1PZEA

T.gondii ldh1 apo form
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
326
structure length
323
Chain Sequence
b'PALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMCEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lactate dehydrogenase
publication title Structure of Toxoplasma gondii LDH1: Active-Site Differences from Human Lactate Dehydrogenases and the Structural Basis for Efficient APAD+ Use.
pubmed rcsb
source organism Toxoplasma gondii
molecule tags Oxidoreductase
total genus 112
structure length 323
sequence length 326
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2003-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pzeA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1pzeA02
3RD5A 1O8CA 2I3AA 1Q7CA 5COQA 3ULKA 3C1TA 1R4MB 1QG6A 3G79A 3T7EA 2VYND 3WX0A 9LDTA 3UCFA 1YL7A 4IUYA 4Z6KA 2NU7A 2LDBA 4M55A 5B1YA 2IE0A 1BW9B 2C54A 4FQ8A 3TL3A 4EI2A 4BS9A 1FDSA 3GEGA 4XX0A 4YA6A 2CUKA 1GZ6A 1LTHR 1NVMB 3GPIA 4G81A 5K0ZA 3EC7A 4FDAA 5I9LA 2PZLA 3GHHA 5L4SA 2CVZA 4U8GA 4HFRA 1YONA 3DL2A 1N7HA 4D41A 2PD6A 2NVBA 4RPGA 4CV0A 9LDBA 1DHTA 2P2SA 5FFFA 1C1DB 5B12A 2NVWA 3H65A 2J5RA 1AUPA 1AGNA 3MOGA 3HFSA 1EK5A 4E2ZA 1NPDA 1WWKA 1NPYA 1DLJA 1E1MA 4R3NA 2DKNA 3GG2A 1NR1A 1P31A 2Y0CA 1M6HA 4GI2A 3V1YA 2OL4A 3ZHYA 4BNZA 1KVTA 1PSDA 5EPOA 5JW6A 1O95A 3ROQA 2CD9A 4RF2A 4E5NA 5GZ1A 1ARZA 2X8LA 3E1KA 4I9HA 1K0UA 4W9NC 4E5YA 2QYTA 3ZNOA 1BXKA 4BGIA 3WB9A 3SVTA 2E82A 2Y1FA 2NACA 4QO7A 3PI7A 4XYBA 2X4GA 3U0BA 3JYLA 3VPGA 4YRAA 4LMRA 1J49A 3AK4A 4WLEA 3HDYA 2EERA 2RIRA 3KSUA 3DHEA 4OMUA 3MTGA 1EEHA 2BFOA 4YRDA 1J4AA 5DZSA 3IOYA 4DIOA 4N54A 4FR5A 4BMVA 3CINA 5KNLA 2VHWA 4PLPA 4WK6A 3LZ6A 1NQAO 3HDQA 4CR6A 1VLLA 3GMSA 1MLDA 4WEQA 3GG9A 1GUZA 2X9GA 3O4RA 3ICPA 2H63A 1HZJA 3SLGA 1GYPA 1NWCA 1PR9A 1UXIA 4YQYA 4ZJUA 3QHAA 5KKCA 1KEUA 1X0XA 3DZKA 4R51A 5CPFA 2O4UX 4RPKA 4JNKA 4S3MA 5EIOA 2AQHA 2VNAA 4WASA 1ZIDA 4CMIA 3CXRA 3INGA 5G0UA 2I99A 3IUSA 4YJFA 4YDRA 1P45A 5L7TA 4R5HA 1HL3A 3WS7A 3RROA 1ENOA 4RDIA 5COBA 3WBFA 3FR7A 1NASA 4DQVA 1DO8A 1Z75A 4RVSA 4BNFA 3RVDA 1D4FA 4W9NA 4DRYA 1MB4A 2IDZA 2DTEA 5JXWA 3MJ4A 2E4AA 3VDRA 5JYEA 4FFOA 2VYVD 2YV1A 4M1QA 2VYNA 3GDGA 1FK8A 4IXWA 1F12A 2PZMA 4J16A 2W4QA 4WPGA 1D1SA 4FIZA 2Y1GA 3M1LA 3O9ZA 3WWZA 3H9JA 3PFFA 4YAJA 4OXYA 3I1JA 4CMCA 2FOIA 2W2KB 2XF8A 3BMNB 4E30A 1ENPA 5L45A 1MA0A 1ULUA 2VZ0A 3WOHA 2JL1A 4MVJG 2EG9A 1QKIA 3STHA 5JS6A 4Y8VA 4B4VA 2Y1DA 1HDYA 1S6YA 2EKPA 2EJVA 2VZ8A 4XQEA 4IIVA 4PG7A 1E5LA 1ZK4A 4BKPA 4OKNA 3N7UA 4UEKA 3MOIA 2GASA 1HDGO 1U28A 2OMEA 3DTTA 1LSSA 4JBIA 4BGEA 3G49A 3V5NA 4R4JA 5IAAA 1ZFNA 4AJHA 2HMWA 4BO0A 4R69A 5AOVA 3WYBA 3WJ7A 1JN0A 3GFGA 4L75A 1XG5A 2I65A 1ID1A 3QP9A 4OHUA 4MKRA 1F8FA 4NI5A 4R16A 4RDHA 2NTVA 1G0NA 2O3JA 3DONA 3QLJA 1N92A 4MP3A 4N18A 3PHIA 4BMNA 5H81A 3RUFA 3E9MA 5I9NA 5KJ6A 5HS6A 1T24A 2R2GA 4F6CA 1VL8A 3ZWOA 3QQPA 3NX4A 5JY1A 4JJGA 1SAYA 3RFVA 2JHFA 3DBLB 4XCVA 4I1IA 3ZU2A 4BO7A 4ZICA 5C7OO 3ZWXA 3ZWAA 4CR7A 1T2AA 3INRA 4E5PA 1U5CA 2EGHA 1ZSVA 3QW2A 5KJ1A 1XEAA 1GCUA 2J8ZA 3RBZA 3SJUA 2FR0A 4NFYA 5TGDA 2XXBA 4IDDA 3FCOA 4E5KA 5L51A 3ONEA 5I9MA 4HNHA 1E3SA 1XGKA 4KUGA 4TVBA 1DC6A 1GUYA 4U6QA 4ALNA 5CEEA 3MJEA 1P77A 4OOFA 2DTXA 1XR3A 2Y67A 5BT9A 4YAKA 4CM3A 2AW5A 2YV2A 1ISFA 3ROPA 3KM0A 1SB8A 1R6DA 1ZJYA 3LLVA 4CQMB 1VI2A 5A9SB 4MDHA 5DCWA 1Q0QA 3E48A 1DC5A 1PJSA 1Q1NA 5TS3A 4QFCA 4KWIA 4DPKA 1T26A 1X0VA 4I9UA 3S1LA 4E21A 1I0ZA 1C1XB 3E82A 3OJFA 1BVRA 4CUKA 1NVTA 3RCBA 1PS9A 1E1KA 2V6BA 2DBQA 2PFGA 2F00A 4J91A 1ZMTA 4RVGA 2VYVA 4XYMA 4KUHA 3ADPA 4XJSA 4TZKA 2DM6A 4J2OA 4HFJA 4RQUA 4MIOA 2X7HA 4U7WA 4AJIA 3P19A 1H94A 5CP8A 5A06A 2P68A 4Y98A 3ANNA 4UUNA 1AXGA 4CM5A 4PG8A 2PKRA 2V7PA 4RV9A 3DR3A 1ISMA 1CIVA 3HE3A 4W7IA 4OL9A 4R1TA 4CLEA 3ENKA 4Q3AA 1UXGA 3E03A 3PXXA 3ITDA 2X0NA 5CAEA 4YJHB 4BO2A 5GZ6A 5CG2A 4N7RA 1UDBA 5FI5A 3LSYA 3C7AA 4MJLA 2X0RA 2TMGA 2YDYA 2QHXA 4BNMA 3FPLA 4LSMA 1C0LA 4BNVA 5IXSA 1C0PA 4N5MA 4CUJA 4IJVA 3G0OA 1I2CA 2DFDA 1YBMA 2GGSA 3DMYA 4PZEA 3ZNPA 2VTDA 1VL6A 3K2EA 4UREA 4FGWA 3IKTA 4ALLA 5JC1A 1QYDA 1ZH8A 3JQAD 4HFNA 2HLPA 1KVSA 2EWMA 3L9XA 1ISHA 1DOHA 3OJEA 1I8TA 2YV3A 2P9CA 4IIUA 4IGFA 3E6AA 4PRKA 1JKFA 4B3IA 1KBZA 1EZ4A 3WDSA 1QYVA 3DTYA 3ON5A 3JD1A 3FNGA 1KIFA 3WNQA 5AXAA 3KYCA 5KVCA 5J23A 4GSLA 3JYQA 5IDXA 4A7PA 1HRDA 5B4TA 5JO0A 4OAQA 4XR4A 4YR9A 3WJAA 1YB5A 1X14A 3GRPA 1R37A 2YHUA 1RM5A 2QYSA 4IZIA 1Z73A 3UF0A 1MC4A 2CDCA 1E3EA 1YWGO 5C37A 5CDSA 5JC8A 4BNJA 1GQQA 3D64A 1JTVA 3TNLA 1PJCA 4P38A 3V8BA 2GZ3A 5DF1A 3UOGA 4R9RA 2WYVA 4RVUA 4KUEA 1GUFA 3WICA 1E7MA 3ZI0A 5MGBA 1GYRA 3PWKA 1U2GA 3OJ0A 4EGFA 3D0OA 2ZIZA 1V3VA 3AOGA 2C82A 3GQVA 4I08A 1R12A 1D7OA 5HBRA 2CNBA 1UUFA 3OQ6A 3L77A 2BMAA 3TPCA 3K31A 4UEJA 3ZNNA 4XYGA 1FJHA 1K89A 1E3LA 4RF3A 4U0KA 1GPJA 1YH3A 1HE2A 4UAGA 5A1TA 4EBFA 2GYYA 2HAEA 1IUKA 1GV1A 2VNSA 2PTGA 3JQGA 2OP0A 2FZEA 1QP8A 4LK3A 1NAHA 1ZCJA 3OEYA 4FFRA 1B8PA 1E3WB 3E8XA 3ZHXA 3RAJA 1DC4A 3ONDA 1Y6JA 2BF7A 3AUSA 1PJTA 4NBVA 5JMWA 1BSVA 2ZTVA 1NYTA 3H9GA 4PGFA 3DAFA 4E3ZA 3C3XA 3F47A 4JJFA 5A04A 4JX8A 4CLDA 5U1PA 3LC7O 2PK3A 4R01A 4IINA 2G17A 3CIFA 3KYDA 1A9YA 2UDPA 1FDTA 2GCGA 8LDHA 2CSUA 1KC1A 1SNYA 2EIHA 1PS0A 3VZRA 1MUUA 3BMOB 1DB3A 1E3IA 1NXQA 3EDMA 3EYWA 3ZW9A 1GAEO 2BH9A 3TDKA 2HDHA 4ID9A 3O8QB 5A4DA 4IDBA 1VKNA 4PZDA 3E9QA 5CDGA 5ER9A 4L73A 5ILOA 1ZMOA 3IC5A 3U9LA 4AJOA 4X54A 2X1HA 4FBGA 4NBRA 3PIDA 4BKRA 5ICMA 3OFSA 4TROA 2HJRA 3OP4A 3Q9NA 3JQAA 2UAGA 1H6AA 4DBVO 5LDHA 4OOEA 2ZJ1A 3U49A 1I2ZA 3DOOA 4OIMA 1YL5A 4QXMA 4EW6A 5F3RA 1GCOA 2UUOA 2D5CA 3O38A 3VZSA 3ZV4A 3LT1A 4OSOA 3WMWA 1B7GO 4BIIA 1KY5A 3PEFA 1CERA 1Q2XA 4BVAA 3QE3A 1BTOA 4PFJA 2Q1WA 4BNKA 5ES3A 3CKYA 1M75A 4IM7A 3RC9A 1YDEA 2AG5A 1BDBA 3S2EA 1JWBB 3WSWA 4W82A 4Y67A 3JQ6A 4D3FA 5F5NA 4WEOA 3ZWVA 2BI7A 2C0CA 2CFCA 4JK3A 4MVJM 3P2OA 4W7HA 5L53A 3WTCA 3QV1A 1V0JA 3RFXA 3IUPA 2UUPA 4L4SA 3VTZA 3V2UA 3NJ8A 2AG8A 2QZZA 4QX6A 3EMKA 4XRGA 3EW7A 4LW8A 1GEEA 3ZN2A 1PL8A 4E4YA 2JKVA 2PKQO 4ALIA 3ZU3A 2CVQA 3K9QO 1TVEA 1V8BA 4PLGA 3FRJA 3PLRA 4KTVE 5EQFA 3PJFA 3VPXA 3GDFA 3VAZA 4RO0A 1ZBQA 4UUMA 2IYOA 4CLXA 1EK6A 1IPFA 1IL0A 3WGOA 1R4MA 4GX2A 3RBVA 1UDCA 3K6JA 4PG4A 5L4NA 1U5AA 3C24A 4W99A 4Y6SA 1BW9A 1LSUA 5A3VA 4E33A 3KV3O 1MG5A 3TN7A 1PX0A 3OMLA 2VWPA 5DNAA 2X86A 1ADFA 1GTMA 4BOYA 4R5MA 3FF4A 3W8EA 4H16A 4PLHA 1LC0A 3A9WA 4HUJA 4YJGB 1BRMA 3D4PA 3QWBA 3GR6A 5B37A 3I6IA 1RYEA 4MIYA 1HYGA 1LNQA 1C1DA 3ZU4A 3KETA 3H3FA 2C29D 2PD3A 4OGWA 4CMAA 3KYBA 3NT5A 2RH8A 2VRBA 3H4VA 3TRIA 4RORA 1HEUA 1Z6ZA 4B3HA 1PQUA 3HFGA 4OQZA 5JAZA 1BWSA 2X0JA 3FSRA 5ITWA 4IDGA 1UZNA 4R41A 1Y8RB 3I52A 1E1LA 2I3GA 2YZ7A 4Z3DA 3X2EA 1SOWA 4DBZA 4FOSA 3BMQB 1KERA 3NT2A 1QXSA 5JAMA 4PRLA 2OZPA 4I5GA 1O89A 4FJ2A 3KLMX 1WZIA 5ADHA 3I9LA 3W4KA 1Y7TA 3RUCA 4C7JA 1M6WA 4J0EA 4NBWA 5DN9A 1BMDA 3GLQA 4F3YA 1QLJA 2B69A 5K9ZA 1Y81A 4BV8A 4BO5A 2Q46A 5BSFA 4Y6PA 3RBXA 5TSDA 3RJ5A 1IHYA 3RUAA 2JHGA 2NLOA 4M49A 4CV3A 3ZZNA 2O3RA 4LN1A 4A03A 4WNCA 3WYEA 1T1RA 4ZD6A 1LSOA 3JQDA 4NQZA 1PIWA 4DIFA 4F6LA 1X7GA 4KQWA 3E18A 4AJKA 1JVBA 3BYZA 2C7GA 5IDYA 4WLVA 4B4OA 4RJTA 2PGJA 3P2YA 4JROA 3K73O 1E3JA 4IQ8A 3HADA 5DBIA 1LSJA 3IDSA 1MV8A 2EEZA 2IZ1A 3BXXA 4A26A 1YB1A 4LRSB 1XWFA 1PJQA 2E37A 1PQWA 3TWOA 4CQMD 2FN7A 1VJTA 1DEHA 2A92A 2ZCUA 4D43A 3BZUA 1PTJA 3RASA 1IZ0A 1A27A 5BQFA 1E6WA 5LC1A 4NJOA 3NTRA 5DOZA 1HF3A 5HA5A 3I9NA 1WZEA 4YEDA 2O3UA 4IDCA 3AFNA 1NNUA 1RM0A 4GSKA 2QIOA 4II3A 4E2YA 4CLOB 2V6FA 2DPHA 4B3JA 1GV0A 1IB6A 2C20A 3ASVA 2Q4EA 3FNEA 2HMUA 4C7KA 4OO3A 1DRVA 3JD2A 4PN3A 4K9DA 4XIJA 2W2KA 5I7FA 3IJPA 1VSVA 1HDCA 3GDOA 2D8AA 3RFTA 1LI4A 1HETA 3Q0EA 2EHDA 2Q1TA 3OBBA 3SX2A 3INTA 5TC4A 1QV6A 3GH3A 3AI2A 4BO9A 1I01A 1KY4A 2YFHA 3JQFC 3F1LA 3NGXA 4H7PA 3U09A 2DBZA 4RF5A 4BB6A 1B8UA 2CF5A 4RVDA 3G17A 1EUZA 3WTBA 4YVFA 3A14A 3JTMA 5IN4A 3F3SA 5T67A 4JQCA 2B5WA 2NU9A 2GZ1A 2UVDA 4L8VA 2W2LD 2AA3A 4NFSA 5G4LA 1ML3A 2BD0A 4H3VA 3BTUA 3RUHA 1U9JA 2AE1A 4XB1A 4CLRB 4FGSA 5T8KC 3WGTA 3FNHA 5KIAA 1I3KA 3AOEA 4INAA 4YACA 2XAAA 3HDJA 4HKTA 1LDMA 3AU8A 1HLDA 1LDYA 4M87A 2PWZA 3NTOA 3DHNA 3ZV3A 1JKJA 2NVUB 4DPMA 3TJRA 3DBLA 2EGGA 3I9KA 4CM4B 4OYRA 1YOVB 5CEJA 3NDJA 4MP6A 3H2ZA 2DFVA 1LU9A 4Y9DA 1LX6A 4CV2A 4R1UA 2RAFA 2JAHA 4CUZA 3Q11A 3GOHA 1YRLA 1D8AA 4IDFA 3IMFA 4I5EA 2ZCVA 3Q6IA 1KETA 4Z0HO 4DMMA 2QZ9A 4IMRA 2BFMA 4PG6A 4E32A 3JYPA 5G0WA 3S2FA 5TRTA 1XQ6A 3DAPA 2G82A 3ANMA 3ORFA 1WLYA 1PGOA 1P0FA 2WM3A 3AY6A 3NJ4A 4ZHSA 1YS4A 4ND2A 1MG0A 1PEDA 3JQFA 3NUGA 1JQBA 4CMHA 5U4QA 1WAMA 4CQMA 4LCEA 5A9SA 2FP4A 1U3TA 2ZTLA 5A03A 3CUKA 4JBHA 5EERA 4WUVA 1DRUA 2EP5A 2IXBA 3BTVA 4M8SA 1C1XA 1TLTA 1Y8QB 4CL3A 5JDCC 4ROSA 2YHIA 3JD0A 5G0TA 4BO1A 1BXGB 4TMFA 4LISA 4NBUA 3HQ4O 3I9OA 2G1UA 3WQRA 5IZCA 2HCTA 3FBGA 4RPHA 3KZVA 4TVOA 4HBGA 3GVXA 2Z95A 3PYLA 3LC1O 3GEDA 5T8KA 5JCJD 2VZ9A 1YVEI 3VOSA 1EFLA 1GZ3A 3E5RA 3ETGA 4J43A 1K6IA 3CSDA 5BSGA 3O26A 1HE4A 4OKIA 3RUDA 1G1AA 3V1TC 4CPDA 1EE2A 1NFQA 1PWZA 1A9ZA 1PZHA 2DLDA 3PHLA 1QYXA 4YB8A 4B7UA 4BL5A 4DL9A 4EDFA 5DOVA 3I5MA 1DBVO 3UXYA 1FDUA 3PLNA 4YT2A 4BNLA 4FSHA 4YJHA 1H2BA 2DQ4A 4WOJA 4CLHA 4DREA 2OGUA 3G3EA 4J9VA 4EUEA 3DXFA 4M86A 3ZHZA 4BGUA 3GC6A 4UULA 1A71A 2O2YA 4CMJA 2OOSA 5KJFA 4LMPA 3FR8A 4A5OA 4EJMA 3ZGYA 5K6AC 3ZV6A 2VUTA 3IKVA 5ER6A 2ILTA 1UH5A 5G2OA 1U3VA 1GQ2A 1Q7BA 4BO6A 2W2LA 1ONNA 2DC1A 3DC2A 5HS4A 4KMSA 3HSKA 4LVUA 1WVGA 1LQTA 3NDIA 3NYWA 4AJ1A 4JBGA 1KOLA 4BQPA 1HSOA 4IS2A 5JDCA 3S2IA 1PWXA 3U3XA 1OC2A 4D3SA 1Y1PA 1DPGA 4NFHA 1YE3A 3ZU5A 1TXGA 2FSVA 3PZRA 3PJEA 4GLLA 3TZKA 4E5MA 4II2A 2Q2VA 3RU9A 1LLQA 4WLUA 3LU1A 3IQDB 2YFQA 5IF3A 2LDXA 3I23A 1LBEA 1PZEA 2O2SA 4QFDA 3AW9A 2GZ2A 4YCAA 2EF1A 2WD8A 4EEZA 4OXKA 1HLPA 2FR1A 4IY1A 1MXHA 3RUEA 4I5FA 2VHYA 1JW9B 5G0VA 4JP2A 2X9VA 2VT3A 3FHLA 3GUYA 4R1NA 1YJ8A 2VUSA 4Z9YA 3LYLA 3DDNA 2E49A 5KVSA 4EJ0A 4ZRMA 3PZBA 1WDMA 1UJMA 3B70A 1HDXA 3ITKA 2X6TA 5K6AA 2OP1A 1PJ3A 5JDIC 3ZWNA 4CR8A 3EVNA 1BDMA 3QWIA 3K96A 3V2GA 4J1QA 1CETA 5JPIA 3NTQA 2AQ8A 3VZQA 2OXIA 3TZ6A 4BB5A 3KOUA 3GAFA 3MZ0A 1E1NA 1QRRA 2A35A 2B0JA 3HG7A 5TJ9A 3AY3A 3RUIA 2J5QA 5JCJA 5L7WA 3RKRA 3NDRA 4Q3DA 4UUPA 1PZFA 2D0IA 2VOEA 1E3WA 1R66A 2NU8A 3JYOA 1JWAB 4I8XA 2X0IA 3NKLA 2W8ZA 1GYQA 4JCOA 2YHIB 5TF4A 4CM9D 3U4IA 2B35A 2JFFA 4NIMA 1KS9A 5IDQA 4BO4A 4R1SA 4FJ0A 2Y0DA 2GN9A 2X5KO 3ZH2A 1UP4A 2ET6A 5C7IO 2FSSA 2EP7A 1NR7A 1QV7A 3FTNA 2O50A 2JD2A 1GU7A 2HRBA 3GPDG 2D4AA 3ZWMA 2AEJA 4RQTA 5BNTA 3ZWPA 3BMOA 5JMPA 4YT4A 5AYVA 1EBFA 4PVCA 2A9FA 2AEMA 3MJVA 3RI3A 4BGVA 2BKAA 1PGQA 3O8QA 2EKQA 4YBZA 4XA8A 4PLCA 1XYGA 3TFQA 1UZLA 1WMBA 5I8ZA 4MPDA 1E7QA 3SLKA 5C5IA 3KB6A 4FFNA 1ZEJA 2YY7A 1KC3A 2WTBA 1MFZA 2HSDA 4IQGA 1DXYA 4IXTA 2PR2A 4AJ2A 5T64A 5JCXA 2FRDA 1T1SA 3OA2A 3KSDO 1DDOA 4YT5A 1W6UA 3GAZA 4CMKA 1ADGA 1B16A 2AEFA 4NU6A 2GDZA 2HKIA 2X9NA 5JDIA 5TJHA 4J4TA 3MWDB 1LXCA 4LCJA 5G4KA 4DUPA 3DWFA 4TSKA 2IZ0A 4O0LA 2FZWA 1H6DA 1SEPA 1ZEMA 2PLAA 2XOXA 3FN4A 6ADHA 4GL4A 3GNTA 4R68A 1YB4A 4RLHA 3CMCO 3W8FA 2GUGA 4L74A 1XU7A 3T4EA 3FWZA 1E7SA 1CF2O 1B26A 2OUIA 3C7CB 1I33A 3GZNB 3HUDA 1YBVA 3QJ5A 3WLFA 5IJZA 4AJEA 5A3JA 3UICA 2QG4A 2ZQZA 3B1JA 4DPLA 4L76A 4QTZA 3O03A 1GR0A 3PFWO 1CEQA 1KYQA 3NEPX 3DO5A 1X1TA 4MVJP 4ESOA 4J90A 1NQTA 4DLLA 5C3MA 4NBTA 3SBOA 4EYEA 1O5IA 1YJQA 3WYCA 1R0KA 4HFMA 1M2WA 3L6EA 3WMXA 3BHJA 4Z0PA 4E6PA 3LT4A 1RM3A 4BNHA 3OIGA 1EE9A 4L4XA 1UZMA 4OH1A 5I7SA 3Q2KA 3BA1A 2AHRA 3ASUA 3GGOA 5C7LO 4YT8A 4Y6RA 1T2CA 2WD7A 1MGOA 5U9CA 2VOJA 2ZK7A 3R0IA 4YYZA 3GGGA 1SZJG 2C5EA 2W98A 3L6DA 4NPCA 3JQ9A 1IOLA 3KLPX 2JJYA 1EVJA 4CMGA 5JY6A 4UUOA 3T7CA 4J1TA 2Q2WA 3GFBA 2OHXA 3U4HA 4GQAA 2J6IA 3GEMA 1SEVA 3PJGA 5IZ4A 2GO1A 5KVQA 3DBRB 4CM9A 2BHLA 2E6UX 1K6XA 1TT7A 3Q9UA 4GX5A 2HMVA 3QRWA 3VKVA 4YJGA 1U7HA 2HU2A 1Z7BA 4R54A 1VL0A 3DFZA 1VKOA 4ALMA 4XIYA 1EBUA 3AM4A 4WGGA 2B83A 4CV1A 3H9EO 1YQGA 2Y05A 1OAAA 1H6BA 3EK2A 3JYNA 4RL6A 2Y99A 1B3BA 2O23A 1W0CA 1DSSG 5JLAA 3FWNA 2ZYGA 4ALJA 1Y8RA 4FOOA 4FC6A 1U8XX 2VHXA 2X5OA 1LLCA 4PLWA 1HTBA 1X7HA 2OBNA 4ZU3A 1EFKA 3PQFA 4OJNA 5MDHA 4PLZA 1EDZA 1H9BA 1I36A 2CVOA 4XDYA 3BMQA 5FI3A 1Z82A 1K6JA 4XDZA 3PQEA 3RC7A 1ORRA 2CY0A 4BO8A 1NBOA 4GGOA 3MJSA 1MC5A 3KHUA 1N7GA 3ABIA 3N74A 3PDUA 4LGVA 3K5PA 1A7KA 1PJLA 2ZYAA 1U1IA 2GN6A 1TEHA 2BRUA 3EUWA 3GA0A 3G1TA 4P4NA 1NHGA 2ZB4A 4R3WA 1R4NB 3KTDA 3VTFA 2I76A 5I7VA 3F4LA 1DHRA 2IODA 3SC4A 4BQRA 1U3UA 1MXFA 3PHJA 4FD3A 3PWZA 3KXDA 1UR5A 5G4KB 2IRWA 1HSZA 1KVUA 1PS8A 3WSVA 4B4UA 2Q3EA 2Y0EA 3QIVA 4YPOA 5IFLA 3F6YA 3UVEA 5ICSA 4HWKA 3RQSA 4IJWA 2VWHA 4CMBA 1ZUD1 1GQYA 1N9GB 1J6UA 2H5LA 1DLIA 3I83A 4IDAA 3ZHBA 2AQIA 3CH6A 3ZNQA 1QLHA 1XQ1A 3H5AA 5CDYA 1AN9A 3RKUA 1OBFO 3MCVA 4DVJA 5JFOA 2GPTA 4PLVA 4DGSA 5HWSA 1N5DA 1RYDA 1UP6A 1TA4A 1P1KA 4XQCA 4BNNA 1VRWA 2QRKA 2J3JA 1GEGA 2PV7A 1NX6A 3S55A 4CLOA 2HQ1A 2WD7B 1P74A 3WG9A 1NFFA 3NT4A 1DAPA 2YDXA 3QVOA 4KWHA 2JCXA 4KOAA 1ULSA 3E9NA 3OSUA 3MJCA 1CJCA 3WXBA 4FFPA 3UW3A 3R1IA 2X22A 1HE3A 4XQGA 4A2CA 5DT9A 3R6DA 3W4JA 1DIHA 4RPJA 1I3MA 1LA2A 1O0SA 2WJPA 1RWBA 2IZZA 4WLFA 4IQ0A 4D44A 4GWGA 4NU5A 5COAA 3K30A 3DZFA 2JAPA 1LLDA 2NU6A 4J4BA 1P33A 4MOWA 1PU2A 4Q9NA 4EEXA 1LUAA 1B8VA 1NFRA 1UAGA 3PJDA 5A05A 4D45A 4JGBA 1C0IA 1T2FA 2RH4A 4PZCA 4CMEC 2X58A 4MP8A 1DIGA 3TZHA 1GDHA 3W6UA 1WDKA 3JQ8B 3WGGA 4E31A 4CLRA 1F0YA 4JXKA 5F1OA 3OICA 1IZ9A 1SBYA 2B4QA 4DA9A 3AM3A 2RCYA 4GBJA 5EL0A 2IYPA 5L95A 1HDOA 4URFA 5ILGA 1R0SA 2NVUA 4J0FA 1HXHA 1DIAA 1G0OA 3ZWCA 3E5MA 1AHIA 4CM4A 1YOVA 1UDAA 2OFPA 4MO2A 2QRJA 4ND5A 4P4LA 4PLFA 1BG6A 2VQ3A 1DIRA 1C14A 3QWFA 5ENVA 5CHEA 3M1AA 2G76A 4AJPA 1X1EA 3FBTA 1JU9A 2ZB3A 3W8DA 3MWEB 4AJ4A 1E7YA 5FWNA 4BNYA 5F1KA 3RU7A 3HJAA 2A94A 2RBEA 3ETEA 2HK7A 4JLWA 3F1KA 3ZWYA 2NM0A 3I9MA 3WGQA 3EZLA 4P4GA 1GY8A 2OO5A 3QWAA 4FS3A 4J9UE 4QQRA 4TKMA 4A27A 2GSDA 3CMMA 2VCYA 3HZZA 2Q4BA 2B37A 1JVSA 4GWKA 1P1IA 2QRLA 1GZ4A 4ONEA 1FF9A 1Y8QA 4RCVA 4B7XA 4BKUA 4W4TA 4CMEA 3L6OO 1T4DA 4FCCA 5F21A 1BXGA 1HT0A 3TL2A 4D46A 3JQ7B 1M76A 3I3OA 1YGYA 2P91A 5L9AA 5CPBA 1ZK3A 3V2HA 3H8VA 2ZTMA 3WQQA 1YXMA 4O5OA 3LDHA 1YKFA 2HRZA 3SXPA 3M2PA 3JQCA 3AOEC 3S8MA 3JV7A 1D1TA 1P1RA 2Q99A 3HB5X 2EV9A 3H9QA 3IJRA 3KUXA 2YJZA 2O7QA 4NK5A 4UVDA 1B0AA 4RZIA 3CTMA 1D3AA 2NV6A 2B5VA 4D7AA 3TQHA 2CF6A 5A02A 5JNLA 2PZJA 1JKIA 4ND4A 4QO8A 1Q0HA 3SJ7A 3V1UA 1XSEA 2WYWA 3OA0A 4H15A 4NG5A 4TKLA 4MVJF 4Q3CA 1NHWA 2D5AA 4Q39A 4K6CA 3IIEA 1O94A 3GVIA 4CM1A 5CFZA 1DJNA 3OH8A 1U3WA 2BGKA 1K3TA 3JCZA 2HMTA 3OETA 4XJTA 5KJCA 3DAGA 2DVMA 4ZQFA 3FD8A 1T4BA 1P3DA 2POQX 3HN2A 1VJ1A 4GGPA 5GZ3A 2H1SA 3X2FA 2P5UA 3WFJA 3IP3A 5THQA 4AJNA 2Q2QA 4WCFB 3JQBA 3AY7A 1NTOA 1PR3A 4HY3A 4RZHA 3TZCA 1R16A 4O1MA 2C5AA 1CYDA 3D5TA 5IZCC 1IHXA 1FDWA 3SC6A 4HX5A 2Z5LA 3D1LA 3UN1A 3A28A 2CZCA 5GMOA 3H5RA 4G65A 1C0KA 3K8ZA 4GVXA 1P1HA 3H5NA 4WECA 2DT5A 3BIOA 5IN5A 5TT1A 3OF2A 1ZJZA 1ENYA 4GMGA 1ZK0A 1E0DA 1U4SA 3GMDA 4GVLA 3LC2O 3S2GA 3WR5A 1WNTA 1NAIA 3UKOA 2DBRA 2UV8A 1E7RA 1XLTA 1Z45A 1I2BA 3DBHB 1SB9A 1QYWA 3L4SO 3ANLA 3U62A 4ZQGA 5JO9A 1VM6A 2DBVO 3WFIA 4B79A 3F5QA 3WGIA 4IGEA 4CM8B 2WYUA 3FTPA 3ZDFA 4MKXA 3OIFA 4XD2A 4B8ZA 1UP7A 1V35A 2EJWA 2R6JA 4CM7A 4WJZA 3VH1A 1A4IA 3BAZA 2HJSA 2I9PA 5DCUA 5JBIA 3PK0A 1EMDA 1R0LA 2P9EA 3JD4A 3T4XA 1DJQA 2BFAA 4AJLA 1PGNA 3PHGA 4UVGA 4NMHA 3TF5A 3IAHA 5EQDA 2HUNA 4MVJI 3VZPA 1GPDG 1UAYA 3WQSB 1EUCA 3C7DB 4MINA 5I8WA 4QSMA 4DC1A 1T25A 1K5HA 4BNXA 3A4VA 4Z9FA 3QVTA 3W1VA 1XIVA 1ZKMA 1EDOA 1Y5MA 1KEPA 1X15A 2VN8A 4PIVA 2X23A 3VH3A 2ZJ0A 2I6TA 4J7CA 5A9TA 3D3WB 3UHAA 1KEVA 1A7AA 1O6ZA 4KZPA 3GNSA 2IEDA 3FI9A 3QWHA 1H93A 3VC7A 4GPD1 4GH5A 4QEDA 2FPIA 2Y93A 4U0JA 2W90A 2PKQP 2CDAA 4AG3A 7ADHA 4J3FA 1KVRA 1LQUA 4XYEA 1LDNA 4M54A 3PDJA 2FPGA 4CQLB 3HNPA 3LF1A 5L4LA 2GR9A 2JCYA 1ZXLA 3VH4A 4DYDA 1PJ2A 1QMGA 4HNGA 3IL2A 3U4CA 1Q7GA 5DP1A 4MVJD 4KDEA 5A9RA 1OOEA 2AQKA 5BR7A 4IDEA 4J1NA 2NTJA 5EMHA 4B8WA 4N5LA 1Y9AA 2YW9A 3LQFA 1P0CA 3HWRA 2CMDA 1DFHA 3WBBA 3R3JA 2VTEA 1PL6A 5DBGA 1QR6A 1L7DA 2GN8A 3WIDA 3DHYA 3GZNA 5JAIA 2D59A 1JAXA 4YQZA 3GVPA 5IDWA 1I10A 3UFXA 4J49A 1ZW1A 3PVZA 2WMDA 4XEHA 4B7CA 4BMSA 2H6EA 1K2WA 3AU9A 3NRCA 4WNIA 1XDWA 3P7MA 1M67A 3HN7A 4P8RA 1DFGA 1H2HA 5EJ2A 4JN6B 2D1YA 2ZB8A 3PTZA 1DIBA 5BNIA 1BHSA 3OEWA 2C07A 3LVFO 5KVVA 3ICCA 3HHPA 2PGDA 3OIDA 4DQUA 1I32A 3COSA 1HZZA 2RHRA 3GUCA 3PQDA 1OMOA 1E6EA 1LRKA 3B6ZA 3RC2A 4F46A 2JD0A 4J4HA 4DTIA 3BTOA 1N1GA 1ZK1A 1LJ8A 3DZHA 1MX3A 1PGPA 1LDBA 4HV4A 3KO8A 3EAGA 3PYXA 2IXAA 2NADA 1A72A 3OQ1A 3FNFA 3ST7A 4FJ1A 2P5YA 1NP3A 1QYCA 2XXJA 2H9IA 1EQ2A 1JDJA 5JAQA 4FW8A 4NJMA 4BNIA 2JD1A 1DRWA 2QQ5A 3F5SA 3GVHA 3OM9A 4P22A 3DBRA 5BSEA 3JSAA 2Q1UA 2Q50A 2GERA 1N8KA 4R9SA 1AXEA 8ADHA 4E2WA 4XGIA 1U2DA 3C1AA 3VDQA 1PJBA 3OECA 2NTNA 1UXKA 1Y9EA 5L7YA 5A5EA 3RSHA 1BVUA 4BNGA 1ADCA 5GY7A 3I9JA 3QVXA 3OHSX 1Q0LA 5DCYA 4F45A 4PG5A 4D42A 5TNXA 3L9WA 1FXSA 5EESA 1IPEA 2JFGA 1SMKA 5T6BA 1VSUA 4FC7A 2G5CA 2Z1NA 2GLXA 4KDFA 2BI8A 2Y1EA 5TIIA 4CL8A 1X7DA 1X13A 2UYYA 5AQ1A 5FF9A 1UXHA 3NGLA 4E13A 3N58A 1HDRA 2BGMA 2OORA 3EGOA 3LLSA 4DC0A 2NQTA 5KOIA 2Y1OA 1JLLA 2PGLA 4KQXA 2C2YA 1M66A 4JJIA 4D79A 1PQPA 4DLAA 4YAGA 4YAEA 3ETDA 4MVJA 1E77A 3DZGA 3AI3A 1NQOA 1ENZA 4UVEA 1F14A 4CMIB 4HADA 4K26A 4TRNA 1P1JA 1DAOA 4XGNA 4TZTA 1TI7A 3I4FA 4G5HA 1V9LA 4YJFB 5AXBA 3CPSA 4NR0A 3ZW8A 5CEFA 3JQ9C 1U4OA 4IPTA 2B36A 1LRJA 1SCUA 3VPHA 3RJ9A 3A1NA 3D5QA 3R3SA 1BGVA 4LRTB 3ZWBA 3K92A 1R4NA 1YL6A 2BLLA 4QT0A 3QSGA 4D0SA 4XGKA 2J3KA 3MTJA 2HO5A 3RC1A 4A73A 4J2HA 4TRMA 7MDHA 2ZQYA 4S1VA 4EUHA 1EVIA 1T2DA 2ZB7A 1NVGA 1XELA 4GKVA 1H0KA 3Q2IA 3GNQA 5DULA 2D2IA 1PL7A 3EY4A 2I67A 5CG1A 5KJEA 4GKBA 5A5FA 1E7WA 4GLOA 4XQ9A 3D4NA 5JYDA 1N9GA 2VRCD 2VWQA 4O63O 2NQ8A 5H83A 4NH4A 1U8FO 1J5PA 4XR9A 1XHLA 2EW8A 3TOZA 3U4DA 4ZGWA 3VPFA 3PYMA 2O3QA 3AUUA 4NK4A 1Z74A 3UGKA 2DUUA 4IZHA 1NPTO 4AJJA 2DU8A 2Y1CA 1SPXA 1ZNQO 2GNAA 4PLYA 5BSHA 3QA9A 3GGPA 3KBOA 1JA9A 3B1FA 1HE5A 4LVCA 1EVYA 3CZMA 4ZRNA 3WNVA 5EN4A 4GX0A 2NNLD 3AUAA 4L9RA 3GN2A 1LDGA 3KEOA 3D3EA 5KCZA 4DWVA 3H9UA 1AHHA 4NHEA 3TSCA 4C4OA 3OQBA 2NWQA 1I5RA 3DQPA 4MVJE 4PLTA 4BNTA 3KEQA 3HDHA 2YQ5A 2J3HA 1HWYA 1ZSYA 3ROMA 4QUKA 2ZYDA 1ONPA 3LT0A 1CDOA 4WCDA 4XYLA 1I24A 5DDIP 4YJDA 1HKUA 1WW8A 5BNFA 1YBAA 5THKA 1W73A 1H5QA 4TRRA 5L40A 3LK7A 2FPPA 3PIIA 4BNWA 3UCXA 3DOJA 4CM6A 1BXZA 1RM4A 4B4WA 1XKQA 4U5QA 2G0TA 5CDTA 1VPDA 4NJMB 2D3TA 4ALKA 4BO3A 2E48A 1Y5RA 2O48X 1WDLA 4AVYA 1EUDA 4CODB 1ADBA 2VUUA 5DP2A 3WLEA 4YTEA 2C2XA 2PA3A 3D4OA 4ITUA 3KVOA 3W4IA 2YUTA 3WGYA 4ZQEA 4TRJA 1VE9A 5TT0A 3VVCA 3PP8A 4IMPA 1TB4A 2R00C 4RPLA 3BHIA 4FPXA 3JQ8A 1F8GA 1H9AA 2P4QA 2PH3A 1WMAA 2FWMX 1Z7EA 4OQYA 4WE3A 1ZO8A 4MKZA 2WEKA 5AXDA 2Q49A 3ONFA 5L3ZA 3EZYA 2ZATA 2ZKLA 2GRAA 4YRBA 4XRRA 2FHSA 4KTTE 2DPGA 4XZ3A 1SC6A 5AXCA 4EZBA 3MEQA 1N1EA 1V3UA 4J7UA 1PJ4A 3B1KA 3F9IA 2TMDA 5DBFA 1LRLA 4XKJA 4E12A 1CRWG 3AM5A 4E0BA 5JE8A 1IYZA 2VT2A 3BMCA 2V65A 5ENDA 3GT0A 4D3DA 1W8DA 3WIEA 5F5LA 4EITA 2BFPA 4LSWA 3H2SA 3I6QA 4L4RA 1A4UA 1H6CA 3CE6A 5AVOA 2O4CA 5T5QA 1GADO 1RKXA 3W6ZA 2VRCA 4EJ6A 4K28A 1JAYA 1YQXA 1YQDA 4YXFA 2C59A 2WSBA 3H6KA 1E92A 2VHZA 2CDBA 2DTDA 3OJOA 3LF2A 3PWSA 3WGHA 4J1SA 3H3JA 3TFOA 1IULA 5TX7A 4Z3KA 1B2LA 1ZK2A 1TT5A 3GY0A 4G2NA 4WCFC 4K1LA 4WLOA 5B4UA 1RJWA 5TLSA 2I5PO 2O7SA 3DBVO 4FFLA 2R00A 4I9NA 2HK9A 3JQ7A 2Q45A 1L7EA 5CDUA 3QVSA 4Q3BA 3DZIA 5LDGA 4ILKA 3ZV5A 3PPIA 4DXHA 4NZ9A 2AE2A 2GN4A 1P1FA 1NQ5A 4UEOA 2A4KA 3PGJA 1CQJA 3JQEA 1GD1O 1KVQA 1B14A 4RF4A 3GK3A 3OJLA 1PZGA 1YO6A 1CWUA 2XPCA 2Z1MA 3HB4X 4IS3A 1ZZEA 3I4CA 3RWBA 3VPSA 2QX7A 3AI1A 3QVWA 2F1KA 1J0XO 5G0SA 3U5TA 2EXXA 4OXNA 1IY8A 1DC3A 1ISIA 1QORA 3ENNA 4JP3A 4RGBA 3KRTA 3VHRA 1G6KA 3GZ4A 4NNJA 5ITVA 1HDZA 4WLNA 4BUCA 1YDWA 3IP1A 4DLBA 1XCBA 4U6SA 3D7LA 4AL4A 2Y66A 3DOCA 1VC2A 4DIBA 3CZRA 1P9LA 3KYCB 3SEFA 3F46A 1I3LA 2OBYA 4AFNA 1B15A 1LLUA 2J5KA 3UH1A 3FPCA 3EHEA 4Q3NA 3C1OA 2B4RO 1B3RA 4MIEA 1E6UA 3H7AA 3AFMA 3NAQA 4BNUA 4ZA2A 1SOVA 2JFHA 4GMFA 2I66A 4TQGA 1WPQA 1T2EA 2PY6A 3GVCA 2WWRA 3UUWA 4PCVA 5KWEA 1N2SA 2AXQA 2SCUA 1OC4A 4WCFA 3QY9A 1NWHA 1SO8A 5LCXA 2JCVA 3Q1LA 1O9BA 2P9GA 4JIGA 3TOXA 1GL3A 3DZJA 3GRKA 1A5ZA 1ZVMA 1OZAA 4OM8A 3UCEA 3B20A 1FDVA 4ND1A 2VWGA 4GAEA 4HP8A 1OFGA 1F06A 4ZQBA 5IG2A 1OI7A 4FN4A 3DB2A 4E2XA 3ROKA 3VVBA 2V6GA 3ADOA 3Q3CA 2RHCA 2ZTUA 4A10A 3CEAA 2GD1O 2NSDA 1ZSNA 2GF2A 1RPNA 1EVZA 2Y68A 5IXYA 2C7VA 5EINA 4L0QA 4BHTA 4O59O 3JQGB 4Z0TA 3GHYA 1I30A 4IBOA 3DBHA 3GN1A 1S7CA 3AJRA 3L4BC 1MFPA 1ZXBA 4WKGA 1DFIA 1R15A 1LDEA 3BMCB 3RIHA 2HK8A 5B4VA 4HXYA 2V6MA 4CM8A 3C8MA 1CQIA 3MJTA 1HYHA 2PH5A 3M6IA 2QW8A 1ISJA 2BELA 4J7XA 4WOKA 2Q1SA 2EKLA 3KYDB 4DMLA 3K2BA 1IE3A 3L07A 3PGXA 5HM8A 2PNFA 1V3TA 4NDNE 2IEBA 4I5DA 3LT2A 1LEHA 4MVJH 4KP7A 2HMSA 1WXDA 2PZKA 3DMTC 5KKAA 4DQXA 4IJKA 3VH2A 3WGZA 4RLSA 2FY8A 5I7EA 1P44A 4M89A 5T57A 4BKOA 1TT5B 1VJ0A 3JQBC 4YWJA 3A06A 1AE1A 4ZQHA 1KEWA 3C85A 4A0SA 1MP0A 3GF4A 1ONOA 2X5JO 3JD3A 1F17A 4BV9A 2B4TO 4CJXA 3JQAB 2EW2A 1WP4A 1QSGA 2PD4A 4ZVVA 5H82A 3D3WA 5FYDA 2VHVA 4UVHA 3BHMA 3M2TA 4DYVA 1ISGA 4UVIA 4GX1A 3DFUA 4FB5A 2DUWA 4FFMA 3TZQA 4OSPA 3ZWWA 4TWRA 2J3IA 3P5SA 5TQVA 3AUTA 1W4ZA 3PHHA 4AICA 1C3VA 4BKQA 1NM5A 3F4BA 6LDHA 3DZBA 2FR8A 1PGJA 4IJUA 3WWYA 3IS3A 4QECA 3L4BA 1U7TA 2WE8A 2WDZA 5KTKA 1FMCA 2FMUA 4RVHA 4XWYA 2YYYA 4CQLA 4N5NA 4Q3EA 1GFSA 1XU9A 1LC3A 2NUAA 5HRUA 1E5QA 3G1UA 4EUFA 2BGLA 5F1PA 5HTOA 3VKUA 1EQUA 3BTSA 3KSZO 4D0RA 5JSFA 3DEYX 4ND3A 4YAIA 2P4HX 4O6VA 2DAPA 1I3NA 4PVDA 3PRJA 2YQ4A 4J6FA 1UXJA 1V6AA 1XA0A 2AMFA 3L0DA 4XB2A 1L1FA 5FEUA 4W6ZA 4RVFA 3NV9A 4K6FA 1HYEA 3DMTA 4Z9XA 3ZCXA 4ZN6A 3EVTA 3BMNA 2O3SA 3UAGA 3AWDA 2O3TA 2WE7A
chains in the Genus database with same CATH superfamily
1T0BA 3RD5A 1J25A 2BN4A 1YKSA 5AKKA 3OOJA 3MMPA 1Q7CA 3F71A 5H59A 1SQSA 2ERYA 3G79A 2ASVA 3T7EA 1RRFA 1RQGA 2OZKA 4O4IF 5FYQA 3A6LA 3D31A 4QBIA 2V5VA 1TJYA 5FOTA 4B75A 1U6JA 1NE7A 4GXQA 2C54A 4WBNA 5TT1A 1LKZA 3UFBA 1U0SY 2IYZA 1KDVA 4NCHA 4GMHA 4BS9A 4D4LA 1GCAA 1GZ6A 1Z9BA 3GPIA 5K0ZA 3EC7A 1PJZA 4OQNA 1QG0A 1B2RA 3RNOA 2DQYA 3GHHA 1Q21A 3FCXA 2GESA 3OQMA 4MGHA 4HFRA 1Z35A 3VSCA 2WM8A 2PD6A 1G17A 3P20A 4O2RA 3UMJA 2VXOA 3WMEA 3CYFA 9LDBA 1ESZA 2I33A 2F3PA 3H65A 5MGNA 1SQ0A 1Z5GA 2J5RA 2BGIA 3I6BA 3VR0A 2X3UA 5F7OA 2PV0A 2JFYA 2RJNA 5A62A 4E2ZA 1NPDA 4LYFA 2ZTHA 1NPYA 3PIRA 4R3NA 3QEKA 5DP2A 3D9QX 2Y0CA 4YRNA 1PFVA 3TMKA 3O3MB 4RTOA 1SZPA 2R3SA 1O95A 1MB2A 3NQ41 1JB9A 2MHCA 1RRGA 3O31A 1WXIA 3TUIC 1KO7A 3USES 4E5NA 1G6Q1 1S02A 1ARZA 3L8EA 5HDQA 4TTRA 2YJ6A 3M7IA 4W9NC 3ZNOA 3FH0A 3ELWA 1MC8A 1AB6A 1D8TA 1NF3A 1UBHS 1O9HA 2E82A 3MGKA 3MUEA 4U02A 3RTGA 3VC3A 1VLJA 2ZBFA 3PI7A 3TW4A 2KW5A 1W46A 5BV2P 3KT0A 4URYR 1J49A 1CIPA 1QB7A 3AK4A 3OF3A 3M6WA 5EJ9A 1USGA 2F7SA 3HDYA 1FMTA 2O06A 3R7LA 1CUGA 1NUQA 5EXDA 4Q1FA 4OMUA 4IDOA 4DA4A 3PX2A 1J06A 4MWGA 3TCNA 2I4RA 3MTGA 3GJ5A 3H17A 1TYAE 4JL8A 3WSTA 2JH3A 4HD8A 1EEHA 1HYBA 2BFOA 1SVLA 1G21B 3RU2A 2REBA 4BB9A 2FXIA 4MTLA 4UJ3A 3OC0A 4DC9A 1JFTA 5BVGA 2VHWA 3TN7A 1M1UA 5BRNA 1P5RA 1LI5A 1NQAO 3EGVA 5FPHA 1KYXA 4GICA 4LY0A 5SYAA 1MLDA 4ZHQF 1ZJ6A 2ABWA 1OIXA 4M7PA 1AKNA 3T1NA 2H63A 1S2MA 3HJRA 4D74A 1FRFS 3NPAA 4UHDA 1NWCA 4V24A 2ZBPA 4ZJUA 2CLLB 5KKCA 5J1SB 2IZ6A 5FAXA 1G6OA 3R9IA 3SS9X 1P6XA 5IMSA 3GEEA 4GMDA 3A0RB 2GN0A 4P7FA 1G2QA 4R2WA 3AR5A 4LOHA 4DAEA 2PUBA 2JC3A 1JHVA 5C8DA 3CXRA 4G5RA 4HDMB 3H75A 1GG9A 3SIPA 2E9SA 1Y4SA 2YXEA 1P45A 4LZZA 4CG3A 4R5HA 1IJBA 1OUMA 1JIXA 4F2DA 1NTRA 1PL0A 1IBRA 2A1TS 5JIBA 1ENOA 3PFCA 1ZIYA 4FD2A 3EZ9A 1Q0ZA 3WBFA 3KPUA 4RQAA 1DO8A 1Z75A 5CW1A 2NUAB 3R3ZA 2ZRLA 4G85A 4RXMA 3C70A 3LXXA 3KV1A 5JXWA 3CVJA 5JYEA 3CO5A 3OUZA 3IODA 2A6PA 1OPRA 1COWA 1TO6A 1FK8A 4IXWA 4W63A 4EW1A 1OH8A 1JB1A 2HWKA 4WPGA 2HWXA 1KEZA 2AKYA 1BEEA 4HZIA 4F92B 1D1SA 1FMJA 2J0UB 4A6EA 4TKVA 4I1RA 4D81A 5JXJA 1SG6A 1B0UA 2NO9A 2V7XA 2Y1GA 3IURA 2WT8A 4NE7A 4Z7NB 4AKSA 4KVFA 2O52A 1CLUA 1WNFA 1Z29A 1IY0A 4M0DA 2CCGA 2YFKA 2XF8A 2W2KB 3BMNB 1JDPA 3O1JC 2PMEA 2JHAA 4HMOA 1MA0A 2GWHA 5E1MA 3WOHA 4CKYA 4EB6A 2VJYA 2A8YA 2JL1A 3DOFA 2OECA 3JU3A 1YRWA 2L42A 2XMRA 4M6WA 3PNSA 4NS4A 3V46A 1QKIA 3STHA 3K70D 2FN3A 1O8BA 3ND7A 1A7JA 4B4VA 1KNXA 1KJNA 3AJ8A 4FYYA 1O5OA 2Y1DA 2ONCA 1HDYA 2QMQA 2Z2YA 1L3BA 1NQWA 3DDCA 2EJVA 2VZ8A 3OCJA 3PR3A 4L0CA 1Y6QA 4PG7A 1E5LA 5DYIA 5TEVA 5L8VA 2PKYX 3DTTA 3TLYA 3IVRA 4WZAA 2D7CA 4JBIA 1JG2A 4FLFA 1N5IA 1QFJA 1NLFA 3AZPA 5K3FB 4P93A 1TL7C 2A5YB 3RYTC 1TTPB 4C30A 1QE5A 2ZRHA 2Z0MA 1NI3A 4DV5B 4HEQA 4AJHA 4BO0A 1UBEA 1V5FA 2D2EA 4R69A 4WK0B 2NU9B 5DMHA 4ZVQA 5IC5A 1JN0A 4HXEB 1T5SA 1A4RA 1XG5A 1XFDA 3PL5A 3QP9A 4Z8XA 1C8LA 5JSQA 4K6KA 2O0KA 1Z8NA 3GJ6A 3GZTB 4RDHA 3X1XA 2O3JA 4QRDA 2DHEA 3DONA 1M34A 3QLJA 1GPBA 5BV8A 5JUWA 2UVQA 3G85A 1L4UA 3MWLA 1YZLA 4DV6B 5I7RA 3BFPA 4H6WA 5B1SA 4JXJA 3LDFA 2R2GA 3ZWOA 3FHJA 1QIMA 3U39A 4MUAA 3C98A 1GARA 3CTPA 3A9TA 1UC5B 1RVDA 1UF9A 3AYZB 2LNDA 4BQIA 4XCVA 4N3CA 4EY3A 1VHWA 2IFTA 1ZCAA 3ZWXA 3ZI7A 5IVHA 2XVMA 3D3JA 2Q1YA 2EGHA 1QANA 1ZSVA 5DYGA 3ZK7A 2HQBA 4CI9A 1FTYA 1SULA 2ATEA 2SHKA 1GCUA 4WXYB 5DHPA 5B3AA 1H2RS 2VA8A 3D2LA 3VO2A 2WU1A 3RS4A 2GRJA 3ONEA 2GVNA 1HV8A 2I4MA 2ZRBA 3ZHRA 3DLHA 4TVBA 1DC6A 2Q5CA 3QTLA 4HDSB 4P31A 1ZU4A 3MJEA 1NN5A 1KU0A 1TEXA 1YVRA 4V0KA 1BKDR 1ZIXA 1EU1A 2DTXA 2I6XA 3IAXA 4IDNA 4WBSA 1EB9A 2BMJA 2GLTA 2C03A 2AW5A 1N8SA 2BTOA 4UBLA 1KU6A 3ET4A 3EULA 5IXJA 1MQ9A 1SB8A 1PUIA 2F2TA 3VXKA 1NC1A 3EJWA 2H51A 3CLSD 4EYKA 3O8CA 3OT4A 1U90A 2PLRA 2RK3A 4AF7A 3E48A 1PJSA 3K1ZA 3SX4A 4JMLA 4QFCA 4J2TA 1VHTA 3S1LA 2QRPA 1RBMA 2VSXA 2YN0A 3KP1A 2BFFB 2Z08A 3CGWA 3ELUA 1SG9A 1B6SA 1BVRA 1Y4AE 4PQEA 1NVTA 1VSTA 2ZGVA 3PE4A 3RCBA 4P83A 1PS9A 2ZBGA 2PKWA 1I80A 2DBQA 2PX8A 1JLHA 2WG2A 5DE3A 2VYVA 1Q5PA 2O9JA 3ADPA 4E14A 1QFXA 2Q7XA 3TPZA 4RQUA 4X8HA 1H1LA 1V43A 3OZRA 2IOQA 3ISVA 3QLVC 3FVQA 4RKQA 1GIAA 4KGZA 1H94A 5I4BA 1GGMA 5B1EA 4B3CA 2Z56A 2WPDD 4UUNA 1M34E 5CNIA 1KO5A 4CM5A 3TJZA 2V7PA 5KX5B 2P4UA 1EJBA 2ORED 4RV9A 3QF4A 3U2QA 1ISMA 4DKXA 821PA 4P32A 2GBFA 1FZTA 2IV3A 2OKGA 4OL9A 3B1YA 4G1UC 5H80A 4CLEA 2RHOA 4K88A 1EFTA 2P3QA 1T3TA 1E58A 1FBNA 1RHQA 2ZITA 3C8DA 3TRKA 1FJ2A 3PXXA 1GGJA 4I8IA 5CAEA 3B60A 1ZH0A 4Z5XA 5EVCA 2GYVA 1HNXB 3A3KA 5CG2A 1JSLA 3B48A 3IJEB 4CFYA 3ER9A 1SUCA 1U8ZA 3LSYA 4RK5A 4JLNA 3H0CA 4MJLA 3LZCA 3HDGA 2TMGA 3CHYA 2MMCA 2O2XA 2A0YA 2GPJA 2BL4A 4JENA 4O4HB 1Z0KA 3GGCA 4LSMA 4BNVA 4Y2QA 4IUCS 4EA8A 3MSXA 4KCGA 2QI9F 3KZKA 1RJ9B 2GGSA 3ZNPA 1YBMA 1ORWA 2VTDA 4B7AA 4UREA 4MQEB 4IOJA 1OBHA 2HHCA 4ALLA 3NHLA 2IBMA 1ZH8A 2LKDA 3RHTA 2M1XA 2WFLA 5DXAA 3S0JA 3C97A 3ZGNA 4C0HA 2HLPA 5CFQA 1RQ7A 1Q77A 5DRYA 3HRHA 4QLOA 3L9XA 5SZJA 5EIBD 3OJEA 1Z6XA 4DLRA 1I8TA 1N5KA 1SKQA 4RMNA 4TS4A 3SZ3A 1XTRA 4LJKA 3ZZUA 3PQCA 2O8VA 4Q7LA 4YONB 2ATVA 2DG2A 2NP6A 4PRKA 5AO9A 2H08A 1SVNA 4JI3B 5HJ2A 1KBZA 3TLGA 3WV4A 4L95C 1XDDA 3JD1A 4UHBA 5F77A 4O2BF 5IULC 4PSUA 5LNK6 2GF0A 2HA5A 4MR9A 5KVCA 3ROGA 3G0BA 1SOAA 2J6CA 1VG9B 4LGYA 1DMRA 4EUNA 1TCAA 1O77A 1XZIA 2MDTA 2UYOA 4DLPA 4AP6A 1KEKA 1YB5A 3WDLA 4ZZ2A 4B40A 3OBIA 1X14A 3O74A 2B7BA 2LBPA 1UM9B 4L6IA 5ANRB 2X76A 1MC4A 1Q0PA 4JP5A 5B7QA 1MO5A 1RWXA 4UFPA 3AESA 4BNJA 5AFSA 3TNLA 2GLUA 4P38A 2GZ3A 2WNHA 3K4QA 2GFQA 3GFTA 2ZWVA 4R2HA 4ZZ0A 3O2JA 1YSCA 1H2WA 2VJNA 4UARA 4UPDA 5AKGA 4F5EA 5KQMA 1Z6YA 3O8BA 3ZHUA 2XB8A 1GYRA 1VB3A 3NC1C 3PWKA 1I51A 1U2GA 3QELB 3IEPA 5DM4A 3D0OA 3GX1A 1GPWB 5DWQA 1Z0ZA 1D7OA 1U3CA 3PX3A 1XHEA 4H3KB 1KIMA 1SKUA 3L0BA 3RYFA 2X3FA 3VKFA 4R8VA 3L77A 1B41A 2BMAA 3CG4A 5EIBC 4UEJA 3WLMA 4HH1A 5AJZA 5IABA 5BY2A 2YRFA 3DOHA 4MRSA 3CURA 4RF3A 2P2CA 1GUBA 4U0KA 4W8HA 3U56A 3BX1A 1Y0BA 4DWWA 4QEKA 2HJ9A 3JPWA 4X1YA 2L2QA 3I61A 4MPPA 1MH9A 3QVVA 3JQGA 3D02A 4LK3A 1T36A 5C46F 1B8PA 3KR9A 4PV7A 3RAJA 1EA5A 3FSGD 1BWPA 4OXRA 1VG0B 4EG1A 4HDCA 3OM1A 1WSBA 3TKAA 1W25A 5IASA 5G40A 2BF7A 3AUSA 1PJTA 2IC5A 2VL7A 2WSIA 1BSVA 3C8ZA 2OB1A 4NBVA 3SOPA 3TOVA 1NYTA 3AT1A 3KJHA 3RW9A 4MW1A 1FQJA 1SXGA 3HV2A 3DYIA 3MJHA 1FLAA 2JFQA 1MHTA 1DAMA 2YWDA 2MMGA 4KN9S 4CLDA 3T1HB 5U1PA 2YWGA 4DXDA 5LD2C 5CXUA 3TAHA 3UH0A 8LDHA 1FDTA 3ND8A 1CEEA 4KE6A 2RGBA 3ZLBA 3CUWA 5DTIA 1Z06A 1MUUA 1E3IA 4GZ6A 1FRQA 2B9EA 2XUIA 2IS6A 3GLUA 2WLTA 3C39A 4LDJA 3I28A 4LZLA 1QRUA 3K70B 4JMPA 4IDBA 5EP4A 1V47A 4QQNA 5CDGA 4C0SA 3T7RA 5KOYA 4X63A 3VYRB 5DTMA 3IC5A 4JI6B 1ADYA 4AJOA 2VUIB 1WXGA 3OKCA 1C8KA 2V03A 2HUPA 1E2GA 2X1HA 5GOTA 1Y42X 4BKRA 1QGZA 5CA1A 3T41A 3AH8A 1E2FA 1MAAA 2CBZA 2HJRA 2EX4A 2YJ3A 1E9CA 3Q9NA 1Y82A 4CFZA 1R9NA 4ER3A 1OWMA 4TVKA 3VR6D 4OOEA 2ZJ1A 2BR5A 3DOOA 3MF4A 2H4ZA 2QX6A 3KZXA 5KQPA 4EW6A 2PH1A 1PVOA 4KXLA 5F3RA 3VZSA 5JS8A 3IIIA 5C1BA 3LT1A 1TKCA 1B7GO 4WD3A 4YP7A 1T6ZA 1KY5A 4BIIA 1CERA 1TTTA 1I9GA 2ZSFA 3LL7A 4BVAA 1BTOA 1NI5A 4IIJA 1AN0A 4YUAA 4M9UA 4RA6A 4OUDA 2D54A 1M75A 2NZYA 5LZ9A 3BB1A 5BYAA 3LVBA 3PT5A 1BDBA 2JIMA 3RSQA 3OTIA 4Q7KA 5ECGC 4BV2A 1JWBB 1ABEA 2QVLA 4FMPA 2WAOA 4DS3A 4Y67A 3JQ6A 5LA6F 1V11B 1MIHA 1JHQA 2E55A 2FN9A 2BI7A 3PA8A 4HUQB 3ZWVA 1AK2A 2FI1A 4BFCA 1NR5A 2CFCA 1EFVB 2CL6X 4JK3A 4W7HA 5EJFA 1G8MA 3WTCA 3D2AA 3ICQB 1V1MA 3V6LA 4PNPA 1PJ8A 1TK3A 1Z28A 1SXJD 3JR7A 2VP3A 3OPYI 3VTZA 3IP7A 5JTTA 3GD7A 2AG8A 4UHKA 5DKFA 3EMKA 3EEIA 1NT2A 1PDWA 3ZLTA 3EW7A 5ED0A 3BB4A 4RY2A 1XZJA 4P6VF 1II0A 1CB0A 1ZLYA 5DTQA 2CVQA 2DCUA 4LQDA 4GQIA 3HCPA 4PLGA 4QE3A 3FRJA 2ECOA 4RKYA 3PLRA 1QPBA 5BOSB 4GM4A 3ODPA 4LE2A 1UKZA 1I4LD 1Z4IA 4RO0A 2AKEA 5BMVB 2WMOB 4JHLA 2IYOA 5EHXA 5C7LO 1IVSA 2JFPA 3L8MA 1NVUQ 1XNQB 2NUTA 4CIAA 3WGKA 3K6JA 4PG4A 5KREA 2FSHA 2IE8A 1U5AA 3Q41A 3C87A 5L4NA 4Y6SA 1GTVA 1BW9A 1LSUA 5DSZA 5A3VA 3H2BA 1N6KA 3LZDA 1GUAA 4WFJA 2CHFA 4WY2A 2GHRA 5DNAA 1JXMA 2X86A 2CWWA 2X41A 2ZANA 5EMNA 4BQQA 2C57A 3MAGA 2IDKA 2CJXA 4TSRA 4KYVA 1XX6A 4V0MA 3W8EA 5LWQA 4ZPJA 1H1DA 1NF2A 2HI0A 4HUJA 1BRMA 2YS6A 3D4PA 5JSYA 3E2PA 2XCTB 4O4HF 2OV4A 1T5LA 4A0FA 1HYGA 2VIIA 1C4KA 3TINA 1C1DA 3ZU4A 3STUA 2QPLA 1Y1QA 2PD3A 3ENWA 4D8VA 3C0KA 3DV2A 5CFPA 1PQUA 1C9NA 3AGPA 4OQZA 4YO7A 1OXUA 3UUFA 1UZNA 1ZH2A 4EI8A 2WSSA 1IMJA 4RYDA 1PTJC 4RL4A 1D6JA 1Z0SA 5J2TB 1RWKA 3TR6A 1Y8RB 3AFIA 2CNWA 2XE8A 3I52A 3ESZA 3L06A 4ECAA 4GE3A 2K4MA 5ALUA 4KXYA 2UYHA 3QEMA 2EKDA 4ZTBA 4FOSA 2JDIA 1Q84A 3QFFA 4XWGA 2W2MA 3EF0A 4DCNA 1QP7A 4IGKA 2EAUA 2Q0HA 3VFDA 1CUYA 3DC7A 1H0SA 3CU5A 3I9LA 5C8YA 3JARB 3SEAA 5TMPA 2AZTA 5CA0B 4DV3B 1GRNA 4G97A 2ZB2A 3UK1A 1JT9A 3KR0A 2EZ8A 3M70A 4HTFA 5AVVA 3G9ZA 2IY7A 4DLNA 1ZN8A 2RB4A 5MF6A 4DFDA 2H7CA 1JAIA 1VHJA 1ZM4A 2LXNA 5JSZB 2OQRA 2I9KA 4CEIA 2QLMA 3GAAA 5AM2A 4RJJA 4X8LA 2O7RA 3RBXA 2OHHA 3T5MA 4Q24A 4K6HA 4ER7A 1FIUA 5EEGA 3I30X 1N2OA 1KJ8A 3OCXA 3MB8A 3S2YA 2QUJA 1DQPA 2O3RA 5AKEA 4FXPA 3UTCA 1LTQA 4KLZA 3PHBE 1E5TA 5GONB 3ZY3A 1KWGA 1LSOA 1DTSA 3K1AA 4JYPA 1I1OA 5DXJA 5L3QA 1FDIA 4DIFA 2XWJI 1Z12A 4TQ9A 2JLQA 5C52B 4E15A 2VYCA 3E18A 4NMMA 2PMBA 1G3UA 2AVNA 1BIFA 1BX3A 2XRYA 4WLVA 1P0QA 3UY4A 4B4OA 4BX8A 3SSMA 1WUJS 2GCNA 5DWDA 2I2BA 5GJWC 1LSJA 4CN8A 1SCAA 5JRDS 3IJ5A 2EEZA 2BHRA 4A26A 5FBLB 4EP1A 1FYEA 4CTMA 3B5JA 5FA8A 4CIDA 3NATA 3GT4A 2FN7A 4FCVA 5CTJA 5JQGB 1R64A 1KFJB 4CCYA 5J3JA 3RASA 3LC0A 1TM2A 1IZ0A 3BWVA 4Q66C 2VXYA 5CD9A 1UC9A 1E6WA 3BD9A 4N7BA 3KEMA 2JFXA 4NJOA 5HQ3B 4G9EA 4IKOA 4DOMA 4NC9A 3MTIA 3AHEA 4WFIA 1SCKA 2GFIA 3AZOA 4YEDA 5ALLA 3AERA 1NNUA 1RM0A 4GSKA 5DN6A 4G63A 4IIHA 1R0CA 4DA8A 4CLOB 2J9YB 2DPHA 2V6FA 3IEUA 1GV0A 4DCGA 1WTCA 4YNBA 7GPBA 1D9ZA 3DSRA 5FUMA 1GZ5A 2HMUA 4WTOA 4OO3A 4QPDA 4L2IA 4RADA 4Q6WA 4X8MA 5CVEA 3UMBA 4M8NE 2L82A 3G2MA 2VHUA 1W93A 4K9DA 4MUBA 2BI4A 2R6ZA 1VSVA 1HDCA 3OF5A 2D8AA 1Q1QA 1D1PA 2WIAA 3RFTA 4FYIA 3S2SA 3Q0EA 3TX6A 3NV7A 5IM5A 5F23A 3KIPA 1KI6B 2EHDA 3VTAA 1ULAA 2Q1TA 3ZE0B 3ECCA 3K9LA 5TC4A 3GLSA 3NHRA 4BO9A 5H70A 1I6WA 1WF6A 1I01A 3B53X 2PGOA 1KY4A 2W7TA 2XGOA 3D1JA 3JQFC 2RHTA 5BWNA 3W2IA 1KI4A 1CS0A 1MJ5A 4S0XA 1UADA 3BFXA 5C5DA 2B1GA 4H7PA 3U09A 3B5EA 2DBZA 4RF5A 4BB6A 1OFHA 2FPXA 3L6CA 2ACKA 2CF5A 4JI4B 2QROA 2WSYB 1KF0A 3DFKA 4YI3A 1EGVB 3A14A 3JTMA 2I7VA 4I2NA 4ETWA 1TIKA 1W94A 2B5WA 3H5OA 3KDPA 3OM0A 2YXBA 3NM4A 5AVTA 3U1BA 3I12A 3N3BC 4I81A 3I45A 2J59A 4A0QA 1UK9A 3G2QA 4WKNA 5LUBA 3AB8A 1IONA 1JECA 1X3LA 5HCNA 3LOUA 5SV2A 4B17A 2XAAA 4ENRA 1I1NA 3PGA1 5AESA 5EJ5A 1T35A 2IYWA 4M87A 1IM5A 4YXWD 4ZOQI 1M6EX 3DPSA 3NTOA 4YP5A 3ZS8A 3ZV3A 5CB4B 1Z5OA 2WQZA 2B5OA 2HC9A 2WRZA 1YZUA 4FHEA 4MV4A 4WKOA 2CL5A 4XTCS 5T4FA 3NBMA 3VR4D 5K0FA 1I94B 3I9KA 4OYRA 2YCLA 3U6KA 4U2GA 2VQSA 5BQXA 4JFAA 1QJCA 1LF5A 2DFVA 4DT1A 5H68A 5HKAA 3KCNA 2AK2A 4R1UA 4CV2A 1MV5A 4N48A 4JJEA 1Z3CA 4Z99A 2QZ9A 1AQIA 3U26A 1XZFA 3JYPA 4MX8A 5CVVA 1FNBA 3KB2A 5TRTA 4LHVA 3RVSA 3OPXA 1XQ6A 4PYLA 3VNUA 2KLBA 5EMJA 1FVXA 2G82A 5J2UA 2CJWB 3ORFA 1JEEA 1Z88A 4KQJA 1X2BA 2D0DA 2DPMA 2GBLA 4ND2A 3ZBQA 1MG0A 2G09A 1DNPA 3IMCA 5A4KA 3THWA 2JLUA 3ZD9A 1JQBA 2QTBA 3TEFA 5U4QA 1WAMA 4KREA 1UQTA 4CQMA 1YS2X 1SXHA 3PEUA 1U3TA 1U9IC 2A86A 2GPAA 2ZTLA 4OMFG 4JBHA 4C3VA 3AV0B 1NBEA 1T9GS 3K0AA 3L4EA 4AX4A 2X9QA 3AP1A 3BTVA 3HY4A 4HJXA 4BNDB 4FMBB 4G09A 4GXTA 1YS9A 4ERXA 3CRQA 2FPKA 1CP2A 4ROSA 2YHIA 4BO1A 5JVDA 4TMFA 4LISA 4F4DA 2XDAA 1SXJB 1L5MA 4FZRA 2WJHA 3WXMA 1K3FA 1N0WA 1NXWA 2WZDA 2FSVC 3EUFA 2HCTA 2VK2A 3FBGA 3KZVA 4RPHA 5HTKA 4YQEA 4TVOA 5J40A 5KQSA 1TJ5A 2XQGA 4R05A 4CCAA 4P4UA 4Y1FA 4LJLA 5FQNA 1YJCA 3PYLA 1Z38A 1JBEA 1XCGB 2WHRA 3F49S 5KYGA 3LUGA 1KZ7B 1XB2A 1C81A 4RMGA 1YVEI 1IZ8A 3CSDA 4PO8A 4WXMA 4X9XA 3O26A 4WN9B 5BSGA 1B73A 1U2QA 2I54A 2XQVA 2XXAA 3W5BA 1G1AA 2HQOA 4KLNA 3BE6A 4PYOA 1K8RA 4YS6A 5J2TF 3T9BA 5CDHA 4B7UA 3TR5A 4YB8A 1XD2A 3FTDA 1GDTA 1IIBA 1M0TA 2IPMA 2O7NA 1DBVO 3M5DA 4BFVA 1VMIA 1EX7A 4N0DA 4UBIA 4BVKA 4XX1A 2GKOA 2ID7A 3SSAA 4BNLA 1AGXA 4B9EA 2Y4OA 3FIJA 4B6JA 2OGUA 1TIPA 1WSAA 2XTJA 2Z4RA 4J9VA 4C4XA 3GC6A 3GWZA 4UULA 1A71A 1MB9A 3OPNA 4R81A 5CA0F 3QLUA 2EBWA 4JQYA 3O4HA 4JVMA 4JJKA 1GNPA 2Q41A 2G1KA 3QYAA 3ZGYA 4A5OA 4EEKA 4KK4A 4L51A 4L3VA 2XKKA 4YPFA 1XHFA 4AURA 2ILTA 4FLMA 3K9BA 2DC1A 2O59A 4KQMA 5K4AA 3SZRA 1HR0B 3IAS6 3KJIA 1TK9A 1CLEA 1E9FA 1L7XA 3U61B 3N59A 3QEAZ 2OHVA 1XCMA 2WNIA 3V4VB 1LQTA 2Y71A 3OT1B 2FG5A 3NDIA 1NURA 3NYWA 4NOKA 4BQPA 5FV4A 4FSXA 2JCSA 4ZMBA 2QDXA 1KFCB 2JFNA 2QN6A 1Z2DA 2B30A 2BKVA 2WJZB 5GONF 1AQNA 3M3HA 1OF1A 3KYIB 4BXOB 2BBTA 2PMFA 3CY6A 2P0EA 1PWXA 5AW2A 1OC2A 3RIXA 3QX7A 1FQWA 4B3GA 1JDTA 1IJEA 1RWWA 1YE3A 2OCIA 3OU2A 4US0R 3RS7A 3ZU5A 1S2IA 1T3ZA 3S8YA 5B58T 2F43B 3RU3A 2ZJ8A 2NVUB 2P77A 4D3YA 1LLQA 4WLUA 3GEPA 4LJRA 3DG9A 2H8KA 1L5OA 4UE2A 1U98A 3NTVA 5M34A 4RD4A 5KEIA 5ERXA 1PZEA 4HDAA 4MV8A 5AI9A 1WW2A 3UAYA 3BE8A 1ZYUA 1AA9A 4RHYA 4JR2A 1DU4A 3KQVA 4QQ8A 3IXMA 4EEZA 3H2KA 3WO0A 5JQGF 3JZDA 4IVPA 2XADA 3RUEA 3NHPA 1WA5A 2LP4Y 3H83A 1CBUA 1JW9B 3ZE7A 4JP2A 3GUYA 3RT7A 1F1BA 3H4MA 3S29A 1NUTA 1R0ZA 2GVDC 5CFLA 3SJAA 1GZUA 1GZHB 1PNOA 1V71A 2H11A 2V7TA 5JCPA 5AUNB 4YCNA 1WXFA 4PEVA 3E0XA 4WK4B 5K6TA 5KVSA 2FFAA 1KQGA 3N8GA 1MA3A 1KPIA 4WNAB 1EVLA 3LX8A 3KBBA 4OA8A 1ZR4A 3MMXA 3KOMA 1WDMA 3B70A 4LF5B 3AR7A 5K6AA 4AZ3B 3KOOA 4KAAA 3E81A 4F5ZA 1PJ3A 5JDIC 3ZWNA 2Q4RA 1F9AA 4MUJA 3EVNA 1BDMA 5IBCA 4O8ZA 5A5VA 3KLBA 3VZQA 2AQ8A 1CFJA 3C2QA 4BFXA 4YDHB 4H60A 3P9NA 1EP1B 4HHEA 1D0VA 3WHIA 3NI2A 5EZSA 1M1NB 2P4SA 3RUIA 1HEIA 3ES9A 5DLEA 3DDSA 4RIHA 3RKRA 3NDRA 4Q3DA 5L7WA 2ZIGA 4TZ6A 1G8JA 1W88A 3BH6A 4N3AA 3T7SA 3ZQKA 3VU3A 5ITSA 4EJSB 5F2EA 1GYQA 1Y4UA 3H42B 3UENA 2BSAA 4CM9D 4M0FA 1CVRA 3HR4A 3IT3A 4FOTA 3RF6A 1G3MA 4C0LA 3M0EA 4NULA 4R1SA 2AMLA 3H99A 4CNQA 2DRIA 1KK2A 1NXSA 2Y0DA 4GO1A 3K9GA 4BNKA 3UG7A 2QM8A 2J9FB 4J0CA 2FSSA 4JX9A 4PHHA 4J0GA 4WESB 3WLPA 5CB0A 1OLUA 1ZUIA 4F93B 1XJ0A 2HRBA 4B3TB 1DAFA 3DR5A 5AK5A 2GKGA 4TMXA 2XODA 1J0BA 3ZWQA 1P5HA 3WKEA 4IIGA 4D2IA 5KOHB 2NO6A 3BGWA 3C6XA 5KBYA 5KWJA 5AYVA 5EIWA 1UMCB 3GPBA 3A8TA 5ADHA 4PVCA 3PNLA 4KG7A 2WNSA 4BZZA 4XA8A 4PLCA 3B6IA 4EL0A 3MCWA 4H7EA 1L4NA 4MPDA 1E7QA 2H31A 5C32A 4FFNA 2JJMA 2O5RA 1KC3A 3TNYA 4JYMA 1C3OA 2H2WA 3OLZA 4G0MA 4II7A 5HPYB 4J1TC 3OZTA 1DXYA 1X1SA 1S8NA 3P5BA 1M1YA 2QX8A 2ZI4A 4ABTA 2HA4A 5JCXA 3OA2A 2ZSHA 2FGKA 1DDOA 3IPAA 3M6MD 4YT5A 3V80A 1W6UA 3AJAA 5LMNB 2Q07A 1TQDA 1C0EA 3QSYA 2PMWB 4WJKB 1AQLA 2HKIA 2FRXA 2NG1A 3FZQA 3OIVA 4C7OA 3HK2A 4F5WA 3AG5A 1M2OA 4DRZA 1KMIY 2GZDA 4HWGA 3QOYA 4IG9A 3V2IA 2FZWA 4Q9KA 4QG3A 1BO6A 3AJEA 5HJ7A 4BX9A 3EGIA 5LOVA 3W8FA 2WV9A 1SZCA 4DUGA 5FBWB 2A3RA 3FWZA 4E7OA 3C7CB 2FW7A 1XCJA 2HA2A 1QQ5A 3QJ5A 3M89A 3ZH9B 4AJEA 2Z43A 3K5IA 3UICA 3ZIAA 4AWAA 3N76A 3UGJA 3B1JA 4JAVC 4L76A 2ZJ7A 5LQSA 4TYYA 2W0MA 5HYVA 2BBWA 3KAQA 3HEBA 3QNWA 1X1TA 3TTVA 1EXDA 2HA3A 4HGZA 4J90A 3S5UA 4TV9A 1YCFA 3B3JA 5C3MA 1USVA 4NBTA 5K7SA 2YJGA 5HF6A 3WYCA 3HYRA 2FPUA 4NCIA 4J0KA 3H19A 4Z0PA 4EM6A 2HU8A 4BNHA 3O4GA 1H2ZA 4C07A 1UZMA 4P3OA 1ZCBA 2YZ2A 3LRTA 2AHRA 3QEJA 2I7CA 1B42A 4OFBA 4Y6RA 3WHKA 1V7ZA 4QBHA 4YRSA 2JLVA 1CEYA 4W9RA 4ITRC 2HCBA 5EGNA 2IV2X 2VXCA 4YJKA 4MW9A 4Z0NA 3VI3B 3Q4GA 3R0IA 3TLJA 2JFUA 2QP4A 2WUDA 1ZQ9A 4FI3F 5JCOA 2P6UA 2W98A 5KTSA 3JQ9A 1IOLA 3KLPX 3SF0A 2W22A 4LNHA 2BRUC 4QREA 2ATIA 3EXEB 4UUOA 4BX3A 5T6MA 3SG0A 5LLTA 4L15A 1YZ3A 5AJXA 3K0HA 3PC8A 2OHXA 1JT2A 2J3LA 2VNJA 1I4OA 1WXXA 3OI7A 1KQFA 2WJVA 4UTNA 4IGAA 1SU7A 3GEMA 1L7NA 3KKZA 1SEVA 1UFQA 4C2TA 1ILWA 5ALEA 2A7QA 3FB1A 4KVZA 1WMSA 2CJYA 2G0AA 4Z51A 5AW8A 5CYOA 3Q9UA 4CF5A 2D6FA 3INTA 2YXLA 3CRNA 4RA9B 5IVPA 2VSYA 2DPYA 2NSJA 1ZISA 1WE2A 1N1DA 4OHVA 2ZSKA 2CE7A 4XIIA 2HU2A 4YYEA 2YTZA 3QPAA 1VL0A 4R31A 2PFKA 1VKOA 3F8TA 3ONVA 2H7XA 4PAGA 4R40A 4C03A 4ILEA 4OX9B 4UCXA 3T4PA 1YI1A 2B83A 4KJXA 1E63A 4W5WA 1N8NA 2PWBA 1ZD9A 1JFFA 3SD7A 2XDYA 4J75A 3H9EO 1YQGA 2Y05A 3JYNA 1H6BA 4IOMA 2F1RA 2EFDB 1Z08A 3N70A 1JX6A 4V3BA 3SYLA 3NHBA 3UPUA 2JJQA 4A8PA 3EQ2A 3GEHA 3L7JA 3WISA 3I0ZA 3LKBA 3WLJA 3EXG1 4ALJA 5FBRB 2HXGA 3WZMA 4DCTA 1GU0A 4PLWA 1V16B 1HTBA 1X7HA 1Z5ZA 1VBFA 4ZAZA 1E62A 4X5OA 1OROA 5DGHA 3SIWA 1EDZA 3VVMA 3DJFA 1XCOA 2YYZA 3LBAA 5LXTA 2R87A 2JLYA 5UKDA 4GLJA 1G8GA 2NVOA 1N3BA 1HO3A 3KB1A 2B99A 1CB7A 5CITA 3RC7A 3WK7A 4IV5A 4YDQA 1FMLA 5I01A 3MJSA 5AM4A 4IFEA 1VJRA 2RBKA 3N74A 5MFPA 4GSYA 2OO7A 1PJLA 4ND8B 2GN6A 3ID6C 5C8XA 1TEHA 2HW8A 1HFJA 3EZ7A 3UJNA 2D1QA 3EUWA 4UEWA 1K88A 3ESXA 1EPUA 1NHGA 1PSZA 2PDAA 3LUHA 1KDRA 2OFOA 3RTDA 3KTDA 5KYNA 1XMQB 2OCGA 3B78A 3EMBA 2X19A 4HAIA 3SM3A 3I8OA 4MQLA 4BQRA 1NC3A 2IODA 2Q3MA 4LDAA 3SC4A 1D1QA 2BBSA 2Q0QA 3ELDA 3HKDA 1TUGA 1OV6A 1PFQA 1WY5A 3I64A 3PE6A 3R6WA 3H5VA 3ONWA 4PAQA 3PVCA 3SC2B 1UR5A 3U7QB 3HGMA 3BS4A 2A7XA 3HCAA 1KVUA 5IZCA 5ICGA 4EKNB 3JAWB 2X1VA 2G67A 3K8QA 1ETHA 3FNBA 3R0JA 4Q4AA 1RFGE 2A9PA 2X8BA 3Q7IA 2OQ2A 2JJ2A 3IEKA 5ICSA 3BL8A 3EDCA 2VWHA 4CMBA 1WHSB 4LYJA 1RZRA 1IHUA 1CKEA 1UWKA 1YR8A 3GWGA 5FI1B 3UMMA 5A3SA 4QM6A 2W8BA 3ZHBA 1UIMA 4G5QA 2QYHA 2AQIA 1ABBA 1D5CA 2HLHA 2WF8A 1U31A 3OZUA 3R0VA 3AEUA 2NTYC 1U65A 4XDGA 2HMYB 1XQ1A 2YFYA 1AN9A 5ADWA 1D0SA 2D1SA 2G4CA 4DVJA 2OZEA 4KX3A 4TYWA 1EK2A 5ALKA 4QOSA 4N82A 4WVLA 1JWLA 1G4HA 1QIIA 3WWOA 1BU5A 2L17A 2QRKA 3N2LA 3ZDBA 1WY7A 4TOIA 2QBYA 1TO1E 1UFOA 3RWMB 3D6MA 1TF7A 5JECA 4EUKA 1C30B 2IHTA 3DYBA 5TV2A 2FJUA 2R11A 4JWTA 1L5HA 1H23A 1L7AA 4KWHA 2YDXA 1CZUA 2JCXA 3OSUA 5DX1A 2ZUTA 4E11A 4RZUA 2M2IA 1XZAA 2JBAA 1RLMA 3ZBTA 3R1IA 4MYRA 4NU0A 4OU5A 4A2CA 4BN0A 2FPPB 2HFJA 4FE7A 1O6BA 2D5IA 3R6DA 2VDPB 1S3FA 1W5BA 1DKLA 1KDTA 1I3MA 1TJNA 1VYVA 2ZIXA 3BDIA 4H17A 2AN4A 4RPJA 1O0SA 1AGPA 2DKFA 2W6PA 4RCYA 2KYRA 4DWJA 3WL7A 1MTZA 4W5OA 3F8SA 5TEWA 1TMGE 3TR0A 4LZAA 4D44A 3KX2A 1SBQA 3FCSB 3LPAA 1EUDB 4RE5A 4NU5A 3A32A 5COAA 5LPNA 2C7RA 1F2TA 2JAPA 3M4JA 1DV1A 1TLFA 4J4BA 4MOWA 1PU2A 4Q9NA 5DGTA 4AECA 3A58B 4JS0A 4DSOA 3RUPA 4OLBA 1V41E 5EFOA 2B21A 4IG4A 1NFRA 3M9WA 5CNMA 1RKVA 5JAPA 4DZZA 1T2FA 3L4KA 4R0NA 4CMEC 5EIXA 2FZGA 3T1VA 5IJWA 1Y8CA 2ZI9A 3P9ZA 3IAS1 4HXFB 2HRQA 1R8YA 3JQ8B 2H06A 4MUEA 2J30A 4HEA6 4S24A 3IPCA 3ZHSA 2XIJA 4M76B 1F0YA 1T2VA 1QE0A 4JXKA 5F1OA 1XMOB 2XB4A 1IZ9A 1SBYA 4HDOB 1GFWA 4YC7A 2BM1A 2GM9A 4C4SA 2YXDA 3IDQA 1FTNA 1HDOA 3LUFA 4Q4CA 3I42A 1KMHB 3FPAA 1Y7IA 3N7TA 3BH7A 1HXHA 1DIAA 3ZWCA 4EVSA 4HGPA 4CM4A 1YOVA 2DERA 1KFBB 2F3UA 1TD9A 5KYYB 4DR3B 4ND5A 4AJ9A 1X7YB 1BG6A 3N2GB 4PLFA 1Y33E 5F1YA 3UB2A 1JR3A 1U9CA 1REQB 1ULTA 5BN5B 1GXSA 3KVNA 5AJUA 4P3NA 2ZB3A 3LWNA 5FB3A 2K2QB 4ER0A 3EFBA 2EKBA 1TQHA 4BRSA 3B9QA 5FWNA 5J5AA 3TD6A 2EEPA 3JWIA 3ETEA 4M1SA 4V39A 1W5FA 1GZSA 5I7OA 4XUEA 4KXNA 1J8MF 1P9RA 1RXIA 2LIVA 1BDJA 3EZLA 2QKYA 1GY8A 2PVPA 4W1PA 3TGPA 4FS3A 1OH5A 2B78A 3VU0A 4A27A 2GVZC 1AV7A 1NRXA 3U7EB 3U3ZA 2P6OA 5E1DA 3RNLA 2B37A 1V7QA 2PQ0A 4LGCA 3RADC 4B7XA 5HX7A 1TU3A 4C0JA 4R9UC 4TVSA 1KAEA 1VTKA 4FCCA 4D46A 1BXGA 3WBKA 2QRUA 3KKNA 4D4HA 3WQBA 4BZWA 4RDXA 2R5FA 5L9AA 2PL5A 2F9FA 3WWPA 5CPBA 3V2HA 3JATB 3MC1A 4DDTA 2PQ6A 1K86A 1YXMA 3ER8A 4O5OA 1STOA 3LDHA 1HL7A 4YN3A 5BXYA 1KY2A 3D6FA 3ZE2B 3U7IA 4FUTA 4QUDA 3S8MA 3IKLA 1NLMA 3JV7A 3FUTA 2I29A 2X77A 1R8SA 5ALXA 5ARDA 1FXWA 2QTCA 3KUXA 2YJZA 5FR2A 2REXB 3PSAA 4PGGA 4H59A 1E2PA 1N6OA 3EIXA 5REQB 1AKWA 4ZC1A 2WTNA 1P18A 3CTMA