1PZDA

Structural identification of a conserved appendage domain in the carboxyl-terminus of the copi gamma-subunit.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
271
structure length
271
Chain Sequence
KVAATRQEIFQEQLAAVPEFQGLGPLFKSSPEPVALTESETEYVIRCTKHTFTDHMVFQFDCTNTLNDQTLENVTVQMEPSEAYEVLCYVPARSLPYNQPGTCYTLVALPKEDPTAVACTFSCVMKFTVKDCDPTTGEADDEGYEDEYVLEDLEVTIADHIQKVMKLNFEAAWDEVGDEFQKEETFTLSTIKTLEEAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDTVTMQVTARSSEELPVDIVLASVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Coatomer gamma subunit
publication title Conserved Structural Motifs in Intracellular Trafficking Pathways. Structure of the gammaCOP Appendage Domain.
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis/exocytosis
total genus 67
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2003-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08752 COP-gamma_platf Coatomer gamma subunit appendage platform subdomain
A PF16381 Coatomer_g_Cpla Coatomer subunit gamma-1 C-terminal appendage platform
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1480 Mainly Beta Sandwich Immunoglobulin-like Coatomer, gamma subunit, appendage domain 1pzdA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1pzdA02
1TGHA 1QTPA 3OC3C 3VN5A 5IYBP 1D3UA 1YTBA 4B0AA 1QN8A 4RODB 1QNAA 5IYCP 4ROEB 1MP9A 1NH2A 1CDWA 1C9BB 1QNCA 1VTLE 1JFIC 1QN6A 4ROCB 1VOLB 1QN9A 2VJ0A 1AISA 1QTSA 1KY6A 2MJ7A 2D0CA 1TBAB 1QN7A 1R4XA 3EIKA 3OCIA 1QN4A 1W80A 2Z8UA 1NGMA 2D0BA 3ASMA 4WZSD 4PY5A 1E42A 1KYUA 1QNBA 1QN5A 1QNEA 1QN3A 5IYDP 1KYDA 2D0AA 2IV8A 1YTFA 1KYFA 1NVPA 1VOKA 1PCZA 1PZDA 1B9KA 1TBPA 3HS9A 1VTOA 1KY7A 1RM1A 2IV9A 2G30A 3H1ZA 3HS8A
chains in the Genus database with same CATH superfamily
5MEOA 3J27A 1FNHA 2IQ9L 3OR6A 2Z4TA 2NY5C 1YY9C 5E6SB 3S88L 2WWMD 4WV1C 1MCWM 3I0WA 3KYKL 3ISWA 4NQCE 3NK4A 4PVMA 4DKFH 4OLWL 1OHZA 4K9EH 3WXVH 3VXRA 4BZ1H 3SPGA 4P59H 4FA6A 3Q6GL 2OR9L 3LD8B 1LP9A 4R0LA 3VXMD 2VDKB 4J6RH 5BOZG 3UTTD 1KOAA 1EHLL 3BSZH 1AD0B 3U7AA 3HPLB 2Y6SC 5SWZA 4DQAA 1OGTA 3KL3A 4LKXB 1UOLA 2R1YA 2W91A 4G6ML 2JKLA 3APCA 4MX7B 4TNVF 5FCUL 3SD5A 1NAMB 4M3JA 4HKBA 3CFKA 5DJAA 2J8HA 4BRVA 4KDVA 1CLOH 4PGCA 3W9DA 8FABB 1IGTB 3Q1SL 2NDFA 1NFDA 4UT6L 4LLMB 4M6AA 2ZOKA 1KCKA 5D6CA 5LBGA 3WUWG 1WZAA 1YAIA 3CLFH 2VH5L 3UYOD 3W39A 1I8KB 2ED9A 2O6PA 5JHDE 5DJYB 3IVKA 3MU3A 4IKNA 4BV1A 3QUGA 4OIIH 1MHHA 4LSQL 4PWGA 1A6UL 2DB8A 4CNIA 1QKZH 4MS6A 1SN2A 1ACYL 1LO0L 3I3WA 2A7BA 3T77B 3VSVA 2VRQA 4MXVE 1DE4A 4GRLC 5LBVA 3B3IA 3F7QA 2Y7QA 2CCWA 3D1MC 2AABH 2G9KA 5IMLA 3QHZH 3T3PE 3DSFH 2OMBA 3PDOB 5AD0A 1U8CB 1L0YA 1FNLA 3RVTC 3HPJA 1S7TB 5K9OB 2JELH 3HUJE 3Q0HA 3LN9A 5B3SB 3DWTA 4LDCA 1ADWA 1HCVA 2FWOB 2GCYA 5EEVA 1GS8A 1JI2A 4OH2A 2F74A 3FO1B 3LKOB 5I9QB 3KXFE 1YQMA 4IKLA 3UJIL 1F18A 1UD6A 3Q6FA 4O00A 3VWJA 3LEVH 4X5PA 4ATWA 1M3IA 1RIVH 1SN0A 5BPPA 1JD9A 1R34A 4ZODA 4GO8A 4BGLA 1QFWM 2X6AA 4QHUB 5IQ9B 3ZKND 1GRWA 3WN5A 5IEHB 4DULA 3D08A 4HSQA 4B50A 5MENB 1TQSA 1U8NB 1YPZE 2GUYA 3DETC 1SBSL 3VU2A 3D4ZA 4FXKB 2QSCL 3O9WB 3MRHA 1N3CA 1ZGLA 4ZNCD 2CBOA 4QRPA 3HJEA 3BRGC 1ACZA 4YIQA 1C12A 1RURL 4TVPH 4QLRA 5HDBF 5B4MD 3RL2B 4EQ2A 2CHNA 2B9BA 3UZEA 5H4ZA 3KPSA 4PH8A 4PJGE 3VXSB 4GQPH 3WAKA 4WHCA 3C04A 4WFGD 3VH8A 5CN3A 4DOHB 5D2LE 2IAMC 3CFEB 3U1QA 3E8UH 1NBYA 2UZXA 1MI5E 1LO3H 1S5HB 1UATA 4XPTL 1E6JL 3GM8A 5A16A 1DVQA 5KN5B 1A7QL 1KYFA 4IL8A 1D7CA 2P43B 1W72A 4H0LC 4JY5H 3DOSA 5C07E 1F5WA 1NGWA 1AS7A 3GPEA 4RAHA 3DMMC 3LDBB 4JFOB 4HIEB 3QC6X 4UIKH 5LAPA 3RI5F 5F3HB 4LFHD 1BZ8A 1L9MA 3DBXA 3FCTA 1A7PL 1Q94B 1AACA 2QTVA 5C09A 2WMPA 3GMQA 3BGFB 4K5OA 2ZKYA 3M1CA 4MZ3A 3QUMH 3VJ6B 3WTYA 2WLNA 1CICD 3JWDL 4FQXB 2NOBA 3ZE0F 4XNUL 3AT9A 1L7TL 4NZUH 5D7SH 3U30C 3BOVA 1QN5A 4K07A 1UXSA 5DMKB 1Q1JL 3GYRA 3C8KB 3VWKD 4PD4K 2GSGB 5LKNA 1XSKA 5BZWB 2YN3A 4B41A 4ZS7H 4NKIH 3IN2A 3NDZE 1PS3A 3SBQA 1HSBB 2HRPL 1N6QL 1RMFH 1A02N 4LIQH 1MQ8A 4OB5L 1F45A 1GGYA 4PGBA 1OWRM 2F7IA 3RVWC 4GKLA 3J2PA 3BCFA 3CZFA 3CX5K 1JVKA 1GAFL 3GMMA 1IGIH 5CCJA 3PRZA 4JM4L 3ORJA 1E43A 5E2VH 4Y4KD 3RFZB 1BQKA 1SPDA 5HYSG 3IN0A 2A6DA 4OGAC 3VDCA 2X2JA 5KBMA 4LBAA 4RFNB 2HT4C 1J9RA 3GBDA 5L7XL 3LQMA 4N28A 2DI8A 1JE6A 2E5EA 2VUOA 1PTZA 5CP7B 3MREA 1GKEA 1RK7A 5E8PB 3WTWA 3DURA 3FFCA 3O3UN 4IIQC 2F1EA 1QSEB 4MMYA 1EVUA 1FZJA 1JGVH 2WIIA 3DV6A 1T6WA 1G7QA 1B0RA 2VITA 4RX4A 3V10A 4P5TD 1KPVB 1CDUA 3CSGA 1MFUA 1SHSA 1YYLH 1HQRA 5A2IH 4FLQA 3WFBH 4APQA 1BA9A 1U9KA 2YXMA 2J1YA 2WP3T 3LPFA 3WY2A 4UT9H 1DFXA 4JFPB 1LXTA 1FH2A 2FEEI 4MA8L 5EWIL 3QCUH 1RVFH 1DJHA 4R83A 4Z78B 2K3TA 3CHPA 5EOTB 4F7KA 5JW4R 3D51A 5CMAB 1XXFC 1DN0A 4K7PH 4MDIA 4P4KD 2P45B 2YA3A 1M3QA 2UVEA 4UNTA 2VT0A 5EU6A 1A4JB 1XB6A 4RGNB 3VD4A 1U3ZA 5DFWH 3HJ0A 3VFSB 4A66A 1KELH 1TCRB 3QDAA 2FYYB 4L9DA 3DX8B 2YUXA 4Y88A 2JWYA 3ELAT 3TZVC 3VSQA 2A9ML 2ADJB 1F90L 4WKZB 5CP3A 1HXMA 2VKWA 1RLBA 5KBLA 3GRBA 3A23A 1RJLB 3I6KA 4NNPL 5TK2A 4L18A 3W0WA 4YFLI 2OFQA 1PFCA 4FE9A 4BYHA 5E23A 1UWYA 1SQ2N 2EDQA 4R97B 2W88A 2HKFL 3TJEL 3ARDB 1ZHBB 4FTVB 5C0IB 1DQTA 1A0QH 4OCXH 2XETA 4O2EA 1N4XH 2X3AA 1JGUH 1KV7A 3NABH 3PMGA 5DVNA 2BIQA 5FGCB 2G75A 4OZFA 2H26B 4CN6A 3BAEH 5I6LA 1NDMA 2IWGA 1DJWA 5LQBH 2NOYA 2QHRL 4XE5B 4N8PA 2C3XA 5I1GH 1RFDH 5D7JB 1QA9B 4UQIM 3DXAB 3BXNB 3FTWA 1UWGL 3PHQA 5FOBB 3QFDB 4LOUC 4D3CH 4YBLB 5CEXB 2EIJB 5E2TH 2BM3A 1IFGA 4MTMA 4HJHA 4JKLA 4H8VA 4AW4A 5KYXB 1KCVL 4UILL 2AF2A 4I3SH 2PXYD 1S7WB 4ODHH 2OL3L 4J3OC 3VFPB 4ENEC 2JJTA 2EIBA 3N1QC 2WWNA 1MCOL 1CE6B 2VW6A 1I4FB 4A2FA 1PPIA 1IIKA 1D9KA 4H8WC 1JPTH 1XR9A 4JG9A 1KGCE 3WJLC 1KTDA 3IU4L 3Q2WA 4ZMPA 1VEOA 2X2YA 5D71L 3OLEA 4IRJC 3MRMB 2B9AA 1MH5B 3GXUB 1L3NA 1RZGA 2BJML 3CLWA 3NP3A 1U8KA 2MQ0A 4QHLA 4WWKD 3BPLC 2VDOL 3QI9C 2WXHA 3T6XA 5IOPA 4YHYB 4L4VE 3FFDA 4DUXA 3LKNB 4UT7H 3VU1A 3WUZA 2ITFA 4HQQH 5GRVL 5M7QA 4L3AA 2MFNA 3IJYA 3EADA 3U0WL 3QQ9D 1IAII 2XPGB 4JB9H 3P9LB 5EA0H 5SWSD 4HUVA 2V37A 5KBDA 3CUPB 1P4BL 3SE3C 2X4NB 4PWEA 5HGDB 2KDGA 3QDJB 2ZE0A 5IM7B 2VMFA 4PWJA 2OZ4A 3TBTB 5JZ7D 2IF7A 2XLLA 5FYKD 3MZTA 4I0PD 3KYNB 2P80A 3FUFA 2FHFA 4MCMA 4N0CD 2XI9A 5D8JL 4IRZA 1WGOA 3DHMA 3U4AA 1IAOB 5DQJA 1TJHH 2BK8A 3SKJH 3T4YA 4AVJA 5EOCH 1H8SA 4LCUA 4Y5XC 5GS0H 3JYCA 3VSTA 4Z7QB 1TEFA 1NLDH 3GTNA 1AQKL 3ARWA 5IVZB 3MRIA 5GRJH 4UT9A 1MCPL 1NL0H 5ACZB 1FAIL 1S9YB 4KQ4L 1S7QA 2WLJA 4BK5C 5JW3L 4XCFH 3BKJL 4HBCL 1RHHB 1IGMH 2NQCA 5JOFA 1R3LA 4WI0B 2IMNA 3QFJD 1NOFA 1E9QA 3FMGL 4HF5L 2XTJB 5FYLE 5SX5K 1JPFA 5CJ8A 2X1XR 2E56A 3ULUD 1PVHA 2GJPA 3IMSA 4DHLA 5I6NA 2CHZA 2O3OA 3RDTD 2PLTA 4YQXL 1I7RB 4ZQTA 1VF5C 3Q3GA 3QQXA 4MNHB 4HZAA 4QXUL 3EDJA 2IFFH 2JTYA 2CJUL 3IRZA 3QQDB 3LZOA 5C71A 3WNIA 3FONB 4WEEA 1YECL 1MHCA 4PJCA 1ZT4A 2X9WA 3KWVA 2YPKA 1RK0A 4J39A 1Z0NA 1N5YL 4PP1D 3CFJA 4I89A 3DUHA 2JE8A 1CDJA 1RJZA 3GSRB 3QH3B 4K7PX 4LRNH 3ECBB 3JWNC 3IH7A 5JPMA 2QQQA 2FQGA 5EO9B 4M61B 5EUOF 2Y7LA 3S3JA 4N3TA 4Q6IC 3DO7B 4N24A 2VDQH 1KBVA 4JFDD 4U0QB 4WU5B 4BK8A 4MJID 1RZIA 2P8PA 1F11A 3HOGA 4KI1A 2VGLM 4NQSA 3NA5A 1IVLA 1NKGA 4XH2B 1GMEA 1QABA 3E1ZA 3PWPB 4V1DB 5IMMB 2FQDA 3EBIA 2WUBH 5DUBA 4FXGC 1OM3H 4PGDB 2HG0A 1TNMA 4LSRL 3BMVA 1F02I 1OAUH 4BFFA 3X3FL 2YPVL 4QR7A 5DJZA 1WLHA 4L1HA 5DGQA 2C1OB 3AREA 3C2AL 3ILEA 4Q9RH 3MRDB 3SE8L 3D30A 2DQUH 2G2RB 4OZ4B 4AXWB 3CZKA 2BRRL 1P84J 2Y5TB 2WQAA 4LCCA 1G6RL 4MCZB 4XWOD 5EIQA 4CKQA 2Q9OA 1R3IH 3I74A 1IC4L 3DX2A 4R4ND 5EU4B 3TO4A 1UUSA 1OP3K 2AKRA 4GKSB 2RBLA 2JK5B 3CC5A 3PDDA 5F1NB 5IVXA 2DMKA 3MRBB 4YHNA 3REWA 3QXTA 1QWUA 3T2QA 5ALBH 3HMWL 1SQMA 2YA2A 5E6IC 1NCDH 2VERN 5IHUH 2YAOA 4WFFD 1R3HB 4PRPD 4JFEA 4CN4A 5FPIA 2WZ0A 3FYEB 3ZY7A 3FQ2A 3GI8L 5DUML 5HHXH 5C0BB 1NZRA 4RBPK 2AQPA 2BC4B 4Q56A 3GMNA 4U1GB 1NICA 5CCKH 5HXMA 2RCSH 5I28A 1VFAB 3HE7C 4M7ZB 3FU5A 2EKSA 2YGOA 4NNYA 1JZ4A 1F4XL 4PJEE 3VXNB 5DEGA 3TV3H 4AE1A 4K8RD 2UUDH 1HOCB 2CBMA 4PGJA 5B39A 3C6EA 1W8NA 5GS1A 5L6YH 1WBXB 5F7NC 4G43A 5B1JC 3U2IA 4FKKA 2IADA 3U4KA 3NACL 4ZYKA 1MCRA 2QDVA 3O45A 2XUWA 2GJZA 3IXAA 4CVUA 2HFGL 4PRHA 1AXSB 3WHE1 1HHKA 1CO1A 3EG9A 4Y2DA 2XWDA 2FJFB 3LIUA 4JDVB 4N1EA 3OG4B 4LPCA 5AUMA 5I8EA 5KW9H 4JGMA 4ZNEE 3C5ZD 2I9LA 4E9SA 3IJEA 2JKRM 5EU5B 4ETYA 3CVIH 3QJZA 4IU2B 1QRNA 3QR1A 4PJIA 4IEFB 4KAQL 4X4ME 1E4KA 2YXVA 2GPZA 3U7YH 3IJSA 3GLAA 3RZCA 1CD1A 2NRDA 3FCUB 1QZ1A 3LMJL 4OJFH 2VAJA 2PP9A 2H3NA 4JHUA 3JWDC 4MA7H 4J3OG 1WITA 4MQXD 5JXAH 1MJUH 2NNRA 4NQCB 4XVUC 5AVZB 3TFKC 4B95C 2HPTA 2VZOA 3UP6A 1QLRA 3VGFA 1G7PA 3FU9A 4NN7B 4JM2F 3FU7A 3SPVA 3BH8A 3U1PA 1XL6A 1RQ5A 2HLEB 4OCRH 3MKKA 4XN5A 1MFVA 1OSYA 2X10A 1Z1WA 4FMFA 5D93B 4G8IB 4LEEA 3CFIC 3WFDH 3V9EA 3LNFA 3RTQB 4FABH 1V7NL 4HYTB 2OTUA 5EOQH 3HCVB 2WOBA 3O8XC 3UYRL 1B4TA 2WBJD 1UJ3A 3NFNB 1EIBA 2J1WA 2XFXA 4YXLL 2O72A 5LGHH 4MQTB 1WG3A 4MAYC 3STBA 2NY6C 5J13C 3H56A 4N0UB 4EI5A 2P5WA 4LIQE 5E4EC 1OOAA 1N5AA 4YDIH 4ZSOE 5LBSH 3A47A 3F12A 3B9DA 4ZXBD 3EGSA 4APXA 2H5UA 5I16A 1QW9A 5IESH 4OV5A 2BSSB 4LXFA 5DD6A 2DWSA 4UQ9A 5BZDB 2LU3A 1WF5A 2XQBH 4YE0A 1U33A 1Y07A 1J1PH 1T20B 4ADIA 3AACA 3QORD 5HHNB 1I53A 1H8OA 3NZUA 3TNNA 2Z31B 3QR0A 4XT1C 5DRXB 3KWTA 1J8HD 3CDFA 2PPDA 3RIKA 4PEEA 3LS5L 3T0EB 5HYSB 3ME0A 3VQ1C 1K72A 1B3IA 1EA9C 4GQ9L 4JQVC 1J9QA 4EKJA 3KG5A 5JHLL 5EZIH 5FFGA 2P48B 4KRLB 1X9UA 4G9DA 4HT1H 1CTNA 1AO7D 5IYDP 4WW2F 3TC9A 1IRAY 4XHJC 1W0VA 3TEUA 2JIXB 2GSMB 6TAAA 5LVEA 3L13A 3KL0A 5DS2A 3TA3D 3OXSB 3B2PA 3MV7A 1D5XB 2HH0L 5EB9A 5F9JA 4B5EA 2EAEA 1XGYL 3I02A 4Q14A 1BM3H 2AMGA 4PJFF 1IM3D 1RUMH 1GZQA 2VKXA 2IH1B 4L4TA 5JPNC 3ETSA 1MHPH 2P8LA 3VFMA 2Y7MA 1MFCL 3DX1A 2NLJB 2VLME 3LKSA 4CJ1A 4H1LG 1JXDA 4U4BA 5B22A 3G6JA 3N43B 3PGFH 5E2UH 4OTXH 4MNGE 4Z7UA 1RUPH 1U6AL 2VM9A 4UDUA 1J5DA 2QADB 4YHIB 1U8OA 4D8PB 2VABA 3MNVA 1NCGA 4AZUA 3KPRB 1J1OH 4E41A 1HHIA 2WTPA 5KUMA 4XBEH 3ULVE 4LDLB 2QEJA 4UZSA 3ATDA 3WIFB 4NKQB 5C0FB 3FCBA 2DJUA 4JFHE 3TCTA 2AP2A 4RZCA 2Q2EB 2VAAB 4WV1B 1TMQA 5MHSE 3A22A 3OAZH 5EDSA 4XMKL 1HS6A 2V2TB 3BHBB 3LQAH 1OOWA 2DH3A 3HC2A 3H2PA 1QNBA 3FT0A 4LLQA 1CVSC 1OAYH 3TVMD 3S4SG 1B0GA 3RBGA 3U46A 1IEAA 3QO1A 2GTWB 2L7EA 4ZAKC 3PFUA 3VXMA 4HWUA 1U91B 1E65A 1BD2E 2YXFA 4H0HB 2XWJB 1ONQA 4OFKA 2YMOA 2XDHA 3O0RL 2H3XC 3QZPA 1M1XA 2BP0B 1E3FA 2UY7B 5ESQA 5E9DA 2NXZD 1BV8A 3U4EA 1CBJA 5DFVD 5L9DL 1HK6A 2L3BA 3M07A 5K9KB 2CLZB 4U1IA 1EO8H 1MCEA 1OTUD 2CCVA 5GJSL 3EOBA 4NKOA 1ZPUA 1WA2X 3E9UA 4R5TA 3OB8A 4D94A 3MRPB 3CMOL 2W38A 4M6NL 1KWGA 2ED6A 4GW5B 4OFIA 4YDJB 1KLUB 1INDH 4LGSB 1QMUA 3L4XA 3KLAB 4R3SB 1A1MB 3ZO0A 3AJ7A 1HNYA 2C1PB 3ZDYB 1EDHA 4X99A 4FFYH 5ID0A 4DT2A 1QBLL 4U05A 4PJ8C 3ISYA 2Y23A 3NCCB 4GRLB 2R0ZH 5E00A 3RHWF 2BSTB 1TCMA 4KO6A 3AFLA 3LZFL 1OTTD 1JNLL 3CAFA 1SFDA 4HK3J 1OW0A 3JSSA 4X83A 2PPCA 4LCYB 3WLWC 4IOSD 2VLLA 3JV0A 4AQEA 2DIJA 3CBRA 1CL7H 5E5MA 3ZUCA 1FFPA 1RZJH 2IBGA 5D70H 4A63A 4CC4C 2JJUA 2EDRA 1NANI 2CHDA 4XAKE 1ZLVK 3R19A 2WW8A 4G8EB 2MH4A 2H1PL 2R0LL 4U6TA 4BFOA 4NC2B 1WYJA 1QI4A 5FKAB 3FO2A 4OBRA 5CLZA 1D7DA 2J72A 1EUUA 2BVEA 4W1TA 1UM5H 4RGMC 1EJ6A 4XCCL 1A4KB 4ZW3A 1HINH 1DQJB 1DZBA 4A7SA 5FECB 3FS9A 2QGCA 1KJVB 4WUKL 2YLKA 4PQXA 2AEIT 3PHOB 4FNQA 5FW7A 1QLEL 2HSIA 3CFNA 5J9PB 5ITFA 5DVKA 3QHFL 4NGHH 3EUDA 3VD0A 3ARGB 3ZW3A 4NP9A 1NGZA 2VRKA 2XWEA 3MLYL 1DBJH 4HCIA 3GPSA 1NEUA 2DQHL 3RVUC 3EYQC 3EH3B 3OGCA 1MP9A 4EAIA 1IAKB 1X5KA 2CQVA 4PVNA 1H9DA 1SJXA 3ABMB 4LL4A 5TFSL 2OMUB 2OXGB 3SDXA 4EJZA 5J5EA 5JYMA 1ND0A 2WQRA 3W11C 2HFTA 4GXVH 2DLGA 3X12A 5T3XL 2IAMB 1LYQA 5AOKA 3QARA 3ZX1A 5D72L 3GXFA 1EQWA 3GIZH 1XQ4A 3H9SB 1N70A 2G3XA 4KGJA 2YRPA 3UBHA 4NO0B 4KZDL 1CLYL 1ZHLA 2H41A 5DRZB 3LHPH 1NCHA 3C6LD 3DMMB 4P46C 4AGQA 4F27A 4KPHL 3L3HA 1E3XA 3OKLB 4PY7A 1MWAB 1WDAA 4JPIA 4TF4A 3MLXL 3O6KH 4J8RA 1MRCH 2PO6C 4FNTA 4YO0B 3A6CL 4JLRB 5CBEA 3D25B 2QSTA 1BPVA 3FB6A 4JFFE 3U30B 4HKXA 3ZKQD 1MRDH 1OV8A 3C8DA 4WW1A 3VO0A 5JW5B 4PG2A 3VWKA 3ULXA 5IUSA 4O4YL 1CVRA 5TDPB 3IU3B 1K5NA 3D2TA 4QXGH 2VSCA 2AEPH 1KEGH 1MUJA 3L3DA 2ITDB 3U48A 4WK4B 3O6LL 1FIGH 1A6TA 1S7XA 4C56D 1XB8A 5C3TA 3X3GL 5LCVA 1GHFL 3U2SA 1HI6A 1JGLH 3H53A 4ZFFB 5ES4B 3OG6B 2XZZA 4ILDA 3U9PH 1JUFB 4LLVB 1JYVA 1WFIA 1DQDL 4XBMA 3QDGA 5KVGL 2BXZA 3TX4A 1AMXA 4WHTA 4E9TA 1JV5A 4I3RH 5I0ZA 4OCNC 4K94H 1Q9WB 1F8TL 4FFYA 4OLVH 4LDOB 4CMMB 1EGJA 1I3VA 2WD0A 3QRFM 4L4VB 4IIQB 3B37A 1MLCB 3K1DA 1AISA 1ZSDA 1SHXA 1PDKA 3TJPA 5DEJA 1YEIL 5J1AB 1HIMH 3UL4A 3VXUE 1CCZA 2X0VA 4ORGA 5KANI 5DMIL 2CRYA 4U0RC 3VVVA 3TURA 1TT6A 1BQRA 5GHWH 4LHJB 1HN1A 3RBSA 3RRQA 5I75C 2X7LB 2FL5B 2NYKA 1KB5A 4H5SA 2VW4A 35C8L 5DMJB 1ZK9A 3P3SA 1IBZA 4B9CA 4HEME 4HKJB 3C2SA 4FQLH 3M88A 3TBYA 3BWAB 3NPZB 4HJ0C 2CAKA 4I9WD 2K1MA 5EBWB 3X2QB 5B3NA 4KZCA 2C5DC 3L3IB 4ABVA 4P4KA 1LK3H 3LEXB 5L8LB 1K8DA 4NRXB 3FQTA 5HI3D 2DQ6A 2KLSA 4A6YB 1A7RL 4KKCD 5CUSL 1OALA 3ULUH 3EHBC 5BV7H 4B9GA 1UG9A 3TZVB 4BCXA 4JY6B 4ZS6C 3LEYH 2VR7A 2FGZA 4J3XA 2D3LA 3ZHLA 4H2CA 2E3VA 2QR0A 2XYCA 3MOBL 4LHQB 4PB0L 2HTKD 4XMXA 5ESVB 5HVWA 1NCBL 5IJVB 1CI5A 3UMTA 1K9TA 3L17A 2EYSA 2VXUH 5DJDA 3CVHH 3ZZQA 1CDWA 3U36B 1IKNC 1BZQK 3DVGA 4ENZA 5F44A 4EN3C 4R7LA 2G2PA 1HJCA 5DRNB 5DJXB 1FNFA 2LW3A 3FRPG 3MLRH 1AY1H 4YSUA 1I9EA 4C47A 2CM6A 3QC5X 2Y36L 3VXOA 2BNQE 1HL9A 3EO1B 5KYYA 3OHXA 2R0WL 2WLMA 3TEXA 3MOAH 1HHJB 3PJLA 1T6AA 4V33A 5FUCC 3ASOB 3L1OH 5AG9A 1JWMA 4DO6A 4MS8D 2PWFA 1QI3A 3PWNA 4HS8H 3VXTA 3NEOA 4JHWH 4F8OA 1K6QL 4BH7B 1KYOJ 4JFTA 1XIWD 4PJ9D 4Z95H 4HFUL 3E8VA 3P2DA 2PTTB 3DVIA 1AQMA 4LT7A 1XBDA 5CJXA 4GXFA 4FGMA 4GBXD 1T80A 4WRLA 4JFUA 1EEQA 3HR5A 3ARBC 1EPFA 4PIBA 1RULL 2EUXA 1DQLH 1ZIAA 4GFTB 2EZ0C 2H47C 4OZHB 3QW9A 5EPMA 4IRJB 3HBPA 5I1CH 3DJTA 3HZYA 5DYOA 3HNSL 3QS3A 1YCSA 5IK3B 2VLRA 2A5UA 4HPYH 3SJVD 3C5SB 3BPLB 1KC5L 2EXYC 3QI9B 5TQ2H 2YEZB 2ZCHL 3UTZB 1AQHA 1X5HA 4MVBC 4FEIA 1C5DB 2YWYA 3OKMA 5I6MA 3RWEA 1KFGA 2R69H 3K46A 4NYLB 1KTLA 5ICXA 5B1AB 1M7DA 3MO1A 4PJFE 4ZMVA 4JHAL 3RKPA 5F1OB 1AR1C 3BUYA 1N10A 5FHBL 1XEDA 2J4WL 2IBZY 3K91A 1J5HA 1PF3A 4P9HH 2ADFH 3S97C 4KKNA 5IBTL 4B9IA 2W07B 3OQ3B 1ZA3B 1CDGA 3GJEB 4PWFA 4GG6F 3APNA 3TH3T 3T09A 3HBQA 4I4WB 5CZVH 5IROA 5IW6A 1I8UA 1HZHL 1T7XA 4QCIA 5IWLC 5E8NB 2AJ3B 4I0PA 4YN3A 5E6UB 3SDAA 5FHAH 3SKMB 1QN4A 2Q8AH 1J48A 4K8RH 4J3TA 1P1ZA 2NTFA 1FSKC 3GXDA 4ZD3H 2IV8A 4Y5XB 2WXNA 3HKFA 1GIGL 3H54A 4OUUA 3TYGH 4RRPA 1SHWA 4PJEB 3TIDA 2BOCA 5TF1L 1UD3A 2ZWZA 1SJEB 1D3UA 4W9ZA 1KV3A 5TDNA 3APFA 1COBA 3F8UB 3IFPB 5DZNA 4MXQD 4PJXB 4G5ZL 4KNSA 1UCBL 1THAA 1R1CA 2DQGL 3IEAA 3W2DH 4O2FA 3L8QA 4Y1AD 3QFJA 4EOWL 2IOOA 2XG5A 4FFWC 5ISZB 3ZHKA 1OP4A 2VM4A 2Q6WA 3T3MF 1S4IA 2AXHA 3L5XH 3KLHD 3R1GH 2QQKH 3FSWA 4NDMA 4ZMZA 4MD0A 1IT9L 3T8VA 4UTAA 2JOIA 3ARVA 5ICUA 5EO0B 5EEYA 3MRNA 4PJDF 1AGCB 4H1LB 5KANG 4L3ED 2NXYC 3ILPB 1MREH 5HVGB 5DUPL 1MW3A 3QUZD 1V27A 3QNZB 3EAKA 3P0VH 4GPVA 2Q86A 5DZVA 3IDIB 1YRKA 3S98A 3H9YA 2Z92B 3QJQB 2ZYRA 5JO5B 4IKJA 1MCIA 3VA6A 5BUGA 4YSAA 4Q9QH 2D3VA 5KSAA 4LK4A 4Q6IB 3QEUA 1AD0A 5C08B 3U6RB 4G11A 1CK0H 4LKXA 3ZE1E 3K71B 3I9IA 3OKDA 4MWFB 2QJDA 1L9PA 4C83B 1T5WB 4J4PD 3QCVL 1IAIL 4YX2L 4MMZC 3UJJL 3NTCH 4EE2A 3MCLL 4LLYA 3S3PA 3S4SB 1A3LH 1HAUA 4FXGB 4LLMA 2O5NA 3UX9B 3DGGB 3LNGA 2GUOB 5ECGA 3S5YA 3CSPA 4LPYA 5DTFB 3UAAA 2FHCA 4R90L 1XF5A 4OLXH 5IQNA 3EYSH 1T1YA 3GSNH 2QTEA 5IGXH 3WXVL 4IJ3C 4K9EL 2YSTA 4ZUSB 2R2HB 3X1GA 4BZ1L 3WS6A 4P59L 4AM0B 1FA4A 1QO3B 1YEJH 5TQ0H 1SXZA 4FG6D 3MRFB 1IILE 3FUHA 4J6RL 5CHNA 5FDYA 3BSZL 1MXDA 3F5WB 3VYNA 2VN4A 2WLYA 3PDOA 2G5BB 4EBQH 5BJTB 2GJ6E 3QO0A 5E6IB 3VUAA 1U8CA 4CVXB 1AQDB 1S5IH 2YRBA 4HJGB 5DURB 5F70A 1S7TA 3GO1H 2AZUA 1CLOL 2R69A 3IDJA 5MERA 4I2XE 2BP8B 5LXGL 2LR4A 4XCEA 4G1MB 5DK0B 3LRGA 1FYHB 2WYZA 2XPYA 4IGBD 4N0FA 3BIKA 3CLFL 3TLRA 2APSA 3FO1A 3LKOA 1OQXA 3HE7B 4DK6A 4KJYB 1UT1A 4OIIL 3E6FA 4ZO9A 1AE6H 1EEUA 4HIIB 4KKPA 1IEHA 1QKZL 1W0YT 1AS8A 3FH7A 5CJOH 2F61A 4F20A 5IQ9A 4QHUA 3QJFB 2ALWA 5DHYA 3GBMH 3N1PC 2OOYA 2NY4C 2VYRE 1JXKA 3QNXA 4XBGB 4ZQKA 2AABL 1E5AA 3QR2A 1U8NA 3G9VA 3QHZL 3DSFL 4LL9A 3ATEA 4KH9A 4AENB 1KIPA 2LOEA 1WTGT 1YVLA 3MNMA 4KK8C 4A39A 2JELL 3RL2A 3MUGB 3P11H 2WKGA 2R2EB 3VXSA 1UENA 4UAHA 3QXVA 3UYPA 4NI6A 1ZT1B 2XVBA 4P3CH 4LNVA 2OV0A 1JYXA 2Q2LA 3EYOA 2Q5BA 1GGBH 5D1QE 5BOJA 2CM5A 2PWEA 1U41A 1U8QB 3WD5H 4DGUA 4XMWA 3VFGH 3L45A 3LEVL 3U0TA 1SN5A 1RIVL 4ZMWA 4NZDA 1YMHB 4JMNA 1NMCC 4XR8C 1AGFA 3T8MA 4JFOA 3QG7H 3O2VH 4NM4H 3LRSA 1UB6A 3NYKA 2E7DA 4POUB 4MRQA 1DJSA 2CUHA 1O7VA 3PF2A 1O5PA 3TT1H 3UTPD 3K6SA 2CJSA 4AE0A 4YXHH 1AP2B 2B39A 3L3GB 1H3VA 4QRRA 5IVNA 1QPKA 1M57B 1NEZG 2FEDD 4TVPL 1I1YB 2BY2A 4G42B 2EC9U 1VGKB 2ESVB 1T0OA 1GS7A 2GTZB 3LHAA 2GSGA 4MMXB 4FMVA 2PYFB 2ZOUA 1SDYA 4QRQA 4RWYH 2F7LA 5BZWA 3O8XB 1PD1A 1UOWA 2Q76A 5HJGA 3E8UL 2BVUA 3MRLB 5A6IA 4HS6B 1HSBA 3CPUA 4KMQA 5GZOD 1LO3L 2NY7H 2X4SB 1T89C 4MAYB 1DJGA 1KEMH 2NY6B 2NZ9C 4JY5L 5IG7B 5FYJE 1F2QA 5AVXB 4F2ME 5I0VA 1SM3H 3OV6A 5E4EB 3D0AA 4UIKL 4DTGH 5DZOA 4JRYE 4X6DB 5A7EA 4X80H 2J56A 1W80A 4Y19D 5T1KB 2QRCA 2VLJD 3US0A 4KRPC 2H4EA 1KYDA 3IWVA 3QUML 2WN2A 3US9A 2X40A 5AKSA 3RY5A 4F7PB 2DEYX 1JVOA 4S1QH 5HGAB 4GLRH 4NZUL 5D7SL 2YRZA 5CP7A 1I85A 4LSUH 5C6PB 1QSEA 1MAJA 2K6WA 2MNJB 4ZS7L 4NKIL 4WI9A 2R83A 2HLAB 3RURA 3I50H 3BD5A 2EIMB 1RMFL 1KPVA 1EFXD 1NKOA 4GSQA 5CD5D 3ZDXB 5FYKE 5E5LA 4N3UA 1YN6A 3BZDA 3AS2A 4KZ0A 2C9RA 2P52A 4OD1H 5D5MA 2X6CA 4JFPA 2Y72A 1AO7A 1JERA 1SDDA 1EZSA 1TTRA 1ZRUA 2O4EA 4FQHB 5E2VL 3HR6A 1ROCA 4U49A 4OCLC 2JLLA 1SEBA 1AYRA 1D7FA 3OKNA 5G5DB 3TA3A 1CGTA 2VC2H 2WQ8A 1H5BA 2ATKB 3P9MB 5JPNB 3DYOA 1E27B 4JQXA 4U3SB 3M6DA 2EDMA 5E24E 2H2PD 2N7SA 3KPMB 4TNVK 1CYGA 3IDMA 2FYYA 2C3GA 3OR7A 3NZ8B 3IWUA 1JGVL 2XQ0A 2YD4A 4ZMTA 5HI5C 1JNHA 2ADJA 2YO3A 5IMOB 1ZGLP 4QHNB 3MJ7A 4ZFQA 3ZTJH 3SYCA 4PRID 1JWUB 4K5NA 4PWIA 4JCWA 1RPKA 1YYLL 4U4IA 5E8EB 3WFBL 1QSFE 3DYPA 4H7VA 2B16A 3MRJA 3NQIA 2DKUA 2RGSA 3UTSB 4CBZA 1ZHBA 2K9FB 3L1GA 4MB5A 4UT9L 5GRXG 4LESA 4Q58C 4GAGH 3BFOA 5F7AA 1SXSA 1JI1A 3QCUL 1RVFL 1JNNH 1XX9C 4OV6F 3DIFB 3N9GH 4MYPA 4F57H 1TVBA 2R29A 2H26A 4P4RB 3D4CA 4S1SH 3VFTB 4AKQA 5JTWA 4L23A 1E5BA 2XT1B 2EECA 4K7PL 4YEFA 2X9YA 5FX3A 5EO1B 3WJJA 4RDBA 3HAEH 3NRPA 4RMQA 5T1MB 2MCPH 1QA9A 2X9XA 2B14A 4TTDD 5D7JA 3TVMA 1KELL 3DXAA 4ZAKB 3BXNA 5FOBA 3GI9H 1H8LA 3QFDA 5KOVC 3EYVA 4JFDE 5E8DH 3K1KC 3L1EA 3H2WA 3FRPB 1WICA 2D8KA 1AYOA 3S3SA 4KJQD 4GEIA 2WZ6A 2GC4C 1V3LA 2D0BA 4BKLB 2ZUTA 1HE7A 3AB0C 5B1CA 1A0QL 1I4FA 2I69A 3BQVA 3OWEA 4HH9A 3L54A 4OCXL 5F1IB 1N4XL 4POZD 1JGUL 5DS8B 2IAND 4FA8A 3NABL 4W9JC 5F96H 2EABA 2XWZA 1HCYA 4HWBH 2YJLA 3U9UA 2MHAB 2PCYA 3BAEL 2VDOB 1IBDA 1P5UC 3G5XB 4YDKH 4IOIA 2WBWB 5LQBL 3UH8A 1GC1H 2AQ2A 4RA3A 2VZSA 3ZT5A 1ULVA 3X1FA 4PJ8B 1RFDL 5I1GL 3UO8B 1UWXH 3LKNA 3Q9PA 4D3CL 3LSOB 4Z7VF 5T3ZH 3SDCA 3S5LA 2LU4A 3WSQH 1N8ZB 4BXVA 2X89D 2XPGA 2V3DA 3EFOA 1QHOA 4I3SL 4CILA 9CGTA 2X4OA 4KMLB 5I74C 1C4GA 3ZRSA 2X4NA 4ODHL 5K33A 4HOXA 3QDJA 3WHXB 2FBRA 4KTEH 5BS0E 5IM7A 3VW3H 3TBTA 1HESA 2FT7A 3CD4A 2TAAA 3COOA 4HIPA 2KZ1B 2HVBA 4BFBD 1AKJB 1Y0LB 1JPTL 1BQSA 1WFMA 3WS3B 5F7KC 5GJTH 3ARTA 3R0NA 5D1XE 3T04D 3T3ME 2FGTA 3EJZC 4RGMB 3RI5K 4HS3B 3KWXA 2HL8A 7TAAA 4BFGA 3S8WA 2Y22A 1G1YA 2W8CA 5HHMB 5C97A 2B1HH 4PJHF 1KIUB 4TQPA 5IVZA 4F9LA 2AFNA 5JW4M 5ACZA 5B7FA 1P6WA 3D3VE 2JCCE 3HS8A 3LPOA 1KT2B 3PAUA 1A6PA 2MOVA 1ZMYA 4JB9L 5GRZA 5EA0L 2ZP8A 1PW3A 1UH2A 3BAIA 3VWJC 3D52A 1PU0A 4UBDD 4HP5A 3MLVL 1JS4A 4G7VL 4YAQA 4QGTA 4CW1A 3FRUB 4MNHA 4PV9A 4Z77B 2C4FU 5BQ7B 5ESAA 3W5MA 5L2KE 3QQDA 4XPGH 1RI8A 1TJHL 3SKJL 4NQDE 2ZXQA 5EOCL 2GEEA 3KPNA 5GS0L 1U36A 1A1OB 5FAAA 5FUOH 3CCHB 4P46B 1NLDL 4E0RB 3LN5A 2VR5A 1G1OA 3D48R 7PAZA 1G9HA 3UZEC 5GRJL 4OZIB 1NL0L 3QH3A 1CQYA 3EOAB 5EG6C 3HI1A 4JDTH 5CJQH 3P4OA 1SVBA 5CSGA 2TSBA 4XCFL 5GGSY 3HI6H 1IGML 3MV01 1V5SA 2WKOF 2F53B 2BSDA 4M61A 5BO1H 2PO6B 1MPAH 5J4MA 3HZMA 4JZNB 4M6MH 4TUUA 3VXRE 2HFEB 1NC2A 1TO4A 1SMAA 5T1LA 3DV4B 3VDAA 2FJGA 1LP9E 4Y5VC 1JZ3A 1I1CA 1TKWA 5FIEA 4XH2A 5IMMA 3PWPA 4ZTOH 2DMBA 4HGWB 4PGDA 2H32A 4WI3A 1J87A 2IFFL 2X4RA 5SWZE 3VI4A 4JX0A 2YA1A 4XPAH 1HOEA 4HGKC 1K2DB 4K9EC 3DUSB 2DJMA 1I7ZB 3Q2LA 3IDNB 4PSRA 3DIVA 1G6RB 3PGCB 3WV0A 3BVUA 2G2RA 1NFDE 4OZ4A 4AXWA 2DQEH 3FN3A 4LRNL 2Y5TA 3CH1B 1Q9KA 3KWWB 3HG4A 2PCXA 4MCZA 2ZUYA 3D7QA 1BYOA 2ODHA 5HHQA 2ROXA 4I0CC 5KBPA 2NX5A 4HD9A 4X5WB 5AVTB 5E51A 5DF0A 2C3VB 2GG1A 4UM8B 4X0KA 2PTVA 2VDQL 3BUDA 4GKSA 2ARJQ 2DQIH 2JK5A 4L1BA 1C1EL 1NJ9B 5F1NA 5FA3B 4ZW5A 9PCYA 2NOIA 3X1BA 2CE6A 3VYOA 3ZKMD 3GNMH 4LOEA 4MD4B 1WPCA 4YH6A 3GBEA 4OJYA 1QFPA 1NPNA 5CLTA 4FNSA 1J8HE 5CEZD 2DI7A 3SHSA 3AY4C 2WUBL 3VAEA 1OM3L 2VO8A 1B6UA 3FAXA 2FWUA 3K5RA 4I7ZC 5D1ZA 1OAUL 1TMCB 1YEDB 4FNLH 4U0RB 1VFAA 1KSRA 4Q9RL 5I75B 2DQUL 2XXFA 3VXNA 2NNAA 1ZEAH 2G5RA 2UZYA 5DVLA 4A2HA 4BUGA 1HOCA 3LIZH 4O02H 1R3IL 2Q1EA 2HPOA 4GFXA 5F1KC 4QOKD 5I1AA 2VW7A 4KFZC 5D7IF 3LN4B 3AAZB 1WBXA 3HZ3A 3OX8B 3UABA 3PHAA 3WIAA 2HG5B 4FJYA 5EF3A 3B9KD 2VERA 1DVFC 4APQC 1ECYA 3GSVA 4OBSA 5ALBL 1YDPB 4M1DH 2ZJSH 4HEPG 3FO9A 4Y1SA 2WLLB 1NCDL 2X2IA 5IHUL 4O2CA 2VLKB 1CXIA 3EHBB 3L7FA 2FJFA 2VZ1A 4JDVA 4QYAA 4FKEA 2WZPA 2OMYB 3OF6D 1JF5A 4RSYA 5HHXL 4LEOA 2ZX8A 1TIUA 4OJAA 1YEGH 4OFYD 5C0NC 3ZN6A 5DFAA 1G94A 4TVUA 5IJCC 1BG1A 1HJBC 4QRPE 1BSIA 4LVOC 5CCKL 2RCSL 3EDDA 5KSUB 2EEDA 2J43A 4EN3B 3QQ4B 4OAWB 1LEKA 1K4CB 5DJ2A 2Q87A 1T7YA 4HJ1A 2YMTA 3TV3L 2OR7A 1Z9SB 3BWUF 1ES0B 2GVYA 4YOKA 1BBJB 2VISA 4J3BA 1S9KC 5JIKA 3DROB 3GS4A 1F3JB 3QJSB 5L6YL 1XMEB 3E6HA 2VIRB 3NDYE 4PLJD 4PW3A 3L5IA 5EZJB 2DKAA 3D6GA 4DP6X 2X88A 1R5WA 1KN2L 2EDXA 5A3IC 4OD2B 4OT1H 3IDGA 5KG9A 5FA4B 4FQJH 3L2NA 4NRYB 1T0MA 4PJAB 5ID1B 1AOZA 5KW9L 1M2OA 5C09E 2CWRA 4N90D 1LVEA 5CCGE 3TBVA 3RTQA 2XN9D 2UWEB 4TL4A 3RP1A 1LQSR 1YJDH 3AS1A 2BNRB 1IJNA 3UPRB 3HC3H 3NFNA 2H8PA 2Z0FA 1NDGB 1I7UB 1MWOA 2PCPB 1QYGH 3ARBB 1MY7A 4GXUN 3O11A 2B4CC 2VTFA 3U7YL 4A55A 3X1EA 1LWVA 4P2RE 3RVVD 5FEBA 4N0UA 1VESA 5EZPA 3AS0A 2D3JA 5F9CA 5HDOA 4BINA 5EF1A 3L3OA 2XZQH 1IM9B 1L6PA 3IMTA 3KPOB 1ETZB 1OAQH 4MA7L 5FW8A 2FIKB 2MWCA 1WAAF 5J6HA 3I9GH 3FB8B 5JXAL 1MJUL 1KXTB 1UA3A 5I76B 3KBPA 2RJMA 4EUPB 1TQUA 4ZX6A 1KCBA 1T20A 4OCRL 1D9KC 3AM8A 4A7TA 1ORQB 3G3LA 3WFDL 4NQXB 3H6JA 1AR1B 2P7TB 3RL1B 4HA1A 4FABL 2BOBB 5EOQL 4BFNA 2WAQA 4OCMC 4N6RA 1AZUA 1N2RB 3PGDA 4ERSH 1M7XA 3DX6B 3B1UA 3SKOB 1OCCB 2CO6A 1XF3B 2E9WA 3D2UB 4W9EC 5LGHL 3FFCE 5GS3A 1LEGB 2AI0L 1YA5A 3D85A 1HCFX 2CIIB 4WK2B 4XXWC 5B3JE 2N56A 2H1LM 5E99H 4YDIL 3MV8D 3EOTH 5ANME 5LBSL 2JIXA 5DZLA 3DECA 1FSKB 3IDUA 3TYFB 3UBXB 1BIHA 2JKXA 5DMGD 1D5XA 1CXEA 3CFUA 4AIOA 3V0JA 4AH2A 2XQBL 2XYBA 3MUZ1 2DY2A 3RWFB 1U3HD 1J1PL 1PL3A 4PJ5B 1AZVA 1ZY9A 3RUGA 3LIZA 4Y5YC 1GYCA 2BSED 4ZUTB 1EAOA 2MCMA 3TONA 3QE5A 5C0GA 5I2IB 1YY8B 3S8FB 3AQZA 5MEND 3FU0A 3GXPA 1NDTA 3PL6D 3P2BA 4GW1A 5EU6E 1YC7A 2FBOJ 4YBQC 1C9SA 4NBXB 1KCRH 3BJLA 3C8HA 5TDOB 1IFHH 2XRAH 5EZIL 1WT5C 3E9TA 4KUZH 4YHIA 3VH8G 2AK1H 1PNDA 3KPRA 3L95B 1B9ZA 5MI0C 1E8YA 2F15A 3S3CB 5C0FA 3LVEA 3O4LD 3W0WE 1H19A 2CIKB 4PVBA 3OJMB 4UDTA 1ZGLM 4MRBA 2OCFD 2V2TA 1DJIA 3BHBA 1H8NA 4DPBX 3QUZA 4IM8A 1BM3L 4LHUD 3SDDA 1RUML 5JYLA 1E42A 1R3JA 4GG8B 2BZ7A 1MHPL 3ASWA 2JLPA 4G8GB 4AYEC 4PP2A 3DJZA 1ZVSB 3FQXA 4POYA 2XWJA 4NQVB 4PW4A 3PGFL 2ZUSA 5E2UL 3NCMA 4OTXL 4E36A 1UKTA 2H2SD 5DO8A 2BP0A 2UY7A 4FQXD 3I3DA 4Z7VE 5HYJE 2GK2A 2ZNXA 1CC3A 1FVDA 2C7UA 4MMZB 4EI0A 1J1OL 2EEAA 4XP6H 4J4PA 1FI8C 4XBEL 5JPMC 4U6VH 2PWWA 3MRPA 2XKNB 4TQIA 4G9FA 3PG2A 2O6DA 1IL1A 1KLUA 1ZTXH 4G7YH 2Y2WA 4LEXH 1Y7VA 1A6AB 4Z7AA 3KLAA 4NP4L 4R3SA 1A1MA 3LQAL 3RPIB 5GSRB 1BVNP 1G7HB 4IJ3B 2APTA 2C1PA 2XNAA 4TSBL 1OAYL 5JQHC 1S3KH 2UY6B 4MNQD 3IMWA 2AK4A 4GRLA 3VMNA 2FIRT 3VE0B 2BSTA 2HLFC 1KIQB 1IGYB 2ATPA 2BCMA 4JRYB 3I84A 4NO5A 2YBRB 5TPWH 4QRUB 2E76C 2O30A 3BVVA 1CGWA 4Q0XH 1WRFA 3AREC 2V2XA 1E7VA 1I9RH 1TQVA 1MEXH 1TQBC 3BUPA 5D7LD 4GIAA 1KCSH 4N2NA 2F0CA 4GRMB 4LCCC 1EO8L 2WINA 1OSZB 4WFED 1CJYA 1PCSA 4B9PA 3DJSA 1WCBB 2W0KA 3DDFA 3NN8B 4LBEA 1BMGA 2KQMA 2WGNB 4KX9A 1FVEB 2PYED 2UUDK 3EJTA 1INDL 5FKAA 4YR6A 5FM5M 3AY2A 5IUCA 1QLEB 2YN5A 2NY0C 3OLGA 1DQJA 3FSAA 4NI3A 4OQTA 1XTLA 3V6BR 4FFYL 3GHPA 4BFKA 4Z3IA 4UCFA 4OFDA 1N0LB 3WEOA 1NM4A 5J9PA 1OAKH 2R0ZL 2DBJA 4R8WH 1HQ4A 4NN5C 3ARGA 1FNGB 3ALWA 2XIIA 3QZWB 1MW0A 2BHYA 1FZMB 3DTXB 3SSGA 1LHZA 3FHAA 5C3IA 2P44B 4LCWA 3MHZA 4MASA 1CL7L 3V0VB 2YD0A 4G5AA 5EH1A 4BK4A 4CSZA 1RZJL 5D70L 3KEDA 2ISDA 2BS71 2W80C 4NUJA 3FTSA 3AABA 3V6FB 2OXGA 2OMXB 3CPLB 2CDEB 5GS1C 1QTSA 3CN1A 5JIIA 4P57B 2MJ7A 1N0XH 3RU8H 4BRJA 5EF2A 5GS0C 5IQ7H 1JV2B 1UM5L 3H9SA 3VMPA 4JRXB 1HINL 4NO0A 1PYWB 4F7CA 2DKMA 1NMCB 1XDTT 2KLRA 3H3PH 4A2EA 3PQYB 1E8ZA 1T0PB 5HYFA 4JGUA 4OZFG 3ARDD 4XXDB 5HHOB 4FYTA 3H9ZA 4NGHL 1CLCA 3WTSA 4MLSA 3B9AA 1W8EA 2MTAA 4IRSC 4PJCE 4L8CB 1P7QB 3WEXB 1MCKA 4ZOCA 3BJ91 3II1A 4KK5C 4M8QB 1DBJL 1NPJA 1IIIA 1RZ7L 3UW2A 4JLRA 2X42A 4KKAC 1NCWH 3D25A 2I32A 4KQ3H 2HKPA 4MJJA 3RZCC 4BJLA 1OVZA 5IB5B 4G3YH 1ANUA 5JW5A 1FJ1B 4GXVL 4WUUB 4A04A 4PJ7B 2E7LC 43C9B 4OFQA 3PHSA 1LK2B 1H0DB 3GIZL 3K74B 4PS3A 3RWIA 4UV4H 4JZOA 1DQQB 4JKPH 2ITDA 4HDIA 5KSVA 4JZJC 3EGDA 4WTZA 1P4UA 3GQFA 3LHPL 5CZXD 4KK6C 4BCZA 5EBLA 1G9NH 1CQKA 3Q43A 4R7NB 5I66B 4KXBA 1Z5HA 4ZMAT 2W9DH 1T22B 1TTAA 4K3JH 3SJVE 3KPPA 4KRPB 3O6KL 4S2SA 1GS6X 1BVNT 1MRCL 1XV8A 2IH9A 3JV5A 2J2ZB 4L3CA 1OP9A 5IB1B 4EI5C 3H3KA 1AANA 5D7IE 3WO3B 5CIPH 1DEEB 3E7JA 1MRDL 4D9RE 5IF0B 1KLFB 2Y1ZA 4ZOAA 5KYWB 1MLCA 1PX4A 4PHZA 1JYWA 3Q06A 1YUHB 2R9HC 2WQWA 4ZO7A 3V5DB 4RMSA 4Y4FC 5FO9A 4QXGL 3Q48A 1FNEB 2AEPL 2J6EA 3OKOA 1KEGL 1X9RA 3MLWH 4FFZA 1S9WB 4JKMA 2ZWKA 1FIGL 3LKPB 3QEQB 2VSKB 2O26U 1LL1A 3OMIB 5I1EH 1JRHI 1I8IA 2FT6A 1MCFA 3RFRA 3P0GB 2X7LA 1JGLL 2R2BB 1OQOA 4CSTA 3U9PL 4M1GH 2V5SA 1BPLB 4S10A 1IGJA 4OJEH 4HMCA 1JPSL 2K70A 1SDAB 5J11C 1BQLH 4XOEA 2OMZB 5EBWA 4P23C 2Z8VC 2X1PA 4AGLA 1KCLA 3PWLA 1RJYB 4I3RL 3HG1D 4K94L 1OM9A 3H4HA 4OLVL 4GP4B 3LEXA 1RZ8B 1OAZH 1T4KB 1F1DA 3GSUB 4U6HB 3DJRA 1IQWH 2Z91A 3O3BB 1FVCA 2E75C 3D3VB 3PWJB 3T0VA 3TZVA 3L5JA 5KSBB 5IFAH 3DARA 3HZKB 1N26A 4JPWH 4M5YH 1ZS8B 4MZ2A 1BXAA 1HIML 4GUOA 5IJVA 1P0SE 5ESVA 2BNUB 4L5FE 4MAUH 2AXGB 3LPWA 1KIRA 2F54A 4PRIA 3STZB 3U36A 4HUUA 3OAZK 5GHWL 5LGKA 4XC1H 3Q1EA 1MF2H 4XMZA 4N2AA 4K3DH 3TESA 4OJCA 4XAWL 3RIAF 2DLEA 4X9GA 4L3EE 5DRNA 1PIFA 3F64A 4PJIE 1T1ZB 4WSJA 4YVUA 3NA4A 4FQLL 4F7EB 4YLCA 1SOXA 3BVNB 5PAZA 3RHWK 1OSPH 4EZJA 4NQQA 4N0RA 4JJOA 3ELQA 4XBPB 1UZ6F 1LK3L 1VFBB 3HW7A 1HHJA 2VZVA 3SCMD 5E08H 3ZL1A 1WAAE 3MGOB 3ULUL 5L88H 1OY3B 4WTQA 2Z0BA 5LGJA 3LEYL 1OZTG 3W56A 2X12A 3PABA 4N2LA 2WWMC 3N44F 3VXRB 2VXUL 2WZAA 1K4DA 3CVHL 3WNNA 3NJKA 2WPGA 2P5ED 1R47A 3BO8A 3AB0B 5GZNA 3N41B 2GT9A 2Z93A 4ZDHA 4GINA 1EBPA 2WO4A 4KX7A 1BREA 1E30A 3AC0A 4L29B 4P06A 4QWWD 4V1DD 4WVRA 3VSUA 4D9QD 2XFGB 1XEUA 3MLRL 2ZX9A 1OGTB 3RX7A 1AY1L 2IANA 2R1YB 1XF2B 2YAPA 4ELMB 1BFTA 2WNXA 1P5UB 4ZUUB 2DQTH 1AI1H 1WIPA 1KBGL 3CFKB 5DJAB 5IK3A 3FPYA 4Y2LA 4OQ1A 2YEZA 3MOAL 4Z9KB 3UTZA 2J7LA 1QLFA 1HZKA 1DBKH 1MAKA 1BZ9A 4HJTA 4H88H 1AC0A 4JGJA 4ODSH 3L1OL 3KPLB 3W39B 3I0XA 4HS8L 3ECQA 4JHWL 4EIZC 5CEZH 1XSJA 3IVKB 1U95A 1T6VN 4DN4H 4Z95L 5I74B 3OVUB 3SE3A 2CK2A 5AYUH 4A1RA 1PEWA 2ENJA 3B7RL 3S5ZA 2VDPH 4QHKI 3QDMD 3GJEA 4WW2C 1T1XB 4I4WA 3Q2VA 2Y7NA 4K15A 3RX8A 2Y7QB 1NTDA 3RWJA 1OPGH 4AG4H 1NBZB 1DQLL 3KW7A 3T2OA 4KO9A 3ZE2B 2DQDL 1BX2B 1FFTB 2NR6D 5I1CL 4KI5C 3BMWA 2RQ8A 5C9JA 1HL5A 2ICWA 4XPHH 4N6QA 4Y5XA 2MNUA 2D7PA 4HPYL 5AEAA 3IAPA 3TF7C 3RA7H 5IQMA 3CH8A 4I77L 5TQ2L 5B39G 1G7LA 1UGNA 1DDTA 2GCYB 3ABGA 4M48H 1SJEA 3M7FB 2R69L 4BK5A 2H4LX 5ECJE 2VSMB 1QNZH 1FV1B 2AERT 5LG1A 4HOWA 3MV7E 4ZPVB 4PJXA 4L9LA 1AD9A 2J8UF 3VWJB 4HOZA 3OPUA 1ZPLA 4P9HL 2ADFL 3MV9D 4L4TE 2D03H 4TLSA 4AV4A 5CZVL 3LH2H 3CQPA 3A24A 1AHKA 3ZKNC 5BW7A 1E6OH 5FHAL 3BZ4B 2Q8AL 1QVOA 3F7VB 4K8RL 5E1HB 5ABAA 5L2JA 4Z7UE 5EO0A 3MRHB 2A6KA 2VN7A 1ZGLB 4ZD3L 5DO2D 4J7RA 3ILPA 4R4FH 4JFSA 1C12B 1DBBH 4E41E 2OKMA 1Q0EA 4JG0H 1HU8A 4I8DA 3GSXA 5ILTH 3KPSB 2FTAA 4LCIH 1N64H 2Z92A 3NP4A 5D7KE 5E7FA 2RAMA 4DESA 4F2EA 3IGKA 1NBYB 3N04A 1SYSB 3ROLB 3HC0B 2M26A 1ZHKA 3VGAC 1FCGA 5C08A 5A16B 3W2DL 4UOW0 2ZF8A 2F5BH 3DOSB 1NGWB 1WP6A 1L0QA 2BIIA 1W15A 2FD6H 4NQCD 4Y5VB 4UT6A 3Q05A 4MWFA 3GMRA 3CVCA 3F3HA 3L5XL 2ZF9A 2IBZX 3R1GL 1T5WA 2QQKL 1FZKA 3DBXB 3FCTB 5C09B 1G7JA 2MOQA 2OULB 3F65A 2YPLB 2E8YA 2D0HA 2A99A 3HE6D 1W8OA 5SX4H 5I8CB 3DGGA 1IU1A 1OGSA 3DHUA 2DYRB 3ALXA 3ISRA 4DJMA 5DTFA 1VCAA 1G87A 2ADIA 1MREL 1XZ0B 5DDHA 5DZJA 1OB1B 4LF3B 5DZPA 3V55A 3P0VL 1UXSB 3MRKB 2OI9C 4ZUSA 3ILDA 5A6MA 1TNNA 1CFMA 1PY0A 2DTMH 2V7NA 5A7BA 4PG2C 3VWKC 4ELKB 2VLJE 2KYIA 4Q9QL 2HFFA 3MRFA 4PGZA 2MQCA 4LARL 4PGBB 4WXAA 1MFAH 3IJHB 1CK0L 3CZFB 4ESKA 3GMMB 1KJ3H 3QULB 5JHDD 1K8IB 2XU9A 2A9NH 2BPBA 3FL7A 3BEVA 2EDDA 5JA9A 3NIGF 2HUEA 5TE7H 4LSDA 4ONFH 4GI6A 4F5CA 3NTCL 4JW3A 1HYRC 2LAAA 2HL9A 1A3LL 3OLDA 5DLLA 1PEZA 2HKAA 2N3JA 2A6DB 2RIKA 4AWJC 3C60D 2Z31D 2BP8A 4O58H 4KI5E 2ENSA 2DTSA 1NUFA 1FF5A 4OLXL 4BQ6A 1P84K 3T0ED 4H25B 3EYSL 3DPTA 3D33A 1FLRH 3GSNL 3MREB 5IGXL 4HIIA 2ENPA 3J8F7 1FC2D 1XT5A 1EHKB 5BZZA 2Z1KA 4MMYB 4I18A 1FZJB 5E1AA 1SVCP 3PDKA 5AW5B 2WIIB 2J8OA 1YEJL 1B0RB 1QSZA 2HTLD 5TQ0L 1JGDA 1IE4A 2E4TA 2JNZA 2JV6A 2P8MB 1KYAA 1P9MA 4B6ZA 2YAQA 3I3EA 4XBGA 1JZJA 1HQRB 3B9VA 4P5TC 4EF3A 1DVFB 4APQB 3KXFD 1GYWA 5HDBB 1MNUH 3ARQA 3P3TA 4AENA 4RBPH 5LG6A 1S5IL 2QVFB 4JDZA 3GO1L 1MCWW 4J6IA 4NQEA 2LTQB 3L4WA 3MUGA 4ZFGH 2R2EA 5CKGA 2WP3O 2I5YH 5KVFH 1KULA 3OF6A 1OZUA 4TKWA 1UM6H 3BDYH 2KUTA 4LVOB 1X5FA 4XN8A 3NJIA 2OX5A 5EU6B 2DH2A 4P4KC 1PZSA 2W9EH 1AE6L 4JQIH 3JTTB 4OCWL 1L9RA 3SDXE 5I6XC 3SQRA 2KS0A 2KI6A 5CJOL 4DP9X 4TNFA 3EF4A 1F3DJ 3GBML 3CC1A 1DCLA 3FT2B 1U3NA 1HAWA 2VMJA 3I6KB 4PTTA 2F68X 5KAQF 1TUPA 3GDCA 3MR9B 3ZE0B 2OR8A 1PBYA 3ENOC 1MI5D 1I1AB 2F7RA 3Q5YA 5I19H 5T5FH 3L3GA 4MQSB 4WHYH 5KVDE 3QXDA 4M8RA 1CFSB 2AJSH 2X09A 4RZKA 3P11L 3AU1A 4G42A 3WTVA 1VGKA 2ESVA 2G75B 4DQOH 1C5CH 4MMXA 1NDMB 2BIOA 2PYFA 1BAWA 4P3CL 3LRHA 5C8JB 4RMBA 1EZLA 4L1DA 2XN9A 1GGBL 4HS6A 1A64A 4D2NA 1CFNA 3WD5L 1OANA 5FLUA 2X4SA 3VFGL 4H8PA 5IMKB 5IG7A 3V52H 4JG1H 3LNHA 1P6FA 2C9UA 3S7GA 2WYIA 2OK0L 4NZRH 4ZT1A 3APDA 3QG7L 3O2VL 4NM4L 1C08B 4HFWB 5CD3A 3OSMA 1PD6A 3QUMB 4N5UA 2EUWA 5T5NF 4ODUA 2D0FA 1QNIA 3TE5A 3WBDA 3TT1L 3LNDA 2G4EA 4WHDA 5CJXC 2AHIA 4YXHL 5EC1B 4G7RB 1D9KB 3ARXA 2J73A 3GLZA 3K3QA 1BF8A 3UERA 1UACH 1R17A 1KTDB 4QPEA 5JLZA 2DRUA 1S3RA 3QDGE 2OMTA 4RWYL 2AQ3A 1UFGA 5F7UA 1RZGB 1NSNH 1D2OA 1U8KB 4M1CD 4QHLB 2HLAA 4N2IA 3POHA 1SFHA 3RKDC 2EEXA 4JQVA 4PUBH 4MCNA 4OLYH 2XX1A 5IOPB 3FFDB 4XOAA 1KEML 4HAFA 2FO4A 4TNGA 2GSIA 2XWRA 1SM3L 2IDSA 3OKYA 5FK9A 4HIHA 3TEZA 2ZG2A 4DTGL 4RVBA 4FQHA 1WD8A 4X80L 5FM5O 2ZXAA 4YLQT 3QQ9C 5F6IC 2H0FA 4LNRB 4NERA 4BJUA 4OKDA 4K94C 3RJOA 1AG6A 3FUMA 1B0WA 3DX3A 5DD1H 5G5DA 1ASPA 3A6BH 3UG3A 4ROEB 2V4LA 4S1QL 2ATKA 2UZIH 4PSPA 4BHUI 5JZ7C 4U3SA 3VD9A 2FEJA 4I0PC 4LSUL 2C7FA 1TOXA 4KKBC 4XCYA 4Y5YB 5EFIA 4FQQB 5ADOH 1N19A 2WXQA 4N0CC 5DQJB 3NZ8A 3T4YB 1MFEH 4XN2A 5C2BH 1UZ6E 3Q01A 5CAYB 3U25A 1PG7H 1P6AB 3CSBA 3QJRB 4LCUB 4QHNA 5F7FA 3DETD 3VI3F 3I50L 1X5AA 4ODTH 1JWUA 5F0MB 2B15A 1A6VH 3LXBA 5AN4A 3MRIB 4AQAB 1ORSA 2LE9A 5E8EA 2Y0SA 5GRYA 5SV3A 3BAYA 3UTSA 1S7QB 3N89A 4JO3L 2OMWA 1ASQA 4OD1L 3U1SH 4Y0GA 5MI0B 2BX5A 5JOFB 2VCOA 2XIDA 3G5VB 1E9QB 2QBWA 4OZGF 3D39E 2IAMD 2AS5M 1DQKA 3KS0J 4P4RA 2EEFA 3TWYA 2G3NA 2VC2L 4JQIA 4LAQH 3ULUC 3UAJA 4ONGH 1KENH 3KVQA 3Q3GB 4CA4A 4LHUA 5T1MA 1ESOA 4V11A 3THML 1TJGH 3CFMA 4ZUVB 4ZAKA 1QQDA 4J23A 4ONHB 5KYNA 4KNUA 1OT2A 1QATA 5C0CA 2OL3A 2QFPA 1RK0B 3KHQA 5J57B 1U58A 5LWYH 2R7EB 3TGXA 5FM4A 3CFJB 5T5FA 4M93C 1RJZB 4PP1C 2MPVA 4CN1A 2EDYA 3D9AH 4BKLA 5JPMB 4F80A 1CF1A 2V9RA 5KSAC 4GAGL 4XGZA 5DS8A 3NESA 1JNNL 3U82B 1MQKH 2F8IA 3JT0A 3N9GL 4WFHE 4F57L 1B4JH 2DQFA 1DDHB 4S1SL 2R5XA 2MHAA 3LNEA 1RZIB 5I6OA 2P8PB 1F11B 4LPXA 1A65A 4DVBA 4MQ7A 5C0RH 1VKLA 4X6CA 1A14H 2J1KA 3RVWD 5D2NE 4QNPF 1JHLH 4PJ8A 4WTXA 1PLGH 3AMLA 1TZAA 2YQBA 2MCPL 3X14B 3GKWH 2MZ8A 3U6XS 1C16B 4FYSA 3T4AA 3GI9L 1BF5A 4NCC1 5KTEH 1KGCD 1IJ9A 5E8DL 5DJZB 2ITEA 1Y6NR 4Z7WF 1QP1A 3BLBA 3R06A 2YZ8A 3QIWD 2WV3A 1FYTB 1MLBA 2IDUA 4IS6A 4LCCB 4X5XB 4CC4A 2E8ZA 1TF4A 3HHSB 3V4VH 4L4VD 4XWOC 5ALCH 3UG5A 4R4NC 1AKJA 1Y0LA 4PPTA 2AKRB 5F96L 5IVXB 4HWBL 3DBSA 4YHNB 3REWB 3HNTL 3OSKA 1ETJA 4I85A 1E5YA 3QCTH 5HDQH 2NY0B 2A0LC 4YDKL 3TJHC 3FCSA 1GC1L 4JFEB 4KZEH 3RB7A 1KIUA 4M4PA 3VGEA 2Q0ZX 4NN5B 3P3YA 3MXVH 3O41B 3QRGH 1NUDA 5T3ZL 1KT2A 1OCZB 4XVJH 5GRWA 1OF2A 2PNDA 4P9HC 2EKSB 4RNRA 5FS5A 2X87A 1ZLVH 1M4KA 4NNYB 1N3AA 1UT7A 4XP1H 1BHGA 4K23H 1JZ7A 2NOFA 3AGWA 4FQPA 1C9BB 1E9PA 3VW3L 1AH1A 3GLEA 2YGPA 3JV4A 3WMSA 4K8RC 5B39B 4I48B 5GS1B 1HILA 1TUOA 4G43B 5H94A 2IADB 2XQYK 4OF5A 5GJTL 4ZYKB 1BOGA 3O45B 5BQ7A 2PETA 5TE6H 3EH5B 2GJZB 3SYQA 1QEWA 3GKZA 4PRHB 4IU3B 3V8OA 5DHVA 4KK9D 1HHKB 2ZG1A 3EG9B 5I8EB 5HDLA 5FYLD 2F6AA 3L7EB 4P46A 4XCNA 3B1TA 2I9LB 2B1HL 1XSZA 3B4NA 3IJEB 4Z7QF 4CU8A 3FT9A 5EUOB 3C5ZC 3MBED 1DJXA 1JAEA 5JIMA 1QRNB 1EO5A 1J3MA 4IRSB 5BZXA 2I7OA 4JL2A 4O5LH 5J0BA 2C8NA 3BX7C 2OQJB 1GSKA 4JZNA 3F58H 2HFEA 4MJ2A 4QXTB 4XHQA 3IJSB 5A2BA 4EIUA 3RZCB 3GS0A 2F7PA 1J9SA 1CD1B 1OE2A 3OZKA 4N90E 3K6OA 5HHVH 1X9LA 3EJCA 1EHNA 2YKKA 4JO1H 4F92B 4GMTH 5JOPE 3GJFH 1ZT7A 2YPVA 2XVLA 4NAJA 4ZOBA 4AT6B 5AL0A 4XPGL 3WCYA 4H13C 1QLRB 4MQXC 3IJ7A 4JZJB 3BH8B 1I7ZA 4DFIA 4J3OD 5FUOL 1G6RA 1NBQA 3PGCA 3GUFA 2Y4SA 2OW7A 4WU7B 4DP7X 3ILQC 4HD5A 1NCAH 3KWWA 4JHVA 5CJQL 4M3KB 1DVSA 4YL9A 2QSVA 2OTUB 2VDQB 3HI6L 3V0HA 1QASA 5J56B 1VADB 5BO1L 1I9IH 3N1GC 4IRJD 2C3VA 4UM8A 2XFXB 5M95B 3DSNA 4M6ML 1UD2A 5B1BB 4BE5A 4EI5B 2IWEA 2P5WB 3BQUB 4UUJB 1AGEB 4MD4A 4Y4HB 3RB5A 3VRIA 5F7EH 1MVYA 1BF2A 3NFSH 2FSEA 4APXB 4ZTOL 3D5OF 4ZXBC 2WBXA 4Y4FB 5KJRH 2C34A 2GBTA 5DD6B 4XPAL 2MKWA 2L7UA 4KXZH 4N2GA 3CZNA 4FL4C 1YEDA 2J12B 1KNOA 5K39A 3MJ9H 4TLTA 2WQXA 3TNNB 1A3QA 5BRZB 4XXCA 3OH9A 3QORC 3V4VA 1EMTH 4GIOA 5C0AB 1NPUA 1QFWH 1ZD6A 5J11B 3AAZA 4RRPG 4P5MA 1O7DC 2HXAA 3QIBB 4P23B 2HG5A 2DQIL 1ZCRA 3QPQD 4XO8A 5B8CA 2Z6FA 3FUIA 2MTPA 3KYOB 3GNML 1YDPA 2WLLA 1NUGA 2B59A 1AJ7L 3RJDA 2VLKA 1KLGB 1HCZA 5LDUA 1W0VB 4N68A 3EFFA 1PY4A 5MENE 2VWEC 3MV7B 3BPCA 3DPDA 2KZWA 1XWVA 5H2BA 1VAHA 3TA3C 1JHKH 5DHXB 3I02B 1H5BC 1OGAA 3D50A 1GYVA 4FNLL 1GZQB 4G1EB 4GRWH 4RRPM 5KSUA 5IT2H 2BHUA 4L4TB 1IKNA 3K4ZA 3QZLA 2P8LB 3CWUA 3VXSE 1K4CA 1ZEAL 3LKSB 2XY1A 5HGBA 2QSQA 5JMVD 1Z9SA 3LIZL 4O02L 4DOHE 1ES0A 3G6JB 1BBJA 2X70A 2BIHA 3ABKB 4Z7UB 1DIZA 2VIRA 3F84A 4UDUB 4AI7A 2D7MA 2EO1A 5LJYH 4OD2A 4YXKH 2VABB 1YNLH 2FZ3A 3MNVB 4L8DA 1WQAA 3MAWA 4M1DL 2ZJSL 4NNXA 4E41B 4YSOA 2EVJA 2K7QA 5BRQA 2DMHA 3RIFF 2KPWA 4PJAA 4MA3A 5ID1A 2FQEA 5DHDA 3A6OA 1XGPA 3FFOA 3QUXD 3CFTA 4G6FD 4XNAA 3KDPB 1DN2A 3B7SA 1SJHA 2UWEA 2WYHA 4ACPA 4QRRE 5LGYA 1A8JH 4LLQB 4R26H 4AJVA 1B0GB 5IIEA 1AHWC 5HSFA 4QJ3B 1I7UA 3U46B 1SUHA 2PCPA 1IEAB 3QO1B 3TVMC 3ARBA 4ZX3A 3VXMB 3T0DA 3SPIA 4YL4A 3GJFA 3ET9F 3UTTB 4EJ1C 5I30H 1S7UB 4AKOA 5DI8B 1UWXK 4EKXA 1M1XB 2WLZA 1ILUA 1ETZA 5ESQB 5E9DB 1RUAH 5E1IA 1F3DH 3U4EB 4OT1L 4U1IB 2NXZC 4TSAH 2VDLH 1P5VA 1CXKA 3EOBB 4EUPA 4FQJL 4JAMA 4AIZB 4KQ0A 2JKTM 2CO7A 2FWLB 1NGXA 1OTUC 2CR6A 1KYOK 1RSYA 4MB3A 4GYBA 1GL4B 5FWQA 1ORQA 2ERJC 2LABA 3RGVA 4R4BA 1V3KA 1BEXA 3RG1C 1YJDL 5JHLA 1NOAA 1U8IB 2MMXA 4Z8FL 1VJSA 1Q38A 5JHBA 3DX6A 1BVOA 3HC3L 2HJFA 4Y1TA 2IG2H 5F7DB 3NJMA 5E95B 5HDWA 5ID0B 3MACH 1A47A 4WW2B 1JBJA 3W57A 1QYGL 2LQRA 2H6PA 5IB4A 3IPBA 4ROCB 3TXAA 1QSEE 1LEGA 4NHCH 3GINA 5AW3B 5IWLA 1F0LA 4HCRH 3SDCC 1UWFA 4GQRA 5IB2A 2BP3A 1OTTC 3MJ8B 3BISA 3DGDA 4DO4A 2XZQL 2ZYHA 3WO4C 4MKTA 1OAQL 2NZIA 4OR1A 3KAAA 4HXBH 5E5MB 3M7OA 1I1FA 3UBXA 2X9ZA 1M56B 5C92A 3I9GL 2MJWA 5CM1A 3MJ9A 1YNTA 3ZBMA 1DBAH 2KDYA 1SF3A 2V7HB 4RDQG 5D5ME 3PWVA 1F1AA 3MYJB 5HYEA 1ADQA 4A2DA 4H0GA 1NMAH 3FOMB 4PV8A 4U7MA 3NGBC 1TEGA 1G5GA 4ZUTA 1LWYA 1YEHH 4DP8X 5A43C 3IDXH 3SGDI 3U2JA 5E2JA 3F6IA 5KVEE 4ERSL 4RGNE 3EYFA 1NGQH 1UD4A 3TPKA 3T3PF 2AVFA 4OQTL 1FORH 2A4ZA 5ITFB 5TDOA 1TYRA 3UJTL 3ENEA 4F9LC 3UO1H 4MBRA 3NCYP 1Z66A 1UEMA 1EHXA 3L95A 3KLKA 5E99L 3M8OH 2R1XB 3RNQB 1NGZB 3WFZA 5J8OA 2FUQA 3EOTL 2BIMA 2EXWC 2VLMD 2WQSA 3O0LA 4D0DA 3OGCB 4FQIH 4YE4H 3VFNA 4F8TA 2IGLA 4FTVE 5B38A 1SBBA 2CUAA 1PLCA 3D4GA 4PJBA 3T1WA 2DM2A 2FX7H 3QZMA 2PW2A 1PMYA 3V7MA 1HKLH 1VIWA 5FGCE 2Q7YA 3ULVD 2EE6A 4M5ZH 3VGAB 5J3HD 3PYCA 1ZVSA 3L4YA 4FCHA 4QNPE 4JFHD 1NCNA 1ZHLB 2CXGA 2AGJH 1EK3A 4Y9FA 1XGQB 5MHSD 1FFQA 1ITBB 2UYLB 1U8HA 4DGVH 5IHHA 1I7TA 1I8MB 4GSDH 4AVIA 3N43F 1KCRL 3L3HB 5FB8B 1IFHL 2XRAL 3QWRA 4IKIA 3DXAE 2CO1A 4G59C 4PY7B 2EEBA 2CUMA 3MCYA 1NGPH 3EJJX 4JPIB 4RAVB 3HIZA 1U92B 3FU3A 3MQIA 1CD8A 4J8RB 1LE5A 2XKNA 2Z64C 5C70A 4PJGF 2IOIA 4Z0BH 1BD2D 4P49A 4ZRGA 3B2DC 2VN6A 2XV6B 4HKXB 4EDWH 5D2LF 2OI9B 3BEWB 5GSRA 1G7HA 5ICYA 1KXVC 1CGSH 1WFTA 1X4ZA 1SNRA 4MAYD 3MFFA 5INDB 1V05A 2F18A 1CD0A 3VWKB 3ZTCC 3UDWA 4Z3JA 2FBJH 3R7RA 1K5NB 2GAZB 1IGYA 2AJZA 3FUKA 3S0PA 1AC6A 4I1NB 1MUJB 4QRUA 4U1MA 2XWCA 3NAAH 5T1KD 4ZI8A 1WFUA 4U3CA 1UA7A 1A6TB 3MRRB 3D4YA 4HJIA 3DUUB 3NUKA 5JHDA 3U2SB 4ETQA 2QELA 4GRMA 2DWDA 4JRWA 2W1NA 1Q9OB 3EYUH 3KDMA 2P4AB 3NMEA 1OSZA 4XP6L 2XG4A 5F1SA 2H5AX 4G7QB 1WCBA 2HP4A 3E0GA 4U6VL 3NN8A 4IK7A 2X0UA 3UTOA 3FQ1A 3OSEA 1E4XI 1O75A 4WHTB 1JV5B 3FSVA 1ZTXL 4G7YL 4LEXL 1ZLUH 1GC1C 2FNWA 2KMWA 3QDJE 3AQXA 5T33H 5HGHB 2ZOLA 1RK1A 4KRNA 1ZSDB 1S3KL 2HX7A 1PDKB 3QA3B 4JRLA 1N0LA 3R4RA 5I6KA 1KXHA 4XAKD 4XHJD 3HUJA 1M6OA 5D1ZC 1N68A 1PZ5B 4HJUA 1FNGA 4ORGB 5TPWL 5G4MA 4P5TB 3QZWA 2VDMH 1FZMA 4Q0XL 1I8AA 4GW4A 5B21A 4Z7QE 1I9RL 2DYPA 3TFBA 4AC4A 3VDBA 1I9JH 1IV8A 1KCSL 3GRWH 2D7TH 1M3JA 1LEIB 1KB5B 2SODB 4H5SB 5K9JH 1D6EA 3WEBA 2A74C 2CDEA 5F7MC 1UTDA 3TBYB 2YEQA 1DZ0A 2EDTA 2JJVA 4P57A 3ECUA 1VZHA 2ZAHA 4HIXH 1URZA 2HRGA 4AEIH 2BHZA 2XTJE 4P4KB 3MBXL 3RY6A 1K8DB 3FQTB 1OP5H 1ZANH 4ODWA 3B2XA 1YPZA 5I6XB 1PYWA 4LLDB 2HZSA 2XXMB 1JGIA 5HI3C 4HU2A 3T6QC 3P69A 1JZ8A 5F9WC 3MCG1 3US1A 1WO2A 4DPAX 1OAKL 2QR0B 4MXWH 4R8WL 2J20A 4LGPB 2DD8H 5FGBA 3WNLA 4PJGA 1P53A 5DJDB 2HTKC 1KGWA 5AVUB 2EACA 1LMKA 5ACLA 3DVGB 1INQA 3CXDH 1RZPA 2RMNA 4YFDB 2VO5A 2WKLA 4KXZI 3RNKA 5IB5A 5C07A 4ZO6A 2WXPA 2ZZUT 4WUUA 4P2OA 4NSKA 1N0XL 3I6GA 4PJ7A 3RU8L 1OGPA 3VXOB 4PCKA 43C9A 5A2JH 5IQ7L 2AJVH 1LK2A 1ED3B 2Y3AA 3MODL 1W2KT 1T89A 1DQQA 1QFWI 4N20A 3RGHA 4B7LA 3ENCA 5AW0B 4JFWA 3K81A 3H3PL 3PWPE 4JFFD 4JPQA 2CZNA 4JJ5A 3VXTB 1DBMH 3H0TA 4R7NA 3VI4E 4MS8C 4C58B 1MDTA 3B7UX 3CFCH 5IHBA 3B2VH 2HAZA 4JVWA 1XIWC 5ACMA 1ERNA 4PJ9C 2AXJA 2Y1VA 1XCXA 3H4FA 4PV1C 5DLMH 2PXYB 5FF6A 3HR5B 2J2ZA 1JCKA 3LH9A 1NCWL 5TJWK 4GBXC 4OY9A 5IB1A 3S5LG 5F89A 4AM0Q 3OTTA 5CEYA 4DPRA 2J71A 5CSZA 4BFIB 1TLMA 2IDFA 4G3YL 5IF0A 3L3OC 5GGRA 5KYWA 5IYCP 1FO0H 1YUHA 2HVKB 3HZYB 2B5IC 1A4AA 5DYOB 5EU7E 4C55A 2VOTA 2VLRB 2UV3A 1JF1A 3V8CA 4QAMB 4WI6A 3NJGA 3WLWD 3CLEH 3ZZ1A 1FNEA 1J18A 4UV4L 4JKPL 2IDTA 5SV4A 2XY2A 3WL9A 3B34A 1BAFH 3OKMB 3FTVA 1ICTA 3LKPA 3QEQA 3RWEB 4C59B 5B7MA 5KS9A 3ML8A 1G9NL 5C0BE 4WI4A 1M7DB 3A5VA 2BVQA 4YLBA 2R2BA 3BUYB 2W9DL 3QUKA 2SEBB 5D4HA 4K3JL 5DK2A 5F6IB 2WANA 3BW9B 2CKBH 1J5CA 4M8UA 3R4DA 2IEPA 2DKCA 2OMZA 2I85A 1FL3A 5IW6B 1S46A 5CINH 2WTOA 4I0PB 4J3VA 1RZ8A 1EEZB 1T4KA 3GSUA 3PWJA 3T6VA 5AAPA 2NTFB 1MELA 1P1ZB 1NCTA 1IAMA 2DMGA 4A6YH 2B8OT 1PCZA 1T04A 2EINB 1RERA 4KFMA 1LLAA 3FK3A 4OUUB 2EO9A 3MLWL 3TIDB 4ADGA 4ZMLA 1TGHA 3GRWA 4P9MH 3BFWA 1F6AB 4JCLA 4NZTH 5TDNB 5I1EL 2PR9A 3BWUC 2JSFA 5FYLH 3ZTJG 4JFZH 4NZFA 4E9VA 4QHMB 3VFWA 4M1GL 1T1ZA 4MXQC 3QFJB 2OTPA 2CDGB 2J3SA 4JM2D 4YPJA 3MPCA 3N0AA 3K72A 1IC5H 2DM4A 3JTBA 4KVNH 3V0IA 2EHBD 2D2CC 2OSXA 4NDMB 4GQQA 4MD0B 3KLHC 2JHNA 4G6KH 1QUNB 2GI7A 3MGOA 1IQWL 3MRNB 4D0BA 5IFAL 4FLSA 1OE3A 4JPWL 4M5YL 3K8LA 4B5ZA 1VRSA 2WHVA 2PO6D 4MAUL 4XNYH 2Q86B 3ZMRA 3QUZC 4M93B 1L9OA 3SDDC 2BNQD 1JTPA 2IPUK 4QRAA 2NPLX 1JZ5A 2FCBA 6CGTA 1AFVH 4XC1L 1HTYA 1UYWH 1MF2L 4LLUA 4J3OH 4K3DL 5KSAB 2JB5H 2WLKA 4DKDC 2VZ3A 3QEUB 1CUOA 4CSSA 4P5RA 1NMBH 4L29A 2MNWA 3WXWH 5CLWA 1A9BB 4H8WH 1LE9A 3G6DH 1XF2A 4ELMA 1ECZA 1OSPL 1P5UA 1UB5B 3OKDB 1D5ZB 4YHMH 4ZUUA 4MJIB 1P2CA 2KKQA 4P99A 4JO4H 4N0UE 1U4FA 4YUEH 4LLYB 4XNDA 5A40E 3MRGA 1XTMA 4J4PC 2NY1C 5FO8A 5E08L 1U8JB 5L88L 4B9YA 1MRFH 4TRPH 5CF3A 3KPLA 1O0VA 3V4PH 4UM9D 1IO4C 1YJDC 1XF5B 1XSIA 2K6YA 4HULB 2K8QA 1T1YB 2NNFA 1N12A 3FHEA 3GB7A 4U1HB 4E42B 2ZXEB 4GG6B 2EDKA 5DS1A 3PJSB 1A22B 1Q0YH 4OLZH 2X53A 2P9RA 3K7UA 4XP4H 1T03H 3EBAA 5EV7A 4J3OF 2QRDA 2JMRA 4NS0A 2YQGA 1T1XA 3F2LA 4CFFA 1H3PH 3ALPA 5CHNB 3QJTB 4R5VA 4LOVA 1NBZA 4D7RA 3T0EE 1I1RA 4Z3TA 1BX2A 4UNUA 3EH4B 1CFTB 3QO0B 2DQTL 1AI1L 4KOBA 4OZHF 4GEJA 4L48A 4B27A 3LV3A 5I1IH 3IDJB 5MERB 4KBPA 4BFEA 4PRPB 4W9CC 4YHPA 1DBKL 3EUUA 4H88L 4ODSL 4R2GD 4XCEB 4N0FB 1AAJA 3BIKB 3QXUA 4JK0D 2ZP9A 4LAJH 1FV1A 3EJYD 4ICXA 5CEZL 2DPKA 1FGNH 1WBYB 4PFEA 4X4ZA 4ZPVA 3E6FB 3FTYA 4M5TA 4DN4L 1NBVH 4HJ0D 3HC4H 4NIYE 1P4IH 2GHZA 5AYUL 3IRCA 2IAAC 2BVYA 2VDPL 4YHZH 5DHYB 4KV5F 2XOTA 2YK1H 3EHBD 3QNXB 4PJDB 3ARGC 4XB3A 1OPGL 4XX1G 1NC4D 4ZQKB 5I8OH 1XO8A 3ZKXC 3BZ4A 1FFNB 3F7VA 3O4OB 1YQKA 1KIPB 3CU7A 2DLTA 4RWHA 4XPHL 4B60A 3GSWB 3GS7A 3BD4A 3RA7L 5IBUG 2HN7B 4UMSA 4H1LH 3KPRE 5IHLB 5E2WH 4WO4D 5DSCA 2YSSA 4FLHA 1P1VA 4M48L 1IEBB 4OFPA 3C5ZB 4OJDH 1QBAA 3GXTA 4PJEF 3UYPB 3ZTNH 4HIQA 5IFHH 1QNZL 3MBEA 3EYOB 2BDNH 4PWHA 2RFXA 4Z3GA 1SYSA 3ROLA 3HC0A 1ZDSA 2L7JA 3DPBA 3U0TB 1Z0MA 4U1LB 3V6OC 1ZKAA 2D03L 3HVNA 1AGFB 4WGKA 5FCUH 2XHNA 2NNXA 4Y5VA 1KPUA 1J12A 3HEIB 4G8FA 2K45A 4I5BA 3LRSB 1UB6B 4GI9A 3LH2L 3K2KA 5GPRA 3Q8CA 1E6OL 4AZ8B 2YPLA 4ODBD 5I8CA 1DANU 1UUNA 3K6SB 2VDNB 5BOPA 1A2YA 1ZLSH 4ATTA 4Y8AA 4QRRB 1XZ0A 5CR8A 4GSXA 1OB1A 4LF3A