A 5TQVA 2PM8A 2JI6A 3COWA 4YRQA 3E18A 1LSJA 4UULA 2YQ5A 5GAJA 3MRXA 2V5UA 4ENTA 2V7PA 3B5IA 2Z8YA 4RO0A 4BJ1A 4S12A 3EBLA 4BIIA 2A9PA 4Q82A 3NIFB 4UTZA 4XB2A 3T35A 3ZV4A 5KNBH 3RWOA 1I7QB 3QOYA 2XD9A 4JA0A 1LTHR 3E1SA 4JX9A 2HI0A 4PANA 2HF8A 5E0OA 3ZZUA 5I3ZA 5KKNB 1IDOA 4NQRA 5KCMA 1YE3A 5JJBA 3EVEA 3LC0A 1OIXA 4OMCA 4QUBA 1EFDN 1JIIA 5J40A 4YAJA 1YF3A 1RAEA 4NMXB 2BUAA 1F20A 3E0QA 4UM9D 4TWIA 1VSTA 1FVXA 3H19A 4RENA 3JQRA 3ML1A 3C7AA 1OREA 5ABPA 1SXIA 3I42A 4YP1A 1I9CA 4EGFA 2HA4A 4Z7JA 2V7TA 3KTOA 3WGMA 3PR1A 4LXGA 1P1KA 5G41A 3R7WA 3WLSA 4DANA 1YKSA 2F62A 3IXMA 3PT5A 3WYFA 5B55A 1DBPA 1N2CA 1QJ4A 1Y9EA 4PC2A 3WLAA 4BNGA 4F21A 2BJVA 2FSSA 2REXB 4ZHQA 1Y5MA 4D4KA 3DBLA 1ZOSA 5DM70 5KOYA 2P5UA 2Q5CA 3HKCA 4PBTA 3ZHUA 5ENVA 3C41J 1Q1GA 4B3CA 2FZ4A 1BE6A 1ZD3A 3G7UA 3PHLA 4ITUA 2ANCA 1IPFA 4KQ1A 4R9VA 5CW2A 3G0IA 4A15A 2FPXA 2X1VA 2PMFA 1RAGA 2NQTA 1KETA 2YKGA 3TNLA 3I1YA 2XDWA 3T52A 1T26A 2QUJA 3QBTA 4UDYX 3WE7A 1EU1A 1CR0A 4GP9A 4L5IA 3GBPA 2IU6A 2YWFA 3D1LA 3TMYA 1I13A 3VVLA 1U11A 2ZB2A 3I62A 1NXXA 3PQDA 4Y3UA 3GFRA 2GAOA 1PK7A 4C2BA 3SEAA 3I4FA 3L7JA 3QVLA 5BWNA 5TMEA 4Y2SA 5DWVA 3MEQA 1T5BA 5IJWA 4TL9A 3N3AC 4HTFB 3R7FA 3EUFA 1TADA 1TRHA 1CE8A 1MH9A 1FP4A 2JGDA 3GLGE 3PHJA 1EDOA 4AC9A 4DQ0A 5CM2Z 4FFBA 1J6UA 3L7DA 4U00A 5CB6A 1US8B 1FW6A 1NR1A 3IV6A 4LE1A 1YNOA 1GTZA 3HCFA 3VYRB 2BFCA 4ZYVA 5IBCA 2Q5QA 1CU1A 1W0KD 5KNLA 9MHTA 2QJTA 4AG3A 1T25A 3PGA1 4IINA 3RK0A 5LP6F 3HKDA 4GE3A 2WF8A 1YVPA 4M7WA 4I81A 1UT8A 1NE7A 4KXLA 5LMCA 3FMVA 3H1GA 4J0JA 4G0OA 2WI8A 4PNPA 3V8EA 2ZFUA 2WEKA 2BKUA 2RHRA 3NBAA 4YQFA 1TEZA 1JJVA 5E7JA 4EY5A 1VDMA 3PKIA 1XZKA 2IBMA 1O58A 5E0KB 2GYYA 1S3FA 4Q47A 3EVFA 3FWYA 3M4YA 2HXSA 1M1ZA 3A4MA 4E70A 3TRDA 4XGIA 3CZ9A 1PGQA 5DNEA 4O02B 1GXSB 1ZKMA 3PUVA 1NWHA 4QXRA 5B1DA 1M8JA 2X0EA 3B52X 3OPNA 4C4YA 1J2EA 5C8XA 1GAQA 2QPAA 5JXIA 3PQFA 4CN9A 4EMBA 4MUXA 2P2ZA 1YZTA 2GNAA 3KL2A 1SCKA 1XCMA 3ILHA 1PR5A 1ODKA 1A27A 2HH9A 3O3CA 4I0WB 1JIXA 5G0VA 5A9SA 1TMGE 5BSGA 1BWQA 2FEKA 1KYXA 3QP9A 4B7CA 1R37A 3T5TA 3RV4A 4B81A 2AN9A 5HM6A 5C80A 4C0SA 1U7OA 1XDSA 2WT4A 2HEGA 3FRIA 4F9FA 3PGLA 4HYTA 4CM1A 4H0NA 1Z5NA 1CJBA 1G6HA 2QR2A 2QQGA 2YX1A 3C7CB 3E61A 3HVUA 3KZMA 2AR7A 5D01A 5IH3A 3ESRA 5ALHA 4C3OB 4EHLA 3CG0A 1MEJA 2ECOA 2WTAA 4KN6A 3UXMA 4DZZA 1OZAA 2Z6VA 3AINA 4GECA 3A2KA 2OL4A 3DTVB 1VI5A 3KQPA 1GGKA 3WADA 3EHEA 4YMHA 1E9CA 3WFJA 1JKXA 1TVCA 3OMXA 5CVJA 2AN4A 3VGPA 5CA1B 3G0HA 4YHHB 1EG7A 5FHQA 1BVHA 4GXNA 3LECA 4EPWA 1XD2B 1ZZEA 1ATZA 2P77A 2IOFK 1Y37A 1GO2A 3NBQA 4D3SA 4DMHA 2YNMC 4EPRA 5KX5F 2NO4A 4B6JA 4RMHA 3UUWA 3ZIDA 3JPYA 2I80A 1KFEB 3ZH2A 1ENPA 4XKJA 5CG2A 5JVDF 3CUVA 2GEDA 3EJ6A 4B6SA 2RHJA 4IM7A 3NHPA 3F8TA 2K6GA 1QU2A 4BB6A 2WMDA 3K96A 4FYPA 2Q62A 1QH9A 2B99A 3SC2B 4F3CA 4RW0A 4QUEA 3AR3A 5KOHB 5JISA 4WJZA 3U26A 2FXVA 5EIBC 3LT2A 5BRJA 2VNHA 3L0YA 3DULA 1Z8NA 1DQZA 4PHCA 4PG6A 2APJA 5CVVA 4P3XA 1FFHA 3L1HA 1CHDA 3UC5A 3D3WA 1T13A 1KMHB 2YN4A 3GFTA 1V8PA 4NICA 4JI2B 4XIIA 1EFPB 3NHZA 2PXHA 4CF3A 1FFGA 5JT1A 3LT1A 3C97A 5FA6A 5KYXA 3OG9A 5TXGA 4UC0A 1ADGA 4B32A 5LYJB 4RTKA 2BPOA 3GXOA 1J2YA 2F48A 5DE3A 5FQNA 4P0PB 3ZWYA 4C0JA 4PSAA 1E8DA 1I32A 2O3RA 5EE9A 2J4FA 4D46A 4Y6SA 4URWR 1KFCB 2J9ZB 3VA7A 2VP4A 2G6TA 3C6KA 4KHZA 4Q4JA 4C4XA 5K0GA 1BKDR 1TW2A 4LZZA 4MYDA 3CLKA 2GO7A 4A6XA 2R00A 1V3UA 5C3MA 3R9XA 2UKDA 2H7YA 3DONA 4J1TC 1LWOA 3EQZA 5F12A 3K2IA 3LT4A 4FCVA 4DJEC 1Y7LA 1AQIA 3VPSA 2HTFA 4DM7A 3UQZA 3KPYA 4BO6A 3EEFA 1JB9A 2O1SA 3UCEA 1BH2A 3P26A 3ADOA 3HGMA 3RODA 5BSTA 3KSBC 4DWJA 1C1HA 2O0JA 4X6XA 5DXAA 3SLGA 4LNUB 4ZTZB 4HAWA 3WWYA 4ZQHA 1OXXK 1ZM2A 1QH8A 1O03A 3B70A 2VNJA 2DF8A 3F6PA 4XVHA 2ZM6B 2XCRB 2O8EA 4XLZA 3PA8A 3AERA 1Q3TA 4ND8A 2E48A 1KOFA 3G8BA 2O8CA 4E7PA 1KAOA 2YWGA 3OLQA 1LSUA 4QXOA 3TZBA 2IH4A 1GKUB 1ARZA 4RADA 3F46A 4LGVA 1VGVA 1XVLA 3RNLA 3V32A 3VR5H 1KORA 3AJRA 1TKBA 4DIKA 2CFCA 2GK4A 1S8NA 2QMYA 4MS3A 3A9TA 1TCCA 3UKOA 1HDIA 3EQ9A 2E85A 3JX9A 5BW6B 3VNQA 1NPDA 2Q9CA 3UK6A 2F9MA 4U3JA 4A0RA 4MCJA 4IOLA 4U8GA 4XUCA 3SR0A 3ENKA 4RSRA 2OHOA 4GHWA 2YZ7A 2YN0A 2R7KA 1G9XA 5HK8A 4MRPA 1HL3A 1RM3A 1UKCA 1TJ3A 3TOVA 1NMQA 1YB1A 2LVBA 2SKDA 3AHJA 3VUEA 1XNRB 2C4VA 4FZJA 4OP1A 4D9EA 3GJ3A 2H8KA 3QWIA 4JCCA 4HBGA 1VSQA 5HDQA 2Z58A 3WRXA 1ORIA 3WBJA 2ZW9A 4FYVA 2ATIA 4GLJA 4KIWA 3IBCA 3TLAA 3ZBTA 2JIZA 1ENYA 1JSLA 2J46A 1VG1A 2PKEA 3TYXA 2IYAA 1RRPA 3L1JA 4MWEA 4YRBA 3N39C 2P9EA 3HWSA 3X1XA 4ZI5A 1EWVA 3L7YA 1XBTA 3I3OA 5FAXA 2R6GA 4C4PA 3AHDA 1E9FA 4H1TA 3A1SA 5IDXA 3EFOB 4U5QA 4PHHA 1NNSA 1W9HA 3AEUB 1TIKA 4GP6A 3R0ZA 4NCNA 2HGZA 5AXBA 4BBPA 1Z75A 4LN1A 4UE6A 3ZWAA 1MRNA 2J87A 3R3VA 3NTVA 3BRSA 1NNI1 3RT1A 2PWYA 2FSUA 1PUIA 1K5DA 4NAVA 4PPNA 3HXMA 3MGKA 1D6MA 2QJFA 1CZUA 4CDRA 3S8EA 1FPQA 1RM5A 4BO1A 1BCRB 2HKIA 1UODA 2W2NA 3O3MB 2DG2A 1A2KC 3HFSA 3I09A 1YFLA 2FKNA 1CVRA 4HATA 4DW8A 2W6QA 2XH8A 2GT1A 5JPCA 2DR2A 3GUHA 3O8QB 2C94A 3TRKA 3QKSB 2JAWA 2LKDA 4C89A 1XZIA 5I9SA 5SZHB 1U7WA 4WBNF 2YV2A 4LBZA 4CL2A 1T2NA 3WGQA 1YC2A 3RU7A 4BV3A 5AO9A 4D8XA 2B7CA 3LOQA 3R0VA 4JJGA 3TIIA 4DLBA 2ATXA 4U2EA 3O26A 1U2RA 3KFXA 5E4FA 4K3UA 2F8TA 1V43A 2IOQA 3IKMB 1J2JA 1RE0A 4WLFA 1O8CA 2PRKA 3CUYA 4OK6A 4WAUA 3QU5A 3WIUA 1KZYC 2ZETA 4E88A 2PU5A 4K86A 3G79A 3INGA 2NQ8A 2VBCA 3RG2A 4DR3B 3QNWA 4G8JA 2H9AA 1F8GA 2CCGA 2Q9AA 1KJIA 4OATA 5KYGA 1I94B 1G4UR 4MUAA 5FH9A 2WZBA 2HNKA 4OI1A 5IG2A 4RK5A 1P2DA 3MS2A 3P9IA 3PVSA 2VUUA 3ZCPA 4ED9A 2FOXA 3PX7A 4QM6A 2HO4A 5CEEA 3RFFA 1N5LA 1NN5A 1K0FA 2BFPA 3A4IA 1D2GA 3OEED 4G23A 1X3SA 5BORA 5L4SA 3OLVA 2KPOA 2XUOA 3QLUC 3RUPA 2NV0A 2BTQB 4G37A 3Q6MA 1THGA 4Q9IA 1J8YF 2O2JA 4X64B 5LOVA 4YV1A 1LBEA 1Q1AA 5LZ5A 3UIEA 3V8QA 3QEAZ 2WU4A 1XZDA 3OZSA 4L7QA 4OL9A 3UAWA 1AQYA 3DPUA 3NBUA 4W8OA 2IPXA 5J4KA 2O0HA 3Q6NA 4EFLA 2Y27A 1ZNXA 2YHAA 4HXGA 4D82A 3T3EA 3NONA 3UBTA 4GWGA 4XGQA 3WOHA 1AXEA 1GZDA 3Q7SA 3IVGA 5CT4A 4JI5B 1XRJA 4Q0MA 2IYSA 2X13A 3OBIA 2J3JA 4Y6QA 4J29A 8AT1A 5IVKA 2QN2A 3CUSA 4HS9A 2OPBA 2F3RA 2H9YA 3LF2A 4YONB 1RYFA 3KOMA 1ISPA 4EJSC 4P54A 5LIRA 1Q22A 3GGGA 4M1KA 3W7BA 4MYHA 1FSZA 5DNYB 4US2R 5GZ3A 5CLJA 2G8LA 1JUDA 1IBSA 3KG2A 3Q9LA 1UK7A 1VGRA 4IH1A 1EE1A 1THMA 4YLEA 2W4MA 1JBKA 2FWMX 1RXUA 3FMIA 4RSHA 3REFA 2ZJ3A 3HCEA 1ISGA 3G2NA 4POAA 4QGBA 3PLAE 2O19A 3HP7A 4D02A 2CK3D 3W5VA 3PD0A 1M5UA 2DKNA 5A62A 2H9IA 3I9OA 3JQAD 4BMOB 4ILKA 4HDSA 3ERCA 1U5BB 3D3KA 1JAIA 1KSFX 4DKJA 1V8FA 3T5DA 1M8KA 2HIMA 3BG5A 3NIDB 3CF0A 1IBRA 4DQDA 3AF1A 2ZS7A 3IKLA 4XVRA 5EVCA 5CA0B 4DC1A 1G21E 2ZI9A 5CPBA 1QGYA 3RC9A 2ZQYA 2VG8A 1P60A 2W6IA 5B4VA 3THWA 4DR7B 2DTDA 1V6SA 3E9QA 1OVMA 2NP6A 1XYYA 3AVPA 3R09A 1NW4A 2H07A 1O6FA 5DTQA 5EEGA 3NALA 1WXFA 4LPSA 3QOWA 1AKTA 4IX1A 3VVBA 4ESEA 2IHUA 1OGJA 3O2QB 4KVAA 3DLBA 4YBZA 1MZPA 2JLWA 2RH9B 2ID9A 2PZGA 2QM3A 2Y0BA 4LJYA 4EMTA 2R84A 5A9RA 3WISA 3EXEA 3FWZA 6YASA 2XBMA 1HT0A 3OZIA 3SJUA 1DEAA 1J99A 2YYZA 2G0AA 4Y2VA 4LFCB 1NBIA 1LDBA 2ZBVA 4FFVA 3DOFA 2GCIA 4XASA 3UG6A 2L82A 3NPAA 5AM2A 4MW5A 4KRYA 2F1KA 4CCAA 4B9EA 3RSQA 2PSDA 5CUQA 1EPUA 3FTPA 3OZGA 2NIPA 3RASA 3ESAA 2V3WA 2FX3A 2XDQA 3NBZC 3PNYA 1CRZA 1O96A 2O2EA 3IUEA 2XOKD 4D3FA 3V42A 3FOCA 4ENUA 5BVHB 1YB7A 3KR0A 4U0JA 4ZOLF 1JAHA 5ALQA 3WJ2A 4L76A 3ZLJA 2FWJA 5JMTA 1CZOA 2FPGB 5IZCA 1U3VA 1EAYA 2XE6A 3N0XA 1SGWA 3T0GA 4DQVA 1LS1A 3KOZA 2EFGA 5LA6B 4YP6A 3WTCA 2X41A 3IPXA 2L69A 2NPFA 2HF9A 1OB2A 4N4AA 1YZNA 2E89A 1FXUA 4B7XA 2ZITA 4RAOA 1WD7A 4P7FA 4DCTA 1O94D 3ZTYA 1TKAA 4OFBA 3KZXA 3R2JA 4NS1A 1U8YA 4CE6A 1NM5A 2QMZA 5E2AA 3OUZA 4DJJA 4HGZA 1RM0A 5DXJA 1NSFA 2Q0HA 2N1BA 4ZD6A 3U40A 4BP1A 1L5QA 2ODTX 3NRJA 3WBFA 2OHVA 3B48A 3I9NA 2V7XA 3T9DA 3IDZA 3SAJA 4JYZA 4MH0R 2FR1A 1JIVA 5KI6A 1Z73A 2UYGA 1B0PA 2HA7A 2GHQA 1XZMA 1GYRA 1LX7A 2I0FA 2Q3EA 4G07A 2JFHA 3ZD6A 2C7VA 2ZE7A 1HFWA 1NDHA 2KLBA 3TIGA 1DIGA 4HQFA 3JQ7B 2BUCA 1YZFA 3H0EA 1QG2A 2Q3MA 4LGCA 2WABA 1ZITA 1H6CA 3RHZA 1AKRA 3JD0A 4P7JA 5AKKA 4BNFA 2DP4E 5FPQA 3JR7A 1EX7A 2H2HA 2OORA 2PS1A 1SCNE 1A96A 3AEKA 3LP8A 5F3DA 5JSQA 4QDZA 4EHHA 1LSOA 3STVA 4F7DA 5JYCA 2BOVA 1EIWA 1EVYA 1NNUA 2H5JA 4AXBA 5DIFA 1QLWA 4BN0A 5AOBA 4IVQA 2BM0A 1QHHB 2AYYA 2C99A 2GBIA 1JZTA 1TLFA 2X1MA 1N8NA 1YBMA 3TLJA 3FH0A 1YS1X 2QE7A 4UAGA 5J4YA 1C3VA 1R66A 4WHMA 5A05A 3VZQA 1YD7A 4F5WA 1SH7A 1Y3BE 2BV3A 4R9UC 4QDTA 5EYPA 5HVNA 2PV7A 3ZDFA 3K70C 2YZGA 2EZ9A 1OLSB 1SBTA 3WQHA 3ZJTA 4L22A 3PDCA 4JLSA 4BX9A 2O8FA 3VUFA 1RYYA 3PEFA 3QF4B 4LZOA 2GXQA 2IV2X 2IYOA 1FB5A 3SC3A 2YYYA 4WBNB 3ZWPA 1YR6A 2HA3A 5AUPB 1NI4A 2G77B 4JBXA 3OICA 1EUZA 3LW7A 5CH8A 5HQ3A 4V03A 3TD6A 1I3KA 4MJ7A 2OAEA 2W6JD 3CW9A 1RWMA 4XDZA 3RJZA 3ZVMA 3N05A 1S7CA 3IB3A 2R4QA 1F0NA 2OP0A 2ZIFA 3BXPA 3JRWA 4PZDA 5EXDA 4BMDA 3JS5A 2XCLA 3T7SA 3IS3A 3SKYA 2OG2A 2PR7A 1J0CA 1ZGGA 1NW3A 1OKKD 1ZD5A 2R8BA 1ENOA 3GNQA 4TKUA 2FG5A 3EIUA 2GCPA 5FWYB 4IHJF 2I29A 2HQ1A 2WIKA 3AB8A 3LNTA 2IYFA 2M32A 5CT8A 4C4RA 4D44A 3BKXA 5KQLA 1RJDA 1VJCA 2YJ4A 1EDDA 1TMOA 1E1LA 5CURA 1U7DA 3DBHA 4EB6A 5JPDA 3QX7A 4ID3A 3D8HA 3NYRA 3MCWA 1RXWA 2ZATA 2VF5X 1TCUA 5HGXA 3DBOB 3BK1A 1KZ7B 3KD3A 3JQQA 2W6ZA 3QM1A 4RZSA 5K6TA 5J3JA 1RWNA 5AIBA 1JR3E 4H60A 4K8RB 4AYTA 3S81A 3ND8A 1L3IA 1M6YA 3AETA 3K31A 3MJDA 4K9KA 1I7SB 1H2YA 3MWDA 5KUTA 4O59O 4Y67A 3A8TA 2FB9A 1LC3A 3E84A 1YRLA 2ACEA 1RWOA 3PB3A 2C2BA 2VI5A 4ZEOA 1EA7A 3F74A 4G6ZA 4KMMA 3CNNA 1RYDA 1RJGA 4WN9B 4E6EA 2AZDA 2PZFA 5LP1A 4M9SA 3AHCA 4BZWA 4EHBA 1ZKDA 1VBFA 2VXCA 2VHTA 3LXUX 4N5LA 3S68A 5IWAB 3AB7A 3CKYA 4KJZA 3T5MA 3TQFA 3AKCA 1G55A 3DA8A 1E6KA 2DFNA 2C3MA 3QVMA 5JSUA 3EG9A 4AFNA 3HTXA 1CF2O 1L8LA 2ZRLA 2RGRA 3GZTB 4XGNA 4OHCA 1NXOA 5BSWA 4DS3A 5TQ0B 4RULA 4MGHA 4F11A 2A5LA 1OIWA 1ULBA 3DHYA 3U7QB 4ADSG 4ZDKA 4PLVA 2IEYA 3ZWOA 1Z5PA 2ZRMA 4M49A 5JEEA 3SGLA 1FTGA 4B44A 2ORVA 2EJTA 4B76A 4CQMD 1WL8A 3ESXA 2NXNA 1NG9A 1LNQA 5JD6A 1RFLA 2UUCB 2O3UA 1Z4JA 2N3ZA 2ZIEA 2C04A 4K9NA 3GEEA 2HJSA 4C7BA 5AVVA 1KOGA 4LXQA 4JSYA 3KUUA 1KBZA 1W2WB 2YOHA 3FFAA 1F4PA 1WV0A 4V0ME 5CTJA 4QUIA 4E5SA 1AZWA 1UMDB 1NASA 4H17A 1JZQA 3MTQA 1JWAB 1ZCBA 1ZH4A 4I6EA 1KI7A 4ZCSA 1GAXA 4MCIA 3GLIE 5DBIA 1DTWB 4MUMA 4KQWA 3VZBA 5HUJA 1PK9A 3BIOA 2R6ZA 2BM1A 3SHQA 2QRLA 1TUBB 1IHUA 2VDNB 2HIHA 3WHIA 4XWKA 3K8YA 2GJ8A 3PWKA 5BMVB 3Q9UA 1EEHA 4G1FA 3ANMA 4N6GA 1CIPA 3RD5A 1F5NA 2QV0A 4KLRA 1UOPA 3V4SA 2EV9A 1JFFB 1IN4A 3U0BA 1TXGA 3OA2A 4MW7A 3BCHA 2QZZA 5B2ZA 3WNZA 2VQSA 5KNBA 1GCUA 1T9GR 3GH1A 4IOJA 1SXJE 2I6FA 2P6PA 4KDCA 4RKYA 1H0KA 2A5YB 4NCKA 1DJLA 2HCRA 3P0JA 3KQSA 4FOLA 3G13A 2HRBA 3HBAA 4KZPA 4MWBA 4QQ8A 5ELLA 1NQAO 3ZK7A 1PYOA 3QUBA 4EA8A 2Q3HA 4Z4CA 1LKZA 4QJ3A 3MF4A 4YFYA 4CRWB 1PZNA 4E08A 5FUXA 1H2HA 3DDHA 3DAHA 2G1UA 3GLHB 3Q5EA 2YWXA 5ENDA 3NEAA 2DJ5A 3GFFA 4LW8A 4D98A 5J43A 4Z86A 4BN4A 3M2PA 4MW2A 4RANA 4FZRA 3O1LA 3IB6A 1VMKA 1D0IA 5DHUA 5ALWA 3K6JA 4MV5A 1C5KA 1N0IA 2YIMA 3ENWA 5J2TA 3U5ZB 3LG2A 5CHEA 5EERA 5EQDA 3O47A 2BFDA 1YFKA 4IGFA 1KO5A 1P75A 1II8A 3B5JA 1Y8CA 3PFIA 3QWHA 2HMSA 3NAQA 3DEYX 2E1PA 4YJGA 4YDHB 5IUKC 3SF8A 5IVPA 1YR1A 5C52B 1LTKA 4RNDB 2JB9A 3P45A 4A6PA 4TYNA 3NUZA 2CUZA 5LQUA 3HP4A 3IDFA 3RQSA 3A6PC 2HPVA 3ASYA 1ESDA 2PSEA 3BX1A 1C8VB 4U6SA 3NKLA 1K6JA 5DM4A 5FOQA 2PAAA 3EISA 3SU8A 5AVXA 1RVV1 2NUAA 2C5FA 3L3BA 3Q0EA 4KN9S 2DVMA 1KJYA 1MJHA 3KR2A 1IUKA 4OI2A 1K3UB 4R2XA 3WKAA 3GGPA 1SVKA 4KQXA 2XODA 1EX1A 2FEMA 4QTXA 3RADC 1JT9A 2F3TA 2FQ1A 3V4RA 1WCV1 2H5LA 5DM2A 2ZJ1A 3AUAA 3KEQA 4REOA 3DE7X 4DY4A 3GY0A 4K88A 4ZO6A 4OG2A 2PLFA 5HEKA 3H5WA 4EI7A 2QEQA 2W98A 4F6RB 1FP2A 1KI6A 4PO8A 4EKIA 1AX9A 1L7DA 5KIAA 2AE1A 2GM9A 1T1IA 1DAKA 5ARDA 5L6LB 2GLXA 1UBSB 2WLTA 4IIDA 4EFDA 2Z6AA 4G4SO 4LI0A 3FZEA 4IDQA 4PGGA 3PXGA 2ZTMA 2F3QA 4JR1A 5BWBA 1J8MF 4FHEA 3ZNPA 3OTQA 3KPVA 1BHJA 4K6CA 3S5JA 1C0KA 4GNKA 2Q1WA 4COKA 1IJBA 1JHUA 1I3OA 2R79A 3O83A 5L4NA 1WVIA 4ACBA 5KYWA 1AK1A 4C03A 3EIOA 5G53C 1QHNA 4L4SA 1KAQA 4GR5A 3O8OB 4G8DA 3ZGLA 5C5IA 1KMMA 3B1JA 3LHKA 2H59A 3QYAA 4G01B 4XWTA 5BQOA 2UZ4A 5BXYA 2BTEA 1UT5A 1E4OA 2AG1A 5CT9A 2O52A 4UVGA 1GZHB 3TQRA 1SFRA 4W5HA 3KKLA 3CW8X 3U13A 5JO0A 3EY9A 1KQGA 1ZBQA 2D0DA 1EFVB 1OW3B 2BM8A 1RZUA 4W1PA 2I91A 5L3VA 1V9CA 3G0OA 3D31A 3Q41A 2G76A 4JUBA 1JV2B 3SHWA 5JIBA 2AI3A 4QTZA 2GA8A 3L9WA 3VZPA 2EERA 5EZ6B 4MKIA 4EGJA 5K45A 3OO0A 2CJPA 1A50B 4WOCA 4LJRA 2FZVA 4QVKA 2WKPA 1ISIA 5FLKA 4GI3A 1CUAA 5CDYA 3ABIA 4F3TA 4IIEA 3ZE1B 1BIFA 3VH3A 1P4SA 2NSHA 1KTVA 3FCSB 3COZA 2J8ZA 2GJ4A 1PK8A 2OWDA 2AT1A 2A9OA 2O0KA 3ECCA 4ZVSA 5B1YA 5DLEA 1NVXQ 4B74A 2HDOA 3VHXA 2BFAA 2HCFA 2R4TA 1RHRA 2VPYA 2XNDD 3H7IA 4MWZA 1IQUA 1UWCA 1W88A 2YUTA 3ZDYB 1JMKC 1GUZA 1KU6A 2QGZA 1E3TA 4W1SA 3U44A 1DAIA 1G41A 2AEMA 5CYOA 1A72A 2Q5LA 3E22B 1AMNA 1HF3A 3O0DA 4NZ9A 5EESA 3DC7A 4K87A 3P9YA 4HNVA 5BW8A 1Q20A 3WGYA 5IJXA 2D74A 2QPTA 4OX9Y 5JD4A 3AC0A 5K0ZA 1R7RA 4GKAA 1H1LB 4FCCA 4WEOA 2JFXA 1GPH1 4FW9A 2JLCA 4FX2A 3VVMA 3HYCA 5JNTA 1ORWA 2CBZA 2JAQA 3H17A 2WUEA 4XZ3A 2EDAA 3G2IA 3UFXA 4YRKA 2LIPA 3A6EA 3ISJA 5IT0A 4COOA 1FNNA 3DTTA 3GPDG 3ZU6A 2C7GA 1N5KA 3LUDA 1YQUA 4DV1B 4MYRA 2G1KA 5AJUA 2OGTA 3A6HA 3DCNA 3H6KA 5EUQB 4FFMA 1BA3A 2C2ZA 2RAVA 3O7MA 3KB6A 2IK8A 3GVPA 5DCYA 4MGIR 3JTMA 1KP3A 4J9VA 5ESWA 1SCDA 4LF9B 3LZCA 4UBJA 3FR7A 2HUPA 2IA5A 4JC4A 1JB1A 3LPNA 1IZ7A 4QULA 4WIAA 3OX3A 1P1HA 1D6JA 2O5RA 4Q39A 3W2EA 4MWCA 1S01A 4TT3A 6ABPA 5CJJA 3LO8A 3BHJA 4S24A 1LK7A 2XUQA 3A0RB 3KELA 4YROA 3ROZA 3UV6A 3L40A 3VH4A 2XZTA 4HLUC 1DBIA 1KAMA 1U0LA 1ZN2A 5BPFA 3K9GA 1CQIB 1UIMA 1IN5A 2UV8A 4JFRA 2VTKA 3A4VA 4ZP1A 4GMXA 1P9NA 1YQTA 2RAPA 3BGVA 1O6BA 1ECBA 2G4VA 2GYWA 1QXSA 4PLYA 2GM3A 2R1ZA 4LHSA 1JEJA 4D9NA 1AGYA 5JCOC 2KMLA 2IYWA 1W36D 2XUDA 2BDEA 1GNRA 1KGDA 4RETA 1KO8A 1X7GA 5JNWA 1FXSA 1RWWA 3COJA 3V9AA 3VR5A 1I3CA 1N0VC 3FDXA 4ON9A 1YB4A 2PCLA 1T4CB 3LNCA 1DXOA 3AZPA 4KPGA 4TYQA 2GJSA 5JI3E 2P5TB 5C1OA 1XELA 1PCXA 2EEZA 3OZUA 1QFXA 10MHA 1KOLA 2DPMA 1OLXA 5JQGA 2O8BA 2KX7A 3LPAA 4GGMX 2DXIA 2WIGA 1RCTE 4P4SB 4YREA 3U4DA 5CNMA 1OROA 2JGIA 3BDIA 3QXJA 5F2KA 3P32A 4OQLA 3CG4A 1YCGA 1CUEA 1P17A 2XRYA 4NAHA 4U6NA 5EOVA 5ICSA 5EIWA 1Z2PX 2RH8A 4QUHA 1WOMA 1MRSA 1X7DA 2QB5A 2ZBDA 4JUFA 4L9SA 1H2ZA 4IRMA 3HEMA 1VCNA 5EGSA 3WGZA 5K20A 2XITA 4RJKA 2JLBA 2VP9A 3RSGA 1AK9A 2ST1A 4UNPA 1Q14A 1Y3AA 1T8RA 2CUKA 5EIEA 3RGWS 4YYEA 1BKSB 1NSYA 3DUWA 4J1NA 4PZZA 4YMGA 4JJ6A 1DEHA 5CTAA 1J9EA 3TQQA 1E9VA 4I55F 1O97C 3DAOA 2R2GA 5DGDA 1U8TA 3ZI7A 1QVVA 5FJIA 4Z9YA 4C6TA 1PJLA 3P20A 4KUHA 2YHIA 2GEBA 2QYOA 4U5XA 3STUA 1U7PA 4J2OA 4YVFA 4HZUB 3RRYA 5EIXA 2P3QA 4C5AA 4G5YA 5DO9A 2PH5A 5K99A 1Y7IA 1Q2XA 2XRMA 4AAYA 4JUDX 3D1VA 4LMRA 3W8RA 4BP9A 2VNSA 4EG0A 3IP8A 4NIMA 4RJ2A 4HYYA 4P5EA 4R1MA 4HH4A 3V4FA 4DCUA 7MHTA 1O95C 3C70A 3HBJA 1TECE 2A4KA 1I2MA 2FW0A 4G5FA 4C9BA 5A06A 5T4FA 3AY7A 3IYLW 4PBRA 2IYTA 5ARBA 4XFKA 3ZN2A 3PNOA 4Z4HA 1YQXA 2VA9A 4QDUA 1DWUA 4OQQA 4WKBA 1ZSNA 1ADJA 3R7SA 4MR9B 1AQJA 1T5HX 2A84A 3FUCA 5A0TA 5FL7A 1ZH0A 1XYGA 5B3LA 4MIEA 3RKRA 2DTEA 3GLHE 1NLFA 3UTCA 3K0SA 1I80A 3DBVO 1OZGA 3UPDA 2RKBA 2QPOA 1Y6RA 3OE7D 4Y1RB 5EMHA 4NCIA 2FUCA 2JGLA 4WX2B 4B3RB 4JY7A 1ZK1A 3MS4A 5DHAA 3CT4A 1RBMA 1L5NA 1B8PA 1E6CA 1Y3HA 2CMHA 4RVFA 3S4YA 5ALOA 4DNFA 4EZBA 3EVBA 4IXTA 2OPHA 3WAKA 3UJPA 5K5EA 1SURA 4UU1A 1O8BA 3W4KA 4OGLA 4G4JA 3RS2A 5TC4A 5IX8A 4EY4A 3KEMA 4FB4A 5JHGB 4RLHA 1R74A 4BRUA 1YZKA 4DR5B 5KTRA 3OJ0A 4KQHA 5DBOA 4AJNA 4MVJD 4N47A 3NANA 4YACA 2AMLA 5B7NA 4DBZA 4CF5A 2XKJE 3J81k 4ZKDA 8ATCA 3RVMA 5IWCA 3TNDA 4DCGA 5B57C 1GPKA 3RJ5A 3Q98A 2WJHA 2J9YB 2B35A 3GZNB 3GOQA 2OZKA 3ABOB 1WAMA 4FZVA 3OFND 2EKBA 2XSZA 4K9LA 1JQAA 1YTLA 3H3XA 3P94A 4PINA 3I58A 2F6RA 3U48A 4GICA 2QL5A 2P6OA 3EX7C 1F17A 1WCIB 3U60B 1S2LA 4MITA 1G38A 4URFA 2WD8A 5B6PA 1SXGA 1JHQA 3JZDA 4MVCA 1UJ5A 3O84A 4XFDA 3HYSA 4CV3A 2CLMB 5HKAA 1DOAA 1XTVA 2ZB3A 4WY5A 3DOHA 5ERXA 4XPIB 1D5WA 2HLHA 2CFSA 3A2LA 3MJSA 4XEHA 1YQWA 5LQKA 3IDAA 2JI4A 1WKVA 1EAMA 5LP6C 3IMEA 3R9KA 3KEFA 2WD7B 2ZAOA 2O6HA 3BRWA 4X63A 3ZWWA 1L7PA 2G28A 1H1DA 2MSCB 3ICVA 4YP5A 1VB3A 1VHJA 3BHNA 3RVSA 5I8PA 3FPCA 4OQFA 5CB8A 1T8PA 1L5VA 2VJLA 3DCIA 3EF1A 2JLZA 4KQIA 1BA2A 2WJAA 1JG6A 1VL0A 3DYIA 2Q27A 3RLIA 5IN4A 1B6GA 1WVMA 4TZTA 4CIXA 2QN9A 2YR0A 1N7GA 2M2IA 4HDRA 2QXUA 2IY9A 5IC6A 2X9LA 1JHRA 5HF6A 1J2UA 4P0TA 4ZYTA 4R1LA 4LRYA 3BSSA 3EYWA 2TYSB 4U2KA 4IF6A 3LLSA 4H9GA 2L2QA 3WQRA 4KYVA 2UXCB 1GUAA 4WXYB 4LXUA 4ESHA 1A2OA 3GGSA 3KJHA 5ILQA 2ZZNA 4XSGA 2CXTA 2Z6UA 4BFUA 3PHIA 2P3LA 1PQUA 2GDJA 4WGGA 3DMGA 4LTMA 4POOA 4GMFA 3VBCA 2EW1A 2L42A 2ZANA 2DWUA 3MGBA 4KK3A 4D56A 1MRZA 4HXFB 1E1QA 3FSEA 2JF0A 5SYMA 2P27A 3S2ZA 3QUTA 4FK8A 4E2WA 1TJPB 3ZK8A 4TTVA 1X0VA 1SUPA 3EN0A 4RMJA 3X2EA 1Z22A 3CN7A 3T3MB 1WZNA 4RGVA 1WM1A 3AHHA 1GA4A 1RWPA 1Q7GA 5HCUA 4YT8A 5JY6A 3E8MA 4QL3A 2GBGA 3WLMA 2AF3C 1NP3A 2HMTA 1Y8QA 1H4VB 2QHXA 4NR0A 4JC8A 3OHPA 1CRLA 4XDGA 1FJ2A 1Z7EA 2Q8PA 5A0FA 3QX9A 3LLUA 3AFHA 1KY3A 4G97A 5PGMA 5D87A 3JWPA 4TTPA 2VHQA 2JBAA 2I4MA 1LQTA 1N3BA 1AXRA 1Y5RA 4AUMA 2V1XA 2G63A 1FS6A 1TFUA 2BWJA 5KJEA 1XNHA 3IV7A 4MA4A 1SM4A 2ZJOA 5BYJA 3MLBA 1DKOA 3C4QA 2L18A 4IH9A 4MS4B 3WLHA 2I22A 1DBQA 2AF4C 2Q6TA 4WNCA 2ZRGA 1Y8AA 4F2PA 1YRWA 2VSQA 4HPXB 1FTQA 1KEEB 1FRNA 2XAAA 3CVOA 1NR5A 4BGIA 3FWHA 3GLSA 3KVOA 4HFMA 4GVPA 1XFDA 3BWMA 1O77A 3GJZA 2R60A 4HJXA 3ROXA 6REQA 2X0KA 2JIDA 1KVSA 3FTCA 4M8KA 1W47A 3WK8A 4FKMA 3DO8A 4QGSA 4IHQA 2FWBA 4JJ4A 4IRXA 4EKDA 2ZE5A 4WK4B 3UYLA 3WGGA 5HKKA 3FYUB 3SQWA 4BCBA 4PG7A 1ODSA 3FZNA 3O4JA 1HC7A 1GP2A 2VT2A 2WUFA 5CYFA 4BJ6A 2Y3IA 2XXAB 3JZFA 4JENA 1RKUA 4BV8A 3WAJA 4F45A 1P62B 3RI3A 1TYBE 1UJ6A 1HDZA 3EMKA 3IALA 4W5JA 1IK4A 4O6VA 1U7TA 2J09A 4PXSA 4YC7A 3TOXA 1FMCA 4D9HA 5JALA 1PWZA 1L7QA 5F21A 4D43A 2AUTA 5EJIA 4QVIA 3T4EA 1MQAA 1A5TA 4TSFA 5D3ZA 1VMAA 4DIUA 3TJZA 4I2NA 3T9AA 2F9FA 1WF3A 2CEAA 2IUSA 2KB0A 2OCPA 1QIMA 2PUAA 2BBTA 4L4YA 3THXB 2I3ZA 4DT1A 4FONA 1GCAA 1S02A 2BKEA 5BMOA 4OP2A 1EDZA 2R1VA 4BFWA 5HPYB 2HO5A 3DLAA 4CYMA 3HBMA 5B7PA 2AEFA 1TNDA 3JQ9C 3WYNA 2I2FA 1XXHA 3H99A 4B43A 4DSOA 4BEWA 4TYYA 3AR5A 4YHBA 3GCWA 1X86B 2V96A 1A8HA 2BZ0A 2O7VA 3FB1A 3SN6A 3IMKA 4AF6A 4BFXA 2YW2A 4K1LA 3CZMA 2QTRA 2HMVA 1HLPA 1GUFA 3ACBA 2VHZA 3ANYB 3V3TA 2DKFA 4RZHA 2CJFA 3QLUA 3CJRA 4GO1A 4JYBA 1XVVA 1LF0A 2K7ZA 1YA8A 1ZCZA 2GNPA 3JQEA 4LJAA 2OYRA 4DMLA 1CRQA 3I01M 4E5KA 1VPTA 2P9TA 4BNWA 2JAOA 3EWSA 4Y9UA 5CLFA 1N6OA 1LVUA 1ODFA 3DD1A 4PNEA 1HMPA 1HTWA 1LSSA 3DE1X 3TG8A 5FOWA 2WINI 1QPGA 1HY3A 3VAYA 3GP5A 5E8JA 1JI3A 4CW7A 1H93A 3G59A</