1PWYE

Crystal structure of human pnp complexed with acyclovir
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human purine nucleoside phosphorylase complexed with acyclovir.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 81
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pwyE00
4NSNA 1JP7A 1K9SA 1PR0A 5K1ZA 3DJFA 3UAVA 4QATA 1V4NA 4EARA 4LZWA 2I8AA 4JOSA 5B7NA 1C3XA 1NC3A 2A0XA 1RXSA 2OC9A 3D1VA 4OGKA 4TS3A 1V48A 1YRYE 5I3CA 1XE3A 1PWYE 2P4SA 3O4VA 2AI1A 4DA8A 3E9RA 2I4TA 1VHWA 3OOEA 4F2WA 1PBNA 2OXFA 3KVYA 3TL6A 5CYGA 1YQUA 3K8OE 1PF7E 2XRFA 5B7QA 1OTXA 1LV8A 1Y1QA 1JDSA 4L5CA 4YMLA 3KHSA 1RXUA 3UAZA 4TTIA 4U2KA 4TTJA 1N3IA 3SCZA 2HN9A 1RSZA 5KB3A 3GB9A 3KVVA 4RJ2A 3OZCA 1QE5A 4E1VA 2HSWA 3ENZA 1RT9A 1YR3A 4OY3A 4OJTA 4TXHA 4MCIA 4F1WA 1Z5NA 3OF3A 1PKEA 1OU4A 5CCDA 4L6IA 1WTAA 1Z33A 1OV6A 1VFNA 1JE1A 2RJ3A 4TYMA 1OUMA 1A69A 4DAEA 1JDVA 2OECA 3DF9A 4BMZA 1B8OA 4M7WA 3P0EA 1PR1A 4QARA 4DABA 2A0WA 1YQQA 2ISCA 1SD1A 1CG6A 3NM4A 3PHBE 3UT6A 1A9PA 1Y1TA 4OGLA 2IQ5A 2QTTA 5CCEA 1V41E 4KN5A 1YBFA 1ODIA 4GLJA 3K8QA 1PK7A 3KVRA 3OZBA 3OZDA 2GUWA 4H1TA 1VMKA 3PNPA 3U40A 4LDNA 1A9TA 1JYSA 5B7PA 4TTAA 5ETJA 1ODKA 2HWUA 5EFOA 4NY1A 4QAQA 4DANA 1JE0A 1RXYA 4YNBA 1Z38A 1V45E 4WKPA 4L5YA 3O6VA 4NS1A 1JPVA 4M1EA 3UAXA 1Z36A 2B94A 4F2PA 1PR4A 1PR6A 3IOMA 1TGYA 2A0YA 4P54A 3FOWA 4X24A 4F3KA 1B8NA 1JDTA 4GLFA 3FAZA 3EUFA 5F7ZA 4MCHA 1VHJA 1K3FA 2H8GA 5JPCA 1Z5PA 1A9OA 4LNAA 3OZEA 1V2HE 3INYA 3C74A 3KUKA 5C80A 4DA7A 4TXMA 1G2OA 3P0FA 4QASA 1U1GA 2QDKA 3ODGA 4LKRA 3E0QA 3MMSA 1RR6A 2QSUA 4R2XA 4WKNA 1TGVA 3QPBA 1ZL2A 4D98A 4D8VA 1U1FA 5EPUA 5F78A 1Q1GA 3BJEA 2ON6A 4R31A 4DARA 4TXLA 4L5AA 2AC7A 4I2VA 4EB8A 4WKOA 1OTYA 3UAYA 1ULBA 1V3QE 1Z35A 4GMHA 1RFGE 3BL6A 1Y1SA 3FB1A 3E9ZA 3PHCA 3NBQA 4TXNA 4MARA 5F7XA 1U1DA 3DP9A 3NM6B 4L0MA 2HRDA 3F8WA 2QPLA 1U1EA 2BSXA 4FFSA 4PR3A 3FNQA 4G89A 1T8WA 2A8YA 3EMVA 4JP5A 1JDUA 1RCTE 1JDZA 1PR2A 1LVUA 4PNPA 1FXUA 1RYZA 4WKCA 4OF4A 5IFKA 1NC1A 1Z37A 5IU6A 4TXJA 4TS9A 1A9SA 2Q7OE 1NW4A 4WKBA 5F77A 1Z5OA 1ZOSA 4BN0A 3OCCA 5DK6A 1SD2A 1CB0A 1TCUA 3BSFA 5EUBA 1TCVA 3LA8A 2QTGA 1ULAA 4YJKA 4DA0A 5FAKA 4GKAA 1PW7A 5F76A 3BGSA 3OPVA 1K27A 3EUEA 2OC4A 4M3NA 1T0UA 2PGAA 4JWTA 1A9QA 2AI2A 4QEZA 1SJ9A 3IEXA 1PR5A 4IP0A 1T8SA 4DAOA 4YO8A 1Z39A 4DA6A 3DPSA 1Y6QA 3FWPA 3UAWA 3LBAA 3NM5A 3T94A 5F73A 4D8XA 4UC0A 1RXCA 3MB8A 5F7JA 4QFBA 1TD1A 5B7GA 1ODJA 1T8YA 1U1CA 4BMXA 1Y6RA 5CYFA 1SQ6A 4F3CA 4G41A 3FUCA 4LNHA 4R2WA 1Z34A 4G8JA 1A9RA 4ECEA 1I80A 3PNSA 3GGSA 3ONVA 1M73E 3EEIA 4D9HA 4D8YA 1LX7A 5CXSA 3KU4A 3LGSA 5F7OA 1ODLA 1T8RA 3OOHA 4OEHA 4K6OA 1ECPA 1PK9A 5CXQA 4BMYA 3DDOA 1Y1RA 2AI3A 1OVGA
chains in the Genus database with same CATH superfamily
1WB5A 2I4RA 4BQSA 4CEHA 2LCFA 4AQYB 1USWA 3PSHA 1K4KA 4KZKA 1G5TA 2Z57A 1WY7A 5TQ2B 3TGWA 3MFYA 2HMUA 3H1BA 3MT8A 2AXNA 2R4UA 3UB3A 1G6OA 2QENA 5C7IO 4LXQA 1GPDG 1V7ZA 4PONA 4TMWA 1UMKA 4G37A 3HYLA 4UDNA 3VNVA 4RZ3A 2G36A 3E70C 3Q98A 3TLEA 4QXRA 3UT5B 3ZW9A 1OF1A 4UUBA 2OG1A 2Z3ZA 4NJOA 3SDBA 3ZI7A 3H5NA 2LUOA 2XECA 3OCVA 1Q0PA 5JYEA 5ADWA 4FK8A 1JL3A 5ISMA 1FNSA 1MB0A 2X76A 3F6YA 1TUBB 1KEWA 1NXOA 1R6TA 3GC6A 3GGDA 3CIOA 1T24A 3Q9UA 4OQDA 2CUKA 3CPEA 2W43A 3WYGA 1Q20A 3I6YA 4LF4B 5CT8A 3QPAA 1OD6A 4K03A 4OXQA 5C2JB 2OXFA 1N7JA 4OHUA 1XALA 3AO0B 1O95C 2JJQA 3SX0A 5JC8A 1UWKA 1GDDA 3ZHYA 2L17A 1IVSA 3UJCA 2I6GA 3CX6A 2MOKA 1POXA 3D1LA 4LISA 5T4EA 5C1OA 2GBFA 3O2QB 1E6WA 2VHEA 4GM4A 3VJLA 2YJGA 2BKEA 5L95A 2C2YA 3I3OA 2CJXA 2D0OB 2CCGA 1D7OA 5ANRB 5TMDA 1CQZA 4M0DA 4LVUA 5C4IA 5CA1F 3MQ2A 4UM8B 1WL8A 4X1YB 4KP7A 4GU5A 4KH1A 5H9WA 3MLAA 3LTNC 4RLQA 5DMXA 4I6JA 1IONA 1DJPA 1Q0HA 1ZXBA 2GZSA 4QXMA 2RI1A 4IX9A 3NW9A 2LV8A 4PYKA 5C8XA 1FQWA 4ND8A 4BLVA 3ND9A 5KYTA 3IIMA 5CA0A 3VU1A 1VSUA 1BFDA 1RKUA 4BU1A 3TTVA 2P6NA 2JCGA 3O8LA 3T1OA 3UCFA 4C0LA 5KPDA 3RSGA 4RBNA 3OQ1A 3O1IC 3BK2A 1GN9A 3I34X 1Q7CA 1XF9A 1DO8A 1YDWA 4AXBA 2FVXA 4BLTA 4CLEA 4DIEA 2H7CA 1TRKA 3L06A 5DM1A 4IRUB 2IHTA 2XMBA 4ESEA 5IJZA 4I1PA 3TMKA 4LYAA 1W36C 2BW0A 4ONEA 4JXZA 4IFTA 1KZ9A 4MVWA 1BS1A 2ZWVA 4CL8A 3BKWA 1NJFA 4BFWA 4DLYA 1FW6A 4QKQA 5K99A 4L6IA 1GLGA 2ONJA 3KSRA 1VZ3A 1DXOA 1LSJA 4JXXA 1SMKA 1FFDA 4DV7B 2I1VB 4OYHA 5A5GA 2FR8C 3VU9B 2QU7A 1RW4A 3KIPA 1FMFA 2F43B 1E3IA 3ULKA 3G88A 3H05A 1DEKA 4DBLE 3GQBA 1C9JA 3U2QA 1HT1E 4A92A 4HBGA 2HV8A 4K40A 1XEAA 3D1JA 1IZ0A 3ENVA 4X1IB 2JLQA 4XPIA 1EE9A 2I9PA 1Z29A 3KB8A 3CZQA 2OQVA 2Y9PB 3TCNA 2WWFA 3FPEA 4KLZA 4MYDA 1CQXA 5JYDA 1RAGA 2ACEA 2X22A 1T0BA 4W8OA 3K16A 1ZQ1A 1YIDA 3GMIA 4ZYZA 3R3XA 4XH9B 1GNQA 5KWJA 4Y6GB 1KEZA 2L19A 4HUTA 1ABEA 4CNBA 1L5RA 2YJZA 3PL1A 3B38A 4JGGA 3NM4A 3PHBE 3UT6A 1QG6A 2IUSA 4AJJA 3PWTA 1UT5A 2BE9A 1YOBA 2FQYA 4NU8X 5E7IA 5I5EA 3QE4A 3NHZA 3ZY5A 3ZR4B 2OD9A 3A32A 2RONA 2Z5FA 3FLBA 4UMEA 3RUFA 4D1YA 1JMYA 2ZJYA 5JDCA 3EY9A 5DSTA 2VXOA 3ETDA 1FJHA 2ECPA 3EXFA 4YX9A 4LDPA 3Q3HA 3VMFA 3WX0A 1F6WA 1EXWA 4ILKA 4EH1A 3SC2B 3KZ1E 1NP6A 2XNDD 2Y6UA 2NX2A 5D5HA 3VISA 1LC3A 4LSZA 2UVPB 1HC7A 5J4LA 5BMVB 2MYUA 3X1WA 5EKTA 1GA4A 3KVRA 1NRIA 4NCXA 2VJYA 5AJTA 1ORRA 4FIZA 4BXOB 4FNGA 4N03A 2C03A 3EDYA 1RIFA 1Y9DA 3T5CA 3UK2A 2ZJ4A 4ZJUA 4D44A 3DMTC 5IAJA 3T38A 3V7FA 5KHAA 1VPLA 4YCNA 4EELA 1Q2XA 3W4JA 2G9NA 2PRSA 3H8SA 3JWEA 3CF2A 4OPMA 5DHSA 2XGJA 5TIIA 1TM3E 1BCRB 3HGQA 1W2HA 3ZWPA 4AK9A 2FMTA 2W2PA 3DC2A 2I6XA 5EXSA 1N9GA 5B6IA 2O0KA 2WIKA 5HXAA 2IIQA 2PBZA 4CMJA 4Q24A 1R6UA 2BTOA 3M6WA 1MT3A 4BVBA 1TW2A 2ZVJA 4DOMA 4GBED 2J0UA 4ZVPA 4B6SA 5ERGB 5IUJC 4LYGA 3MGGA 4CCAA 5AW5A 1HYQA 1FFCA 4KU4A 3HXOA 1T6YA 2HK6A 2VYFA 3N2KA 4KUEA 4FYPA 1A95A 2GAOA 3IAS1 4WSOA 1CUZA 3WYCA 1BS9A 4K8RB 3GLGE 4K6KA 3D3NA 3GROA 2IUFA 3RC3A 3SX4A 1EFUA 1ORDA 5IARA 3H9BA 2IL1A 4RZUA 1IN7A 1E4OA 4M55A 4HQNA 3KPWA 5DXFA 5EAIA 3UKOA 1IN6A 2JFWA 3G2HA 3I6ZA 1QR2A 3IUJA 2B8NA 4YBRA 2HHLA 2G71A 3GZNA 4PAGA 4B7CA 1HDZA 5AW6A 3Q85A 2E89A 1XTIA 1SBQA 2X3FA 3SJCA 2FEPA 1COZA 3DDWA 3GFSA 4I9UA 4QU8A 5KJ1A 3O3NB 3PEEA 1AU9A 1PR4A 2HOQA 3ZNOA 1PR6A 4JVMA 4PLGA 3CFYA 4Q93A 3T5AA 2R8PA 5EKUA 4EQ6A 1ONNA 3LLUA 4HCJA 4UAJA 4UQLA 4Q3AA 1NY6A 1N6KA 3FTPA 1TCBA 1V11A 1CK4A 3DCIA 4X0EA 4BBZA 1RZUA 3KYDB 1FP2A 4JEMA 5HG0A 5FBVB 1F7VA 3WDSA 5DYNA 1JDTA 5BRNA 5KYWB 4RTJA 2EBHX 4DMMA 1KYIA 1WBJB 3TW8A 3SJ7A 4BQRA 4EB6A 3JQ9A 2FKNA 4MQ5A 2QZZA 1KRXA 1X7YA 1UFRA 3BVPA 1VL6A 4GE0A 5C1PA 3DBHB 4EKGA 3P7MA 2C9YA 1WLYA 3KS9A 4PZCA 1Z4PX 3ZY2A 3BJIC 2ZI5A 4R2HA 5EKXA 5JJ5A 4Z9FA 3FI9A 4A23A 4QZVA 1L5GB 3SMVA 1KQNA 3OKCA 1O08A 2QQFA 4B8ZA 3G2QA 1YZNA 1NNI1 4B75A 4ED9A 1AKNA 5C3MA 1RQXA 1MEJA 1L7XA 2GM9A 3A70A 3FCSB 3INYA 3W4IA 4BQQA 4LHEA 1Z5ZA 2R6GA 4IFIA 4M1QA 2HDHA 2C7PA 4M6WB 3K9QO 1IXSB 3OOJA 3QEMB 1IG3A 4IWXA 1G2OA 2YJ4A 3DLBA 1QIDA 3H2HA 5E6SB 1MMFB 3VJMA 4JBGA 4N0MA 2I2XB 4EJ6A 1ORVA 4LKRA 3L4BA 5EC8A 4TLDA 4XWKA 2NTVA 1CUWA 1Z13A 3EDQA 4OI1A 3K6SA 4FBMA 3AL3A 4XIJA 3UYKA 3ZTTA 1ZL2A 2CDNA 3C3MA 3OFKA 3COSA 1NAHA 1QYIA 4Y9TA 3IOCA 4U9HS 1CXZA 3PFNA 4O1MA 2BM0A 4UHFA 1JJAA 2AK2A 3HKCA 1XTZA 2G0TA 4R31A 4TXLA 1JIVA 1DLJA 1P4HA 3I9OA 2H2AA 1D6MA 4PAOA 2J3IA 1JI0A 1W581 3PGVA 1EQAA 1N9GB 2JEZA 3EDCA 1MPXA 3L1UA 1Q0UA 3Q2IA 5FNVB 2ZK7A 3LVFO 3IP3A 1M83A 1VHLA 3K96A 2W2MA 3KXDA 3L02A 3LDUA 4BLRA 2NT3A 4CLOA 2IY8A 1VGVA 3LQ4A 1NKTA 3NKLA 4ZK2A 1TZKA 3FWZA 4E2FA 3OP4A 3OTHA 1HDIA 1M66A 2H4ZA 3OJ0A 4Q16A 5CUQA 4CQLA 4F96A 3S8EA 2FTKE 2WAYA 4Z4FA 3AH8A 1IEQA 1D4FA 3DVQX 4TM8A 2PKQP 4O59O 2XMRA 3VI3B 3E22A 4BO5A 1DADA 5B3KA 2VIIA 4C88A 4N3NA 1M6EX 2X8BA 2CK3A 1GAWA 5JCOC 5MDHA 5K8UA 3HBNA 2E7ZA 3GJRA 1JU4A 2QQEA 1YL6A 3LQ2A 1Z5VA 4I1RA 4KXUA 4WK2B 4I46A 1K1EA 4AB1A 2IYXA 1YOVA 1HOXA 4LE2A 4OXKA 4EFNA 4DJFC 5NULA 4N7JA 5CD1A 1DAMA 5TDHA 2YMLA 4ALLA 5BPHA 1A5ZA 2WG0A 5E0KB 1NQTA 2VZ9A 1VI2A 3BHMA 1V1RB 3BX1A 1ZIYA 4PBRA 4E4YA 1F8GA 4Z7JA 5K8LA 2P2DA 3I32A 5G3ZA 2IXGA 1SULA 3DZFA 3HACA 2L2QA 3NHWA 4KYTA 1I5EA 3WRXC 3TUZC 3LUKA 1FUYB 1HE3A 1BW9A 4FCVA 3DMFA 3HKBA 2W4QA 4LFAB 2WTNA 4LZZA 1ABFA 4O8CA 4FVTA 1U1IA 1IQ0A 2H4XA 1IWPB 3HWRA 4FHGA 3RUIA 3WLEA 2PZGA 3E9YA 2UUBB 4TS9A 4HNGA 3JPWA 4FYMA 5DOZA 1A9SA 3DDHA 3I2FA 2Q7OE 1NW4A 1RAEA 2OKCA 4QU0A 3SBDA 3VMMA 1NSFA 4D56A 4JLJA 1DIGA 3ENWA 2WF6A 4MGYR 2FPGB 5KWEA 2O54A 5LN1A 3I2KA 3OZSA 3AUUA 4A7PA 1SC6A 3K5WA 1BXGA 1ILWA 1KEPA 4YMWA 2PEZA 4RTOA 4DM4A 2JIRA 4C6TB 4MS4A 1KQ3A 2PGNA 4MGHA 3UK7A 5KNDD 3C6XA 4ZO7A 3AKEA 1E59A 1HSZA 1DHTA 3K4HA 3K9GA 4HUJA 4MI1A 2WAAA 3I5XA 1QDUA 3KTAB 2X0IA 2IFTA 3GVPA 4TS4A 5EUBA 3ZWCA 2JD2A 1FQKA 4XXHA 4PPNA 3MG9A 5BVGB 1H8HD 3CB4A 2BCGY 3BXZA 3UEOA 1X1SA 3VTZA 1U81A 2R7MA 3IVAA 1H42A 2IEDA 1Y3IA 1MAAA 4QSHA 4E22A 1XMIA 3F98A 2OC4A 3RADC 3GUVA 2FETA 2PFKA 2H63A 4FUQA 2L42A 2X86A 2WG1A 2G40A 4HQRA 4PQYA 1YBVA 3KZMA 3ZWXA 4DTCA 3E84A 5JSQA 2J0QA 1QGZA 4INPA 1T8SA 1TMYA 4IP0A 5CT6A 3Q8XB 4KDEA 1SC4A 1BD4A 2ZIVB 1AA6A 3J7TA 1D2HA 1HY3A 1WP9A 1AMNA 3V4RA 2IS4A 1L1QA 3UMGA 1RMYA 3NAZA 1ISJA 2OXCA 3A2NA 2Q49A 3OLQA 1IPEA 1R9MA 2VAPA 1Q21A 4OA5A 5KWVA 2VRBA 3GRFA 1HRDA 4HEA1 3UICA 1JIIA 3CW8X 5TGTA 1RXCA 4G09A 3IGFA 4V2UA 1K8QA 3R9KA 821PA 4G9GA 5DTIA 4MWBA 4BNTA 3CEHA 2UYGA 3RS2A 3PC8A 4RS3A 3L0PA 1T3TA 1MQAA 3G8DA 5CFQA 2C7QA 1L5MA 3T7KA 1NW9B 5JISA 3QTLA 5C5EA 5IWCA 2PGIA 3ABQB 1MIOA 3C15C 3A9UA 4W9NC 3RUHA 4BZPA 2YMMA 4GOJA 4HLQB 5D3ZA 4CI0B 4PIMA 4M88A 3HABA 4JYCA 4XGIA 1GR1A 2ZVPX 3KP1A 2G3YA 1Y4UA 4HADA 1XMJA 1E8DA 4JLMA 4BVHA 4EF6A 1R18A 4X84A 4F5YA 2O3SA 3D7LA 1TA9A 4F85A 1UT8A 4UOZA 5JI3E 1XZLA 4CM4A 3ITKA 4D8YA 1BDMA 2B98A 4HXFB 5L7YA 3QBTA 1J33A 3T15A 1CZRA 4FMPA 3IE0A 1MKYA 2WJ3A 3FYHA 5AKGA 3ZUGA 1E9RA 4B3FX 3K3PA 1ZH4A 2BFOA 2OTCA 1FRNA 2X7JA 4B3GA 1NGSA 3T95A 2IYAA 4FINA 5H68A 3N28A 5HM8A 1M1UA 2NPFA 1ZH8A 4IIVA 1QZ3A 4UBNA 4BPBA 3DMYA 1DO0A 2OPBA 3HBLA 1J99A 1K6JA 3E9MA 5EWLA 2YWFA 2X0RA 2GZHA 3KB6A 3ADDA 2O1EA 2J67A 4DCUA 2PJRA 2J7KA 5TVGA 5C5IA 1JP7A 2GCNA 3LSYA 2PMWB 1LI4A 1G5RA 4GPIB 1NE7A 4W5NA 1V8OA 5JD3A 1EGQA 1NLFA 2GBGA 2JEOA 2QLLA 2XOKD 3BE8A 3HY6A 4LW8A 4CL2A 1SRQA 5HW0A 1NJ8A 5B5SA 3PA6A 4I9HA 3TKYA 1LQUA 3L1JA 5JSFA 3VDMA 3IJPA 2CXPA 3NAQA 4HN2A 4ZZIA 4OGKA 2P2GA 4IAOA 4RTKA 1B0UA 3HNRA 3PUKA 5JASA 1NSYA 3UGTA 5A6SA 1VG8A 3R0IA 1JJBA 4QHTA 3BTSA 1EEHA 3PPYA 4V0RA 3WMRA 5BWOA 1VCIA 1XE3A 4A8JA 3GO4A 5AM4A 2XGOA 2C7OA 2W2VA 3RI3A 2P4SA 1CP3A 3K5PA 1P6QA 5DM60 2AE1A 3DS8A 1Y9AA 3ZIAA 3D7MA 4AF6A 5HSGA 2JH9A 2WWGA 2EJVA 3HPRA 4DQLA 3Q0TA 4KO4S 1UKCA 5P21A 3TOVA 4EY5A 1JIQA 4UDXX 3M5PA 3B5JA 1IZ7A 3KQLA 2Q62A 1F3LA 1ZQ9A 1J9EA 2QN2A 2UYQA 5CVJA 3S5UA 1YQUA 1FP4A 4IIJA 3VAZA 4UPDA 5CDFA 4FJ1A 4CKEA 3CEAA 1CJKC 1IN5A 2PBRA 4L5IA 2G1KA 4Q1AA 3DPIA 5LKRA 1NJ2A 5DYYA 1W36B 5CYPA 3TTSA 1GPKA 1GQQA 1YS1X 3AEUB 2ZSBA 1W5BA 3LPCA 2EFYA 4BKMA 2H3EA 2HA4A 1Z6QA 2WIAA 5EZYF 1PYOA 4CKBB 1Z07A 1JDPA 2NG1A 2Q3BA 1X7XA 2ZB3A 4MEJA 2LDBA 1OAOA 1SVSA 2I67A 1ESCA 1M1YA 5AK6A 3VYTB 3KSUA 4KXXA 1USGA 3SEFA 3ZJTA 1D07A 4KBFA 1UP6A 4R40A 5KAPA 1EUDB 2GYWA 4XWYA 2V7WA 1WB6A 2EU8A 4NBRA 3VPGA 3MINA 3DZGA 3P2MA 3PUWA 1AQYA 1MP0A 3GPDG 3LF1A 1E6CA 4NLLA 1ZEMA 1R00A 2P4HX 2DWCA 4OJTA 4TXHA 2B6NA 4MIEA 1AUPA 4A3SA 1KI7A 5HUJA 1Q74A 1GQSA 2F3TA 2GWHA 4DVGA 3HVHA 1VPVA 3I01A 1WO8A 4PNZA 4KE6A 3AXSA 3QMWA 4UJ5A 5KI6A 3RUEA 1XD9A 3ZDXB 3DMDA 4NQRA 4GLLA 4YCBA 1ZCZA 2MYPA 3L18A 1KGSA 2OD2A 3QKRA 4XB6B 2DBYA 5FT9A 3E18A 5F21A 2V03A 4R71A 3QMPA 4X65B 1FVXA 4YUYA 1TYEB 1F38A 4E6EA 4EW6A 2I55A 2VHCA 2I54A 1NHWA 2D1RA 3MILA 2XGGA 4CV2A 1C30A 4ZOCA 1U0FA 3RABA 1I51A 1D2MA 1NXXA 4P35A 5AH0A 3HDTA 2ZDQA 1AKMA 1OVMA 1UDRA 3EIWA 2HYIC 5FAXA 2EJTA 1OWNA 3RJ5A 5AJUA 1GNPA 3MWYW 1LBQA 2Z95A 1XNQB 4FW8A 4BCBA 4XYGA 4CV3A 4ZANA 3RJMA 3NJ8A 3EEYA 1GCAA 5HF5A 4C0AC 2XQGA 3KL2A 5LNK6 1GFZA 1SKBA 1CJTC 1WHSA 1RE1A 3BYZA 1I5RA 2VRCD 3M1LA 4LZNA 2QUBA 4Q4AB 4X8OA 4C3OB 2QJOA 3ZZTA 2QNIA 2R7AA 3R4VA 5LQAA 1UJ4A 1BXKA 2JJYA 3OFND 1C1HA 1W0KD 2F1JA 2J4DA 5CTAA 4AUEA 3UJ9A 1U3CA 4KN8A 4CIWA 5GONA 3TNFA 1YVEI 2DECA 1CEXA 3C4VA 3PR3A 4GEKA 1MENA 1T2AA 1PS0A 1PJRA 1GZ5A 4D45A 1NBME 1L5VA 3ZNPA 5IK2D 3E9DA 1YMUA 3GJ8A 2B5VA 3Q7IA 5ICEA 4DSUA 2QSJA 3DUWA 4A6PA 4N3GA 4POAA 2ONKA 2ZQ5A 1Z6ZA 7AT1A 4NBVA 4NV3A 4TVKA 3T35A 4KXYA 1GPYA 2DUWA 1XMVA 2VTKA 3P5BA 4GDMA 4J0DA 4HLUA 1MVOA 2HJSA 5JAQA 5FL7A 3QXHA 4ENWA 2BGRA 3N2KB 3PNYA 1ZIDA 3PUIA 3C7DB 4ZGGA 1YBFA 4FE3A 4QPJC 1RVDA 2NVOA 1W75A 3OJXA 3OZVA 4C0KA 4IFBA 3K8QA 4BE4A 1RPJA 3AV0B 2VP5A 5HZGA 3SD7A 4BKUA 1RM0A 1FF9A 4H15A 1CNFA 3TECE 4GP9A 2XWPA 1ZK1A 3HGMA 4JVLA 4NOJA 4N8DA 4BO3A 4DR1B 5LWQA 1RQPA 1OYYA 2Y1FA 1N2CE 3CV3A 3LYLA 4MIOA 3UTCA 3W5UA 4DIUA 4JSYA 2PBLA 3R5JA 3PFKA 2R86A 1WAMA 2NUPA 4G8CA 4KR7A 5HBRA 1Y33E 3GT3A 1GADO 4TTAA 1W4BA 2A5YB 2G9QA 1G21A 3MLEA 3QQ5A 4RIEA 1Y4AE 5ETJA 4MAFA 4AO8A 4KQGA 2VJOA 1ZUD1 1NOJA 1S8NA 1ZGZA 1A5AB 2IEIA 2HJGA 1P2BA 2GESA 4ZHQA 5HTOA 2WTBA 2O5EA 1VG0B 5I4IA 2PUWA 2GRAA 4PLHA 3LRPA 1I2ZA 4HTAA 4I50F 4KO8A 4MOWA 5BMVA 1M1YB 3F67A 3KKKA 4HG2A 4S12A 4V1CI 3FZYA 2RGEA 3EZGA 3UAOA 3DC7A 2ZJ7A 4B17A 3L2OB 1B76A 4OLAA 4BV9A 3UJDA 1T91A 1BH6A 1Z4LA 2EF1A 5ALZA 2G09A 1KDTA 2LTAA 4LC0A 3ZI4A 3CLSD 4DLPA 1DCFA 1P9OA 2JFVA 2FAXA 2H85A 5L7WA 1G0NA 2M6RA 4EVRA 5EIHA 3R23A 4E11A 1V8BA 1KO7A 2XMDA 3H7AA 5SV2A 5HF6A 1O94C 2UUAB 1WMBA 1U9IC 3UK0A 4BO1A 3EVGA 4WESA 4EB0A 3VR3D 4RULA 3MYRA 4R68A 1A96A 1BEUB 3ENKA 1CJBA 3I9NA 5HQ3A 3HZOA 3OM8A 4IVQA 3C87A 4O2AF 3FZEA 1QFYA 2DPHA 3C7CB 4ACBA 2JVJA 3HCEA 1UKZA 2PUGA 1CD5A 4TYQA 2NMVA 3GOHA 2EP8A 5EPEA 1KFCB 5H81A 5C52B 3TW0A 3QSGA 3WAJA 3R5XA 5J2TA 1MH9A 3FGZA 4QDUA 2EKLA 3EA0A 4N1AA 2WJYA 5B37A 4DV0B 2VQDA 1F4VA 2WTAA 3BFKA 2ZJ6A 5GZ1A 3BFVA 2VT3A 1N1GA 2RAUA 3NBXX 4AT1A 3T9AA 1UFKA 4QEDA 3BCRA 3LBNA 5CR9A 2HWYA 5KTPA 4HNRA 5L3VA 1KYXA 3SHOA 5FLEX 3ND7A 4N18A 4Q9HA 4QUAA 1SB9A 1J2YA 2JZOA 4D3YA 3UVEA 4KWEA 2WICA 4I8IA 3HA5A 4KQXA 4EPTA 3K31A 1LJUA 4WOBA 2VHWA 2Z56A 1Z5PA 4EKEA 2J09A 6REQB 1AQJA 2IOQA 3CRW1 3DAFA 1SXJA 3BILA 3H18A 3HYNA 4DBZA 1FDVA 3VYRB 1ICIA 3OT4A 3QW2A 2AUTA 3RBZA 4YJFA 3GLKA 4WXYB 1QC5B 4LVOA 2C96A 2JFNA 2NIPA 3JD3A 3B6MA 4RQAA 1ZOPA 4TXMA 5D3MA 2QJRA 1P3JA 4A0GA 5I7SA 1A1VA 3UK6A 2QDKA 2C2MA 4J0JA 1EX6A 3P19A 1PGJA 1GZ4A 1WEHA 4JUDX 4M8IA 3SZGA 4YALA 5AMXA 1XJWA 4KIWA 4F4DA 4DADA 2XMZA 3W9YA 1YZVA 3GCZA 1KEEA 1HPLA 1FFXA 1FS4A 4BJ1A 5DXJA 4O2RA 1OXKB 2IHYA 3CG0A 4H0FA 4X1KB 2YOFA 1GP2A 2I1WA 5D84A 4BNVA 1WEKA 2ET6A 2OB1A 4L0DA 2WZDA 1Z6PA 2WF7A 1P5FA 2A7XA 1GSHA 2V97A 3LT5A 4XYBA 4F3YA 3MWGA 3CX7A 2OEPA 3ZHTA 1SCDA 5I01A 1TO1E 2LKDA 5ABPA 1SD5A 1AKVA 3ZG6A 1GGKA 1ADBA 4G1VA 2H1RA 1VJ1A 5HCUA 5JY1A 3DL0A 2DEUA 1RZ3A 1TIKA 2JCBA 4H3VA 2Q0XA 4LDJA 1DKLA 5EQFA 4IVPA 3VZRA 3D3WB 1NVEA 3SQXA 2MDTA 1LB1B 3I1YA 4IUCS 3C6YA 2JKVA 3Q3VA 3UZUA 4ARIA 4BIMA 2GN4A 1XTJA 1X7GA 3BC1A 2IJGX 3BL6A 1NZJA 3EZ9A 2XOKA 2NZVG 3M5WA 3MRTA 3OZRA 3MXOA 4KNWA 4YRPA 3K32A 3SBXA 3TN7A 3LNTA 5FNZA 1Z2CA 4UZEA 2P8SA 3P4YA 3QOFA 1CBUA 2JA1A 2YVQA 3T5BA 1B26A 5AKZA 1BHJA 3VUFA 1ZK0A 1JIUA 1SXQA 1YVUA 1BN7A 4D4IA 1JEYA 3OE7A 3S2YA 2YFQA 3LS2A 1IM2A 4NYMQ 4E2XA 2UYCA 5JVDB 1A5BB 3ILHA 3N8HA 2QL9A 1Y5NA 2Q0SA 2QPLA 4PC7A 1K6XA 2OSVA 3U0VA 4HH0A 4N54A 2GD2A 4DMFA 2QX8A 5AVZA 5IEJA 1I0ZA 3MZ0A 4PICA 4JI5B 1KK1A 3L0ZA 3L92A 3NVAA 4AZVA 3OIFA 4HD8A 4NARA 4ZYTA 5BPFA 2C59A 3R74A 2R3SA 2I0FA 2PU7A 2H1SA 2ZIXA 1L5LA 5JJBA 1I94B 2ZBVA 3LOUA 3ZYCA 2Z5LA 5LIPA 4IGAA 1P0MA 1LBTA 4K9PA 3VYVA 3I9LA 4EJSC 3RQSA 1NVUQ 2JAUA 5FH9A 2IS6A 2I8CA 4ZDKA 1SRRA 3BFPA 3NBZC 1T2CA 4MV8A 2JEYA 4K28A 1IJFA 4Q9NA 1LQ2A 4WY8A 1BX3A 1QLWA 3UFXB 1MGOA 2HF2A 3GT4A 5M2QA 2QOEA 1XEFA 2KS6A 4HAXA 2FPIA 3EHEA 2VYCA 2C07A 5CFZA 5F77A 3RYCA 1NMZA 1P18A 1VBNA 2WF9A 4AJNA 5DEIA 5KQRA 2O8BA 3DVLA 3FKQA 3MTJA 4YUZA 2LDXA 5FBRB 1MQ8B 4BMDA 1QIFA 1NNUA 2YJ5A 3COZA 4GPD1 1G7TA 1E7SA 3VOSA 1BMTA 5DK6A 4QQFA 4ZZ3A 3ZDBA 2IEYA 4N5NA 4NJEA 2FHSA 1OZ0A 3HKBB 3KL4A 4QJ5A 3N58A 4DLLA 1E77A 3B7GA 1AE1A 1NT2A 4WMLA 4EZEA 4YP9A 3U19A 4MLPA 5BUQA 5CW1A 5C4MA 3FLAA 4HWOA 3AVXA 1Y89A 3N75A 4PO9A 3KQTA 3FFXA 3EPLA 1DJNA 3AEYA 3PDJA 3GRUA 2H1IA 2BBOA 1NXVA 2VHJA 2WHQA 1G6Q1 4BDTA 4FCTA 1SNYA 2R85A 3E2IA 2F59A 3R24A 4HEJA 3ZEAA 4UCFA 4DQDA 2HZ7A 4GX2A 4ZQFA 2FOLA 2HJ9A 3G2IA 4P08A 1M76A 3ND5A 1OPXA 5BSKA 3OFNA 4BTLA 4RTSA 5DRTA 1T34A 1WZCA 5EIBC 4H3KB 2NZXA 2FFAA 2HCBA 4RS4A 5EXXA 5LYYA 4FFDA 1KY2A 3THOA 5LOVB 1V1JA 4ZA2A 4LY6A 1FP1D 3L07A 5AQ1A 5KYXA 3LDGA 4LX0A 4AG3A 3IO5A 3A6PC 1DXYA 1H8HA 2AEFA 4PSUA 4RKYA 3G3EA 4IS3A 1WSDA 3DEAA 4G9EA 5A9SB 3HP7A 3RS8A 2C2XA 1LPNA 5LQDA 5E9WA 4LRYA 4WN9B 1UKYA 4FGLA 4NONA 3QV1A 1THGA 2MSLA 3EFOB 3TFQA 5F7JA 3I0MA 3Q3CA 3LFUA 4HH1A 1FMCA 5J9FA 4GVLA 5IBPA 3ZNQA 1ISMA 1U1CA 3GUCA 2OAGA 5IDQA 3CUVA 4B3DA 1T9KA 3WLTA 4L15A 4CT5A 4MV3A 4GQBA 5DCYA 2H5IA 5J5CA 4YUAA 1S02A 3KD3A 4G3XA 1O8BA 1T9CA 3IQDB 4G5RA 4ER6A 2DQKA 4S35A 4CM9D 3U3RA 3I0ZA 1A9RA 1A77A 2GETA 3QUAA 2MJLA 5FLKA 4CQMB 4DUGA 4F7WA 2Y1CA 5LQRA 4XSGA 2GAFA 3CBQA 3LUJA 5KVVA 2FWBA 1EWQA 2C54A 4LRTB 5SYNA 1THMA 2VEDA 3H04A 3VVMA 4EOGA 1HLPA 2XA9A 5CH8A 5EEHA 3UH1A 4LHSA 2OV3A 2C5FA 2FSPA 3HDVA 3KQQA 4PHGA 1AURA 4WFJA 4O4HA 2I3BA 4F9GA 3ZQ4A 1NFRA 2AGVA 3AERB 3Q9SA 1DG3A 2E1RA 1N2XA 1QQTA 5M04A 2W6NA 3OQHA 2ZU6A 5F1KA 4PN7A 4CGZA 2B37A 5TARA 1O96A 3K70D 4G0WA 4MNTA 4OVKA 1Y6GA 2IYTA 4QULA 4NKRA 2GCEA 4CKBA 2CYBA 1CUBA 4TL6A 4JBLA 3U44A 3QVXA 4EUEA 3A7EA 1L7PA 3PFBA 3N0WA 2XY4A 3T06B 4C05A 2QQ5A 2A94A 3HA7A 1O8CA 3MMXA 2A7QA 1TLFA 2B1JA 3VSCA 3D64A 4BO8A 4LQLA 3VVLA 3OM1A 2A35A 1L0BA 2LRHA 3UV3A 3N07A 1RADA 1RC0A 2Y0DA 3QIAA 1QZTA 1S2OA 4R8MA 4U9UA 5GWXA 4EARA 3JYPA 1TVKA 2WY2D 3T4XA 2GZMA 5E4FA 1RC8A 3PQ7A 4FW9A 4CKYA 2NXCA 4EY4A 1E66A 4J1QA 4KHZA 1CZUA 1LJLA 1NC3A 1QPGA 4EZBA 4LS3A 2D1TA 1AV6A 5GJVC 3T5TA 1LI5A 5L7TA 1QYWA 3PWZA 4L7VA 3LDAA 4CCWA 1N1MA 1R5OA 4ZOLB 3ZUPA 1PWZA 3WO1A 2CJWA 1O96B 4CKCA 1SBHA 2PKRA 5IX8A 3ZD7A 3C1OA 1W88B 4KLRA 1EFRD 1PG5A 5BQPA 1NA5A 5K0TA 3L40A 3G9UA 2D5CA 5HVNA 1EVIA 1S7CA 2DKFA 1PJCA 4H60A 4IUBS 3N2EA 1BX0A 4LK3A 1K4MA 1CIPA 4KDCA 1QAQA 1U0RA 2CVFA 5FF9A 1KDOA 1IOLA 1CFZA 3L4EA 3H8VA 2PQ0A 4G1BA 5FTMA 2RKWA 4Y3UA 3A9CA 3DFFA 3GEDA 3FPBA 4US1R 3TB6A 3ZV7A 1UEIA 5A4JA 5CYGA 1GO2A 1XDZA 3Q1KA 5DLDA 3AEXA 1JQAA 4C4RA 3WFJA 1ZMRA 1UPCA 3DLPX 4J0EA 1NW8A 1Z0JA 5DYGA 2R79A 1EP9A 4XUDA 4LK2A 4CM9A 3MHTA 4PQEA 1KWGA 5C18A 4MJXA 5EYPA 1I1NA 1M2WA 2MYNA 1E3EA 1G6KA 1VJRA 4I1YA 4OBWA 1X8JA 5BWLA 4NMWA 2QSYA 4EGAA 1TQ4A 2QD4A 2XQIA 4OMDA 4AC9A 5LYJB 1M2HA 3CBGA 3FTFA 5G0VA 5C8DA 2IW3A 2O4CA 2BCEA 4TT8A 4GX0A 1K4YA 2JS7A 3NTQA 4ZEXA 3PUHA 2FWPA 1MX1A 1AIPA 1ST2A 3NRJA 4Z9YA 3Q5DA 5BN3A 2CKDA 3AQIA 3E8XA 1DUIA 3BA1A 4XWWA 2A14A 5IM5A 5KMGB 5E4JA 3SE0A 3FSEA 2CLLB 3DOCA 1Z63A 1EPUA 3Q40A 1ONBA 4B09A 4HRXA 4U7PB 1E2UA 4KPGA 3L8GA 1XCBA 1URPA 4YO7A 1HE4A 2G06A 3W1EA 4IQGA 1LPAB 1FTNA 3DEHA 3GRKA 1A7AA 5B6PA 4PFKA 2QNBA 4LBWA 3OEEA 1KPGA 2ISQA 1TL7C 4F11A 3PVZA 3RE1A 4UCWA 1H8EA 5HK9A 3VU8A 3HA3A 3FMIA 3BMNB 4E2ZA 4EKYA 2IV2X 4ZRNA 1BVRA 2J7PA 2HIHA 5IW8A 3BAFA 1NN5A 2BP7B 3A6FA 5FFNA 2ZWMA 4Y2XA 4ZGWA 5FWNA 3JVIA 5K8IA 5HKKA 2XVXA 5BSWA 2CHGA 3SHQA 4O63O 4LOIA 4QT4A 5FUMA 2QTZA 2JKZA 5ER9A 1U0OC 1Z33A 1LNSA 2DPGA 3S2ZA 3TSYA 1L8OA 3L4KA 2ZJBA 1JSRA 1OXSC 4Y2YA 1OBHA 4FFRA 1DKMA 3ES9A 1KYQA 1NR7A 3PXAA 3T5PA 3GEBA 1KY3A 1S1CA 2NXNA 3N6VA 4JP8A 2WWRA 4OH1A 5KDDA 3IIJA 2ZJ2A 5E6UB 1Z22A 2F4NA 2QUJA 4IOLA 5HKOA 4L9AA 4OAQA 2IUEA 3MOGA 3SZ3A 5LDHA 1JGTA 3R3JA 1WP4A 5TT1A 4B9AA 5DIZA 1GRQA 2DHEA 3VZQA 1RCUA 3S6JA 4BNGA 5CAEB 2PU5A 1Z6XA 2FPUA 3VSEA 2H00A 4H7FA 4EHIA 4HC4A 3PFIA 2BCJQ 2ZSFA 4AYTA 2I6QA 4D92A 1NN1A 1KOFA 1I24A 1X42A 1RVV1 2GSWA 2W83A 2QTLA 4NNPA 5G3YA 4ZMSA 5ILQA 3UATA 2H4JA 4EYSA 3CTPA 3CO5A 3P9IA 2Y67A 2GBIA 1SHKA 4GGOA 4GS5A 4C5AA 1P81A 4AO7A 1GTVA 3LBHA 3I6BA 4OCZA 4DV2B 2WJVA 2IX9A 3QPVA 3VSAA 4GR9A 3IP6A 3JQ9C 4B3RB 4YCCA 2QTTA 3NEAA 3B20A 4J0CA 3ZHRA 1FJGB 2OCXA 1Q3KA 2GEBA 5FTJA 2H1VA 2VH1A 3GMDA 3UJHA 4F6CA 3GLFA 3KSMA 4R1MA 1ZD9A 5IYZA 1AKTA 1ODIA 4NZPA 4AY2A 2QMQA 2SBTA 4WZ6A 3OIYA 3QMMA 2JRLA 4QUEA 2ZAYA 3PRJA 1SKUA 2X9LA 4LRQA 3OZBA 2PKXA 2IXTA 2QRQA 4J0HA 4RMJA 9LDTA 1QF9A 2H2GA 3WWOA 1FZQA 1TIPA 3K6KA 1OU0A 2PKEA 4IH9A 4MYSA 4R1UA 4DG9A 4UVIA 3NQ41 4P83A 3UQZA 3ANTA 1SCQA 8AT1A 2ZUCA 5EJMA 1X7WB 3UXHA 3B1ZA 5HYVA 2O14A 2R8OA 3GJXC 3W06A 3R8CA 3SKYA 4CTMA 3A9RA 3U4HA 3EBOA 1EVKA 3JZAA 3BMQB 5IABA 2QD1A 1QBKC 1UPUA 3MYYA 1HDEA 4IJ5A 4UBJA 2K5UA 3WS7A 1KYZA 4A2PA 1HDRA 5CM2Z 1FFHA 3VPFA 1C1XB 4D81A 2PKWA 2WLTA 1ZXLA 1I10A 2Y0CA 2QPOA 2HNKA 2IZ0A 4O3FA 1IEVA 4C2AA 2YHIB 2WOOA 2ZYHA 1BWRA 1RTTA 2OR3A 1P5RA 4TL8A 5LQUA 1WETA 3P45A 4B74A 2PGOA 4YRTA 3X1JA 1KMCA 3R7FA 4RFSB 3FWYA 4B3MB 3EF3A 3NTVA 2G0NA 2I2DA 1JN0A 4A1FA 4B6QA 5GPBA 1TVCA 3KHUA 1N0HA 1V35A 3WZLA 1H65A 2OYCA 3R2JA 5TRTA 3DO6A 3CUWA 2B69A 2H51A 3WMGA 5A62A 3HKEA 2FUKA 4NG5A 1QZUA 4MHSA 5DP1A 2WZBA 4HDMB 1WKBA 4A91A 1UWVA 3O6VA 1YAJA 1K5DA 2H52A 4LZOA 4PGFA 1JPVA 2V7EA 3TW4A 5CLQA 1GCGA 4YPOA 4EX7A 3PSAA 1EAMA 5EWMB 3WICA 4UUNA 4MV6A 1D2RA 3HB5X 3ETJA 3HY4A 1DNPA 1CJMA 1VA5A 3E22B 2BH9A 2E4UA 3D5TA 5D1NA 3A04A 1PZEA 4OJYA 1YZTA 1EXMA 4ODIA 4WFKA 3HXQA 3UPTA 3X44A 5DNCA 4CQLB 3EPHA 5FL3A 4MR8B 4F3KA 1FS5A 1JG7A 1L3BA 1VLVA 1XRMA 1V26A 5A5FA 1X7WA 4YRCA 1X80B 4IMJB 1JV2B 3D9QX 1JWBB 3ZBTA 1LDBA 4KAFA 4GIBA 4AO6A 2R6R1 1Z16A 3E82A 4Q02A 3ICQB 4DJJA 5JCOA 3DAOA 2AIRA 3K6RA 3V4ZA 4HDCA 4E07A 4EI7A 2I2BA 3IEKA 1YDMA 1DTSA 2Y68A 4K9NA 1AA9A 4KVFA 4MCHA 1IY2A 1HQCA 5CB4B 4TWBA 1BS2A 1E2MA 2P5YA 4DF3A 5JEEA 1K3FA 4D3XA 4EY8A 1XF1A 2G6TA 3ICOA 1PFQA 2PZLA 4UUAA 3D6UA 1XJCA 3WRVA 1XRJA 2QG9A 3IKMB 2HMTA 4PCUA 3HDGA 3ZX4A 2VNHA 3UW3A 3DT9A 2C5BA 2EX1A 1WDTA 4TMYA 1WMDA 3CF6R 5DHUA 1P8JA 2G1UA 2WM3A 3VR1A 1KK0A 4YQFA 2YUIA 3HYTA 5JJIA 3ZZNA 3IT0A 3LL4A 4ZD6A 3O9VA 2EVWX 4GECA 1JR3D 3VVCA 1DG1G 1A8PA 1DBVO 1UJMA 3K8YA 5AKIA 4QUKA 1RHMA 5JWHA 4KTVE 5LZ8A 3IIEA 4C89A 2J1LA 2EFEB 2NW6A 4QWMA 3BB3A 3LK7A 2ZRHA 4H4DA 5AVOA 2FWJA 2VPQA 3GFFA 5MFPA 2CLIB 3EXEB 2BM8A 3U6BA 1T2DA 4NQZA 1VJDA 4UKDA 1LTHR 1WD5A 3I37X 4JQYA 4B5KA 2R66A 1TZBA 1ZJ5A 1E1QD 1SHJA 2C61A 1Y3HA 4P81A 4W99A 3U7RA 5TPZA 4D42A 4UCXA 1O95D 1VKZA 2KLHA 4UDOA 4Q3LA 2XBUA 4G0ZA 2P9TA 5IH7A 1PGPA 5AFSA 1XZDA 2XE7A 4Z4EA 1EDDA 3UGQA 3RANA 1JZQA 4H7KA 5JZ9A 2C98A 2BDEA 2Y92A 4OJKA 3NB0A 1X2EA 5KYUB 4ECAA 4PZ0A 3M6VA 1TLLA 3KJHA 3BMNA 2DM6A 1VOTA 2RG7A 4EAQA 2GCOA 1CUGA 2AXQA 1ETHA 2GEVA 2QRGA 3O82A 3CH5A 3O8OA 4MVJP 1CT9A 3GN2A 2EWMA 1GILA 2C2BA 1Z6GA 2LVBA 5AOVA 3JQFA 3KWJA 3OQVA 3QU2A 4C0JA 4KBGA 5HKBA 1F2TB 3F9CA 4I6GA 3WKBA 4LJ5A 2YWRA 4ZT7A 4CUJA 3HSYA 1S3IA 1GKYA 4D8UA 2IY9A 3UXEA 3RK1A 1NW3A 2RJNA 3UV6A 5IHPA 4KXNA 3GLUA 3A6EA 2FEKA 4AF8A 4MPDA 1LRLA 3I4LA 4JOCA 4C0WA 4H7DA 2QTBA 3ZCPA 5I4BA 3NM6B 4MUMA 2O1XA 4N3CA 3CEMA 2BRUC 2PL9A 1IY8A 1SCNE 5AXAA 1ZVMA 4FFSA 1TYZA 5F2NA 2FOIA 4IGIA 3RVMA 4PS1A 1DCTA 4GKKB 3RT1A 5EJ9A 3THRA 3H4TA 1O77A 1DC8A 2LZ0A 4EFLA 4S1TA 3QJYA 4DNPA 4NCBA 3RC8A 3RKUA 2D4AA 3C24A 3L8CA 1RCTE 3UWSA 3VSDA 4C29A 2D62A 5EE9A 1DIAA 2X8LA 2YKGA 1XDGA 2WG2A 3MJSA 4YUVA 1W36D 1TYCA 4P22A 5IG2A 1UBCA 2LIVA 4OMUA 4PZLA 1T3GA 3IOEA 1K66A 4PCAA 4EEXA 2PTGA 2RI6A 4GG1A 3AM3A 7GPBA 2AD1A 1RJWA 3E15A 3KQHA 2HSGA 3T34A 1NC1A 4LMBA 5LBUA 3ROXA 1UJ6A 1HQYE 3BWVA 4C22A 2QM3A 2ZM6B 2Q46A 5CVEA 1PNQA 3ZVMA 2QV0A 4GX1A 4M6WA 3FHTA 2B2NA 1XNGA 3L4BC 2FMFA 3PIIA 5MGBA 2AKYA 4BB9A 3IXLA 4AJLA 4CG2A 3IVCA 4KQHA 3H1EA 1EJBA 3Q6IA 4DE5A 4MQMA 5CU7A 3SC6A 4YV0A 3SDSA 4D3FA 5FHQA 2QMUA 3MRVA 5JQGA 3WA7A 3V7WA 2CD9A 1XQVA 4OQNA 5ARCA 2VWQA 4EUHA 2DH6A 2HHHB 4LX8A 5CT4A 3OCCA 5GJBA 2J48A 2XYGA 4LSGA 3WGJA 1ZHOA 1JQJC 1U7HA 1Y81A 3ROKA 4ENSA 5I9SA 1PJLA 1JAIA 1Y0BA 2HMAA 4Q4HA 3PD7A 2P0EA 2QTVB 2XRYA 1DBQA 3GJZA 1YRAA 1VYUA 3GRYA 1C7QA 1I2AA 2NO4A 5EJAA 3W2TA 4BFZA 2P6RA 1YBHA 3C8MA 4RK4A 3EYAA 3ORQA 1A50B 4YJKA 3SS8A 1MU0A 4ARBA 2VTBB 2UYYA 2GCPA 1ZSNA 3A1NA 1TEVA 3TG8A 1TEHA 1ORWA 4GAEA 1PWXA 4JLPA 3H2JA 5ITZA 3GDFA 3VHRA 5F9HA 2QI9C 3GDHA 1U99A 3RAPR 3C5HA 5BMVF 2HIAA 4JWTA 1I7SB 2AFIA 4O5OA 1W49A 3FBWA 3PUZA 2GJKA 3ANSA 4HAIA 3M6LA 1KDVA 5CB0A 4U7HA 5DULA 3IEXA 3L8YA 1WQ1R 3WIBA 4QBGB 5JAZA 1XLVA 3QHAA 1WXFA 4YV1A 4NBTA 1LPOA 5KNBA 5JSYA 3JVVA 3BE6A 1PL6A 1UWLA 3DPSA 1M10A 3PFCA 5FPHA 3TKAA 1TCAA 1Y8AA 3ZCSA 4WHMA 4C0SA 1U3FA 4L2IB 1KJWA 1Z62A 3AJEA 1W46A 2Z0MA 5AK3A 1OILA 3H5WA 4WDRA 4DNQA 1G3IA 3PA8A 1BDBA 1C0LA 2XUHA 3EVNA 3UCXA 1U5AA 4R6WA 1I4TD 2R8EA 2A88A 3EZ2A 3TZEA 2AG5A 3VC1A 1EYZA 3K1ZA 3OIVA 4GMDA 4H7HA 1FQJA 1NNLA 4UREA 5IJXA 4LF5B 3HKDB 3ZLJA 1TD1A 2H2DA 4HQOA 4F5ZA 2QP9X 1D8TA 3VO9A 3L84A 4HR7A 5TMBA 4E94A 5IM4F 2A86A 5EHIA 1Y9ZA 3UUEA 5KO2A 4F3CA 1SQ6A 2YWBA 3HJUA 1VPTA 4NVRA 1QOZA 1DBRA 1KRHA 4MVYA 3FPFA 5CM9C 4LI0A 4BV8A 5BYKA 1JEEA 4HRVA 4UJ3A 4XUCA 3P27A 3DOOA 3ITDA 5JAHA 2C0PA 1BWSA 4ECEA 3D6TB 2AJ8A 1BCRA 1GQRA 1OIVA 1KKMA 2ZYVX 3DLCA 1U2QA 1NVAA 3F5QA 3AW9A 4WZZA 4ZEWA 4J2HA 4ILEA 4HAVA 1B0PA 1LF0A 1M73E 2PR2A 4NULA 5F12A 1JKMA 1F2TA 1NOKA 2AN5A 1KIAA 3DQPA 3G9XA 4D9HA 2WWXA 4NK4A 1SCJA 3QFCA 3W8FA 5KYNA 1I9CA 5IWAB 3PX7A 4A6XA 1E5DA 4YMVA 1ZCJA 2CWWA 2WU1A 4LDQA 2EX4A 3FYUB 1AO0A 2J6CA 2XQKA 1M6VA 2H17A 3OWXA 1WW2A 1POWA 3HJHA 3QHQA 4IH1A 5AKJA 5CXXA 1FFYA 2GK4A 5F51A 5EQJB 3RU2A 3LQ1A 5L3RA 4QYIB 2P3SA 4F2HA 3QELB 1Z9BA 5D01A 3K1TA 1C9KA 2JCXA 5A6SB 2B92A 5CXQA 5IF3A 1SKYB 1Z4QA 4YCAA 3V6LA 2VBIA 4JUBA 2CMDA 5E1DA 1U7ZA 3OX4A 3GRPA 1UT6A 3LGXA 3QWIA 5K5EA 1COWA 1JB1A 2HL6A 3O5AA 4RK7A 3GZ4A 1RLTA 3GLIA 3D6JA 4KQ9A 2RC5A 1ODTC 3ROQA 2PWPA 4ESVA 4JIMA 2BUBA 1PJAA 4B81A 2I8AA 1YZQA 4TTQA 3BT7A 3RSSA 3TFWA 4BHTA 2B8EA 3EAQA 4EG5A 4NNOA 4ZQEA 2BMWA 3ZH2A 4E6PA 5HWSA 3QVUA 1AT1A 1UJBA 4HFNA 3LHDA 3L5OA 1ADCA 2H2IA 3LT2A 1XZMA 4G1EB 4H08A 1NN3A 1RHUA 4Y30A 3L7NA 5DASA 2EW1A 5I7WA 4LF9B 4LY9A 2BGGA 1H5QA 3D3WA 3GX1A 3KFXA 2AUMA 3ML1A 4GL4A 3GLFE 5IDYA 1D5WA 1UC5B 1Y3FE 2A5JA 1JBKA 2WPDD 2H7XA 1XXHE 3C6QA 1LLCA 2JLCA 4X85A 4FR5A 4GRDA 2PT6A 1X13A 2IE0A 1EX1A 3U4GA 2UXDB 5I6DA 3DE7X 3O38A 2R8YA 4HZUA 4E51A 4AI6A 1OWLA 2AN3A 1IUOA 2HTFA 4J7XA 4YR9A 3ZE9A 1L5SA 2H29A 2OHJA 2PV7A 2X2EA 1Z8FA 1WIWA 3K5HA 3OCUA 3PKZA 4NE7A 3QYPA 5JDCC 3ZS9A 4JITA 4BNWA 2LE0A 2P6OA 2ERXA 2HXYA 3GPCA 1TT5B 5IZCC 4A26A 4D0SA 1SK8A 4IRXA 3B1JA 1NW7A 2FWRA 3FPAA 1YR1A 2FPMA 2BMEA 3EGXA 5DBFA 5CG1A 4FM9A 1M33A 3Q5GA 1ZDMA 4R8SA 1PEDA 2VH5R 4JVNA 2GLUA 1U7UA 4WNYA 5ALUA 3T3MB 2FK7A 4G1MB 1UK8A 1Y1PA 3PQ6A 2B3TA 3DCNA 3I2YX 1Q7BA 3TRDA 1YRLA 2QKYA 4ZCIA 5G4KB 3TX6A 4PANA 3AZPA 3OAAD 4BCDA 1Q5PA 1R50A 2GFIA 5BYBA 3GAZA 4ND8B 4ZU1X 5IDWA 1VECA 1RJ9A 3E2PA 1GNLA 3DGFC 3GLTA 3HU5A 1DQRA 4G36A 1GYPA 2YVAA 3QFSA 4F72A 1P0FA 3GVCA 1V7QA 2F1OA 4IIUA 1K7EB 3ICVA 4EECA 4F7DA 1T3HA 3HVUA 5K8JB 5E3IA 1VI5A 4GGMX 4IJVA 3PQEA 4OY3A 4HAWA 3W5HA 2CLSA 4RIIA 3Q3JB 1GL9B 1ZIXA 4ER0A 2ZAOA 4YY3B 1R8SA 3REQA 1EQUA 2J9YB 2OV2A 3DDNA 3F8TA 1T9HA 5B1YA 3DKRA 3AVUA 121PA 3H0CA 3G17A 2AOTB 1ENYA 2ECOA 2XUGA 5C8YF 2PWAA 4DV3B 1LWOA 4URWR 2FDXA 3G82C 1XNRB 3QYFA 1XTQA 5G4KA 4AYXA 1KAGA 4C1BA 3ZGXA 1YFJA 1OXXK 1Q12A 3KJXA 4FQ8A 4F8JA 3WB9A 3E3NA 4FPXA 4RAOA 2WI8A 5IJ0A 2V8OA 3BTOA 5IVKA 3VZDA 2N1BA 4LPSA 5AI9A 3MD0A 3VBEA 4E70A 3F96A 2V3WA 1WUTA 2OYRA 2C4MA 3BMQA 1A9XB 2WFAA 3BWEA 16PKA 1ZHFA 3QKTA 4RETA 1B8OA 2IOFK 4A6EA 4M7WA 1K0UA 5L8VA 1PEYA 2G6BA 1MTZA 1XEXB 4EENA 2WKRA 4MYTA 2J32A 1FDTA 1UC9A 1KKUA 3AXTA 2VJBA 3M6AA 4FCWA 4RZSA 4BX3A 2XBLA 4MHOA 4EZIA 1R3UA 2H7YA 5BV7A 4XVUA 5EA2A 2C84A 5SYAA 1VL1A 2SICE 3NX4A 4RGYA 5A7FA 1P7CA 1A0OA 3IUEA 4C7OA 1NR5A 3TZCA 2LD4A 2YYAA 5FOQA 4N0QA 4HNAA 3RB8A 1GA1A 2IHBA 5C53B 3ZJUA 1BQEA 3F74A 4W5OA 3UOWA 1CETA 1UEJA 3HQ4O 3EOBI 3Q87B 2OXIA 2RIPA 1SKAA 4H4EA 4QO7A 3GFVA 2AS0A 4LHXA 3VSBA 2JFGA 4JU8A 2YV5A 2A0UA 2XMQA 2JI6A 4K8OA 3PE6A 1GXSA 5AVWA 5LZ2A 2ZZKA 3CN9A 3TSZA 4M86A 1F20A 4AJEA 2ZE7A 1ZUNB 3JU3A 4P6VF 5JH7F 1U80A 3QVMA 1JQ5A 4Q4CA 2OHOA 3TJRA 4P4UA 1TCCA 1WUKS 2J45A 4W7HA 3AY0A 3KOOA 2O7SA 3O8BA 3Q7RA 5C1IA 1CHDA 1SHZA 3F1KA 3WQRA 4R0NA 3ZHXA 5CAEA 7ADHA 5B1HA 4JYZA 2XZPA 1IJBA 1MO4A 2BEVA 4XQEA 3H3XA 4ITUA 3U40A 3ESQA 5IASA 2C42A 1DQSA 3S2SA 3RG2A 3M1IA 2YXPX 1ZU4A 4EFDA 4F4JA 1A9TA 5B7PA 1FLAA 1AKEA 3B3JA 4MK4A 1EDOA 5FPTA 4YUWA 4PPQA 4Y2TA 5DX1A 3T99A 2OO5C 2FW0A 3KX2A 1ZMBA 5FI3A 1ADGA 3VKFA 5JSZA 4XTCS 4YRAA 3GFQA 1XAGA 1OKKD 4DR7B 1YGPA 1OZAA 3FMVA 3AWDA 3WI7A 1N2OA 3ELUA 3GJYA 4WESB 2G4VA 3ZY4A 2OYSA 2G5CA 4TTSA 4WACA 4TKUB 2NO7A 4GZ6A 4W63A 1W5SA 3H1FA 2H92A 4O4HF 2OCDA 2RGBA 4EF4A 3CVWA 2AKEA 4DCCA 1E79A 1SVOA 4EIWA 4WLOA 3GXBA 5I7VA 3IDSA 2EQAA 4IEFB 4G23A 1X8XA 1P19A 1R66A 2O2YA 1V45E 3HFSA 1WDLA 3ZTWA 4XOUA 4WIAA 5CLIA 2QX6A 4Q4AA 4WKPA 1IAVA 5ALGA 1VB5A 1WZNA 3QF4A 3JSAA 3ESZA 4V3BA 3WL4A 2VYVA 2Z5VA 1L9XA 3PUVA 2C4NA 2HXSA 4UBMA 2XCSB 3QKUA 5FXMA 5IMSA 4KSYA 4DY6A 1YS4A 2XB6A 4HMPA 2DETA 2EHJA 5J5AA 3OZTA 1PD0A 2CL0X 3CNOA 4FBLA 2ZR7A 4TV8B 1F06A 2EV9A 1DRUA 1EVEA 1SUWA 1P75A 2IEBA 2ZRNA 2D59A 5TEWA 1RWPA 5HBGA 4EUFA 2D5IA 2VXYA 2WHPB 3TX2A 5JO0A 2JHFA 1WBBA 4OQMA 2P1DA 3LCVB 5BT8A 3QE9Y 5BO5A 1NPTO 3GOQA 3MS7A 2G63A 1L4LA 3L7IA 3NWEA 3ZDCA 1P3Y1 4AG5A 3T1QA 3CNEA 1DARA 2QDXA 2X14A 4W4TA 1BVHA 3TINA 4GLFA 2XAAA 4IS2A 2I9KA 2HF7A 1ML3A 2V4UA 1QB8A 3K9BA 4JKIA 4KV9A 5HEKA 2B35A 1S3FA 4Z4GA 1B8PA 2QK4A 3OPYI 1I32A 1OLOA 3B9RA 4ENVA 1KFKB 2I33A 2BJVA 3WNQA 5JXGA 4NEQA 3LCCA 3IO3A 3KPJA 1SXHA 4QG7A 8MHTA 3H9QA 4YECA 3M82A 3U7HB 5IFLA 2RGGA 2ZYGA 5KYVA 4E2YA 4E88A 2O2JA 3WIVA 2QRKA 2B1RA 1A9OA 4GC9A 4U1RA 4Y2VA 4YCLA 4ZV7A 2HRQA 2AE2A 2EIXA 3QA3E 5KTRA 4G0YA 4LJ9A 2ZR8A 3O31A 4AROA 4CM1A 2HPHA 1YRWA 2Q9UA 3DE1X 4DMUB 3KETA 4G1UC 1CNEA 1N8NA 1WMSA 1OZGA 2GEUA 1DAHA 1HKUA 1BXRB 2AEEA 1XZCA 3COWA 4JBYA 4NYIR 2WAXA 5A9SA 1RYBA 5DBEX 4UEWA 2BR3A 1LPBB 2NADA 1C0KA 4RNDB 1MF7A 1KHHA 2WA1A 3GZTB 4MKXA 5GZ6A 5KQGA 5HRUA 4FE4A 3C7TA 2F3PA 3L7CA 2VUUA 1E94E 2HO4A 3VAYA 4YUXA 5HJ7A 1ULUA 2GR9A 3D2CA 1FFBA 3KQYA 1Y42X 4I9FA 4D3ZA 3AOGA 1N2CA 5DMHA 1HYBA 1BWPA 4B76A 2HV9A 4KQWA 4YLYA 4D4HA 3L1IA 4XDYA 2J07A 3DV0A 1E98A 4G4JA 3TEJA 3QX8A 1CTQA 1WCV1 4RCYA 4DV6B 4YASA 2HZBA 3LOPA 2VYVD 5K51A 3BRWA 2VQ3A 3X1DA 3L1HA 3G8CA 3TTTA 1QQBA 2C7GA 2EP7A 1KY5A 2NVBA 2QN9A 3FOCA 5LMUB 1G4AE 2CNOA 1QHSA 5JSKA 4NK5A 5EZYB 4AS2A 2JPDA 1O94A 1O9GA 2CHEA 5JSZB 1NONA 1LBHA 1JSCA 2AMFA 2CSUA 4IIYA 4PX3A 5JNVA 1DAEA 1I7LA 2G9ZA 3SHTA 3DKPA 3EEFA 3QOXA 4A0RA 5JPDA 4ZIRA 1WB9A 4YQYA 3UWDA 2A57A 5HJ5A 1HA3A 1RPTA 3GRRA 4I1IA 3R0JA 4RWEA 4IO1A 3MB5A 3PQ3A 4O2AA 1UXHA 2BN4A 1T5DX 3IV6A 3QGMA 1MVLA 1YA4A 3N8DA 4KX5A 1I2BA 4B7XA 3NCHA 5KX5B 1EK1A 1Y1SA 1GPLA 3TTYA 3CIFA 3T4UA 3D81A 3H1AA 2JD1A 1NJ1A 4ND4A 4KQFA 2B7LA 4L0QA 4I08A 4O4LB 3W2FA 5AVUA 1E6KA 1D9ZA 5EMKA 4D6PA 1J39A 1R0XA 4ZTZB 4RFVA 1IWBB 1XPUA 5FDFA 1D2AA 3B6EA 1N0IA 1WV1A 3T0GA 3VKUA 4BVGA 4BNIA 3GMTA 1E92A 2Q4TA 4M98A 1J70A 3BB4A 3SM3A 1BH2A 4LMAA 2QGFA 4AJIA 4GPAA 3WL6A 1T8WA 4GUAA 1KI6B 4LVCA 4HEA6 3E8MA 2APJA 1EJ2A 5SZIA 5HIAA 1K5PA 1JDZA 1KZYC 3GR6A 2CVHA 4AP9A 1QLHA 4M0FA 1QG4A 1MXFA 4FHZA 2V4MA 4MS3B 4BQFA 3SZUA 5JFTA 4ISBA 3I9V6 3C1AA 3L1KA 5CW2A 1FXUA 4BJ3A 4YACA 8LDHA 1F8YA 4M1WA 5TY0A 4X64B 3V4SA 3W2EA 1U0BB 1E1CA 1FDSA 1QRTA 1XEXA 5A5DA 4WTOA 4U5QA 2GVDC 3M6FA 2JVKA 3MM4A 4HPWA 2X7XA 4LFBB 3D2BA 1N92A 4MR9B 4I4LA 4F8YA 1UZNA 2K7FA 3QWBA 5LIRA 4YYEA 2RCYA 4F86A 1Z26A 2I76A 4HJRA 5BSMA 2WBLC 2IV3A 3AKDA 4WZAE 5E7MA 4OBBA 3B3GA 5FD8A 1KOJA 4AIIA 4EA7A 5EE5B 1KORA 3C43A 3EPRA 1ZN8A 1U11A 1JQEA 1TO2E 4GICA 3PEYA 2BFPA 2VT2A 4IX1A 3DMNA 4MV0A 2V7UA 4GYKA 3QWAA 1CZLA 5EL0A 3NAGA 3LA6A 5ELMA 2RHMA 2HA7A 3AJDA 2VUTA 4G2TA 1FQOA 1N5KA 4QECA 3AWIA 3EXIB 1T4MA 3MWKA 3EWNA 3UHOA 3NHFA 4GKAA 3EARA 4P3XA 3ZLUA 4C4YA 5JECA 4AUNA 4UMFA 5H7XA 1XZIA 2Z6QA 3NATA 3DFUA 4A36A 4G1CA 5I9LA 5LU9A 2PN1A 1CE8B 4HYEA 2QT1A 3UMFA 2CFCA 3MT7A 4FX2A 3FOZA 1MFPA 2H1OA 3DLTA 4A27A 2PGXA 5KYKA 4IDCA 2BFBB 2CMHA 1SJ9A 4Y2GA 4QE3A 1R7RA 2R2AA 2VDMB 4MDEA 2IA5A 1ZM9A 3PDUA 2NU6A 4NU6A 1DS6A 3AY3A 3U3XA 2ZT5A 3UHPA 3B6IA 5G2OA 1Z2PX 4M9RA 1L5HB 2REQB 3ANXA 2D00A 5K3CA 4OJNA 4XIGS 1EG7A 3QPCA 4LNUB 1QC5A 1P39A 1CLEA 5CA0B 1VE9A 1SU7A 4TYNA 3OQOA 4AN0A 5ICMA 3KXKA 1XKTA 4KR2A 1O95A 1SUAA 2YRXA 3CHYA 2I7CA 2C0CA 3QE3A 4KMSA 2WSLA 4EPYA 4O1IA 3GRZA 5KOYA 2DJ5A 2JNWA 4MWSA 1H5UA 4UEOA 2P68A 1I7DA 1C80A 1TT5A 4LJSA 4M83A 3AHFA 2ECQA 2ERCA 4KXMA 5HKLA 3BZUA 1GQOA 3AI2A 2FN4A 4KFTA 2AA3A 2PZFA 3OP1A 5KYGA 3KKPA 1V2GA 4UHDA 1QPBA 1Z0FA 6ABPA 1F8XA 3FGNA 3ED1A 3RK0A 1JBEA 1XQWA 3FUCA 2JAQA 4M9SA 4DILA 3L8DA 2CNBA 2YH2A 3U3MA 5CLHA 5JAOA 1PVVA 3RHTA 1XZBA 3P2EA 1UJNA 3BSSA 1H2WA 2CF6A 3TVYA 2ZM5A 5CJ2A 3SKXA 4D8TA 1SCUA 1HURA 5J2TB 1XTSA 4FZRA 5LZ7A 4I6EA 1YUNA 3PT5A 1NW6A 4MZXA 4R2IA 1ZI6A 2IYWA 2R6ZA 1T9BA 1H1LB 3JARB 4YRQA 4DM7A 2OSBA 1DT5A 3BK7A 3HUEA 3AUFA 2FI1A 2J30A 2AYXA 2P3LA 3KU4A 3W6PA 3FDFA 3LGSA 3T1TA 3BSWA 3Q7QA 5J63A 3H2GA 3I8SA 4JP3A 5FYDA 5T3YA 3BHNA 3BWYA 1WXGA 1IK4A 3R7WB 4IZOA 3MCWA 4P4SA 3IAEA 1T8RA 1KJQA 5KTSA 3HJBA 3ZNNA 4G86A 4K6OA 2VDNB 5F9MA 4IHJF 4N8SA 5HNKA 2OENG 3NHJA 4NR0A 1RWMA 4AY5A 1WXQA 2ZUSA 3HN2A 2AC4A 4QUJA 3SYRA 2MSKA 1XZ8A 2VHQA 4TUYF 5DNWA 2AI3A 1LV8A 3HJFA 4XWTA 1JNXX 4CPDA 3U6KA 1FYWA 1P7VA 2W6QA 2WSIA 7MDHA 3V1KA 4YP0A 1R9GA 5ALMA 2BH2A 5H0IA 4MX8A 1JVBA 1K9SA 1RHJA 4JVSB 4MI6A 1ZAYA 4OLFA 5IN5A 1JAYA 2PCLA 3EE6A 4JDPA 2P30A 3CLTD 1GITA 3CNQS 1W9MA 1ZITA 3VPHA 1U2DC 2L82A 3RS7A 4TSRA 5K9ZA 3E1SA 3UNXA 2VDKB 1C3XA 4QU5A 5CDYA 2C3OA 2ZXUA 3PKJA 1RDFA 2I34A 2OC9A 4IDNA 4EG1A 5JNRA 3T3HA 3BMOB 2YW2A 3ZWOA 3U5TA 3PWKA 1YRYE 4JJKA 4NBKA 5LZ9A 3QUCA 4C07A 2BZGA 2XD9A 4DUZB 4QVIA 2C4HA 1FMJA 1OJLA 2ZT8A 3JQBA 3K73O 3WGUA 1D0SA 1YS9A 5HMMA 3L6UA 2CSXA 4MRMB 1MAHA 3UG7A 2I4TA 1VP3A 3UMSA 4L8VA 1SKQA 2WPNA 4LJ8A 3R76A 1OFTA 4QNMA 2JGNA 3DD1A 2WYWA 2ZIEA 4ZQHA 5GIPE 4X62B 1UFVA 3E3AA 3K8OE 2D7DA 4JHXA 4FXPA 2ORWA 1EZ4A 3M9LA 4BGDA 1PV1A 3IL2A 3EXIA 5B7QA 3MJVA 2J3LA 4NAHA 3QXGA 4HSEA 1J1ZA 4Y6QA 2OCGA 1GTL1 4WZBE 2WJ4A 4LGCA 4MP8A 4D9IA 3RJ9A 3UJ3X 3UAZA 3URKA 3MC1A 1QGUB 2NTYC 3HJRA 2QP4A 5C3UA 1YI0A 2R00A 3LXRA 4PYLA 4DKXA 3IQIX 1JFSA 4CEJB 3HCDA 4DL9A 1JHAA 2RDMA 4BATA 3NHBA 1UXIA 2OG2A 5ALWA 3ENNA 1O3YA 4IXNA 3CLTC 5DE3A 2R62A 4CJXA 2CLCX 3FWNA 3TVDA 4B4WA 3HO1A 1YOVB 4RX1A 4FT4A 4OQFA 3VPSA 4D8WA 2X8JA 1J23A 3GB9A 4BFXA 4RJ2A 1RHQA 2G9UA 3OEHA 4K5QA 4TTPA 4DZRA 4QBKA 2KPOA 1MG5A 3JYOA 3GH3A 3LRXA 2G77B 4G5QA 2JZCA 4D9BA 1AZTA 3M2TA 1TA0A 1YZGA 2QR5A 1U31A 4E09A 5IKEA 3W78A 3KJQA 5L6MB 1FBNA 1FNDA 3IAS6 4HFRA 4JJ8A 5FI5A 3SJAA 2VA9A 4HQLA 1ORTA 1OGJA 4K9DA 4OXNA 1YVPA 4KRFA 1Y8QA 1Q0TA 3M49A 4C6RA 2H59A 1RFLA 2JI7A 4JB2A 1PFYA 3FGOA 2AMLA 1JEJA 3WK9A 5FUXA 4BBPA 1Z18A 2E6KA 5J40A 2IPXA 5BN3B 1JEDA 1EM6A 1R88A 2P40A 3AK4A 3NC1C 4MUKA 1Z5UA 4HNHA 3ISTA 5FFMA 2KJQA 2B7BA 3JATB 4HGOA 4GWGA 4LVNA 1ACJA 1A7JA 1KI6A 4LJ7A 4ZTUB 1U28A 2ZTMA 4MO9A 4JOQA 5DISB 5FQOA 3RSLA 1JE1A 4TZ6A 3AILA 4QXAA 1FE8A 1Y7PA 4KQ6A 1R15A 3GCXA 1E2KA 4QYWA 5K4GA 2BEUA 2VHUA 1YJ5A 5T5QA 1FSPA 3KZKA 1QO7A 3G9ZA 3JRNA 3HCWA 4FGZA 4CKZA 1BU5A 4PHTA 4A16A 5BRAA 2WQ7A 3RVOA 5F2OA 4C1NA 2PTHA 5TMPA 5DXAA 2WJPA 5C37A 4JT8A 4HVLA 3MS2A 3R3ZA 2CDBA 4JLNA 2H2WA 5JNLA 1NRWA 3LF2A 1WU8A 1A72A 4TLLB 4NZZA 4H31A 2P62A 3K53A 3F4KA 1GZ3A 3NFRA 2DR0A 1I1OA 4XIYA 1PYDA 2VDJA 3IP7A 3NDPA 5I7OA 5BWMA 3CEJA 3JQAA 1SD1A 5AM5A 5E6SA 4FMDF 1E63A 4D3DA 2EKZA 4LFCB 2ZJ8A 1L7VC 2ADFA 3QI2A 3EISA 4DR2B 4YAKA 2QTNA 4UDYX 1NDQA 4HDNA 3N59A 1Z7EA 1J0XO 4M0EA 3UJBA 4LCEA 1H69A 2LW7A 4WASA 2E2WA 5IXSA 1TM5E 2PSJA 1VHQA 2JK1A 2GN9A 4WE3A 1FNBA 5GQSA 2TECE 4K87A 4KE7A 5GMOA 4DYVA 3CVXA 4P0QB 1FLVA 5J23A 4G0VA 2Y8EA 1HT3A 3F3KA 4GBMA 2NO9A 4L75A 2QAGC 1TECE 1O9HA 3MCUA 3LAWA 3WNCA 3KJFA 1U3TA 3D7NA 1J9ZA 3FYTA 3ETHA 3AVPA 1ARZA 2Y0PA 1Q1ZA 4QYSA 3IE2A 2ODAA 3R7LA 3GA0A 5IHXA 1JG4A 1ZGCA 3FCAA 3I1JA 1LUAA 3OMWA 4FFWA 1ODFA 3LC2O 1PBTA 5DI3A 3EXAA 5T4FA 2FW7A 1F14A 5CK5A 4GW3A 4RVFA 3AT1A 4EYQA 2DZDA 4CF5A 1CR4A 1IZYA 3IQEA 2ZI9A 2ZRLA 1UPBA 1R27A 3PIRA 2YYYA 4QD3A 3GJSA 1N5MA 2H9YA 3LC1O 1KJ9A 3U4AA 4C4OA 1G8GA 1N78A 3MUNA 1W4AA 4MVCA 4FGKA 2HWUA 4QTUB 1JEAA 1LPSA 1QHHA 4IKPA 1TZCA 4G0NA 1T0IA 4Z51A 4NXNB 4UMDA 4HDOB 2X9QA 2Y1DA 1PFWA 3HC7A 4MW6A 3PTAA 1U2RA 2QGZA 5G0WA 7ABPA 4PZAA 4MRRA 4J6EA 4RY9A 2PUBA 1A7UA 4KVGA 4RD3A 3WVNA 5KPJA 1UP7A 2QMHA 2OCKA 3HRIA 5K3AA 3THXA 1JZTA 3B7WA 3AP1A 5I9MA 2ZCVA 1XVTA 2QX7A 4PXAA 4BC1A 1RRVA 1ZK3A 2PT9A 3DXXA 3DZKA 4R8RA 5BSUA 2YS6A 3CYFA 3QVTA 1OBCA 1R4AA 2W8BA 4R1QA 4WY5A 4C20A 2GZRA 2NU8B 4DSZA 1TE2A 3MEQA 4RA9A 2QORA 4H9GA 4ZVLA 5HQJA 4GMFA 1H94A 4YQEA 5C34B 3SF0A 2AX3A 2I66A 2HRCA 3E7XA 3U31A 2XUJA 1AN9A 1NVXQ 2PVCA 3A11A 4D96A 1RI4A 2G5PA 2IHUA 1H3EA 3HDYA 4MQFB 4HBZA 5JWRA 1ISSA 4P54A 2N42A 3VU9A 2JLXA 3A10A 1CF4A 1VG9B 2JAXA 5TC4A 2Z09A 3NBYC 3HVJA 2OFFA 3REFA 5HFAA 4YMGA 1MAVA 1R4MB 2E1PA 3IBGA 4U4AA 3ZWNA 4DLSA 6GPBA 4PLTA 1F5NA 1OJ7A 2ETVA 2I2FA 3RVSA 3OPMA 1P1HA 4RHYA 1HGXA 4KODA 2ZQZA 1X7ZA 7MHTA 5AYVA 3RVKA 4EO9A 3N0RA 3QXXA 1K3UB 3GLHA 4CMGA 3BTUA 3LTEA 3NWJA 2P9FA 2WJWA 3NHRA 4DDMA 1OSNA 5AI6A 3M4JA 4KQCA 4O4JA 4RVOA 2WKSA 1K7SN 3ZOKA 4LZPA 5L51A 2V6GA 3S8YA 5L3QB 1KFJB 5JXIA 5DHPA 1W7AA 3NIWA 3T7DA 2VSNA 4K9KA 4XA8A 2I8LA 2QAGB 4MUJA 4A0FA 1JQLB 3REOA 1VPDA 2OAQ1 3C74A 4R2KA 4YMSA 5K0LA 1JFRA 4V1CB 2AMJA 4NJEB 2RHDA 4NV1A 3L9WA 4CM7A 1HNNA 4ND3A 4DA7A 2RC6A 5E6RA 3AP3A 3M6XA 4GI1A 3AFOA 3IR5A 2CCJA 4C7VA 3BHIA 3F73A 2A9RA 3WGOA 3ODGA 5UKDA 2QMEA 4LBVA 2FZKA 5KJEA 3E0QA 2QVGA 4H1HA 4CMHA 1DTWB 4MTLA 1H2HA 2EC5A 3LYAA 1TFUA 1P1RA 5KTYA 3KV3O 3PF8A 2WD7B 2XYVA 2Z2XA 2XGSA 4GP6A 2SKCA 4LY3A 1QO0A 3G8YA 3FVVA 5AKKA 1YASA 4RTMA 5J1SB 2G4CA 2ATXA 2HUPA 4R81A 2ON6A 4Z86A 4CDMA 3CN7A 3CB2A 2YHIA 3EDOA 3M33A 2ZKIA 5EESA 4E03A 1L1FA 4ETNA 5HOQA 1HO3A 1XPJA 4BKRA 1Z7WA 3PLRA 1E2JA 1CJSA 1KMHB 1KS2A 3HDQA 4MLDA 4EB8A 5JC1A 4ZQBA 4LYHA 4OK6A 3U1BA 2YHSA 3OM0A 5FNVF 4NP6A 1OTYA 2IPNA 3IAM6 1X0VA 5IDVA 2IXDA 1XZQA 3P0HA 2JDIA 3PUJA 1M2KA 3MGBA 4WI1A 2H48A 1YJCA 5FPQA 5AW0A 2DH5A 1B41A 3BBPA 2UXCB 2B5WA 3QNMA 1Y48E 4Q15A 4CIYA 2W7TA 3PZBA 1C7JA 3V8PA 2ONYA 3B2QA 1RFGE 1WHTA 3OWHA 1R4NB 3O7WA 1ISPA 1NUSA 4OFBA 2J9ZB 4MAMA 1PHPA 5JT1A 1PTJC 4NESA 3VOAA 1N8SA 1HMPA 3UPDA 4CM4B 2A33A 5HX7A 1VE6A 2CT8A 4ZAVA 1DOZA 4WXRA 3ZDZB 4RZ2A 2B82A 2HRRA 4TXNA 1QVWA 3TZLA 3DP9A 1J06A 2PYIA 5BVHB 3ZKAA 3I2IA 2ID8A 1XO1A 3G5AA 1PJZA 4Q4LA 4B3HA 5A3RA 3NWBA 1EFCA 3NYIA 1WABA 1IATA 3N8IA 4P0TA 2R0QC 1JALA 3G2NA 3V9PA 2LCIA 4BNKA 5L3SB 2JATA 3FNQA 1XTUA 1SAYA 1JEOA 3SZOA 3LHFA 1GVHA 2NQ8A 5IKOA 2WM2A 1HE5A 2I3GA 3JY6A 3SE7A 2TYSB 1AGXA 3BWDD 3LNCA 4EGCB 1DUSA 3U17A 5J3JA 1W6UA 5ARBA 3DVAB 4FTWA 2UXBB 3LT1A 5TMEA 4L3OA 2IHNA 4MJ7A 3NDBB 4K26A 2JGDA 2WR8A 5TQJA 5LKAA 2HMVA 5AVTA 1C9NA 2W6ID 5G1OA 4MVJD 4B7UA 4Q7MB 4TYYA 3ESAA 2I03A 3EVBA 1IBRA 4R9RA 3P2JA 2OD7A 2PSFA 1E3MA 1M1NB 2E21A 2CVOA 4KQMA 2GEKA 2OGSA 4UXHA 1FFXB 1YUBA 1A2QA 1SURA 1QTRA 4MVJA 1G63A 1M6VB 2ZJ3A 1PDOA 2TMKA 3E05A 3ZWKA 4E2WA 3RT9A 5IJ9B 2GILA 5CEFA 1QIKA 1FTSA 5JS7A 2AFHA 3ER9A 2ZFUA 2ZWAA 2K4MA 4Q12A 4FB5A 2GLTA 4UTNA 2FFBA 3OMXA 4KO3S 4BMVA 4NCHA 1DDGA 4RWZA 4XCXA 2WT8A 2RHWA 3DWFA 1CUEA 2F67A 2Q8QA 1FPQA 4I1OA 3UKDA 1TCUA 4J2OA 4TRMA 3INNA 3PICA 3EF1A 3ONWA 5GP1A 1O5OA 4HTFB 3WLPA 4YAUA 3S7ZA 1DC4A 3LZ6A 3WIDA 5L4NA 2OZLB 5MN6A 3IAHA 3OE7D 4L27A 1ZEJA 5KSZA 4F97A 3KSAC 1VSBA 3L5KA 4HX2A 2YFYA 5DB4A 4EBBA 4KWCA 1QKJA 2KYRA 2PRJA 1QAMA 3JRWA 5B58T 1CQPA 2BFEB 2BKLA 3KT0A 1DKUA 2FGKA 2OE2A 3OI7A 1WKVA 3QNUA 2AYZA 2ZYRA 1MFZA 1TMKA 1YXMA 2Z4SA 3WQHA 4AZ0B 1T4GA 4BDSA 4BNDB 3OTOB 2A5LA 1RRGA 5CYOA 1MO2A 2JD0A 4XSVA 3TK1A 2DQZA 1ZJZA 3K2IA 2X1MA 2H65A 1E9BA 3DWEX 3GFBA 4M4SA 4JL5A 4BO7A 5LL6P 1GZUA 2B4TO 1OFVA 2GCGA 3LL7A 3N8KA 3OEED 3U3JA 5ALVA 3DO5A 2FP4A 4B7AA 3TR5A 1AVTA 1YR6A 1Z39A 3Q88A 3ZJVA 1NXWA 4EP1A 5LYJA 1J07A 2X9NA 3CLUC 4ZAXA 3A1EA 4XLZA 3ZJYA 1N9ZA 1D2CA 1GRVA 2C00A 3AU8A 4F3RA 2GZAA 4RHEA 1HLDA 1O0SA 2A58A 2V7TA 3NBFA 2FSSA 1C4XA 3MTDA 4I50B 3SQDA 5AVSA 1NULA 1RMTA 2RJOA 2WHEA 3TJZA 3MB8A 4ZVMA 2FE4A 3HPQA 1MA3A 1CUIA 1G8KA 1FK8A 3EIEA 1FUEA 2NSYA 4X91A 1PRYA 3ZV6A 4RLHA 2PQMA 1KP2A 1N6IA 3KOXA 3LXUX 1I3NA 2ZWPA 3PC3A 4FCCA 2C5AA 1T8YA 3K4PA 2FSVA 5FWDA 1L5FA 2I6FA 2VUHB 2GEDA 3RWMB 5K05A 1L5OA 2XDAA 5H70A 2ACKA 2JW5A 1UJCA 1P9RA 4ALMA 1E1DA 2OWDA 3LBYA 1GZ6A 2I7DA 2W70A 2JG3A 2V58A 1I80A 1MOQA 4GO1A 5DI9A 4TWIA 3ZWWA 3F5DA 4CT4B 2QYHA 3CINA 4FDVA 3TIFA 5E95A 3QLUA 4FEAA 4ZVOA 1SXJD 3TYXA 5JQGB 3U1TA 4NIMA 4OUDB 3BZBA 1UOEA 1S8AA 1ZP6A 3K1JA 3LMKA 4PFQA 4JA0A 4PZEA 3WRYA 4HRYA 4IEIA 3DE2X 1ABBA 4DV1B 3JPYA 2F62A 1BDIA 1Y4SA 3CUTA 4WEOA 4ER3A 5JROA 1RZRD 3K0KA