1PWYE

Crystal structure of human pnp complexed with acyclovir
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Crystal structure of human purine nucleoside phosphorylase complexed with acyclovir.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pwyE00
1Y1SA 1CG6A 4TXLA 1SJ9A 4LZWA 4PR3A 2H8GA 4WKBA 1YBFA 4X24A 5B7QA 1A69A 3IOMA 2XRFA 2AC7A 4TXJA 2QDKA 1PR4A 3OPVA 3OZDA 3ENZA 4TTJA 1RXUA 3FB1A 3SCZA 4JOSA 1Z36A 1PBNA 1VMKA 5EFOA 4TXNA 4DANA 5I3CA 3FWPA 2I4TA 2ISCA 3KHSA 1QE5A 1RR6A 3U40A 3MB8A 4OJTA 1JDVA 4KN5A 1A9TA 4LDNA 4LKRA 4D9HA 4D8XA 3BSFA 4H1TA 3OOEA 1PR1A 1B8NA 3BL6A 1A9QA 1SD2A 3EUEA 3OF3A 4G41A 1V48A 4F2PA 4R2WA 1Q1GA 3NBQA 4TXHA 1B8OA 1T8WA 3UAZA 5CCDA 2OC4A 4QFBA 1RXSA 1K9SA 5F7JA 2PGAA 5KB3A 1PK7A 1I80A 5F78A 4WKCA 4QAQA 3TL6A 1Y6RA 1JDUA 3F8WA 4R2XA 2AI3A 1XE3A 1PK9A 4QASA 4QARA 4RJ2A 4DARA 1T8SA 1ODKA 1WTAA 2HRDA 1U1DA 3KVYA 3FAZA 3PNPA 4WKOA 5JPCA 4MCHA 4PNPA 3FOWA 5CXSA 4L6IA 3BJEA 4WKPA 4GMHA 3DP9A 2BSXA 4WKNA 4U2KA 1JDSA 3NM4A 3DDOA 5B7NA 1NW4A 4F1WA 1Z37A 1U1EA 4BN0A 4QEZA 3DPSA 3UAWA 2HN9A 3KVRA 3OZCA 4M1EA 4BMXA 4E1VA 1ZL2A 1TCVA 4P54A 1TGVA 1K3FA 1YRYE 4M7WA 3C74A 4OEHA 1Z33A 3EEIA 1OVGA 5CYFA 3KU4A 4L5CA 3PHBE 3E9ZA 1ULAA 4YO8A 4DAOA 4TS9A 1Z34A 1JE1A 1OUMA 3DF9A 4I2VA 4DAEA 5CCEA 4EB8A 1V45E 1Z38A 4OGKA 4DABA 1NC1A 3GB9A 3P0EA 1V4NA 1ULBA 3QPBA 3K8QA 3OCCA 4DA8A 3UAXA 1ODLA 5F73A 3O6VA 1OTYA 1SQ6A 5F7OA 4L5AA 4MARA 4M3NA 1RCTE 4NS1A 3EUFA 2AI2A 1CB0A 1LX7A 3P0FA 1ZOSA 4D8YA 4TS3A 4ECEA 1V3QE 1RYZA 1Z5NA 2Q7OE 1LVUA 2IQ5A 4JWTA 1A9OA 4BMZA 2A0WA 5B7GA 1M73E 4FFSA 3EMVA 1U1CA 3BGSA 2A0XA 5F77A 2A0YA 2OECA 3LGSA 5CYGA 3O4VA 1VHJA 4DA7A 1FXUA 4QATA 2AI1A 1G2OA 4GLJA 2B94A 1ODIA 3FNQA 5C80A 3NM5A 1PR0A 4NSNA 4K6OA 3OZBA 2HWUA 1TCUA 2OC9A 2QPLA 3PNSA 4L0MA 4BMYA 5EUBA 1LV8A 4R31A 2QTTA 4TXMA 1RXYA 4YJKA 1PF7E 1JPVA 1Y6QA 1N3IA 3T94A 5FAKA 3E9RA 3FUCA 4OGLA 4G89A 1C3XA 1T8RA 1Z35A 1PR2A 1OTXA 1Y1RA 4D8VA 5B7PA 2QTGA 4GKAA 3LBAA 1PR5A 1Y1QA 5EPUA 4NY1A 4G8JA 3E0QA 3IEXA 2A8YA 1V2HE 1T8YA 1Z5OA 1PR6A 4LNHA 3UAVA 4UC0A 3KUKA 1YQUA 1Z39A 3PHCA 5F7ZA 3DJFA 4D98A 4YNBA 2QSUA 1YQQA 1OU4A 4YMLA 5IFKA 1VFNA 5IU6A 1A9RA 3UT6A 5F7XA 3KVVA 4IP0A 2OXFA 4F3KA 1PW7A 4L5YA 3ONVA 3LA8A 1PKEA 4GLFA 1A9SA 1NC3A 1U1GA 5K1ZA 4EARA 3OZEA 1T0UA 3D1VA 4TTAA 2I8AA 4TYMA 1RXCA 1RT9A 3OOHA 2RJ3A 2P4SA 1YR3A 1TGYA 3NM6B 4DA6A 4TTIA 1TD1A 1Z5PA 5CXQA 4F2WA 1ECPA 1JDZA 5ETJA 1JDTA 1Y1TA 1PWYE 1A9PA 1SD1A 2HSWA 5F76A 1JE0A 5DK6A 1V41E 1VHWA 2GUWA 3UAYA 4OY3A 3K8OE 1RSZA 1JYSA 1K27A 1U1FA 1RFGE 2ON6A 4F3CA 3INYA 1OV6A 4MCIA 1ODJA 4LNAA 4OF4A 3ODGA 4DA0A 3MMSA 3GGSA 4JP5A 1JP7A
chains in the Genus database with same CATH superfamily
1FTNA 1KR2A 3MAGA 3Q9NA 5DNYB 1ZINA 3VVBA 1Q15A 1CG6A 2CLEB 3NOOA 1QB8A 4MUNA 1RW4A 2DY1A 4KRXA 4AKGA 4Y6PA 2FP4A 3OMXA 4F9GA 1KTVA 3DHEA 5LKAA 4DB2A 4WZBB 1IZ9A 4RSRA 3DZIA 3NWEA 4H7KA 2GD2A 2O2IA 3DJYA 2JFNA 4UOZA 1DRJA 3F2VA 1J24A 3HM2A 4B73A 1YACA 2DTEA 1PFGA 4I6GA 4LOHA 4U7TB 1V6SA 3HCBA 4O5OA 4WKBA 1KWKA 5AFSA 3H05A 1TYDE 5CGZA 1GL7A 1EVEA 1UJ2A 3QU7A 4Y1RB 4D4GA 1UUFA 3DE5X 2QRHA 3STTA 5KTRA 3UPTA 4MVJE 1G8SA 2HHAA 4EY8A 3H04A 3NIDB 3W8FA 1K6XA 1FX0A 1T5BA 1ULHA 2TMGA 1GSOA 4HFRA 3U62A 3OZDA 2CZGA 2VAPA 1PL6A 2WPDD 3C6MA 4BO4A 1KEZA 3QXSA 5E1DA 4A3SA 4EGFA 2CUKA 1VSVA 1OFVA 1GNQA 2G6BA 1QZ3A 3H9GA 1E77A 4ZOLA 3ZU6A 2OXTA 3R0VA 2D13A 3IXLA 1D2NA 3A0UA 3MGKA 4MUJA 1IBRA 2QIOA 4CG1A 4CM8B 4L8VA 4YUAA 1GPLA 2V7XA 4ND6A 2VSQA 1YHNA 4G0UA 5LA6B 1ULTA 2OD7A 2GWRA 2ZJ1A 3I2GA 1MJ5A 4GE0A 4GOLD 1NVGA 1VDZA 3DKKA 3HKEB 4TYQA 3MG9A 1TQ4A 1YD7A 3Q3JB 5HF9A 7YASA 5JFGA 3FVVA 4U1RA 2C3PA 4DJEC 5JZVA 5CDGA 3KQSA 1G3UA 2WTXA 4KACA 2GESA 4HXGA 1OYOA 2IBSA 2JHGA 3VTAA 1NQXA 2NAFA 2GB4A 3IVAA 2IOQA 5IBQA 2BT4A 3WDSA 2FGJA 3FZNA 3I73A 3PEVA 5CMLA 4ZZ2A 5H4GA 2ZIXA 1P0QA 5AXAA 2EP5A 2XHEA 2I62A 1CZNA 5LXTA 1JQ5A 1AKNA 2YFYA 1JFLA 1A9QA 1G59A 1XNHA 4PLFA 1P6QA 5BWCA 1D1PA 1ZEMA 3R5FA 4EDHA 3OIDA 1I7SB 2EGGA 1XQVA 2OXIA 1YS1X 3JTMA 4MWCA 2FJ0A 2VRBA 5I9MA 3LFHA 4X8MA 4TXHA 4HNQA 2CFCA 4ZQBA 1BQ3A 4FUQA 3J80A 3FH0A 2NO4A 1VE1A 1OAOA 4ZVMA 1KJQA 4CLEA 2C5LA 5BV0A 3HSYA 3VPDA 3AM3A 3K1YA 4JYBA 5EIAA 4EG6A 3JRWA 3NHBA 4XIYA 3S55A 3VO8A 4IJWA 3RROA 1HY3A 2NTEA 4OX9Y 3OWXA 4CLXA 3R0JA 3JTEA 2BE7A 2AV6A 2FEMA 5MFPA 2M6LA 3T9CA 1A8PA 3OLQA 2PXAA 4FR0A 4L6AA 3AERA 2MT9A 2WYUA 4NXMB 1RHMA 3HN2A 4BVFA 2KQUA 1IZ8A 3LHDA 4MICA 1ZJ4A 4WNAA 2Q7DA 1FTYA 3QFSA 4LMPA 3SHWA 2P69A 5JY6A 2PXHA 5L3VA 5ALVA 2J6HA 1OIVA 1FJGB 3OT1A 4YC7A 4B7UA 2PNFA 1V26A 3D6FA 4U2GA 4FOPA 2RKBA 5K5EA 1MAUA 2HA7A 4OXYA 2AWOA 2Y71A 1VHDA 1A2QA 3TDKA 1AUOA 1BVYF 3UPDA 2B1QA 4BWGA 5JJ5A 1W7AA 1H8EA 2VQ3A 4M9UA 4RELA 5J1SB 2YIJA 3OQMA 5D1HA 3T3DA 1E59A 2UYHA 5EE1A 5B2ZA 1AZLA 1PG0A 2YC2C 3BB4A 3B53X 4JY7A 4CU5A 2BI8A 2E4VA 3EZYA 1RLTA 5DGCA 4EHBA 2IHVA 4RPHA 3JAWA 4ID3A 1Q11A 3RVDA 4YB8A 1C3VA 1XLUA 3W2GA 4DTCA 4MPJA 4IWNA 2G9QA 1P1HA 3FNGA 4N5LA 4EG0A 4OA8A 4GI7A 5TE9A 2ZTVA 3FGOA 3CKKA 3T7TA 4ATNA 4OKIA 4GMHA 5JOQA 1H6BA 2XGJA 2QG6A 3DO5A 3E9DA 2VTEA 4QQ8A 5A9SB 3Q7SA 3ZJUA 3DAHA 2PXXA 4HO1X 4WGGA 4QGSA 2BGMA 1TM3E 4OUDB 1KI4A 1AUPA 5ALEA 4MLZA 5K0EA 1UIMA 2C8LA 3HBAA 5DM60 3OZXA 4JI8B 1RBQA 5ALDA 1SZCA 3CLUC 4AROA 1XTRA 3ZBTA 3BZUA 4JT9A 5DIZA 3HNOA 4B6JA 5HQ3A 1NP6A 2J5XA 3R4CA 3NHAA 3ZXXA 1X1DA 2X76A 4MYCA 1P7WA 3KS9A 3L7NA 2X3YA 3NI2A 3V7UA 3FBWA 3UGJA 2A0UA 4F9FA 1OWMA 1YRAA 2Q1TA 2C1EA 1W2HA 4EJ6A 1NUTA 3EZGA 1SXHA 3GNSA 2PSDA 3USZA 3VYSB 3ZU2A 4RK6A 2GA9A 5K0TA 3DPSA 5CA1A 1Z7GA 2M2IA 3R6GA 1ESCA 2P7IA 4Z9BA 2HN9A 2V3WA 4E0BA 3WOHA 3PX7A 1UAGA 3OU6A 4M1EA 2IJGX 4DLYA 2PGNA 2FW7A 3NPAA 5A3VA 4B6QA 1YJ5A 4MDFA 3OP4A 2I7TA 1Q7CA 2VYVA 4E21A 4EO9A 2EQBA 2YZGA 1EQAA 3A9SA 1N77A 4KR7A 2OG1A 2ZQZA 2D7DA 4IIHA 2PUVA 3ZZ1A 3P4UA 5DM2A 2I6QA 4LJ4A 3V4FA 1UM9B 2AR9A 4QDJA 5DBGA 4J75A 3TBHA 4D3DA 4ECAA 5L95A 3QVTA 4DDKA 2GBCA 1FQOA 3OF5A 4N54A 3WLAA 3ZNNA 4DUGA 4CDRA 3L40A 1YNSA 3AB7A 2GILA 4E6PA 4IJMA 1IXSB 1F0KA 4DZZA 1JHAA 4JQOA 4ADSG 4Q5IA 2HT1A 2GJAA 1NAIA 1TTQB 1XEFA 4QYIB 1OH7A 4ZK6A 2ZSKA 3KT6A 3LUHA 2X4IA 4ID9A 4J0IA 3NIBA 4KN6A 3E9ZA 5CDYA 1KJZA 1KSGA 4A82A 1Q7GA 2P90A 3E15A 4RMHA 5JRZA 3E1SA 4TVKA 1NQ5A 1W2WB 4UAUA 3IOYA 4FJ0A 3RS5A 4YO8A 3S1LA 3M1YA 3IUMA 4RYDA 4Y1FA 3TR6A 1H6DA 4MTLA 4HQFA 1RWNA 4RCZA 4D0SA 3EEOA 1N8KA 1QG6A 2O07A 3BIWA 1I6LA 3UJ8A 5BRJA 1XKLA 5G0VA 5DOZA 2GFHA 3MD0A 5EXDA 2OSVA 4DCPA 4M1ZA 2PD4A 4OLBA 2G83A 2PAFA 3S3TA 4NXNB 4DABA 1DTWA 4K05A 3EVFA 5IUKC 2X4DA 4EVQA 2VUSA 4BECA 4FB4A 4R40A 1Z28A 3DZDA 5CFZA 3R5HA 4M1SA 1W73A 4NCKA 3OQIA 4ARAA 4RK0A 1QTIA 4B7XA 3N6XA 2BKXA 1A71A 3T4UA 4XB6B 1MENA 3O7WA 3C45A 5E6UB 1W76A 3GJXC 4G23A 3TAHA 1H4VB 3TTYA 3DLHA 3I34X 2V58A 3OE7D 3LZDA 3UKJA 1B1CA 4HZUA 4BO1A 3BK7A 1E2IA 3N6RA 4L78A 5HQ3B 1F14A 1QK3A 1H0RA 3VX4A 2XB2A 2X2OA 5EOVA 1Z2EA 2JGDA 4M3NA 4LSWA 4URXR 1ZL0A 3SE0A 1BE8A 1XZLA 3DLIA 4DWOA 3QZUA 4TLMB 2ES4A 3VBCA 3W8EA 1SVOA 4ND4A 1MRZA 6REQB 3AG6A 5IW8A 3TVTA 2CJXA 4PBTA 2DYKA 4Q6WA 5FPHA 3R7WA 3WY9A 3D8RA 1CY0A 2EJBA 2JH8A 3ZH9B 1EXWA 3DL4A 5LBIA 2YV3A 4MVJD 3A1CA 4GPD1 1Y33E 3RFUA 4C0AC 3EZ6A 3N7TA 4FQ7A 1KH2A 3IV6A 4Q4AA 1JFSA 5EE5B 1XTUA 2CF5A 4IUYA 3JU3A 5BNFA 3JATB 1U6IA 3FMPB 4MVJG 2FXIA 1KYTA 3FZEA 4QC2A 7MDHA 3SF8B 3J81k 4YAOA 1V5GA 1NLYA 5J5AA 1WQ4A 1ZAKA 2O2SA 3P2EA 3OEED 4MYHA 5ICFA 3GFGA 2FX2A 2LRHA 1U8TA 2V6MA 3ZOKA 4JJFA 4AP6A 2YZNA 3FF4A 4MW6A 1UMKA 3B52X 2K2QB 1FYXA 2DBVO 3PUIA 1YR6A 1WU8A 3NPMA 4RJJA 5ERYA 5JLAA 4EUHA 4F93B 2GRAA 1SIUA 3GHHA 4GWKA 4JLNA 4JJ7A 4AZTA 4UVGA 1N5MA 3B9QA 3AOEA 4DJ5X 4PXSA 1B15A 2C54A 2X40A 3JQBC 1NWCA 3Q87B 4GIBA 2IU4A 4FDUA 2BDEA 2CBGA 2AMFA 3B7PA 1W4AA 4BV3A 1R4AA 5DWDA 1K8RA 2FVXA 3R77A 4DJFC 1T4BA 2EHDA 2C5GA 2LCIA 2FW0A 3IVGA 3O83A 4JBLA 5AM2A 4RTMA 3EXG1 1XLTC 3HYTA 4NSNA 1IUOA 2YV5A 3C7KA 2GOYA 4ZT5A 3GFRA 4IZOA 1QDLB 3GELA 5IUJC 2RAPA 4ZAZA 2QPLA 1Q20A 1P44A 3K5PA 4P80A 1OJ7A 2VTBA 4GI1A 2WWXA 1Y63A 1GJRA 3PNLA 4FW8A 3S6JA 3ZDYB 3T5AA 3TE6A 3PNQA 2H2WA 1O0BA 2EJUA 1RRCA 4LS3A 5K6AA 5JBNA 3OJCA 3WQBA 3M33A 5LYJA 3BFVA 4AM8A 4NX2A 2H9IA 3FUCA 2XGSA 3JVUA 4B7ZA 4DHEA 4EPYA 1NV8A 2WQ7A 2QP3A 4CN9A 1M2FA 2FQQA 2IE0A 5K2MA 3RVOA 5C4IA 2FOLA 3RAEC 3FNBA 1WPXA 4U0JA 4ER7A 1YU9A 1YVRA 3CXUA 3ILXA 4GKAA 1BJRE 5I9TA 4Q9JA 3TQQA 4BVAA 1PR5A 5B3JA 2V54A 1SKAA 3BICA 3MWGA 3QRWA 2Y3IA 1N78A 1THZA 4FZ5A 2KBEA 1KR5A 1VL1A 5AKKA 3FPAA 5F1YA 3THOA 4KE9A 4GI3A 4P08A 2Y1GA 3PUXA 2JVJA 2NZ2A 3F1KA 1BS9A 2X6TA 2W6JA 1XDGA 3T61A 1B43A 2A4MA 5FT9A 1WHSB 3HN6A 1N4AA 1K0UA 4Z5XA 3D6HA 2OQ2A 4XWGA 1ZWLA 2V9PA 3U6KA 3B38A 3E3OA 1UADA 2WNHA 3KUKA 4WE3A 1N2CB 4NCAA 3R9XA 4QOEA 2E21A 4EA9A 3MT0A 4OM7A 1OKKD 1DIGA 2NXNA 3DMTA 3P2IA 3WWOA 3WZLA 4YRPA 1XD9A 4IIUA 5ITZA 2XKKA 3WK8A 1ZK3A 3CEPB 4QSHA 3N2LA 1JQAA 3G2KA 1L5WA 1Q14A 2YN2A 2VHCA 5HKBA 2DUWA 4V0ME 3DM9B 4BQIA 4EFMA 3BIFA 3NHWA 1CNEA 3KB6A 3QELA 5LP6F 1ZI8A 5CJ2A 1IVSA 2YUTA 3VPFA 1T9DA 3WFJA 3A6LA 2ZULA 1ND6A 1CVLA 1ZFNA 3FYUB 3OG9A 2A4KA 3W34A 2QSUA 4ENTA 4NOJA 2GEDA 2FSHA 3IQZA 1GV0A 3TIGA 5BW5A 1MOPA 1VRWA 4IH1A 4MI9A 5G4KA 4XGQA 3IQIX 5FWYB 1VM6A 5JWHA 4Y18A 1ZIXA 3S2IA 2GCNA 2DFNA 2E4UA 4QO7A 4RKQA 3OURA 3QU4A 2RHWA 2DLDA 1M6VB 1DZ3A 2Z2ZA 5TARA 4NBWA 3TO5A 3ZK8A 1MO4A 4K88A 3CRZA 1T1EA 4FS8A 4YRSA 2ZT5A 4LUCA 4DLPA 4Q4JA 4XM1A 4AX8A 4JI0B 1T36A 4UATA 3EXFA 3CLRD 3PC4A 2WAMA 3AXTA 1L5SA 2E9SA 2XUDA 4AURA 1OA0A 4P98A 5ENVA 4FB5A 4G07A 3QX7A 4AQDA 3ED5A 2XECA 3AF4A 4D80A 3F2IA 3ASVA 1J1IA 1D0VA 2H1RA 2WKQA 4ZHQA 3LPNA 2GN8A 4NOLA 5CH8A 3N05A 5FDFA 5JSUA 2DKFA 1VJ0A 1UFOA 1DBQA 2AGVA 4JS0A 4W5OA 1L3IA 1VG1A 5EI5A 4BLQA 4X3OA 1FVXA 4TKLA 1WZIA 3RIMA 3Q3CA 3W4IA 4EW3A 2BBTA 1B74A 2GJSA 4TVSA 1VSTA 4F06A 2OP0A 3QXGA 4TN5A 5KMGB 2OO7A 4PTZA 5AD1A 4ND3A 4W8GA 4C1BA 4CKBA 4JR2A 4ZT4A 1YL6A 1G3RA 2ECKA 3PA8A 4Z8XA 4XIIA 5BSRA 5B55A 3F4BA 3D3NA 4C22A 3EEFA 4PN7A 1XMQB 4O3MA 1XN4A 2IUSA 2I1LA 4ZAFA 1T2NA 1Z0UA 3TSCA 4D6YA 3PPWA 4ZQFA 3A1DA 4QVKA 4X60A 3ZD7A 1L7RA 1OWPA 5DF1A 2P67A 1Y1TA 4PWZA 2F3RA 5KNCD 3GEIA 5LC1A 3ROQA 3SZUA 5A2GA 1ZLXA 4PLTA 1XZ8A 1ZK4A 3GQVA 3CE6A 5C9ZA 3C6KA 4PGMA 3GFPA 3UM9A 2O3UA 2GCOB 3EZLA 1YZYA 4ND1A 3WBBA 4KV7A 2MR6A 3E1KA 4RSMA 4F2GA 4H59A 4GDMA 1GA6A 3GLHA 3M3HA 3K6KA 4ZQEA 3WGNA 1F2UB 1YJAA 2PSFA 3I8XA 1ZM3A 1XPUA 1QF6A 3C70A 4QUDA 3GDHA 3J7TA 2XWJI 2A59A 4IZHA 1VECA 2NXEA 3V8MA 1XZCA 4CLOA 2DPMA 5CIYA 2PBFA 5ECWA 4TT8A 2AE1A 3NKVA 5EWJB 4HHEA 1U0LA 2RAVA 3PC3A 3KIPA 2QN6A 2HK9A 2V0NA 3MZ0A 3G0DA 2QB5A 3JD3A 2WF6A 4LN1A 3G9QA 4NHOA 2HR1A 5F1OA 5LU9A 3FZYA 1JKIA 1MABA 2VPQA 4GMFA 2X42A 4KHZA 2JL1A 2YYYA 2WHQA 1DOHA 4MPPA 2V7TA 5HZMA 2FUKA 1VHTA 1U3UA 3THSA 1OPXA 3GLKA 3D8NA 4TUYA 1EXDA 3RUIA 3IAS1 2CDRA 4R2LA 3UUWA 3RFFA 4X64B 4YQFA 4B3DA 1AH2A 2BHRA 5CDFA 2QW1A 4H31A 3SKVA 3RYTC 1EUYA 2CSXA 4QUBA 5KHAA 4X85A 2P3OA 5K05A 4C9BA 5DYNA 4HWKA 3DPIA 1O6GA 1CYDA 2JGKA 2QORA 2RJOA 3L92A 1LNZA 4YRDA 5J43A 4JGIA 1J97A 3QUTA 3FB4A 1X70A 4RVGA 5BUQA 1Z2CA 3OMWA 1R64A 1REQB 4FW9A 3HADA 4XJTA 4I9GA 3JVEA 2G0NA 5E9JA 3TNLA 1FCJA 4H6VA 4UASA 3ENZA 1E0AA 4ZALA 2R86A 1HYEA 1XEWX 3L05A 3O8OA 4NU0A 4TSKA 5AK0A 3TD9A 3WGOA 2UVDA 2J41A 1OGIA 1D04A 2OO3A 4LFCB 2J3LA 1WEKA 3OEEA 3WBKA 2F9FA 2ZIWB 2DFPA 4NICA 1V25A 1CYEA 1XLWA 1XQXA 3IP5A 2ZB8A 3KOUA 3BMQB 1MZPA 1JGTA 3IOBA 5K3DA 1EDOA 5GONB 4K03A 4JUCA 1BJTA 4DHWA 5EKSA 1R9NA 1QE5A 1U0EA 3MHTA 2E49A 2A1UA 3LPDA 5K8TA 1E2EA 2BEKA 4LMBA 1GCAA 1E1KA 4PNZA 5EERA 1DJMA 3FR7A 2VQ6A 1WKVA 4ALKA 4MQFB 2OBXA 4BJ5A 3SHQA 3PHIA 5E1BA 5LR6A 3B2EA 3EAGA 2WLTA 1AXEA 5ESWA 1GKIA 4EHNA 5U9CA 2VIIA 3HYSA 1K97A 2R47A 2YVLA 1RIFA 1UT5A 4LOIA 2WJHA 5KYKA 2BCEA 4QELA 4UDNA 2OXCA 4JBNA 4UBJA 5ER9A 6PFKA 2WM2A 3LT2A 3ETLA 1C80A 1DB3A 4ND5A 3RASA 1EK0A 1KJJA 4OLFA 1H5NA 3FVWA 1TZBA 1JG7A 5SV2A 1DUIA 4RAQA 2ZJFA 4QZVA 1I1HA 1Q1GA 3G79A 4MQ5A 1O3YA 5B6IA 3FOZA 1J2RA 2PRJA 3NBQA 3MJHA 3ZJ5A 2RGNC 3BPSA 5CCBA 4U5XA 4GEKA 1MIOB 4RZQA 4RE6A 3V97A 2PZBA 2HQRA 1W30A 3OUZA 3X44A 2H1OA 1T8WA 4AG6A 1T6YA 4QBGB 3UAZA 1U0SY 1YT5A 2CK3A 3Q4GA 3A6HA 5AVOA 5HKAA 4TRJA 5FA5A 4B7AA 2Y92A 5CB4A 4BOYA 1B41A 4Q4CA 1UQTA 1R0ZA 3VAYA 5IBCA 1UOEA 4KI7A 5HX7A 5JR3A 2C1XA 1TTTA 5EMHA 3RREA 3T5GA 1PEKE 4RKFA 3GLIE 3S4YA 2GVDC 2HWKA 2D4AA 4DGSA 4QO8A 3Q6NA 3KUXA 1TLTA 5JARA 3GA0A 1JDUA 3AU9A 2B5WA 1T9BA 4KP7A 4PHGA 1S3FA 3MT9A 4PYNA 4QTTB 1AKVA 2H5JA 3K1AB 1RHRA 2UUCB 4L76A 1H6CA 1KYZA 1Z6PA 3X1WA 3H99A 4DQDA 2OV6A 5CFPA 9ATCA 3U2QA 3EB9A 5T64A 1VGRA 4CUZA 3FLEA 3WLIA 3ZWKA 4PBRA 4G0PA 1QIKA 3E61A 2X1VA 4TMFA 4GMGA 1NPDA 4U9IS 3JR7A 3O90A 1JXMA 4AJNA 1OYYA 1SWVA 1JXQA 4C4PA 5AKHA 1PSZA 2PEZA 4KAFA 4Q34A 4V3CA 4BQFA 3R41A 4JB2A 3KJHA 5DI9A 4B4KA 2P6OA 2YWFA 1Z62A 4PNEA 3B5JA 2I65A 4UJ3A 4YRFA 3WK6A 3WGGA 2NADA 2CY0A 3BJEA 3V6MA 1V16A 3VHRA 1OY1A 5JJBA 1D2GA 1TIBA 3FKQA 3S2FA 5C8VA 4YXFA 4JCCA 1WU7A 3C3KA 4J0EA 1Z0ZA 1NLZA 5CVCA 1PBTA 1EGAA 2PA0A 4I50B 4J1QA 4OHFA 2QIPA 1TYZA 1ZNQO 3OO0A 3ULKA 2FFJA 3ZHOA 2JEZA 1TUBB 2GNOA 3MWYW 4HDRA 2YWGA 4P4SB 1LC0A 3CBGA 1D5WA 4G01B 5JDIA 4B6EA 1TEXA 2ISQA 3HHPA 2JRCA 4HWGA 4I3GA 4W5WA 5EEHA 4AIIA 1Y4UA 2ZT6A 1EQUA 2FDCA 2JCYA 3FZGA 2J67A 5JYCA 3WWCA 3UAWA 3DBHA 5DEOA 1PV1A 3I62A 2AUMA 2ZT8A 1GTMA 2ZE6A 1LLUA 3SD7A 1E6CA 1WMEA 3INTA 3UK2A 2H48A 2Z9BA 3AO0B 4AT1A 3CVVA 1XBTA 5JSHA 3DMYA 3LQFA 1EK6A 2FZVA 4N8DA 4X54A 2HRZA 1WXHA 3OX1A 4BNDB 1EAMA 4RVDA 3LKVA 5KIAA 521PA 5LQSA 3S2YA 1EFRD 1AS3A 3U44B 2FPIB 3ABZA 3N28A 2Z6UA 1S01A 3TFOA 2FZEA 2DPHA 3R8XA 2P6PA 2O05A 4F84A 1SCQA 4ZOLF 1JSRA 1YA6A 4D46A 2HF8A 3OC0A 2IEYA 3OOJA 3QKSB 1HG0A 2R4TA 1SKYE 2XUKA 1ZRNA 2FGKA 4WY2A 4ZYYA 3H5WA 5A4JA 3CBQA 3EF1A 3RS9A 5ALMA 4EF4A 1ZISA 1E32A 1GU1A 1H65A 1XRPA 2QRQA 4LXYA 3TL3A 1U3TA 4P4UA 5KNCA 2GBFA 1E18A 2QVGA 3AINA 1JLMA 2VZLA 3O31A 1S7GA 4RHUA 3MAAC 3REOA 4DWJA 4JYPA 1BNCA 1HFEL 3IUSA 2VJMB 4BX9A 3PPYA 2Q5JA 5A62A 4Q48A 5JSQA 2QLTA 4CF7A 1SXJB 2VI5A 3TW8A 4QD3A 3PGMA 4C5AA 4HNVA 4I2VA 4RENA 4GZ6A 4WDRA 3MWJA 2Q99A 4UUBA 2B0JA 5LXTF 2Q3EA 3GBSA 4TRRA 4TROA 5DRTA 1NF2A 5I9BA 4BEJA 1EHYA 3DVRX 2I9KA 4L6CA 2Y1WA 3GB9A 1L7XA 1W44A 4EB6B 2OCAA 2WTUA 2C7OA 2JLZA 3H65A 3EH2A 2IZ1A 4XLLA 1VE7A 3M6LA 1U2RA 4L1KA 3GZNA 2O8EA 4TS1A 4AJ2A 4JL6A 3SSAA 3FLMA 2HOQA 4MGIR 5C7IO 4M1TA 2PL9A 3G17A 3HRHA 3MA0A 4EM6A 1XVUA 3C48A 1MOZA 1NBME 1QCYA 2W6OA 2YQ5A 3A6KA 3JQ8B 3PZBA 2GS9A 3BJMA 4KK4A 1VIMA 4QOIA 3TD6A 3AKCA 5GM2A 2NU9B 4D6XA 5GJCA 3RVSA 1QH1A 2H31A 1IC6A 3I6IA 3MBIA 4D9NA 2P9HA 3VA7A 3LUCA 1NURA 3WMRA 3A2KA 4YFVA 5H3HA 1ZVVA 1VLLA 3BQNB 3EG9A 1N6OA 1X14A 2QF7A 5A0FA 2FSFA 3OM8A 1K63A 5DVZA 3U0VA 1L8LA 5EJ2A 1H2YA 5C8ZA 4HYTA 3K9WA 1DWOA 5KYUA 1CJKC 1JKJA 2OVBA 4EG8A 3DF7A 3PX3A 4DCOA 3CWZA 2I6SA 4RIIA 1Q0RA 1O0SA 2FUEA 3AZOA 2R44A 4EG7A 1SQ5A 4CHGA 3T3GA 1KTIA 2HH9A 2C8VA 2JCGA 1ZD1A 1KXZA 5DX0A 3IEKA 3U3DA 3W2IA 3HXQA 4F3TA 2IQ5A 1WBBA 2Z8XA 2ZIZA 4KLZA 3EN0A 5FPYA 5HW0A 4JITA 5EIBC 3HBJA 5EQTA 2A3RA 1JILA 4JUIA 3VJKA 2OWEA 4UW9A 3ZD9A 2M98A 1LSJA 1L1FA 4D4HA 2XNKA 3PF8A 4P2GA 4B34A 4W7IA 4LHSA 2J30A 5FJIA 3LKBA 2P6UA 1A5BB 4X1KB 4JOQA 5JO0A 5DNUA 1GCIA 4HWTA 3KHKA 1WMBA 3LGSA 1D03A 1QE0A 2AZDA 2GPNA 5KINB 4KAJA 2AQHA 4OH1A 1LLQA 1KEUA 1CKEA 1USUA 2C1ZA 3C14C 4OM8A 2FCRA 1DAKA 2IBTA 1N5IA 1SCKA 2FMHA 3U0BA 5EP2A 3SJZA 4UOEA 2IZZA 3GJ4A 4WY8A 3W8RA 3TG2A 1E6KA 1GT91 4NE2A 4B6RA 4F96A 4I1OA 5TVKA 3TB6A 3U4QB 3HXLA 3KEFA 4OL9A 2HL6A 3HVIA 2HU8A 5FLXA 4YMVA 1FUYB 5ADWA 1EZZA 1GPNA 5DE3A 2BV3A 4CODB 1KZ1A 2C0PA 4G0QA 3DDSA 3HJCA 1RWVA 2AJDA 4FYJA 2NO6A 3NHZA 1YU6A 4OGWA 5FUVA 4OXIA 1U0HC 2W6CX 4UEKA 1GCUA 4YJKA 5HZHA 4Q7EA 3TNJA 5HJ2A 5CA1F 1ECFA 2QMZA 3TGPA 4UTRA 4WXRA 2DCMA 3MELA 2GSDA 2HAEA 4UAVA 1KYXA 2XA9A 1AMOA 1CEXA 1URPA 4ZOEA 2GQ0A 2NV6A 3NGMA 4U5QA 1OB2A 2QX4A 2W22A 4NARA 4ZPXA 3T8YA 2QTVA 1LC3A 1GVNB 2L17A 1L7AA 3O91A 5E9WA 3V00A 2W2TA 2WA1A 3LBAA 4OAPA 4DMRA 2OA0A 3QNWA 1V5FA 1MX3A 1NBEA 2BFBA 2OGWA 4FZRA 4MI1A 1A1SA 3TW4A 4BE4A 2O1WA 3P32A 1WG8A 1Q0ZA 3KKZA 3NVMB 3L7OA 5ALZA 4JLDA 5KVSA 3T5CA 3SIWA 1L3BA 3HXKA 5AJTA 2PMWB 3IEXA 3LM8A 4WK2B 4HUJA 1FFGA 3M4YA 4TRMA 2QXYA 2XCUA 1O9HA 1UWKA 5I6DA 3FFBA 1OVMA 1I4TD 3IIEA 1JAIA 2BR5A 2F8SA 4UFPA 2GXAA 3W6UA 1NONA 2PWYA 3JYOA 3WLOA 1AKMA 4MS3B 1E6EA 2LP4Y 2HCBA 4O2AA 4FDMA 5BSVA 3CC8A 4P4NA 1QDUA 2AEFA 3A1TA 5IRCD 1ZNYA 1ZYUA 1MO6A 2C4TA 2VCYA 1E3DA 3ESZA 3I45A 2F3UA 3HO8A 3O3CA 3QA9A 3O8QB 3Q3IA 4N12A 4TKMA 2A0FA 3SHVA 3R09A 5C7OO 1Q12A 1QDEA 3LVFO 5CD1A 1Y5LA 5F12A 1ZOOA 3O1HB 3NG1A 3GGOA 3KXLA 4EWLA 1T3SA 3LCCA 1UEIA 1C9MA 2R1UA 4MW5A 3HFRA 1NM5A 4QGBA 1QHNA 2ODQA 1E4EB 2BHSA 4CKXA 5EKUA 4J3FA 5D3MA 4WBSA 3UOWA 4G5GA 2PKCA 3FTPA 3Q5GA 3I5UA 3H2IA 2W8ZA 3JS5A 2Z8YM 2QU7A 1WXQA 2AB0A 1OBFO 4Q9KA 1TKAA 4NTZA 1ZHHA 4E5DA 1QIMA 2BSQA 3BD6A 3Q1KA 3UJ3X 4D1YA 4KG7A 3EFOB 4Q7LA 3HCOA 1XRRA 5SZHB 4Q05A 1YR8A 4B80A 1II8A 2MMCA 3C5EA 3FRHA 4AY3A 2AG8A 4BO5A 1NHGA 4QPPA 4JHLA 4L5YA 4I1YA 2NV0A 2KLBA 2W9XA 2I3AA 2PAAA 1F3OA 3M4ZA 4HDNA 3VNRA 2IITA 1B8PA 3FMVA 1RAIA 4B7CA 4G84A 1ZJJA 1NUPA 1TLFA 2AMYA 4EGQA 2B8EA 3D54D 3T4PA 4U3JA 2H5IA 3QYFA 1R4NB 1O5OA 3LF1A 2X14A 3PI6A 4PYKA 1F3LA 4EARA 2XZOA 4BJHB 3T3OA 4OQLA 1MXFA 2P0EA 3KWLA 3L0SA 1ZM4A 3P27A 4RDHA 3SC2B 1CZRA 1QIIA 2BI7A 3SIXA 3PE4A 3ILYA 4NFHA 3UC5A 1BRMA 1YK1A 4G9BA 1YVPA 4LMAA 3MS4A 3SR3A 1TOAA 3A6EA 2IEZA 3E7FA 1DTEA 2G1UA 5TIIA 3F7MA 3N2IA 1Z5PA 1Y8QB 3EFEA 4H2DA 4LJKA 4E1AA 1R6BX 3ZIAD 1ODSA 1ATIA 1R50A 1L1RA 3EVCA 3QVMA 4Q03A 5DHUA 1NN0A 2DT8A 5FBHA 2J1LA 4TMKA 1YIDA 2ZI7A 3KTAA 3OCUA 1CRPA 3FCSB 1AD2A 1A9PA 1O08A 3D8HA 3LC0A 4L7QA 1MLDA 1J07A 1NMSA 3DZFA 2J7PA 5IC4A 4C2TA 1U5BA 1GAQA 1VIDA 2W42A 1NBAA 2FWJA 2JW5A 4BNNA 3GY0A 4BCCA 1CLUA 1EA5A 4CKZA 1QYXA 2ERCA 1JLLA 4GPTA 1O6ZA 4OQDA 3ANTA 1I4LD 1ORWA 5AKEA 1U31A 5FA8A 1CIPA 2A33A 3U7GA 1P5ZB 1Q1QA 3ORHA 4AQYB 2X58A 3HBMA 3QOWA 2WNSA 4OK3A 3L8EA 2HHJA 5G0WA 1KZ9A 3E9YA 5M7EA 3AYXB 2H1CA 1RMQA 2QE6A 3GUVA 4G0YA 1GG8A 4HYEA 4M7RA 3HMQA 1E92A 4EEZA 2NSLA 5LYJF 2W2KA 2QLNA 4AP9A 3TUZC 2ZDQA 4E15A 1V6CA 4W5RA 3OX4A 3AVYA 4G26A 5IF3A 4ZEMA 4MQEA 1FLAA 1W5EA 5AIAA 1WB5A 1Z0AA 5LDDC 5KPDA 2W98A 3IBCA 3TM4A 2R6FA 3UH1A 2FPWA 3OOSA 3FR8A 2WTBA 4XDHA 1GCGA 4ZP1A 1H9BA 2LUOA 4KVAA 5DTMA 1VI6A 3OEWA 5A06A 4LAFA 2UYOA 2RH9B 3B6EA 5LKRA 1DWQA 2C82A 1X1TA 3GFSA 5EC8A 2D2VA 2HJGA 3WHIA 4BKMA 2HSGA 3BGIA 1HEIA 3AKDA 4QPZA 1DQSA 1CUIA 1XTQA 5HIKA 2IZ5A 3THYA 3UWDA 1VHLA 4Q1DA 5BT8A 3I9KA 3UMBA 3VNSA 1M6NA 3KKMA 4W9NA 3K73O 5A04A 3ELDA 1NXXA 2PX3A 1CJSA 1VCNA 1Z2OX 2R8XA 2XRFA 3H6GA 5EZ5A 4WW0A 4D8WA 1UK7A 4WZBE 1ARZA 2W2OA 3I9NA 4G36A 2AOWA 4DTIA 4EYKA 2X5JO 2DOKA 5DISB 4YAIA 2QBYA 3EC7A 5AQEA 3IIMA 1PWHA 4OIMA 5BW4A 5KJEA 1UKBA 5A6SB 5B3KA 2Y77A 3TECE 5IZCA 2UXDB 1QU3A 2NV2B 1B6GA 3SCZA 1XU7A 2Z09A 4M8NE 4TXNA 3I61A 3KQOA 5FLKA 4IOLA 1T3ZA 5GZ6A 4CQMD 1KDPA 2XMPA 2AFHE 1N34B 1KDZA 1KO5A 4WWHA 1DJQA 1CV2A 2CBZA 4XXHA 4XWTA 1G6OA 4NH4A 4ALLA 5JISA 5K0BA 3HJHA 5EQFA 2OEPA 5B58T 4FD2A 1ECCA 4Q21A 4BE9A 4H3KB 5CFMA 3DYIA 3AY7A 5G53C 1I0IA 4GOMD 4FSDA 4LDNA 4P0QB 1OOEA 5IJZA 3TTWA 1PX0A 3OLZA 4DZRA 4NAVA 1N0VC 2RGBA 2I2BA 4H1TA 1QO0A 1M2GA 4RJTA 2C5BA 1XWFA 2H57A 1R6DA 5JO9A 4B4OA 4UHJA 5GZ3A 3WV4A 3IEVA 1DGQA 1Q16A 1MEEA 2OVFA 2CE2X 3REQA 4FQ8A 2FTKE 2WSLA 5LMUB 4JC5A 3LZCA 4Q9LA 5DSXA 2ZVQX 5GAJA 1SD2A 1H3EA 3UV3A 4ACAA 2Q50A 4K2HA 3QMWA 4P86A 4UPDA 2KSQA 4PAGA 3TZKA 2CVPA 1GKLA 3LD9A 3RUDA 2NACA 1JDBB 1JIQA 1GPAA 1ODFA 2JFYA 3L6OO 4ZHQF 4V0LA 5A05A 1A8QA 4NU8X 4K9KA 4R6WA 3P97A 4WFKA 4BV8A 3K70B 3O2SB 3P9SA 3L1UA 1UJ4A 1RHJA 1TVKB 3AILA 4PG5A 3WWZA 3FJYA 2OO5A 3GQBA 3CX3A 3R3WA 2R8BA 1P2BA 3BXEA 2BMVA 4CCYB 4V38A 3GPCA 4MI3A 2TMKA 3RNLA 2RK3A 4AO7A 4GM4A 4CGYA 2W00A 4JUBA 5CCDA 2HBZA 2C29D 3G8DA 3L8YA 3L7DA 4QFBA 1RXSA 4X7PA 1E7MA 2RHJA 2FN4A 4JQYA 3NH9A 1I80A 2BMDA 3B13B 4XE5A 4B6PA 5B1EA 4R7TA 3LA6A 2Q5HA 4RGQA 3LUJA 1WB4A 1RJDA 2WHRA 2Y0DA 3ABQB 2R1VB 3G8YA 4MCJA 3ZTYA 2JLCA 3ECCA 1C4KA 3IE0A 2EEPA 2EEZA 1UPFA 1GOTA 3DW1X 3FOFC 1KVTA 1S2IA 1KIFA 4NCJA 1CJMA 2UV8A 3IP3A 1SBCA 3LLSA 3PCTA 1GL9B 3BL8A 2YRXA 4FFOA 5AR1A 3N39C 3ZXIA 1NXVA 3IS3A 3WYFA 4BBJA 1E69A 2VP3A 1QKKA 4EVSA 1IUPA 1LQUA 2OGUA 4RJ2A 2PSJA 2Z04A 3A31A 1RPJA 2D0PB 2W6MA 1ZNZA 3FBGA 4WL0A 3BRSA 4A2PA 3VR3D 4BO0A 4LA4A 5C5EA 3L1IA 4PONA 2BYTA 2QGNA 1SUWA 3KVYA 4WGFA 4OXXA 1KOGA 1U0NA 1ZSVA 4QFCA 3FETA 1I94B 3VU3A 3SX4A 1Q5PA 5EIXA 3J7AC 3SP1A 4HDQB 1QH9A 3PSAA 4WFQA 4OXKA 1G0NA 3BCSA 3TYXA 3VR5A 4YDHB 4TYWA 3C4QA 1Z4KA 3BB3A 1YS4A 2QYOA 1Q7BA 1X7ZB 3N2NA 4WKPA 2OCYC 2B2CA 2V55B 1JZQA 2WBLC 1G21A 1M6EX 4BMVA 4QYWA 5DM1A 4BU0A 3LCJA 1WXDA 5FYDA 1TC2A 3BN3A 3LUPA 2NU8B 1RJWA 4FCCA 1SGWA 3GJ5A 3WGLA 3ZWPA 3IFSA 3WQRA 3TJZA 5DHQA 1GZ5A 2HU7A 2AOTB 4CTJA 1W581 4C29A 2F8LA 2O8VA 3QW2A 5H3LA 3H3FA 3UT5B 4EMTA 4TUYF 3JARA 4YJ2B 2F43B 1G60A 4AN0A 4KO1S 4NZZA 1DMRA 2RC5A 2X15A 3OQ6A 1NKSA 3TSAA 4ZTZB 2YCLA 2QMYA 4CM4B 2W6ID 1E5XA 2P5UA 2IYUA 1UPTA 3OKAA 4IGKA 4XDGA 4KLCA 3QK7A 5ES3A 4KDCA 5DIFA 3AF2A 2PIDA 3COYA 3NORA 4E4YA 2I1QA 3T5MA 1EKXA 2O5VA 3FDXA 1UBSB 5SYAA 4M87A 1QORA 4K9DA 4EUSA 3NANA 1SZJG 4UAGA 2ZT7A 3F6YA 4IINA 1NATA 5BQ5A 1TF5A 3QLVC 4GLOA 4QVIA 3FSEA 4HEJA 2N1MA 3GIDA 4MWSA 4QYMA 2ADFA 1K7SN 2DBRA 4KDEA 1LK0A 3UA3A 4F4HA 5FO1A 1X38A 2OAQ1 1L5NA 2E4AA 3DTVA 4EMUA 2V0GA 3ZY2A 1VE5A 1NF3A 3OPQA 2C2HA 2NUAA 2VT6A 3G0GA 4XQ0A 3HFGA 3KOXA 4JOBA 4DXAA 3BQMB 1GU0A 3HE3A 3HU3A 1DJNA 3SS7X 2QGFA 1TQDA 1BXGB 3CH5A 3GC6A 3N2EA 3AL2A 4GI2A 4L8WB 1TA0A 1P1IA 1YUNA 2OCKA 3ND7A 3D2CA 1CXZA 2A67A 1XNGA 4BVGA 4LQCA 3M8KA 4DB4A 1LX6A 3JD0A 1PJ8A 1F7VA 3UMMA 5C8YA 3AFNA 1YFJA 5JFOA 4R54A 2C2YA 4CRWB 3PXBA 4GXQA 1CP2A 1VKNA 4Q3CA 1ISHA 3DF9A 1WLSA 1D9ZA 3LQKA 4O0LA 5HP4A 4NJEB 4X3PA 5H82A 1EHCA 2BBOA 5TS2A 3I4CA 4BRSA 4D74A 2YXPX 3EHEA 5ULLA 3FNFA 1R9MA 4KOEC 2NIPA 1GZ4A 3JYPA 4LDQA 2FWAA 1QJCA 3L6BA 5IWCA 2IH5A 4BXOB 1FL9A 1M0WA 3QMPA 2EX0A 3UGKA 1AKWA 4OQZA 1B26A 3IUJA 4BMPB 3LVQE 1T2UA 2DG2A 1KHTA 1Z6QA 5DNAA 3OPMA 3PXDA 1NP7A 2RBEA 1TYCA 4HNUA 1EXNA 1BDHA 1I10A 2HYIC 2I3ZA 3CUVA 1ZD5A 4F45A 3ZK7A 1P1FA 1I30A 2YVKA 2A5FA 1GFSA 1XEXB 5U4XA 3PE6A 5CB4F 3LT4A 5DMHA 1OAKA 3KQWA 1U3DA 3H2HA 4C20A 2YWBA 2FQXA 4LZPA 3T15A 3KDAA 2AI2A 4ITUA 1AO3A 1IVYA 2MSEB 4M0DA 1FMLA 1QPGA 2D1RA 3MB5A 4JJ4A 1SC6A 1SD5A 3WMGA 3LQ2A 4PGFA 1S7CA 4ZCPA 3W8NA 4EHFA 1UDCA 2MMGA 4U7JA 3U19A 1HEYA 3DAOA 1TU0A 1VI5A 1XCJA 1KZYC 4NBVA 2DERA 1FFCA 2X5XA 3GJ8A 4BGIA 1Z5NA 4DQXA 2VK4A 3S1SA 5AYVA 1HI9A 1JJIA 5FA6A 2JFWA 4I4TF 2W6NA 3HYRA 1OGYA 1JHOA 5ICGA 5ICEA 1R7RA 3ZDQA 1U7XA 3MMNA 4QNMA 4M53A 2E3JA 3B3FA 1GU7A 2CVHA 1CS0A 5C3UA 4YYEA 4WZZA 3LK6A 2COKA 4N0QA 4R6XA 1XJ0A 3GV0A 2BJHA 1Z25A 2JFQA 2J3EA 1UKAA 3O84A 5IJ9B 2B35A 1LS1A 1BH6A 3L2OB 3V9PA 3V8QA 5CEJA 2X6RA 4BNHA 2IOYA 1P74A 1T91A 2GD0A 4MEAA 1VYUA 2QV0A 4YUVA 2B25A 1C1HA 1PQYA 3DE7X 2GJ8A 1NUHA 1BA3A 4AJIA 3V1LA 3VC2A 4Y2JA 2FFAA 3ZHBA 4EQ6A 1DC4A 2GZ2A 4CMAA 2B6HA 4G8BA 1F0PA 1DBPA 4U00A 1RKXA 1QFJA 2QA5A 3KQPA 5KOJB 1FNCA 4G2NA 4XSVA 2XWQA 1ZP6A 4KB5A 4DIMA 2J85A 4G86A 2R48A 5C7LO 2PUDA 1LA2A 5K3FB 3W1EA 3INRA 2GN1A 4PX3A 2H1IA 5EUBA 4P38A 4W8OA 3GCWA 2DJ5A 2G5PA 1JS1X 2QTTA 2WD9A 2WU3A 5ISMA 1Y8RA 2Q5LA 3NBXX 2GO1A 2CCJA 1G7RA 3GYGA 1M2OA 5K0CA 1FXWA 1P9LA 1DJPA 4QUGA 4TSFD 3JQDA 5L3SA 4D4IA 1JJFA 3DCJA 1OR8A 2VNAA 1E62A 1SUCA 5K7SA 1T0PA 4Y6RA 3GEPA 4LSGA 1IB6A 3OD1A 4OGLA 4B17A 4PW0A 3IKMB 4RVSA 2QP9X 4EMBA 4F2HA 1SRRA 4NF2A 1TU3A 1XZFA 2DUJA 5JQGA 1JWLA 2AZTA 5TMEA 5H9WA 5KJ6A 1YFLA 4M22A 1OI7A 1CX9B 4ZYXA 2QVYX 2XRYA 1DSSG 2P5YA 3SQDA 1A9XB 2ZVPX 3D4LA 3GMSA 4W6QA 1NIJA 2VKTA 1NASA 2YN4A 3C3WA 2MSKA 2IIBA 5JBQA 2BDUA 1UF9A 2JLRA 4KEAA 4ZMSA 4JEHA 3FUVA 2VPWA 4WCFC 4UM5A 1WZ2A 1HXHA 2QL7A 3DZBA 5EUMA 5FBWB 3OQOA 3GRYA 4RPKA 1SUFA 3Q10A 2CYAA 1MBZA 1Q0LA 2B5OA 2Q3BA 4R51A 2PH3A 4TTQA 3F8TA 1JEQB 1PKXA 3NV7A 2EJCA 4LHXA 4P5EA 5FWNA 2LR0A 2VHTA 2HLDA 3O8BA 2QJRA 3G7NA 3BG5A 2VK1A 1ZJZA 4MWOA 2PX6A 2FK7A 4M7PA 4TM7A 1BD4A 5BWLA 5F7ZA 1JG1A 1JH8A 1EZ4A 3E9QA 3VR3A 1G5IA 4PSCA 5AVXA 4YAKA 2FMFA 3A3NA 3TKLA 4BTLA 2R6CA 2VBCA 3D6TB 3NTQA 4IXDA 4LOKA 1YZHA 3G1TA 3HO6A 3GZJA 3Q0IA 3AUXA 4OI1A 4B2YA 1V1RB 1ACJA 1ZK2A 2O0HA 2WJYA 1HETA 1N2CE 4R69A 1CVIA 1RYEA 1KA9H 1YWGO 2VPPA 1WP9A 2X41A 1KYQA 1Y7IA 1IXKA 4AJHA 1NUSA 1MHPA 1YCFA 3WL6A 4KQIA 4B87A 1ZN9A 1Z2NX 2D0DA 5G2OA 5EKXA 3D6MA 2ZU0C 3G8CA 4H08A 4HB3A 1TJYA 1Z4OA 1P75A 4QGGA 4QQRA 1AK2A 2GARA 2ZI3A 3SGLA 2UUPA 1KY2A 4H17A 4EOGA 3G6KA 1FFHA 3VH1A 3X1ZA 4PC1A 3KXPA 5CNJA 4L8FA 3W3AD 5AXBA 3TSWA 4C7OA 1TAGA 1Y34E 3BJZA 3JQBA 5CYPA 3L6UA 5B37A 4CEJA 3AHEA 2JJ2D 2VHQA 2AOUA 4WCDA 2JCBA 2YX1A 1JG6A 3RLIA 2AMLA 5ERXA 4NYMR 3RS3A 1V9SA 2ANCA 4J0CA 1OHHA 4MMXB 3KLOA 4ZN6A 3SMVA 4OB6A 1XLTA 2RGEA 3AONB 1VMDA 1GGHA 1ZCZA 3RTEA 3AUAA 1C7JA 4MRNA 5A9RA 2Z58A 4YTEA 5HBRA 3HDVA 1U8FO 3E9EA 2WJPA 1IJKA 4ZYLA 3OPYI 1Q1BA 1XB2A 821PA 3ADBA 4FFBA 1T9ZA 1WVMA 2GN6A 2Q6VA 4UD6A 3EVAA 1UP4A 3B48A 1VOTA 3DB2A 4DQVA 1ZCBA 3UJ6A 4UHCA 4EBBA 1VBNA 3V33A 3VM6A 2YDYA 1P7PA 4I9FA 5EJMA 2ZYSA 4IIJA 3CY6A 3NHMA 4NAHA 5DTJA 1W5TA 3X43A 4PZCA 4ALIA 5A4MS 3LH5A 3A05A 3ND8A 5DTIA 5TEWA 3IBTA 2F55A 3RFCA 4AFNA 5KU7A 4P3YA 1EJ0A 2R97A 2Y1LA 1MAVA 4QUKA 5TGZA 2WV9A 4CR6A 1DXQA 1O6CA 4DCSA 2K7FA 1W47A 2BFCB 2P6MA 3ZWCA 5BUCA 1OIXA 2JBWA 2EKPA 1PWYE 2F3QA 3E0XA 1E3QA 4B84A 1ZOIA 5KQPA 3W6OA 3ENVA 1MOSA 2EG5A 3O4HA 3IAAA 3L8GA 2NT3A 2P5TB 3FE2A 3OAAA 4Y9UA 1N7IA 5ECYA 1NMYA 5KS2A 1B42A 1JG4A 2G6TA 2GUWA 3FPCA 2XBMA 2BFDB 2FJPA 2Y2VA 3JVIA 4D5GA 5JS2A 4CL0A 3KQLA 4FFNA 3QY9A 4BC1A 1QIFA 1RAAA 3QBEA 2VWQA 4AC9A 3ZW9A 4D42A 1IN1A 3P0RA 2XOKD 1SEPA 4U02A 5CPFA 1BROA 3Q7EA 1KOFA 4ZEXA 3CIOA 4JVSB 2JHFA 4GZ5A 3DM5A 3TINA 3ZVMA 1DKPA 1PJZA 2QY6A 1XQWA 4KMRA 4OF4A 4RLFA 5EYPB 3RVJA 4DBVO 1XF1A 4DR5B 4LVOA 1RXVA 1JDBC 2PN1A 4WXHA 4D4LA 3C5WP 3AW8A 4W1PA 3ZWDA 2NUPA 2VH1A 3K9NA 4R84A 3SS8A 6ABPA 3K70C 1T2DA 1T9KA 4D96A 1XMSA 1T3GA 2NZXA 4QECA 1F9AA 1NBOA 3HA7A 2H4XA 4JODA 1LDYA 2UVQA 3KEOA 2YRFA 4OTZA 5C32A 5K20A 4H7JA 3GD5A 3PXUA 1Y9EA 4AYXA 1PNOA 2O8CA 1BMFA 4IO1A 4UHDA 2DWQA 1ONNA 4KREA 2X0NA 4QICA 2Q49A 3SEZA 5AUNB 1P3JA 5BMVB 1YZLA 1YE5A 3TK1A 3ZWXA 3AEUA 4ZEVA 1H8HA 4YGXB 3ZVKA 2RH4A 1SO8A 1VC2A 4KFSA 2HLPA 2ZSUA 3JRNA 1S1MA 3AV0B 4S2EA 2E48A 3EGXA 2OQIA 3R5JA 3NHFA 1KJ9A 1E0JA 3NEPX 3RJ5A 2B3DA 4EY7A 4BPRA 1GFWA 3ZWBA 4HXEB 1UP7A 3GUUA 4H0FA 1H5QA 1XWIA 4M8IA 4LXTA 1Z4QA 4FOOA 1HT2E 2WD7A 4DJDC 1W5BA 3WV5A 1RXUA 2P68A 3L6CA 5DM70 1K9VF 3F46A 2C20A 3RG2A 4PRYA 1OFGA 1VMKA 2VP9A 5ALLA 3CT6A 3OLCX 4NENA 4OUKX 1EFAA 3KV3O 1NSFA 5LP6B 2Q45A 1N1EA 2W2LD 5AJWA 2I99A 4UFOA 1DI0A 2CL6X 5CLJA 1CEEA 3SXPA 4DLTA 2VNIA 1XRLA 4M36A 1Z47A 1CERA 2H0QA 1F6BA 4NCIA 4YRJA 3LUKA 1IJEA 5EQDA 3CLTD 1PHPA 2BR4A 4N9WA 1JDPA 3HVKA 1NNEA 2DUUA 3KOMA 4QUJA 1A95A 4FIZA 4FCVA 1E0DA 4HTFA 3H4MA 3SSNA 4CM8A 1MX1A 1U3VA 4GF5A 1VPDA 2GD6A 2GR9A 5DRYA 3NBMA 1ECGA 4BTEA 1TK2A 4YA6A 3VQTA 4HGZA 4BNVA 2F00A 3SYNA 1SZPA 2VA8A 4QYXA 3A9RA 3N8NA 4JUAA 4GECA 3HLTA 5THXA 2RGDA 2J33A 2ZP1A 4HGYA 4FIDA 5I4IA 5IKXA 5CT5A 1I32A 1KP9A 4RTQA 2PZGA 2XB4A 1O9BA 4HMPA 4ZANA 1DEHA 2ZB2A 1EFKA 3SS9X 3BMNA 1U0OC 4DADA 1IIRA 2ZYTX 3HCNA 2L42A 4F72A 1DBWA 4QXQA 4KVGA 2AVDA 4YRZA 3FMOB 4YAJA 2H5LA 3KM0A 2Z2IA 2C2OA 1GYQA 4HX9A 3KG2A 1V7PC 1IM2A 3ZDBA 1JN0A 2PT6A 2IVZA 3E58A 1BWRA 1GAJA 1WY5A 5JWOA 2Y1EA 5M2QA 2IV3A 4DNOA 1CDEA 2OC4A 3NRCA 1MAHA 3E23A 4M89A 1K9SA 1NVWQ 3TEMA 4URWR 1YZFA 3DXZA 4OHRA 4JASB 5ALQA 2ZWOA 4I3HA 2ID9A 3R3ZA 4H0NA 4Y1EA 5FBKA 1Z8HA 2GA8A 3ACDA 4EUFA 1RC8A 2GYVA 1HURA 1MJGA 3AC0A 2WK1A 2WM3A 4JR1A 3ZHTA 2Q8QA 5IAEA 2IDZA 4C0SA 3HH8A 5F2NA 3C3BA 2L2QA 2FZWA 5B12A 1C50A 5KJ1A 1FY2A 1OFTA 1KZ7B 3V42A 2CHGA 5DWQA 3H86A 3VU1A 4B9AA 2G36A 4UM8B 3QKRB 1Z08A 3AUJB 4F4FA 2ALJA 1GG2A 1BE1A 3M6VA 4E5PA 2F1HA 4GZ3A 2F17A 3HXPA 1KPHA 1SC9A 1JA1A 2YJZA 3QHPA 3W9YA 3FJOA 3NYQA 3X1JA 2XDAA 4YCLA 2C77A 4PICA 2X9QA 5D2CA 4QOFA 1XYGA 4Y7DA 1RM3A 5INTA 1ZJYA 4WLOA 3UCEA 4HAYA 2CEKA 3PNOA 1XF9A 4R8MA 4FSXA 1CRWG 1K3TA 3Q15C 3AL3A 4PNPA 4FYKA 3TR5A 4C0LA 4CMIB 3HVJA 1C14A 2CJYA 4NE7A 1K8YB 5EE0A 5JCZA 1PVOA 1E2DA 3E35A 3KWFA 4WUVA 3JQPA 2GK7A 2GFIA 4QFDA 5TGTA 2BSXA 3LOQA 1LTHR 2MCFA 1Y1KE 5AKLA 1JI3A 4WKNA 5FI1B 2G0AA 4JT8A 4MVYA 2G25A 5CX4A 1AUQA 1FS6A 4XUEA 1OWOA 1C30A 3INGA 3ETDA 2ANBA 4MR8A 4F60A 1Q95A 4BFSA 2PSSA 2I33A 2QE7D 1B6TA 1LY1A 2XADA 4AUEA 3NEYA 1KI3A 3VPGA 4F4IA 5A02A 1SCUB 3N5KA 2OD9A 5GOTA 1ID1A 1U1EA 1LU9A 3WAGA 3T1TA 3CQ9A 2V3VA 3H18A 5A9SA 5AVUA 5C7YA 1TECE 4PG7A 3VPSA 2HFJA 3BH0A 4QIHA 3PHLA 4N0DA 1EFLA 2YW9A 2Q62A 1PX2A 5K3SA 2CNLA 3SY8A 4RVHA 1IM5A 2BBWA 2F64A 3EF3A 4Y2YA 1EDZA 2ZTHA 5IVPA 4C14A 3LKDA 3PDIA 3GP3A 1QTRA 3Q11A 4YH1A 5T5QA 4X71A 3W9UA 1V3UA 2GPJA 4KXWA 2XNDD 3DP7A 2H0AA 4GP7A 4K6FA 4HMOA 4P31A 1KFJB 3WJAA 1YRYE 4D3SA 2WFZA 4CIXA 2R25B 3U31A 2W6QA 4BLVA 5CT8A 4XUCA 1UDBA 5B5SA 5TEVA 3OICA 3RD5A 3D8BA 3JQ9A 2RGNA 3L4BC 1I6MA 2DWUA 4DLUA 4UHEA 4YP0A 4QLOA 4XVUA 5D01A 1O7JA 4JU9A 2NT4A 4HSGA 3TQOA 1WB9A 3KPWA 3ZV6A 1XMIA 2JH3A 4W8HA 5FL3A 1N2HA 4E5VA 1CY2A 3VR4H 4G4SP 5F3RA 3QUBA 3W2EA 4Q3KA 1VYVA 1IG0A 1QK5A 3RVQA 3RTGA 4P93A 3NCTA 1XVLA 1N6IA 2XXJA 2WQZA 1IBLB 4F4UA 5DW3A 4DY6A 1YFKA 2I78A 3ASZA 1MA3A 4HRYA 1A72A 2DHEA 4RHCA 1UPUA 2ZS8A 5AW3A 3C7DB 4BN5A 4RVNA 1TIKA 3PYXA 4I46A 4NKRA 1N2ZA 1Q91A 1T5OA 1D2CA 3GPDG 2JI7A 3CT4A 5ITWA 4YALA 3KC2A 1F5SA 3SDBA 3UAVA 1ICEA 4MV0A 1QVRA 4BNIA 4KK3A 3N59A 2JK1A 1FYWA 2VDOB 4LJ9A 4AXBA 2QI9C 1BU8A 1Z38A 2XTAA 1EFVB 3EUWA 2B4QA 2XOKA 3D0RA 3N86A 3PQCA 5AO9A 4A0SA 3QVSA 4LBZA 9MHTA 3ICPA 2I67A 4NBUA 3QVKA 4Q4HB 3HCDA 3FM9A 3RANA 3LU1A 3MJSA 5E2AA 3AKYA 1N6KA 3V6LA 1SXJE 4RA6B 4AZ0B 3O1JC 4AKEA 3KQVA 4G5FA 3BXHA 2JHPA 1JQ3A 2Q2QA 2FSUA 1B3BA 1ODLA 4EATA 1IN7A 2ZPAA 1MMFB 4UTZA 4FHZA 3ZD8A 3TB4A 2RDMA 2ZUFA 5E7IA 2P0AA 1TT5B 3JYNA 4KXQA 1ICIA 2DH6A 4TKVA 2I87A 3H2BA 2CVQA 4MARA 3L0BA 4AU1A 3N3BC 1WZCA 2IP4A 2P30A 1U9IA 2KJQA 4M0CA 4MKIA 4S1VA 3VTKA 2PHZA 3IEMA 4CLRB 2ACWA 2D1SA 1CP3A 1IHYA 1AE1A 2WJGA 5K0SA 2J9FB 5FOQA 4ABTA 2I6XA 3NDIA 4OXRA 3R7LA 1OI4A 1YQ9A 2JFUA 2FWNA 3RK0A 4TYYA 1XZMA 5C2JB 1XNJA 1W19A 2BTQB 1T6BY 1FLNA 2X5NA 4ZAYA 2QJWA 2G0TA 1ZJ5A 2B9EA 3H5NA 3JWHA 4XD7A 3ED1A 4CDMA 4ARCA 5HKLA 1WUJS 2YYAA 3AWDA 6LDHA 1KOLA 3EEBA 1R9GA 3E84A 5TX7A 2ZUCA 1X7XA 1E61A 2FN9A 3RUAA 1NVVQ 2BGNA 2ZBVA 5NULA 3W4JA 4IDAA 1RP1A 5B7GA 3AJDA 1K86A 1U7UA 5G0UA 4DCVA 2XCQA 4P3XA 2VYND 5HKOA 3ZWQA 1WIWA 4XYGA 5ERGB 1RKUA 1QYRA 2NUTA 3EARA 1QQTA 2O2GA 1EAYA 1W4LA 3MJDA 4J7CA 3RBAA 1PV4A 4ZXFA 4ESEA 3VZBA 5CYGA 5AXCA 4UAJA 1S89A 3CEMA 3JQGA 5ESXA 2QPAA 1XDUA 5HKKA 1Z06A 1C8BA 2OTCA 3N87A 5JNWA 4AY6A 2XXAB 3MCAA 2JBHA 1Q17A 1YULA 2A86A 2GD1O 2QLLA 3IGFA 1KDVA 3W3ZB 1USIA 1VCHA 2E7ZA 1PK8A 3AVXA 2B4RO 1HFWA 1M1YB 3HP4A 4DV7B 1YI8A 3HCRA 2XNSA 5TY0A 2JI8A 2EZTA 4BZPA 3DZ8A 3A6ZA 1DQNA 1KI7A 3AI7A 4LRXA 1UFRA 3TXXA 2FPPA 4K6OA 2AW5A 2LKDA 5SYMA 5A5EA 4B6GA 3ZCVA 4N82A 3N8DA 2ID8A 2X1LA 5BYBA 1GPKA 3IA2A 4O3FA 4Q82A 3RYFA 3NHUA 4BB9A 2V6BA 4QOSA 5ALTA 4C4RA 2V7WA 1EIZA 4JJEA 1JEYA 4RUKA 2FP4B 3EEQA 3NHKA 4PRKA 2J9ZB 3BBLA 4J16C 2J07A 3UHOA 2BFFA 1XXLA 1NR5A 3QI2A 4MUFA 1U9YA 3V80A 2QRLA 1L9KA 3T94A 3A6FA 1G6Q1 1V8DA 3NQ41 4BNZA 2R8PA 3PCXA 5CLGA 2RGAA 3KSZO 4G89A 4I1VA 5F3WB 4KXUA 5JD5A 4RH3A 2QUBA 3TPCA 3KZXA 2VWPA 3A1FA 4E5NA 3QWFA 4O8CA 3ROGA 1PJ4A 2HPVA 3RU3A 1P1BA 3HEBA 1VLMA 4ZK2A 3KWMA 4E4RA 1FVFA 2JGIA 1FX0B 1JWBB 2AS0A 4RD4A 3BCUA 3ZS9A 1XJCA 4MPDA 2DECA 4YDQA 4MW9A 4G37A 4NZMA 2DUNA 3T4EA 2GDZA 2RI0A 1U2GC 2DCUA 1XRMA 1NHWA 2GZSA 3QEMA 3DFZA 4ZOLB 5DEIA 5HS4A 5JSZA 1M7GA 4M7OA 1NE7A 5DM4A 2C3UA 4GLLA 3CV3A 4Q02A 3HZRA 5K0JA 4LE1A 4YJHA 5ALRA 1UKZA 4MW4A 2ZRQA 3VTFA 3I4FA 1Z74A 5ADUS 2WAXA 3BYZA 1H4TA 5KOHB 1N3LA 3CNLA 5FULA 1I3KA 4YMSA 1TA9A 5C8YF 1YS2X 5DH9A 2Q4BA 4M4SA 4YLEA 1GV1A 5KREA 5HRAA 2PRSA 2I6GA 4M1MA 2YIVX 2C7BA 3LNTA 1VQ1A 4HDAA 3DMHA 5EKDA 4DEVA 4DQUA 4CKWA 3E18A 2KS6A 1CC1S 1KK1A 1TCAA 3NHRA 4IJ5A 5EHXA 3IESA 1U11A 2DULA 3C24A 3R44A 3B1FA 5JXJA 1I7PA 1MVLA 2VCHA 1ZSYA 1WUYA 2ZIXB 4JX8A 3VXKA 5LXTB 1O57A 3GLSA 4V0RA 3JXEA 1APBA 4BLRA 4DVGA 4L7VA 5DHAA 5JRJA 1TKRA 3HA2A 1MAAA 5HFNA 3OOWA 4QTYA 2H63A 3ENQA 4MUHA 4PAQA 1AF7A 1TYBE 1GPH1 2CXRA 4KSYA 2IEBA 1PUJA 1E4VA 1PAUA 4CI0B 2QN8A 2BCJQ 3OPYA 5AI0A 3I04M 4JUDX 2A5JA 1U2ZA 2IZOA 5FUWA 4IJ6A 1RLIA 1YMQA 1CUDA 1QSGA 4GVPA 3HCAA 4MXDA 4P4GA 5FWYA 1DPFA 1UBHS 6YASA 3QVJA 3D7NA 5AW7A 2Z30A 3HU2A 2G9RA 3KXDA 2JGMA 1NYRA 2JGEA 3DZGA 3FUXA 4IRUB 1G19A 2CMDA 1CY6A 2WJIA 3BREA 4J1SA 1XKXA 1IN4A 4BATA 4UNQA 4F71A 1UBLS 1EVIA 1NRJB 2P9TA 1ISRA 1P62B 3AJ8A 1GADO 3BULA 2EQAA 3H5RA 5HCIA 3OZEA 2XD9A 4LVCA 4CM9A 3AERB 3S68A 1J2TA 3TUIC 1XTJA 1OFUX 4GPAA 1RRVA 1YV9A 4Q6BA 4CQLA 4WNAB 3HBNA 4YPOA 3KYBA 2DBYA 1CNMA 4L4UA 1SQ0A 1BKDR 2HIGA 3OT1B 5EL0A 3N2KA 3NAQA 4O1MA 2GN9A 3QXJA 1R2QA 2OHOA 4C4AA 2WW8A 3SQOA 4DEYA 1GQ2A 1ZUD1 3CYFA 4JHXA 5I45A 3WNBA 3HJBA 1TD1A 4HH3C 4EPWA 3LX5A 3LX4A 4RZ3A 3PDHA 5IASA 5ETJA 2OQVA 4G85A 3H2YA 1RLJA 4UVHA 1Y98A 3JAWB 3D4PA 4RCYA 1QPBA 3KZ1E 4K7JA 1U3GA 4QDXA 4FHGA 4NFLA 3G8BA 4ZARA 1MGPA 4AMYA 4BASA 3W7AA 2ZKIA 1C1DA 4PFSA 2G08A 1ONPA 2WB4A 1HR0B 4YK7A 5DU2A 5FBLB 4FX2A 3VR1A 3K5HA 4IDEA 3ZGOA 3K9HA 1XALA 2CCKA 2VDKB 4UD2A 3BZWA 1GTSA 3NYIA 2IHNA 4HGNA 1GUYA 2GCIA 1TQ8A 3TNYA 1E2BA 4RXMA 1RPAA 1FRZA 3ZXYA 2DE0X 4M21A 3CUEF 5EZYA 3OJ0A 2ZJ6A 3BEOA 3IVRA 4IKEA 3W7VA 4NS4A 1SFRA 2XE8A 4YS6A 4F3CA 4ZFNA 3B3QA 1SXJD 5BYKA 2LE0A 1GNSA 4AKIA 3JZDA 2HYDA 2YJNA 3IMCA 2VAMA 2I6FA 2I0FA 3P0HA 1F2UA 1ZUWA 3CF6R 4JEMA 2EBFX 1TZJA 3RSZA 3MMSA 4D4JA 1CSEE 5TPZD 1LDGA 3GVIA 1BGVA 1ACLA 1YGPA 5CA1B 1EFUA 1M34E 2QYHA 3STHA 2QG9A 2XLBA 3ME5A 4GYWA 2B61A 4HFJA 4MMZB 5ITSA 5JQGF 3WP0A 1RXWA 1ABBA 3W9SA 1Z16A 2B30A 2C9YA 4JP1A 1IHUA 1YRBA 4HS9A 3NBYC 2QG4A 3DHVA 1WXEA 4K9SA 3WK9A 5KQRA 3WA7A 4EI2A 4OCZA 2R6JA 2B5VA 2VPIA 2P2ZA 2EL9A 2C2GA 2J6IA 3T5DA 3VU9A 4PIMA 1Z4NA 2CV2A 5KOHA 3T9DA 1GZVA 3ZEIA 4A2WA 2C7PA 3SIPA 1K8QA 1E8DA 3AHHA 3D7KA 1M2NA 1WKBA 4IZ6A 3UJDA 3C6XA 4BRUA 3AHCA 3FHTA 2XJ9A 1SRQA 3L6RA 1KE1A 4WBNA 5K8CA 4KR6A 2CLLB 1NJ8A 2EVWX 4RF4A 4WI1A 3K6SA 1WY7A 2ZRMA 3UOAB 1U0GA 1PZGA 1QHIA 3GZTB 1YDMA 1G41A 4LV5B 1KQGA 1CR6A 1E2PA 1VA4A 2Z4SA 3B2QA 5HMMA 2G8NA 3VKGA 3NMUF 1KVRA 4B3MB 3AL0C 1L4YA 1TDJA 4ZREA 5FQOA 1YRWA 5EFOA 3IR6A 3PFFA 3C7TA 1O94C 4C87A 1A8SA 1CVRA 1REQA 3A14A 2CUNA 4PHTA 4Y9RA 2A1IA 2QUZA 2I4IA 4LK3A 4P7KA 2SBTA 3QKIA 4BQRA 4DSZA 1ZR2A 4WOBA 3KOWA 4MUGA 3AJAA 5TQJA 1TMOA 3I9V6 3IDZA 1H2HA 2WKWA 1DTWB 2AW3A 3ESCA 4GUAA 4HP8A 3BRCA 4NESA 3H8JA 4FGKA 3R76A 3T3PB 3TCNA 4KIFA 4M86A 3ZWOA 3I2JA 5DX1A 5JEEA 1P9RA 2POQX 3NTUA 3OOEA 1KKUA 5GONA 3OQIB 2QMEA 2G7ZA 3OO1A 1RQRA 3OZFA 5K45A 2KX7A 3D3JA 1DJOA 5C35A 1DPGA 2VK8A 5K0FA 1SIOA 1ZD4A 4Y2GA 3RRYA 4HZUB 1SB9A 3PG5A 4X8OA 2AL7A 1POXA 3G2MA 4KWIA 4MYDA 3MRXA 4W82A 1UFKA 1MC4A 2E4ZA 2FN8A 4E32A 3QBJA 4U2EA 3BF8A 2JGDB 1C5KA 2EL7A 1FFXA 5GMOA 3ZWYA 4BNTA 3EMBA 2VHJA 2KYRA 1ZCJA 4O6VA 4FS3A 2M6SA 2IUTA 2IKSA 4URVR 4K1XA 4YCNA 1DBSA 1MQAA 3UWMA 1ES9A 2IHBA 1JQLB 1AQUA 2EKBA 4RPLA 3IERA 4URHA 1M3SA 4DR4B 5A4DA 3KVOA 2OR3A 4PCVA 3S2EA 2OESA 4NZPA 1AA9A 1DMSA 2VJKA 1H0SA 1IOZA 2C83A 1PK7A 2YYZA 4IIJF 3EDRA 3RIXA 2IS2A 1V9CA 1YZNA 4JLWA 2YH2A 4RFSA 2NVUB 5BV1A 2BFMA 3D6JA 2X5OA 4DJAA 9ABPA 3F0TA 1M83A 3UT0A 2ST1A 3H1TA 1WETA 1L5LA 3GRFA 1QV9A 2BEWA 3S28A 1LPPA 3N2YA 5EP3A 4HNHA 1GFZA 1NPTO 2RG1A 3LWZA 4FOTA 2ZBDA 4ZGGA 4LF6B 4Z7NB 3RSOA 4ZJZA 4RS3A 2F1OA 4K6KA 3SEFA 3QM1A 2VQFB 1O58A 4OXQA 3IL2A 3MYYA 2I5PO 5B1SA 4HRXA 2CLSA 1LPOA 1NIPA 1PG2A 1QS0A 4IKPA 2FVYA 4J6EA 4DM4A 5C1PA 1EGVB 4RZIA 2MYUA 3BZBA 2RBGA 1TMKA 2VDLB 4EECA 3DGEC 2AT1A 3N07A 1PFYA 3M70A 2G1PA 1TJ5A 2QV7A 4IV0A 5AW5A 3OZWA 2YVQA 5CXSA 3EIQA 1WNTA 2WY2D 5C3MA 1BD3A 1CUSA 1A96A 2VHEA 3TLCA 3UICA 4EY5A 3SVLA 1YDWA 2JLWA 1SHJA 1ZMXA 3BJIC 4HYQA 2NSDA 3T7EA 4ZJPA 4AY2A 2VJNA 5F52A 2VTBB 4XCQA 4BNXA 3NONA 4N1AA 1AZWA 3CRRA 2HX1A 3HR4A 3DCNA 4WQMA 4M88A 4NPCA 3NM4A 3QLUC 4K0RA 4H77A 4AD8A 3I0NA 1V5EA 3AFMA 4X7RA 3HSSA 2WF5A 4EPXA 5LYJB 4MULA 3ESDA 3RARA 4QU0A 3ECAA 2D5IA 4KQKA 5AK3A 2ZYRA 3KQMA 1CUGA 4C2BA 1JEEA 3S81A 2A9QA 1N6LA 1F8YA 5MHTA 4FKBA 2ZUTA 2IYLD 3EDOA 4LEIA 5ALXA 1CJUC 2NTNA 3GJYA 2RHCA 4FEGA 4WUTA 3QW4B 4PZ9A 2PR2A 4DWVA 4DC0A 4E31A 1GTL1 2RI1A 1XVIA 4Y9DA 1HK7A 2WSBA 3WKCA 2Q9UA 3LZ6A 4KSCA 1G42A 3WWPA 4EKYA 3EQ9A 3CU5A 2O8BA 2UZ1A 4P54A 4PG4A 1KC1A 3ASYA 3FOBA 4PC2A 1QGYA 2WSYB 3WL8A 3GLGA 5EIHA 3BM5A 4XGKA 1T43A 3R9XB 1L1EA 2HQOA 4G0NA 4PLVA 1T5IA 4V0MA 5FTNA 3TOZA 5BSGA 4C7JA 4NDAA 3R7FA 3KQYA 2Z9CA 5F5NA 1EI9A 1IWBB 1NI3A 1C9JA 3PUJA 3ZNPA 1IQRA 3X3HA 1YUMA 2IOHA 3RAGA 4LC0A 1GGMA 4NOKA 2GCPA 4X91A 5CT4A 5HHTA 2AKYA 4KR3A 3ZG6A 4C2UA 3V8EA 2HSEA 3S40A 4HT3B 1EFPB 3ZY4A 2FPIA 3ZDDA 5AM0A 2XV1A 3O4IA 1Z22A 4E33A 1IHPA 3LO8A 3ICCA 3DTTA 4RY2A 5G4KB 2CB0A 3LCRA 4MUYA 4AW9A 5B6PA 2J9XB 3EQ7A 1KJYA 2IXDA 4G63A 4I9UA 3QKSA 4WIAA 4C05A 2FNAA 4EL0A 1VJDA 2P11A 1D0SA 1JNXX 4HNSA 2ZYIA 4PHCA 1GRQA 1CDOA 4QJIA 5ED0A 5H5JA 1VCOA 3ZY5A 4DS3A 3EASA 4Q01A 3I6BA 1SU4A 5CGQB 1AMUA 1XMOB 3SKXA 2OV1A 3P9ZA 4DLVA 1DRVA 5JVDF 1K6JA 2VUUA 5CK4A 3LNCA 5HF8A 1X74A 1JMKC 1JALA 4Q4JB 5ALOA 4C3ZA 4CMCA 2PWPA 1NJ6A 1T36B 4CNQA 3EXFB 3GJTA 3H83A 2WHYA 1QHFA 1ULBA 4ARVA 5JCPA 3H1FA 1M2KA 2QD3A 2H1WA 3PXGA 1ISFA 3HM9A 2WP8J 3RFXA 2ZJOA 4I4NA 4Y0VA 3W78A 2BKLA 2YZKA 3CO5A 3FCUB 4TGLA 4QYSA 4EYEA 1I0LA 3TIVA 4ZHQB 1Q92A 3TTVA 2IOFK 5GJBA 3DNMA 1V6AA 5IKMA 1A5ZA 4X66B 1GEEA 2DWCA 2QAJA 3GNTA 2XTNA 3RSLA 1O1YA 2C0CA 4KX5A 3SKYA 1I7DA 1MT3A 3KJNA 1QRRA 5ARCA 4JMLA 4B6OA 4CF4A 1GN8A 1XCLA 4MA5A 2RMKA 4N49A 1J33A 5HEKA 1G1AA 3IDFA 3NW9A 4JLPA 5GJWC 4WLNA 4EG4A 2PZ8A 1ADBA 2GAAA 4KFUA 1TC1A 4H35A 3VV3A 4AJOA 2ZSAA 5KTPA 4DLSA 2XCSB 4CKBB 3IEPA 4HUTA 1O77A 1X7GA 1Y0BA 3EK2A 3U4GA 2NP7A 2DSNA 1BHJA 3C8UA 4HQ6A 1BEEA 3K6RA 2X19A 4NBNA 4Z9YA 3KK0A 1Z18A 2G72A 4J49A 3IE2A 3K20A 2XHZA 4QRIA 1FSPA 3K2QA 2GGSA 4TLLB 2C07A 4UTOA 4LJ6A 3MXTA 2XE6A 5JS8A 5K03A 5FTKA 3NUGA 3KQNA 3IUNA 3CGWA 4FOLA 4DMFA 4LRQA 3GBVA 1CDDA 1Z6XA 4NRDA 1ZVJA 4CL3A 3MGGA 3M4NA 3GLHB 3C5CA 3QLVA 4MDEA 1CZOA 3DWGA 4II7A 4YBRA 4LF4B 5KQSA 3EZ9A 3BWBA 2CNWD 3ETJA 1X8KA 4NCBA 2JJQA 1PGOA 5EVCA 5HFJA 1UM8A 4CLOB 4ZQGA 4K26A 2XA1A 2NQ8A 3K2EA 1YMVA 1GWNA 1W35A 3QKWA 4KIUA 3X2FA 2RGYA 1T8TA 1PL8A 1X0XA 4E2FA 3BSWA 1L3CA 4RK1A 3L1HA 5TNXA 1NMQA 2B82A 3PGXA 2QTHA 2POCA 4P33A 4FU0A 3KUCA 4TMTA 2EFJA 4NLLA 5HS6A 1C81A 5BQOA 1XG5A 2OG2A 2ZROA 4I08A 5JAZA 1WUTA 5EGNA 4AJ1A 3U3KA 1XAGA 2VRCA 4BNWA 4LJ5A 5KTNA 1RI3A 3HUDA 4TUYB 1DIBA 1PLLA 2PKXA 1OAOC 1V7CA 2HA5A 3H11A 4YAEA 1R0SA 1U8CB 3O21A 3TXYA 3ZLBA 4UTXA 4F97A 3ZCSA 2W2PA 1W36C 1NLMA 4ICIA 3F5QA 4WOCA 1P7YA 4YJGA 5L53A 3OPNA 1KK3A 3IUBA 5KKAA 4H4DA 3DV9A 2JFXA 2LNDA 3I32A 4EHLA 3IHTA 3RVNA 4UPEA 3R40A 3RSCA 1NYLA 2WC1A 2Z43A 4X62B 2EW1A 4KR2A 3K70D 4ZO4A 3PR2B 5TQ0A 5FNVA 5AW6A 2PX2A 3FY4A 3IQWA 1UBEA 3O8OB 4BE7B 1YRHA 3GOHA 3KVNA 5C46F 3KYJB 5AW1A 3D02A 3FVTA 1T4MA 1V2HE 4ARZA 5FFMA 1N7GA 1YIOA 3AI2A 1SKMA 4AG5A 4DFDA 5J47A 1VGVA 1LUAA 2OFXA 4LPSA 4U39A 4XCVA 1ZGZA 3AB3A 1SUIA 1Z39A 2HMUA 3NWPA 1JG3A 3G68A 1OPRA 1MRSA 1TKBA 2A1UB 4PM4A 4UNIA 1Y1PA 1GVHA 3SG0A 1HE3A 2CD7A 1KPIA 2Y2UA 3W77A 5AW2A 1RQPA 4KWEA 1P33A 4S12A 3WIBA 4D0LB 5TMDA 5IVIA 1DEAA 2VH5R 2FFRA 5C4MA 1I6KA 1QVZA 1RQLA 2PD3A 4TMYA 3D8UA 2H07A 1AN9A 2C7GA 3U3MA 4EP1A 2W83A 2XIQA 3G88A 4N65A 3KPYA 2AEMA 1Z4LA 4HGQA 4KLAA 3E05A 1RBZA 5A3SA 1QPZA 1QF9A 1OLUB 5K8IA 1GP2A 1ZCAA 3UBMA 4DDHA 5CLLA 2E89A 1SUSA 2JKVA 4B44A 2KW5A 5FOVA 1KQFA 1A8UA 2GPSA 3VZDA 2WF8A 3DE3X 5H83A 1H1LA 2VAVA 3E53A 2WAAA 5EJ7A 2KM1A 3Q7PA 5DW0A 3ZN2A 4BVLA 4Z7JA 5TLSA 3PKJA 3TIIA 4Q66C 4K6MA 4QOJA 3OA0A 1XPOA 1BVHA 3M6AA 4YT5A 1J0CA 1RYMA 3P26A 1H9CA 4M8LA 3Q3EA 1SCNE 4PINA 1V8OA 3SBDA 1V0JA 4EPVA 3FZQA 1MR3F 8AT1A 2OXFA 2J5BA 5CB4B 4IGEA 1DDIA 2J3KA 4DR2B 2DX7A 4AIRA 2PUAA 2PBLA 3CLHA 1MOQA 2JA2A 4TWAA 3ZWMA 3HVRA 5KDDA 2FHSA 1GNTA 1LI5A 1Q0QA 2EU8A 2NXWA 3D1VA 3GGCA 4G1EB 4B4WA 2XY4A 4BMDA 1HTWA 3AIKA 4TT3D 4QUHA 4X0EA 4GG1A 1QK4A 2VWHA 3F8SA 4HDMA 3L8HA 4YPVA 5DKFA 3EVGA 4PQRA 3TLKA 2NZYA 1BS2A 2CN1A 3PQ4A 5FP0A 1T15A 3NTOA 3DAFA 1YXMA 1EB8A 4G1VA 3W5SA 2PKWA 3OZSA 1YR3A 2X8JA 4JMPA 4TS4A 5ECGC 4I4TB 4DCMA 1ACMA 1J0AA 5IABA 2BKUA 4OHWA 1GQQA 2BFPA 3KSUA 1Y3BE 5FO0A 4ZZ3A 4OYHA 1QVWA 1XTIA 4NWIA 2RKOA 1SN7A 2ZJZA 1ONSA 1FP4A 4CUKA 3ZNQA 3PPIA 3O94A 3Q6MA 1CR0A 4JYMA 3V2UA 3HDYA 4QDUA 4DNPA 5LLDA 4G65A 3VO1A 2Q1XA 2O06A 3V2HA 4RBNA 5DCUA 1V16B 4WCFA 1GO2A 3BAFA