1PZEA

T.gondii ldh1 apo form
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
326
structure length
323
Chain Sequence
PALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMCEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lactate dehydrogenase
publication title Structure of Toxoplasma gondii LDH1: Active-Site Differences from Human Lactate Dehydrogenases and the Structural Basis for Efficient APAD+ Use.
pubmed rcsb
source organism Toxoplasma gondii
molecule tags Oxidoreductase
total genus 112
structure length 323
sequence length 326
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2003-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pzeA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1pzeA02
3WFJA 2G17A 4G65A 4XQGA 4CM9D 4QFCA 4H15A 3KSDO 5T8KC 4IMRA 5G0VA 4R54A 2HMWA 2OP0A 1JAXA 1HETA 1NPDA 4JQCA 3DZBA 4YRDA 5TC4A 3GRPA 3RC9A 4FSHA 3FNHA 5GZ3A 2AHRA 1NTOA 3DR3A 3RUDA 2B37A 1EK6A 4RZIA 4X54A 4QFDA 4IJUA 3QRWA 4JXKA 1ORRA 3DDNA 4K28A 3HADA 4OXKA 2VNSA 2O3JA 4DYDA 5B4TA 1N2SA 4L8VA 3PEFA 4XYEA 1RWBA 2RCYA 4TRRA 3BYZA 3NGXA 2Z95A 2DC1A 1O6ZA 4B3IA 4E5KA 4F6CA 3K2EA 3KLPX 4PIVA 4RF5A 3WYEA 3ZWNA 1GUYA 5TGDA 3IDSA 3PQEA 3KBOA 4I5FA 3WSVA 3BAZA 4KUEA 4CM6A 2P2SA 4DLLA 1WDKA 4DRYA 4GWKA 2ZYAA 3PWSA 4DPKA 3ICCA 1IE3A 1T1SA 3HHPA 3PQFA 4EW6A 3WICA 3I4CA 4PLPA 2CSUA 4M55A 8LDHA 2VUUA 2X86A 4PN3A 1BDMA 4RV9A 4YJGA 5A5EA 1LLDA 1QG6A 2BLLA 2GRAA 4H16A 1HXHA 3AM3A 1ZSNA 4RJTA 1E5QA 5A9SA 1MX3A 3IJRA 3ROKA 4C7JA 1E7SA 4RVHA 4O0LA 3ZU3A 4Y6SA 4CLRA 3L4BC 3DZIA 3I9MA 2Y68A 3ICPA 3ZZNA 1X0VA 2EKLA 4AJ2A 2J6IA 1UXGA 3COSA 2VRBA 3GR6A 3G1TA 2PLAA 3PLNA 4NJMA 3RQSA 4ZQEA 2PD4A 4DMLA 2I65A 2B4QA 3RD5A 1N9GB 4BNWA 1YDEA 2X6TA 4DPLA 1PR9A 1CQIA 4CR8A 3AJRA 3PZBA 3AK4A 1HRDA 1G0OA 4UAGA 1DFGA 4FFRA 4A0SA 4M54A 4CQLA 3RUEA 1PIWA 3E82A 2UDPA 2RBEA 4DQXA 2ILTA 1LUAA 3QVTA 4OH1A 4FOOA 1PGQA 2C7GA 5ER9A 4DQVA 5IDQA 2WE7A 3ZV6A 3AFNA 3RROA 1K2WA 3CINA 1DIAA 4OHUA 4CLOA 2EGGA 4S3MA 3ENNA 4RL6A 5KIAA 1CYDA 4YQYA 1U8FO 1B3RA 3LT2A 3H9JA 4JP2A 4LSMA 1QMGA 2NNLD 3BTUA 1BHSA 4BMVA 2EEZA 4CMIA 4ZRNA 3VAZA 1E7WA 2D4AA 2Y1CA 3SC4A 1ISHA 4AJJA 1LBEA 3ANNA 1JW9B 1A7KA 4MVJG 4F3YA 5F21A 1C0IA 2VTDA 4A03A 5CEFA 1SBYA 2NSDA 2J8ZA 5A03A 3VPSA 3NJ8A 2O23A 1PZFA 4YQZA 1HL3A 2Q1SA 4YJFA 5L7YA 1F14A 4EGFA 2P9CA 1H2HA 2BFPA 4MO2A 3UFXA 4NK5A 1HDGO 4GWGA 4KOAA 4LW8A 4R5HA 1WZEA 5I7VA 2PFGA 4DIBA 3TZQA 1P45A 2ZTLA 3OQ6A 4NZ9A 4WASA 3F6YA 3U4IA 4O6VA 4BNLA 1SEPA 4J7XA 4K1LA 1M6HA 2IYOA 4HFNA 4R1TA 2YDYA 5JAIA 1SCUA 3ZWCA 1Q0HA 5H81A 1ISFA 1HKUA 1I32A 3JYQA 2NVUA 1LLUA 4W82A 5DBGA 1UJMA 5BSEA 2FN7A 2OFPA 1U3VA 2QW8A 2UUOA 5JC1A 3FPCA 1K6IA 3CPSA 1K5HA 4RLSA 3S2IA 1DBVO 4HV4A 1BVUA 4CM4B 1ENOA 3RUAA 1LDBA 3GG9A 1B7GO 3N7UA 1T26A 2JFFA 4J16A 1PQPA 3KVOA 3EAGA 4BQPA 3QWIA 1H9BA 3AUAA 4XKJA 1A9YA 1W6UA 1LEHA 3MJTA 4BQRA 4DBVO 4I5EA 1M67A 3JTMA 4PG7A 1I3NA 4ALJA 4Q3DA 5IFLA 3G49A 4B7XA 4B4WA 3GVCA 1YO6A 3GVHA 3LU1A 1PX0A 3HWRA 3PFWO 4AJHA 1PQWA 4K6FA 4GI2A 2I3AA 4MVJE 4QEDA 3HFGA 4GMFA 2CVOA 1N1EA 1JVSA 2Q50A 3H7AA 4WCFA 1IL0A 2LDXA 1Z75A 4Q39A 5BT9A 2A35A 3F3SA 4M8SA 2UUPA 3VDQA 2AE1A 1HDZA 2EXXA 3CUKA 3R3JA 1EUZA 3C1TA 1FDVA 3HJAA 3INRA 3R6DA 3ASUA 4ALMA 3GN1A 3VHRA 2J3KA 1VL6A 5JC8A 2UAGA 3IAHA 3WWYA 4Y67A 2DLDA 2OBNA 3LF1A 2O2SA 3LLVA 3ST7A 2GR9A 5DF1A 1CRWG 4U6SA 5AXDA 5DN9A 3GNSA 3L6DA 5TJHA 1NQAO 3RI3A 2GN8A 3BMNA 1U7TA 3WX0A 1WWKA 3NRCA 2X0IA 3MCVA 3KV3O 5KJEA 3GZNA 4I5GA 2Q4EA 2YUTA 1PS0A 5JS6A 1AXEA 5DBFA 1UP4A 4PG8A 4GGOA 4NMHA 2EERA 4D42A 1CWUA 3H9UA 3I9KA 4TVOA 3VPGA 1JKFA 1YB1A 2HKIA 2B69A 3UF0A 3UW3A 1SOVA 1I3MA 3AUTA 3HG7A 2C82A 1X0XA 1NQ5A 3KM0A 5THQA 4ZN6A 1D8AA 3BMOB 2Y0EA 1LX6A 2GERA 2W2KA 1PL7A 4EUFA 1P77A 5A9RA 3MOIA 3RKUA 4FD3A 4JBIA 1CQJA 4ZQBA 2OZPA 4EEZA 5CDYA 5EERA 3ROQA 2WEKA 3RBXA 4D3FA 2HK8A 4E4YA 2D1YA 5JY1A 1ZVMA 4CODB 4IJVA 5JMWA 3OHSX 4DLAA 4I8XA 3S8MA 1DOHA 1O9BA 2NM0A 3GVIA 4BNGA 1NYTA 2PKQP 3F47A 4MVJF 3FNEA 1DAOA 4M1QA 3JQFC 5B37A 4Z3KA 4KDFA 3KOUA 3GH3A 4Q3BA 5CP8A 2I9PA 1UP7A 4CR6A 5CDTA 3T7CA 3JYNA 2EKPA 4YYZA 5A05A 4MPDA 3S55A 2AEJA 3WGZA 2Y0CA 4E21A 4B79A 4NHEA 5KVCA 1FXSA 1ULSA 1MB4A 5T67A 4TMFA 4GH5A 5HM8A 4GAEA 1YOVA 2O3UA 2Y66A 1DHTA 4CQMA 3P2OA 2Q99A 3NKLA 1U4SA 5JFOA 3CTMA 3P7MA 4XB1A 2PD3A 1U5CA 1YL7A 2DBRA 5CEEA 4CUKA 3K96A 4WOKA 4NU6A 4O5OA 3BXXA 3U4HA 2RAFA 2BGKA 1Q7GA 4RVUA 5CG2A 3TSCA 4L4RA 1DC5A 1E7QA 1IUKA 4ITUA 4PVDA 2CNBA 2E49A 3T4EA 1H5QA 3A1NA 1LLCA 1NX6A 3CMCO 4U0JA 4BO8A 2QRKA 4GGPA 1OAAA 3VOSA 1U1IA 3BMCB 3AFMA 4C7KA 5JAMA 1XYGA 5MGBA 4OJNA 4XQ9A 3I9JA 3U49A 4DBZA 1R4NB 3H5RA 1PZEA 3ETGA 5C5IA 3HB5X 1GEEA 3O9ZA 4EUEA 2C29D 1F17A 4HWKA 1KY5A 1QP8A 1E3EA 3BMQB 2UYYA 4J1SA 3A06A 4ALLA 2YHIB 4FS3A 3D5TA 4EZBA 1MG0A 1LLQA 1OFGA 1QORA 1ZSYA 2QHXA 3OETA 3GNTA 2HMVA 4AG3A 3OJOA 5G4LA 2FPPA 3BHMA 4R69A 4BKOA 3RUHA 4CPDA 4LSWA 4KUGA 2O3TA 4FC6A 3TOXA 1LQTA 3GN2A 3OA2A 1YWGO 1C14A 1KYQA 3GHHA 1EQ2A 4BMSA 2QYTA 4EBFA 5ITWA 4PZCA 2V65A 2BELA 2ZB8A 1IYZA 1ADFA 3DMTA 3QSGA 4OO3A 5L9AA 4WNCA 4EEXA 2P5YA 1DDOA 1Y81A 4IINA 4XR4A 1Z74A 4IDEA 1T4DA 3RC7A 2C2YA 1L7DA 3FWZA 4CLHA 1DJQA 3HDYA 2DUUA 3NGLA 2VN8A 2ZCUA 3OEWA 3K92A 5CPFA 3PIIA 1OZAA 3PWZA 2VYNA 4JGBA 3KEOA 4BNZA 1S6YA 5KTKA 2H63A 4WLNA 5DP1A 3WIDA 4KQWA 1GZ6A 3RFVA 5JDCC 2Y1DA 2CUKA 5I7FA 1ZK4A 4J1TA 2G5CA 3DL2A 2E48A 4J91A 3PHIA 1T25A 2NVWA 3NTQA 1MG5A 3ZNNA 3FD8A 4HUJA 1LDYA 4WKGA 5AOVA 4D0SA 1H0KA 4B4VA 4XCVA 4R9SA 1BGVA 1B8VA 3VH2A 5ILGA 4FJ0A 2GN9A 1E92A 1TT5A 3NDRA 5FI3A 1YGYA 2YFHA 1C3VA 1H6BA 5G4KA 2J5QA 1ADCA 2HRBA 4CMJA 4HKTA 4CL8A 3HN2A 2JD1A 5L7TA 2WD8A 3BA1A 1CF2O 5L40A 4E0BA 2GYYA 1ZEJA 4MIEA 4XYGA 4GLOA 1C0KA 3V1UA 3ZU2A 4DMMA 2PKRA 4DREA 2LDBA 2FZEA 1N9GA 4PZDA 1EVJA 3FPLA 1Z82A 4ZA2A 5DZSA 2FR8A 4BGVA 4PRKA 4CM8B 1FMCA 5COAA 1HWYA 4UUOA 2FSVA 4CM5A 4D46A 2PH5A 3I1JA 2G0TA 1KVTA 2XOXA 3DONA 3MJSA 4BO9A 3ADOA 2W8ZA 3I9LA 4EYEA 3PVZA 1IZ0A 3JD2A 2QRJA 4CR7A 2C5EA 4WEQA 1KEVA 2C2XA 3OJ0A 1FF9A 3ONFA 5B4VA 4RDHA 2YW9A 3ZI0A 3I9NA 1H94A 3H5NA 1UP6A 3OQ1A 3ETDA 3NT2A 2WYVA 4XWYA 3WR5A 3OIDA 1V3TA 2P9GA 2VWPA 1DSSG 1W73A 3QWAA 4BKQA 4YPOA 2ZYDA 4HNGA 2VYVD 3IIEA 1PJSA 1C1DB 3LQFA 4XYLA 2FOIA 4HFMA 4R5MA 3ADPA 5COQA 1XA0A 4EJMA 3PHJA 1I2CA 4NK4A 3WJAA 2ZB3A 3I6QA 4HP8A 4YRBA 2BI8A 2NLOA 4UVDA 1LDNA 5MDHA 5A3JA 1IB6A 1A71A 3VTZA 1FDSA 2IODA 3OJLA 1PQUA 3VH4A 3DBHA 4E3ZA 4FDAA 1PGPA 3AW9A 4QXMA 1RJWA 1J4AA 2QX7A 2VT2A 4FFNA 1O5IA 2HO5A 2GGSA 4WNIA 4Y6PA 1D3AA 3IP3A 4PLGA 3ZHBA 2TMGA 2PV7A 1D4FA 2EP5A 5TF4A 5KVVA 4AICA 4W99A 4ZICA 4BO0A 2D3TA 3VPXA 1A4UA 4GKVA 4P4NA 1U28A 4PLWA 3FTPA 3NJ4A 1VSVA 2FMUA 4YTEA 4QECA 3V2GA 2YV3A 4YA6A 3E9QA 3UCXA 4NIMA 5AXBA 4JNKA 1J5PA 5HBRA 1HYHA 4E2ZA 3VZPA 4E5PA 1NVTA 4W7IA 1A9ZA 4ND2A 2IYPA 2R00A 4Z9FA 5CFZA 3PWKA 1GTMA 1ISJA 1ZK2A 3DBLB 3G0OA 3RBZA 2WD7A 4IDFA 3H5AA 4L76A 1SEVA 3H4VA 4A5OA 1N1GA 4CMEC 3GEDA 3AUUA 4PLYA 5TS3A 4TZKA 2GD1O 1MFPA 5LCXA 1CEQA 4BNHA 2PTGA 4JLWA 2CMDA 1E3LA 2BI7A 1GZ3A 2WMDA 3E9NA 3JQ7B 5EJ2A 2BFAA 3DZGA 3TL2A 1DRWA 3DBVO 4CM3A 5A9TA 4NNJA 2W2LA 4QT0A 3DBRA 3JQEA 3FHLA 3KTDA 5DOZA 3TPCA 1P31A 1ZUD1 1G1AA 2WSBA 3IS3A 5CDSA 3WGQA 4W7HA 2AMFA 2QQ5A 1JDJA 3WQSB 2EW8A 4DL9A 4F45A 4UUPA 1EDOA 2C7VA 5IF3A 1ZKMA 1EBFA 1PGJA 3GVPA 1I2BA 1RM5A 4G81A 3PK0A 4YEDA 4JIGA 4KTTE 3SX2A 3S2EA 4MDHA 3CZRA 1EE2A 3ZH2A 3MTGA 4WGGA 4XDZA 1BTOA 5DBIA 2DAPA 1JQBA 2OOSA 4QUKA 2OBYA 1BSVA 4ZHSA 3BZUA 1HSZA 3ONDA 5KVQA 1ZEMA 3K30A 2BRUA 1DPGA 1ZSVA 4W4TA 2RHCA 4TVBA 4R68A 1BG6A 5IZCC 4IDAA 3T4XA 3GA0A 4QO7A 3UAGA 3VVCA 1GEGA 1MV8A 1I33A 1QXSA 2B4RO 1H6DA 2O7QA 3H2ZA 4N18A 2JKVA 2EIHA 5TSDA 3ZU4A 1UXKA 3PYLA 2JD0A 5T5QA 1UXHA 4Z3DA 4BS9A 4IGFA 1LI4A 2J5KA 4B3HA 3WJ7A 3ZNOA 3AU9A 3GUCA 1BXKA 1HYEA 2R6JA 2FPGA 3DOOA 4J4HA 4QQRA 1IZ9A 3PHHA 4L75A 5TX7A 1AE1A 2J3HA 3GOHA 4MVJP 1IHXA 3OSUA 4RVSA 1GYQA 2ZQYA 4M86A 4B3JA 3AWDA 2EG9A 4HY3A 4OSOA 1PJ3A 5TQVA 4D45A 1T1RA 1WLYA 4OKNA 1M76A 3VH1A 4R3WA 1NASA 4IJKA 4N7RA 5T64A 1U4OA 3EY4A 3GF4A 2VHZA 4B7CA 2XPCA 1A72A 3GAFA 3WG9A 1J0XO 5T6BA 1P3DA 3ZDFA 1IHYA 4E31A 5L4NA 1NFFA 4Y8VA 2D5AA 4HBGA 2JHFA 2GF2A 1KVQA 4RPKA 1KOLA 3QQPA 4OXYA 1N5DA 1ZXBA 2NUAA 3U5TA 1GR0A 5LDGA 4BGUA 2JCXA 5JYEA 3TZKA 2QZZA 1BW9A 1IPFA 2BD0A 4IS3A 4NR0A 4R41A 3KYDB 1C1XA 4YT8A 4Q3AA 4RQTA 3ITKA 1I24A 3C85A 1DLJA 3MWEB 2F1KA 1TLTA 4WK6A 4GX1A 4A26A 1BXGA 5DNAA 4ZU3A 5T57A 4MVJD 4URFA 4BO7A 2ZTMA 3UCEA 4BGEA 8ADHA 1A7AA 1I8TA 3OM9A 1LRJA 3QWBA 1GL3A 4OAQA 1YQDA 3C3XA 2YJZA 4XX0A 4CMKA 4QO8A 4I9UA 4BB5A 4R01A 1X13A 2X0JA 3G17A 3PHLA 1ID1A 1NQOA 3N58A 4WLOA 3L4SO 1GQ2A 5JO0A 3DHEA 4R9RA 3SJUA 3AOEA 1EEHA 4OQYA 2B36A 1ZK0A 3D4OA 5THKA 4W9NC 2X9NA 1NVMB 3A9WA 4II2A 1ZJYA 2EWMA 3P19A 5ER6A 3OH8A 1YQXA 2AXQA 3RUFA 3UICA 3EDMA 1ISGA 1GQQA 1E7MA 2GZ1A 4J7UA 4XRRA 2I76A 3LVFO 2ZK7A 3GNQA 4ONEA 4MP6A 1VJ1A 2VOJA 2NQ8A 1P74A 2QZ9A 3ZW8A 1HDYA 1R0KA 3UCFA 2OP1A 1R37A 4GX0A 1XU7A 1DC6A 2X9GA 1K89A 3M2PA 3P2YA 2JFHA 2O50A 3ANMA 3JQBA 3O4RA 3WB9A 2QRLA 3SVTA 5IDYA 1LDEA 1LSSA 2BF7A 3ENKA 4WECA 4WEOA 4Y6RA 4MVJM 3KYCB 5JLAA 4CUJA 3RC2A 1P9LA 2GZ3A 4A7PA 5I7EA 4NH4A 2DTEA 3WGHA 3RBVA 1ZK1A 1DFHA 1LQUA 3ZHZA 2C54A 4IDGA 1WW8A 3JQ8B 5I8ZA 1GQYA 2ZCVA 1M75A 2VTEA 3RFXA 5H83A 3O8QB 4JCOA 3PPIA 3QA9A 1HT0A 4MKZA 3SC6A 1HTBA 3HFSA 5IN4A 3LT1A 2DKNA 4XA8A 3CEAA 4UULA 3VKVA 3ZCXA 1N92A 1CJCA 1P0FA 1T2AA 4CLDA 1HE4A 1U5AA 4KQXA 5T8KA 2Z1NA 4YWJA 3KUXA 2WYWA 3SLGA 4BL5A 4WLVA 1Y8RB 3I9OA 4IPTA 3W4IA 1X7HA 4XJTA 3H2SA 1ZO8A 4PLZA 4KP7A 2GSDA 4YAEA 3T7EA 5U4QA 1HLDA 3M1LA 1DO8A 1HE2A 4TQGA 5B12A 1WNTA 5F5NA 3SEFA 3U09A 5CAEA 4MOWA 4DUPA 1CDOA 2D5CA 1YONA 5HS4A 3O38A 1PU2A 2UV8A 3DZJA 3Q9UA 3C7DB 3WNQA 4Q9NA 3RAJA 4PG6A 4GSLA 2IXAA 2EF1A 1T4BA 3VPFA 1H9AA 1TEHA 4XRGA 1P1HA 5HTOA 3LT0A 2VHVA 5EN4A 4EJ6A 1HZJA 3QVWA 3W1VA 3D0OA 5K6AC 3L6EA 3INTA 2Z5LA 4FGWA 1ULUA 2ZJ1A 4FN4A 2E37A 2QG4A 3OA0A 4NI5A 1XR3A 2CDCA 3S1LA 1P1IA 2PGDA 3R3SA 2V7PA 3DAGA 5ICSA 3IOYA 2ZB7A 5GZ1A 3V2UA 3Q0EA 4KZPA 2AA3A 1F8GA 4LRTB 3ONEA 4W9NA 1BDBA 2I66A 3L4BA 1E3IA 1VRWA 4EITA 3WQRA 4D43A 1QV7A 1M6WA 1ADBA 2V6GA 5KCZA 4P8RA 5L53A 1FK8A 2O4UX 3RCBA 5C7LO 3NTRA 1Q0LA 4U5QA 4NPCA 4JN6B 4XGKA 1UR5A 1E3WA 1Y6JA 3UOGA 3ZU5A 2VZ9A 5CDUA 3CIFA 3E18A 1KBZA 1X7GA 1LRKA 1SC6A 3F1LA 4D0RA 5CDGA 3OBBA 2DT5A 2ZATA 5DCUA 4IXWA 3TFQA 3F9IA 1GV0A 3PIDA 4JK3A 4A10A 1U2DA 3F4BA 1Y8QA 4DPMA 3GFGA 3LC7O 2YV2A 3WGOA 1DHRA 2DPGA 4E13A 2A94A 1R0SA 4BNFA 2J3JA 4YJHB 3JQAA 1ISIA 1I10A 5DDIP 1P0CA 5IN5A 2JAPA 2X0RA 5JAQA 3AY7A 1UXJA 1ONNA 5IDWA 5IG2A 4XYMA 1HEUA 2HCTA 4GSKA 4J1NA 1BXZA 2V6FA 1PJCA 4DA9A 4D7AA 4J4TA 1Q1NA 3NYWA 2A92A 2E4AA 3HUDA 1B0AA 4MVJH 4BB6A 4OGWA 5JDIC 3K31A 3VH3A 1GADO 3RWBA 3O03A 1NP3A 2VUTA 4ND3A 4CLXA 4E12A 1H6AA 3CMMA 2DUWA 3HN7A 3ZGYA 2DFVA 3EGOA 2AQHA 4ALKA 4ALIA 1XQ6A 1JKIA 1PJTA 3LC2O 3FWNA 3PHGA 4QX6A 2AQIA 1VJTA 2HDHA 1X1TA 3I83A 4NDNE 5TT1A 2WTBA 1TA4A 4D44A 3D3WA 1C0PA 1R4MB 5KVSA 4EJ0A 1ENPA 2GZ2A 3IMFA 2HMUA 1XIVA 2Q4BA 4XIJA 3UGKA 3WMXA 2NACA 1EVIA 2PGLA 4BV9A 4EUHA 1VL8A 4HFJA 3WQQA 1DIGA 3ZWVA 1OC4A 5F3RA 3HDJA 5EPOA 3OQBA 4TRMA 3JYPA 3L0DA 2P4HX 4RORA 2Q3EA 4RVFA 4J0EA 4WLUA 4E2YA 1UAGA 3H9GA 2OXIA 2YV1A 3DO5A 2OGUA 3PFFA 4YCAA 1P1JA 3FR8A 3EMKA 4TKMA 4TZTA 1MUUA 1PWZA 2CD9A 5TNXA 1NHWA 3V1YA 4CMAA 2VRCA 1GU7A 3E5RA 1E5LA 4WUVA 4A27A 4DXHA 3PDUA 3L9XA 1WMAA 2O3RA 4YT5A 5JY6A 3TFOA 2BFMA 4FOSA 1MGOA 4OOFA 4WPGA 1XHLA 1QYCA 2Q1UA 1Q0QA 3JD3A 2HRZA 3ZN2A 1B14A 3DAFA 3MJEA 1HDCA 2P5UA 2BMAA 4N54A 1Q7BA 4ESOA 3EHEA 3H6KA 3KZVA 3GDOA 4RDIA 1KETA 3GGGA 2G76A 3RASA 4WLFA 1J6UA 1KEPA 3AI3A 3WGTA 4GBJA 4BMNA 4GPD1 2NTVA 1GDHA 2E82A 1QRRA 3OJFA 4H7PA 5HS6A 3AM4A 3ZWPA 4E2XA 1M2WA 4QSMA 3E8XA 4TRJA 3U4DA 1B2LA 2ET6A 3V8BA 2VWGA 2CVQA 2P9EA 4YJDA 1T2DA 2PKQO 2WWRA 1YL5A 3DB2A 1HDXA 3SLKA 1ZH8A 1SAYA 1EUDA 2BH9A 1XWFA 2GASA 4CQMD 4BKRA 4IJWA 2B0JA 3C7AA 3CZMA 4YJGB 1ADGA 1KS9A 1HLPA 1PGNA 2X22A 1U3UA 1YBVA 3QW2A 2AQKA 1I3LA 4PCVA 4U8GA 4XIYA 3VKUA 4RQUA 3Q11A 4MJLA 1WXDA 1I3KA 2GUGA 5JSFA 1I5RA 2OL4A 3U4CA 2NWQA 1PSDA 4CLRB 2VWHA 3MZ0A 3JV7A 4AJ1A 5I9NA 3D1LA 5FFFA 1GPJA 1VM6A 4I1IA 4TROA 1ZXLA 3C1AA 3JQFA 1YKFA 3H3JA 3AI2A 1YDWA 3CE6A 3PYXA 1LU9A 3KLMX 3DWFA 3MJ4A 3UXYA 1ISMA 4HX5A 4RCVA 3RU7A 1CETA 3W4KA 4CM1A 1B8UA 2Z1MA 4CQLB 1R66A 1XELA 2VOEA 4HXYA 1A5ZA 1BMDA 4IQ8A 4ZJUA 4Q3NA 5EMHA 3O26A 2FSSA 4J0FA 5AQ1A 4MKRA 5TRTA 5FEUA 3GEGA 1ZZEA 4P22A 2VHXA 1RYDA 3MEQA 5G2OA 4DQUA 3JD1A 4GVXA 1LRLA 1NWCA 3GAZA 3JD4A 3JYLA 4IMPA 4IM7A 4WOJA 2AE2A 2X8LA 4RZHA 4CLOB 2ZKLA 1IY8A 2QYSA 1DRVA 2DQ4A 2BFOA 1CIVA 3H65A 4UEOA 3UN1A 4DIOA 4CMIB 2X1HA 4PG4A 3WFIA 3FSRA 2EP7A 2OO5A 1WVGA 3QHAA 4NFSA 3FBTA 4I9NA 1RPNA 2Y1GA 3A28A 4L74A 1B15A 3KXDA 1SNYA 3UHAA 4Y9DA 3ON5A 3FTNA 3U0BA 5JO9A 2X23A 4YJFB 1VJ0A 1NVGA 5EL0A 3ANLA 4PLVA 1YS4A 1F06A 2VYND 3Q6IA 4BO1A 3RIHA 3E5MA 5F1KA 2NU7A 5AYVA 4KDEA 2DU8A 3RJ9A 4DVJA 1E77A 1V8BA 3X2EA 3AY3A 5CEJA 3LZ6A 3ABIA 4B7UA 5IXSA 1XEAA 3GRKA 3I23A 1F8FA 4GX5A 2EGHA 3Q2KA 1QYDA 4DC1A 1GV1A 2PWZA 2P68A 1QLJA 3TF5A 1GCUA 4J90A 1KERA 1O89A 3WNVA 5L7WA 3JYOA 5A4DA 2FR1A 1ZFNA 3KO8A 3M1AA 3WYCA 1SMKA 4J1QA 2CDAA 1R15A 3OICA 3Q9NA 3EK2A 3JD0A 3U62A 2O7SA 3LT4A 4RVGA 4AJLA 4XEHA 3OIGA 1LSJA 1E6WA 3IJPA 5BSGA 3D7LA 1MFZA 4AJOA 1EK5A 3LDHA 2HMSA 4WCFB 5EESA 4ZQGA 1O95A 4FB5A 4FGSA 2DBQA 1IOLA 3TWOA 1KY4A 1I0ZA 3WTBA 4CV0A 4EI2A 4CM4A 1VE9A 2JD2A 3UH1A 4ROSA 2VHWA 2I5PO 1TVEA 3JQ9C 1I30A 5JDCA 3GY0A 5G0SA 1BWSA 5A5FA 4CL3A 2WJPA 5EQFA 3B6ZA 4UVGA 2JJYA 5DCWA 1NR7A 1KIFA 1GAEO 4NU5A 4ZRMA 4YB8A 1I2ZA 3BMNB 4OMUA 4BNXA 2DFDA 2OHXA 2VT3A 4BVAA 2RH8A 1N7GA 4UEKA 3GZNB 3DXFA 4PVCA 1OMOA 2Q1TA 4PLHA 3NAQA 4K6CA 1RKXA 4IIVA 4DWVA 2IDZA 1YBAA 3E48A 4A2CA 4DYVA 2Y0DA 3HQ4O 1JWBB 3LC1O 2PGJA 2PNFA 3OIFA 4J2HA 3ZW9A 1QYXA 2QIOA 3PQDA 5FYDA 5JCJA 5IDXA 3BTOA 4ND5A 1XSEA 4UUMA 1E1LA 1NAIA 2W2KB 3A14A 4BNKA 2DTDA 4CMCA 4CV2A 1UDCA 2EJVA 4BKUA 1L7EA 3B1FA 3R1IA 4U0KA 2NTNA 1XCBA 2IZ0A 3PZRA 4DGSA 1D7OA 3SBOA 1EBUA 3AI1A 1QV6A 2ZJ0A 3PRJA 1QR6A 5FWNA 3PGJA 4YR9A 4OSPA 2C07A 3BHIA 2IEDA 3WLEA 3M2TA 4D3DA 2VQ3A 1YBMA 4B4UA 1DAPA 4CMHA 4GMGA 1GPDG 3H9EO 1KVRA 3GUYA 1RM3A 1ZIDA 2FY8A 4IDCA 3L77A 3OECA 2C5AA 3BMOA 1JA9A 1QLHA 2A4KA 4R1UA 1Y5MA 1OOEA 4S1VA 5BQFA 1HZZA 3ZV4A 2FRDA 3CH6A 2HUNA 3FCOA 3KHUA 2AEFA 4YT4A 2C59A 5DULA 4UREA 2B4TO 4RO0A 4F46A 1AUPA 2Q2VA 7MDHA 5L4LA 2W2LD 4AFNA 2X4GA 1SB9A 2CF5A 2UVDA 3OEYA 3F5SA 4MP3A 3PJGA 1MC4A 1U3WA 4BOYA 1PWXA 1T2FA 3ZV5A 3W8FA 1NXQA 4ZD6A 4RF2A 1KEUA 4IBOA 3MTJA 1EFLA 3UVEA 4BNTA 2XXJA 5CPBA 3HSKA 4R16A 3DHYA 4U7WA 5L95A 2PH3A 5U9CA 3WGIA 3ASVA 1FDTA 3JQGB 2PZJA 1LDMA 4YAJA 5KKAA 2HQ1A 2CDBA 4Z6KA 1VPDA 5CHEA 1YXMA 4OOEA 3VPHA 2Q45A 4WCDA 1ZW1A 4ZVVA 2HK7A 4IDBA 1VC2A 3MJCA 4XGIA 1Z7BA 3QVOA 4FFMA 1XLTA 3RU9A 3GQVA 3NEPX 3DZFA 5A04A 2BGLA 2HAEA 1E0DA 4IGEA 3ULKA 3WYBA 1U7HA 4KWHA 3QP9A 2X5OA 4UVEA 1O0SA 3IC5A 3VVBA 4M89A 2Y93A 4CMEA 1C0LA 5IAAA 4FQ8A 1Z6ZA 3D4PA 1PZGA 4YDRA 5GMOA 4GLLA 2VCYA 2PA3A 3RJ5A 4E5NA 5AXCA 5BSHA 3OJEA 4BNMA 4J3FA 4LISA 4L4SA 3W6UA 4J4BA 1P44A 4CM7A 1YL6A 1DLIA 3BMCA 4AL4A 3NT4A 1R16A 3F4LA 1E6EA 3GDFA 1R4NA 3EZLA 5G0WA 4FC7A 1DXYA 3ZNQA 3OF2A 5KJ6A 3BMQA 4I08A 2YHIA 4ZGWA 4YBZA 4NBUA 1SOWA 2JAHA 5HWSA 3DC2A 2HK9A 1Z7EA 6LDHA 4JJIA 3ZWWA 3EZYA 5G0TA 4YXFA 3NUGA 4B8ZA 4E32A 4RF4A 4BO5A 5JAZA 5DOVA 3AU8A 4LN1A 3ROPA 1PJBA 4E6PA 3DFUA 2Y99A 1Z45A 2NU9A 4RPJA 1WZIA 3S2GA 3WBBA 2ZTVA 4MIOA 1P33A 4I5DA 1RM0A 3K73O 1VLLA 1EMDA 1R12A 3BHJA 3HB4X 4KTVE 3VZSA 1QSGA 4J2OA 4XGNA 4INAA 5IZCA 1OI7A 1QKIA 1YB5A 4G5HA 3E03A 5JCXA 4M87A 4LMPA 2WE8A 4O63O 5ENVA 4WCFC 2VUSA 1TT5B 4J9VA 2DVMA 4NBWA 5CG1A 5G4KB 3PP8A 5ITVA 5GY7A 4YACA 1E1KA 4WJZA 3UKOA 3BTSA 4L73A 1ZBQA 1LSUA 5EQDA 1DC4A 4ZQHA 5KKCA 1U9JA 4RPLA 4ID9A 4UUNA 4XDYA 4BHTA 5TT0A 4G2NA 1I01A 1PR3A 4MINA 1ZMOA 4YAKA 2VZ0A 1FJHA 3PLRA 2H1SA 3ETEA 1PJ4A 3DHNA 3WS7A 5C37A 2PZMA 2O4CA 3C1OA 3OMLA 1HE3A 4OKIA 5BSFA 1UZNA 1U3TA 1XDWA 4LMRA 1SZJG 2W4QA 2AQ8A 3ZHYA 2D2IA 3GMDA 1PS8A 1NFQA 2O3SA 5I8WA 3I3OA 5L3ZA 9LDTA 2HLPA 2X58A 4LVUA 3G1UA 3U3XA 4TWRA 3GGOA 4DLBA 4U6QA 2GCGA 1W0CA 4QTZA 1KC3A 5IZ4A 3VDRA 2A9FA 4CM8A 4ALNA 1P1FA 2I67A 3KRTA 5A3VA 3WGGA 1TXGA 3PXXA 3WWZA 4XQCA 4J9UE 1E1MA 1JKJA 1GD1O 4YRAA 4K26A 3DTTA 1E7YA 5LC1A 2ZIZA 4NG5A 1EDZA 3TQHA 1P1KA 3A4VA 5EINA 2DPHA 3GG2A 1AGNA 3HNPA 3AM5A 1G0NA 4UVIA 4XYBA 1NPTO 3DBHB 2YY7A 1AXGA 3N74A 1ENZA 1GCOA 2GPTA 5H82A 4BNNA 3AUSA 4J7CA 2IZZA 2I99A 4BNJA 4ZQFA 2JHGA 3ROMA 2GN6A 3C24A 1C1DA 1QYWA 1UZLA 4MKXA 1ZK3A 5L4SA 1YJQA 4FFLA 4E5MA 1E1NA 3DOCA 3TZCA 3TOZA 5AXAA 3K9QO 4AVYA 2ZB4A 4KWIA 3WSWA 2ZTUA 4LCJA 2PK3A 4NBVA 2B5VA 2FP4A 3IUSA 2H6EA 1Q2XA 2AEMA 2I6TA 2J3IA 3D64A 4R51A 2DBVO 3JSAA 4RPHA 2Q2WA 2OORA 3ZNPA 3TN7A 1PL6A 2W98A 2G1UA 2WD7B 1LXCA 3LF2A 3ZWBA 1NBOA 3FI9A 3LSYA 2CF6A 2BHLA 2X7HA 3R0IA 1SPXA 3WLFA 1MP0A 5C7IO 1XQ1A 4KUHA 3GT0A 3K2BA 4IZIA 2NVBA 5B1YA 3X2FA 2IEBA 2TMDA 2BGMA 3GGPA 4PFJA 1Y9AA 1VKOA 4Z0TA 1UDAA 4BUCA 1GUFA 1UAYA 1Y9EA 3B1JA 3W4JA 4AJEA 5F5LA 3NDIA 3DBRB 1WAMA 3TJRA 2FHSA 2XF8A 1W8DA 2YFQA 4BO4A 1JAYA 3D3EA 2Y05A 3HE3A 1NPYA 3WXBA 1PJQA 1V6AA 4FPXA 2WM3A 3FN4A 3FR7A 3ZWOA 3DTYA 3W8EA 3NX4A 5F1PA 4ILKA 4J49A 4FFPA 4GVLA 3DBLA 3LYLA 1PTJA 3EC7A 5HA5A 2GDZA 4FJ1A 5TJ9A 2BKAA 2VWQA 2PY6A 3CSDA 4R4JA 2PZLA 3G3EA 4MVJI 1YVEI 4PG5A 1E7RA 4B4OA 3JQ7A 2AG8A 1EQUA 1F0YA 3WTCA 2O3QA 1W4ZA 1KEWA 4DIFA 1LA2A 4XQEA 3ZWAA 1LSOA 3L07A 3EYWA 3QVSA 3ZWXA 4FW8A 1U8XX 1XG5A 2NV6A 2G82A 4OXNA 3DMTC 4JX8A 1EVZA 2J5RA 2VHYA 3PTZA 1MA0A 1UZMA 1GFSA 1IPEA 1ONOA 2JFGA 4IZHA 1DIHA 2C20A 2YHUA 4TSKA 1EUCA 1EVYA 3EW7A 3HDQA 3RKRA 2O2YA 2OUIA 4Y98A 1YRLA 2CZCA 1JTVA 4BIIA 5BNTA 3V2HA 3ZWYA 1PJ2A 1JLLA 4OIMA 4I9HA 1HDRA 3QWHA 2HJSA 1WPQA 2HU2A 4YAGA 1TI7A 2ZYGA 4E30A 4YT2A 3KSZO 1HSOA 4RLHA 5K6AA 1ZNQO 2YQ5A 5ADHA 4BNUA 2FR0A 4XD2A 5KJFA 5J23A 4JJFA 3QVXA 3JQAD 1GYPA 1GZ4A 2RHRA 4Z9YA 2F00A 4LCEA 5KWEA 5JXWA 1VI2A 2IRWA 5ENDA 2X0NA 1ONPA 1V3UA 1F12A 4L4XA 2NU8A 2Q46A 3PI7A 3QJ5A 5JYDA 3NT5A 3GFBA 1NFRA 3QWFA 4BNYA 4LVCA 2HSDA 2NTJA 1B16A 3I5MA 3TZ6A 3PJEA 4R3NA 4A73A 1DIBA 1ML3A 1YB4A 1MC5A 3NTOA 5GZ6A 4FIZA 1UH5A 4NFHA 4AJIA 5KOIA 3DAPA 4JJGA 1DFIA 3GK3A 1J49A 3IP1A 2VZ8A 4J43A 2Y1EA 3F1KA 1BW9B 3C7CB 2PD6A 1UXIA 3RSHA 3KB6A 1C1XB 1LDGA 3JQGA 3JQ6A 3E6AA 1LTHR 1RYEA 3IL2A 3LK7A 3I6IA 3PYMA 3JQDA 2IXBA 4P4LA 5JW6A 5EIOA 3H3FA 3GPIA 1BXGB 4IS2A 2YYYA 3MWDB 5FF9A 2HJRA 3F5QA 4RPGA 5A02A 3CKYA 5KJCA 4BO2A 2IE0A 3DEYX 4NFYA 4D3SA 1H93A 1K6JA 4HFRA 3TZHA 4ND4A 4IUYA 2WDZA 3GMSA 1NQTA 4AJKA 3RUCA 3HDHA 1EZ4A 4RGBA 1WP4A 4CMGA 5A9SB 1PEDA 4AJNA 1V35A 1GY8A 2WYUA 2AG5A 1FDUA 3B70A 3KYDA 1UUFA 3Q1LA 3OP4A 4JROA 3I52A 1DRUA 3KEQA 3ZV3A 2RH4A 1Z73A 5G0UA 2YZ7A 1R6DA 5BNFA 5JDIA 1ZCJA 2P91A 4NJMB 2VRCD 1B3BA 3JQCA 4XR9A 5A1TA 2RIRA 4FR5A 4PLCA 1BVRA 4JBGA 2CFCA 5JNLA 4Z0PA 4IY1A 5JBIA 1HF3A 4NBTA 5AVOA 4P4GA 4JBHA 3BTVA 3W8DA 1N7HA 1ZMTA 2D0IA 4II3A 1R0LA 1X1EA 2XXBA 3GC6A 1K3TA 1NWHA 5HRUA 1GUZA 4DC0A 4NBRA 4IDDA 4AJ4A 4PRLA 4YAIA 3QIVA 5A06A 1UDBA 2VYVA 1D1TA 3GHYA 2V6BA 4PLFA 1KVSA 2R00C 2EJWA 3G79A 3DZKA 4UEJA 3WMWA 1QYVA 3PJDA 5K0ZA 5TIIA 1HDOA 5L51A 2Y67A 1X15A 2Q49A 5K9ZA 3FNGA 4TRNA 2DTXA 4W6ZA 2B83A 1B8PA 1A4IA 2POQX 1HE5A 4D41A 2I3GA 3D5QA 5IXYA 4N5MA 1NR1A 1IULA 2EW2A 4GKBA 4BO3A 3IUPA 3IKVA 4GL4A 1PL8A 3KYCA 3M6IA 5C7OO 4OM8A 4C4OA 4WE3A 1DEHA 1DC3A 1HYGA 1SO8A 2C0CA 5DCYA 4XZ3A 1BRMA 1YH3A 2YQ4A 2GN4A 3NDJA 2JL1A 1TB4A 3JQ8A 4HADA 4NJOA 1A27A 3FF4A 3D4NA 1E3SA 4E5YA 2O48X 3O8QA 1LNQA 1U2GA 4CMBA 4K9DA 4LK3A 5BNIA 3SJ7A 2Y1OA 4O59O 2NVUB 5I9MA 3DOJA 1VSUA 2E6UX 3TRIA 3W6ZA 1V9LA 1N8KA 2Q2QA 1YE3A 3ZWMA 5B4UA 1G6KA 1Y8RA 4PLTA 2X5JO 3MJVA 2NU6A 2XAAA 2JCVA 3VTFA 2FZWA 3E1KA 1PZHA 2SCUA 1T24A 3EVTA 3JCZA 3LLSA 3ORFA 3DQPA 5DT9A 3UUWA 2GLXA 2Y1FA 1Y5RA 4Q3CA 1X7DA 1YJ8A 4AJPA 4M49A 1XU9A 3RFTA 6ADHA 3S2FA 4Z9XA 5COBA 1Y7TA 4WLEA 2IZ1A 2JCYA 4E33A 1K0UA 1SB8A 1EFKA 3PJFA 1I36A 3Q2IA 3KSUA 3IQDB 4OQZA 1NAHA 3IKTA 3FRJA 1JWAB 1OC2A 1AHHA 1GYRA 2NQTA 4NQZA 4UVHA 3GPDG 1NNUA 1E3WB 1ZJZA 2B5WA 4RVDA 1DB3A 1D1SA 1T2EA 1WDLA 4CV1A 4D79A 1DJNA 3U9LA 4LRSB 4BO6A 4HNHA 1MLDA 3PDJA 3RUIA 4DTIA 2H9IA 1Y8QB 4EDFA 5JPIA 3ITDA 4ND1A 2PZKA 4F6LA 5FI5A 4IXTA 4JP3A 3QE3A 1PS9A 4GQAA 4B8WA 4GX2A 3JQAB 3PGXA 2CY0A 2NADA 4OYRA 5LDHA 2X5KO 1NM5A 3K6JA 3WBFA 1X14A 4XJSA 3V5NA 2Q1WA 1AHIA 4Q3EA 1JN0A 5TLSA 1E6UA 1Q7CA 4IQGA 3AOGA 1ENYA 3QY9A 4R1SA 1K6XA 1NHGA 5ICMA 5L45A 1TT7A 1VL0A 4YVFA 1KVUA 1L1FA 4CLEA 1T2CA 3B20A 2GO1A 3E9MA 2HMTA 5F1OA 3EUWA 3INGA 3GDGA 1LJ8A 1M66A 2EKQA 3SXPA 1WDMA 1XGKA 1V0JA 3KYBA 5ILOA 3HZZA 1O94A 3K8ZA 4MP8A 1Y1PA 2YDXA 3WDSA 2FPIA 5IJZA 3RC1A 5KJ1A 2CVZA 4YJHA 1MXHA 1O8CA 5KNLA 4BKPA 2B35A 1LC3A 2PR2A 1WMBA 3Q3CA 3TDKA 4L9RA 1FDWA 4H3VA 2AW5A 3F46A 3MOGA 4IQ0A 4BV8A 2H5LA 3ZHXA 2VNAA 4CM9A 5I9LA 4R1NA 4PZEA 3BIOA 1EE9A 5U1PA 2D8AA 4J6FA 2DBZA 4OL9A 3WOHA 1S7CA 4MIYA 3D3WB 3NV9A 3AOEC 4BNIA 1YQGA 2ZQZA 1JU9A 3STHA 1AN9A 3QLJA 1XKQA 3L6OO 1ARZA 7ADHA 2FWMX 3KETA 3K5PA 1YOVB 1B26A 4CQMB 3TL3A 1MXFA 2X9VA 4O1MA 3C8MA 3VZRA 1KC1A 3GZ4A 4P38A 5I7SA 3DMYA 1JVBA 3DFZA 3GVXA 3H9QA 3RVDA 3WGYA 3VC7A 3DZHA 1V3VA 4Z0HO 4CUZA 3QV1A 3VZQA 5JCJD 4RF3A 5ES3A 5JMPA 3GLQA 4XB2A 1PGOA 1PJLA 3P5SA 3JQBC 4LGVA 3WIEA 1RM4A 9LDBA 3OFSA 3CXRA 3FNFA 4BGIA 1H2BA 3AY6A 2OMEA 1R4MA 4CJXA 2GNAA 1OBFO 2P4QA 1E3JA 3V1TC 4FBGA 1H6CA 3GEMA 4N5NA 4MVJA 3L9WA 4L0QA 2V6MA 3H8VA 1LC0A 3TNLA 1VKNA 3JQ9A 3EVNA 4FFOA 5C3MA 4FJ2A 2R2GA 4IIUA 1P1RA 2D59A 3B1KA 4PGFA 4BNVA 3I4FA 4E2WA 2EHDA 2W90A 2EV9A 4N5LA 4TKLA 5JE8A 4CV3A 3FBGA 1DIRA 4KMSA 4FCCA 5DP2A 5BR7A 2DM6A 1CERA
chains in the Genus database with same CATH superfamily
1VYHA 3MPOA 3Q8WA 4QBIA 2GPJA 3PNSA 2DULA 4QFCA 2FSHA 1NA5A 3OIVA 5T8KC 5B1DA 2OP0A 4M8IA 4JQCA 5BQ3A 3CH7A 4MTCA 1DUSA 1ZU4A 2ES4A 3ZZTA 4HDRB 4YP9A 1JEYB 1Z16A 4V0RA 4J0QA 1NTOA 3DR3A 5GZ3A 3I2JA 1EK6A 4F1WA 4X54A 4Q82A 5KNBH 2VBGA 2X5NA 1UWLA 1C8KA 4XVUA 5TGZA 1Q0SA 2OECA 1USIA 1LK0A 2ZRLA 4K28A 3NUQA 3BWMA 2VNSA 3KPUA 5ALGA 5B4TA 1Z2AA 4L8VA 3SZRA 1V1RB 2A9PA 2BBOA 2LIPA 1R0WA 1U7PA 2OG2A 4XYEA 2RCYA 4TRRA 5AKYA 3NGXA 4DT1A 1ZLYA 4EA6A 5JZSA 3QEBZ 2DG2A 4WKBA 3O4GA 3UAWA 2CXUA 1E79D 2GPYA 3K2EA 4RD2A 3ZWNA 1KYVA 1NONA 3IDSA 4I5FA 1J97A 3T7IA 1UMDA 1B00A 3DE3X 3FETA 4HQLA 4KUEA 3PXUA 1J22A 5AOBA 3CNQS 4DLLA 3DDZX 3NANA 1X39A 4IHQA 5AESA 2IP4A 3IH5A 1VHLA 3QZUA 2DR0A 1EXVA 4EDHA 1EM6A 3O90A 3WADA 4DRYA 4HGQA 2GLTA 2ZYAA 2YWCA 2JGNA 1Z29A 1WXIA 3PWSA 4GWKA 2W6OA 3ICCA 4HNUA 2IBTA 4J16C 1A8UA 4RFSB 4HDQB 1T1SA 2OCKA 4I6EA 4EHAA 5HJ7A 1BVHA 2QEQA 2BFDB 3MGBA 4XOIA 4EW6A 2Z3VA 3MSXA 3Q10A 3I4CA 4TLDA 2QM8A 5G3YA 4ZHQF 5AW3A 1UZUA 5JZ9A 4PLPA 3B82A 4EYOA 1NJFA 1VE7A 2CSUA 2VSYA 4M55A 4TTTS 3ZXIA 1M34E 2GPAA 3J80A 4PN3A 2O8FA 1H1LA 5A5EA 1YHNA 2BLLA 4RJTA 5FO1A 4O8CA 3FCAA 4PPNA 1JRLA 1FBTA 1E5QA 3HI6A 3D31A 4GF5A 3WC4A 1MX3A 1MHPA 5A9SA 2Y9MB 3A3PA 1KI3A 3IJRA 1QHFA 3OOJA 1E7SA 4OLFA 4L4ZA 4O0LA 3ZU3A 5CVTA 3KHTA 4CLRA 4B2PA 1KIMA 3ICPA 5B2FA 5LMCA 4QGFA 1GHTA 1BO6A 2J6IA 4IIBA 5CM8B 2JEOA 3COSA 3V8NA 2VRBA 1D2EA 3GR6A 3OHMA 3PLNA 3G8AA 4PQGA 4N76A 2I65A 4EKDA 2B4QA 1FUIA 4GRAA 2BMVA 1NKSA 1YDEA 3OEHA 4HK4A 4JEMA 4I99A 2CLMB 1Z4OA 2IJGX 1G7TA 5K1ZA 1E9FA 4OV6B 3BE6A 2ZYVX 1G8MA 3TK1A 3KL4A 5ENZA 1TVMA 5C8YF 1DFGA 2X0KA 2QX4A 1W36C 4CQLA 2WJVA 2OM6A 3FLAA 3E82A 2RBEA 2AWNA 4DQXA 2ILTA 3SXUA 4BJHB 3T3EA 5KYXB 4FOOA 1WXQA 3HPQA 2JBAA 4DQVA 2IXGA 1E32A 3DYIA 2OFFA 5SZIA 5KDLA 4CWAA 3CINA 1CR4A 1UIMA 2W7TA 3F90A 1JEQB 4PYOA 1DIAA 4V0KA 4QDZA 2JIZA 1W4BA 4Z54A 2DQKA 3GUUA 3IMEA 4M0CA 2RHHA 4B44A 2PE5A 1J8DA 3GLHE 4G8JA 4LSMA 1QMGA 5LMZA 3BTUA 3GFOA 4CMIA 5CR9A 1YR7A 5B5SA 5BOVA 5FTLA 3I37X 3ZZMA 5K5EA 5EJ7A 1KL7A 4F86A 1I4EB 1L5HB 2OFWA 1ISHA 1LBEA 1AKYA 3K9LA 4W1QA 2O7RA 1M0EA 4LXQA 4CEIB 2EG5A 2PWYA 4ZOLA 4F84A 3G9XA 4FI3F 1RVV1 2BGRA 5LUBA 3MCTA 3UG7A 4Q9AA 4BB0A 1TAHA 5LBUA 1C7FA 1KZGB 1NRWA 2IYXA 2YR0A 2Q1SA 3E8SA 3F3YA 3QY0A 5GM2A 3UFXA 1T1EA 4Q9KA 2UYQA 5DIZA 1C29B 3MGGA 3PFBA 4ZEMA 1RJGA 4O08A 4QJ3A 3K1AB 5KU7A 5KYXA 2ZTLA 4WASA 2JJ2A 1KZ6A 1Q1QA 2XUHA 3ZCRA 2QBYA 3I9V1 5CNKA 3VKVA 4FTWA 4BBJA 1M6HA 3O4IA 5KX5B 4R1TA 4ENTA 2BVNA 4MRAA 1SCDA 3PWTA 3DEIA 3B3JA 1P4HA 1YDMA 4Q1BA 1RT9A 1CVRA 4AUNA 1HYQA 2NVUA 5LQAA 2WHPA 5AKXA 2J0UA 5DBGA 2WKRA 4AROA 5A5GA 3RDPA 1XMSA 1KBQA 1U3VA 2UUOA 3SDZA 5K99A 5DXFA 5BUCA 2HB6A 3OCZA 2H65A 1DBVO 2EZ8A 1BVYF 5IVHA 4CM4B 4LZOA 3SZMA 3KPVA 3GG9A 1B7GO 2E9SA 3N7UA 3QNMA 4Z99A 4CI0B 3UYKA 5IVDA 3P0RA 1AM4D 2R751 1H9BA 3ZH9B 2A4MA 1Y37A 1A9YA 1GQOA 2BT4A 2Q5QA 2VJMB 4PM4A 4DBVO 5JNSA 3HKDA 3JTMA 5IFLA 3QBJA 4EY4A 1Q91A 4B4WA 2W6JD 1J99A 3TI9A 2IV3A 4ZFNA 5B1EA 1SIUA 3PRHA 3FPJA 3L1VA 4O4HF 1NW8A 2QJWA 2WTNA 3QFHA 4GI2A 1FFEA 1OFHA 3HFGA 4CKWB 2R5WA 4TV8A 1JVSA 5ALUA 5ARDA 3WLKX 1Z75A 5AW6A 1MJNA 1JIJA 4M8SA 4TLCA 2PNJA 5IKPA 2V3VA 2AE1A 3FNQA 2NQ2C 1HFWA 2J3LA 3DKKA 3R3JA 4DKXA 2R4UA 3D81A 3K0CA 4QOGA 2OHFA 3C1TA 4DLPA 3ASUA 4GGMX 5SV2A 2WABA 1X7WB 2BSAA 3NBAA 4EFDA 5T4HA 3ITNA 3RYCA 1G4UR 1G9SA 1KDVA 2UAGA 3IAHA 1Y8AA 4KK4A 1M73E 4Y67A 5F9MA 2FF5A 2PX6A 1X7ZB 3ST7A 4G9EA 1A5BB 5JSZB 3WJ2A 5CT9A 1UPUA 2ZULA 3BC1A 4K87A 4NVRA 4ROTA 3BA6A 2YH2A 2WSSD 1NQAO 3L6DA 5EVCA 3KOMA 4DV4B 1J1UA 4X94A 1YCDA 3KV3O 2C7PA 4PTZA 3D6FA 1US8B 1B93A 3NRBA 4FZRA 4TYQA 4MJ3A 4UOZA 3A1SA 6PFKA 2AR0A 2HQRA 3B2NA 5KYUB 3I9KA 5LXTF 1KOJA 3ESXA 4X85A 1JKFA 2HKIA 3H2BA 1UKYA 4P53A 2B69A 3CNNA 2I2WA 2IS4A 2IU6A 4BCCA 1J56A 1JG7A 4FOLA 4NL4H 3HU5A 1VIAA 4JXZA 1Q14A 3EZ9A 4FU0A 1TZJA 3A7DA 3BMOB 5FT9A 1W25A 2Y0EA 2IH5A 2DRIA 3COWA 4C0JA 4EL0A 2Q3HA 4O1IA 2LWIA 1H0RA 1P77A 4OBBA 4CVNA 1IEXA 1AGPA 3JWIA 5ETJA 5EERA 2XRZA 4U2FA 4QJIA 1G21B 1GM5A 2APJA 1P2GA 3D8HA 3DMGA 5FAXA 2H9YA 1ZVMA 3DMNA 4CODB 1SVNA 2C9YA 1VE6A 2Q3JA 3NORA 5J2TF 5HUJA 4BNGA 4PCLA 1QVVA 5BMOA 4JELA 5CCEA 5K8VA 3RS2A 1U3DA 2VPTA 3BS4A 1T5LA 1N0VC 1NJ8A 5CP8A 4F5DA 4PU0A 4QQ8A 3W5DA 3PKIA 2NO1A 3ZHUA 5EJ9A 1CY1A 2EBWA 2PU5A 2VJYA 3V4RA 3ASYA 3AUXA 1C50A 2HIGA 1YRYE 1SULA 1O5OA 3CT4A 2GNPA 2Q0QA 4B35A 3HV2A 2RGAA 1E4OA 3CG4A 1CUBA 4UEWA 1CXZA 621PA 3AHJA 4U02A 1M5TA 5KVCA 4LX8A 4TMFA 4L2IA 4GH5A 1E1QA 3DM9B 5HM8A 5IT4A 1GNSA 3BX1A 1WKBA 1QK3A 2Y66A 3ZY3A 4CQMA 5GGXA 3P2OA 4ZVUA 3NKLA 4NABA 4XWOA 4K9OA 3ACBA 4LYDA 3ZQUA 1O7JA 2XGJA 1JSCA 1W5BA 5P21A 3V7YA 5HVNA 2P65A 3VA7A 4RVOA 3PE4A 2PD3A 5KMGA 2WT9A 4G63A 2WSIA 4E5DA 1DNPA 4KZKA 1XDZA 4BFTA 4CUKA 5CEEA 5C53B 4ZOEA 2VQFB 3OQJA 4S0XA 3D3QA 4NU6A 1BN6A 1PFWA 3ZE8A 2FFBA 5JH7A 3U4HA 1MAHA 3I1FA 1Q7GA 1ML4A 3C7TA 4BJ6A 3TBKA 3ZVMA 5I9TA 4HWRA 2GPNA 1PT8A 3OURA 1E7QA 4OFWA 5C9ZA 1CUHA 2CNBA 1KE1A 1SQGA 1H5QA 1Y89A 1LLCA 2L17A 2YZGA 1NX6A 3H0CA 3IUNA 3KBBA 4H27A 3EC1A 4JA2A 4M60A 4BO8A 1TMGE 4KBYA 1WZUA 3P0HA 2QT1A 2RGRA 2P4UA 3EDCA 1YV9A 3BMCB 3AFMA 2OCYC 4C7KA 4QKQA 5JAMA 5J3JA 4XQ9A 3TRDA 3VKGA 3FG9A 3KXKA 3KPYA 3H5RA 1L3CA 1PZEA 4Q03A 5C5IA 4L22A 4EG6A 1W581 4F3KA 1IXRC 3OLVA 4U39A 2C29D 2VSXA 4ZAWA 2OA0A 2UYYA 2AR7A 3A06A 1GG9A 1JIQA 1PCXA 2B4AA 2NTEA 2REQA 3OE4A 4FS3A 4IEIA 3ZS8A 3FVRA 3QUTA 4M98A 3BE8A 2V4UA 1KQ3A 4P4UA 3AR2A 3OETA 3O83A 3P27A 4BKOA 3RUHA 4WQMA 5GV7A 1U0RA 4KUGA 3GN2A 4NOKA 2OVFA 2EL9A 1KYQA 3B3GA 2I8LA 2I8AA 3GHHA 4RVNA 1NBWB 2QYTA 3LDFA 3O5AA 5BNIA 4URXR 1BMTA 4YASA 3QM1A 1OXXK 5L9AA 2DPYA 2EX1A 2E85A 2IEYA 2P5YA 4HLCA 4ZKEA 4LDZA 4F4HA 4H7JA 4IINA 4RL4A 1Z74A 5IX8A 3F73A 3E3OA 2V4ZA 5EE3A 3CXUA 3RC7A 4QYMA 1W1UA 1UOEA 3OTGA 3IV7A 3FWZA 4H08A 5AHWA 3MWFA 1RIIA 3HDYA 3ZKWA 2F64A 3NGLA 3B51X 3QFTA 4G0PA 5IPFA 1X2BA 2IPAB 1A96A 1OZAA 2Z56A 4B2LA 2VYNA 4JGBA 1S01A 3ETHA 3KEOA 5HRCA 2GM4A 3ZLBA 2H63A 1GN8A 3U17A 1CEXA 2ZRDA 5F3WB 3ANXA 2P6NA 3V4LA 3O31A 3QBVA 3HCBA 5IMBA 5JDCC 2FDXA 3AP2A 1TJYA 4Q3KA 5I7FA 3ZUPA 2GD6A 2O8DB 1P9OA 4BTVA 2DPMA 3TJZA 4INJA 2PZEA 5HIKA 1LK7A 4QC2A 5ALXA 2NVWA 1IM8A 5D7NA 4TV9B 4GM1A 1P5JA 5FA8A 2B94A 4FXPA 3RSLA 4B4VA 3HUFA 4XCVA 4H0NA 1EFDN 3JTEA 1EVQA 2PU7A 1B8VA 4Q4AB 2OPHA 4K9KA 3I12A 2WVJA 4C7OB 1JT9A 3WNBA 1E3TA 2MHCA 3WLAA 2YFHA 1C3VA 1SM4A 1H6BA 1OD6A 4PAMA 4DA0A 1CCWA 3VU9B 1SC3A 1D2MA 2HRBA 2JIDA 3KVVA 4UMDA 4ZOLF 2EBHX 4JZKA 5DYGA 3SQNA 4HYYA 2JD1A 3SKXA 4HOYA 1M7GA 1SHJA 3AF2A 3R0VA 4S1WA 1NNI1 4MIEA 5IW8A 2CJPA 2A57A 3SVZA 3V1UA 4DLZA 4POAA 2FZEA 1N9GA 3RM3A 1VOTA 4ZK2A 1WPXA 3FPLA 4CU5A 5DZSA 4BGVA 4PRKA 3BXHA 4LJ6A 5CFNA 4B1FA 2J0QA 4JSYA 2OAEA 2P6UA 4TWAA 1JKJB 4UUOA 4INZA 5FOVA 2IH2A 2V7GA 4MITA 3BRQA 4UC0A 4AM8A 1EVKA 2YJ5A 3UGQA 3I1JA 4KMMA 4YCJA 4ZVRA 5KYTA 4UHEA 3AKCA 3DONA 3D8TA 3M7IA 1ZG3A 1A82A 1ZOLA 2AOVA 3DQZA 3MJSA 1PK8A 3V1LA 4EYEA 3KFVA 4P4TA 1DXQA 1Y9JA 1UBOS 1OVGA 4P3OA 4Q5IA 1JXMA 3CJQA 1KEVA 4NC9A 3OJ0A 3EWAA 1T9DA 4B45A 3HVKA 5HUHA 2FSPA 2YW9A 2QU7A 5IBRA 1H94A 5K0LA 2BRUC 2NP7A 3OQ1A 2BN4A 4EHBA 4EWLA 1QTQA 1VYVA 3I05A 3IPRA 2ISSD 2VWPA 1NOJA 4MW7A 2WA1A 4QFMA 7AT1A 1TADA 1OFUX 4Q00A 1DJPA 3P32A 1C1DB 3H2YA 2ODBA 1W52X 1W4AA 1I0LA 4IIDA 4LWOA 5COQA 2Z58A 4LQLA 1ECLA 3PHJA 1YVUA 4FFWA 3WJAA 4YRBA 1Q3TA 2ZJYA 4D98A 4Q9JA 3IR5A 4BP3A 5CHYA 5A3JA 3VJKA 1RQ7A 5LBIA 2FP4B 4TV8F 1M34A 4PPGA 4OH7A 3MMZA 1A71A 3VTZA 3C70A 4F5ZA 1HE8B 3OJLA 1PJ8A 1LBQA 1PQUA 5D5PA 3OFJA 2TS1A 4YRMA 1AK2A 3DBHA 4TS4A 4FDAA 1PGPA 3DA8A 5BVHB 4YRGA 2DQZA 3ELUA 4UBNA 2FU5C 4YMVA 1ZM3A 2OBXA 5AICA 3ZDXB 2HO5A 1FMLA 3LP5A 5AHXA 1JEAA 3ZHBA 2TMGA 5TF4A 4KPYA 1N0UA 3AHHA 2NYUA 4M0FA 5AR1A 2MYTA 3DCYA 1A4UA 3MWYW 3CRRA 2AS0A 1U28A 3CVOA 2WF8A 4P4NA 2AC2A 2OO7A 3H13A 3TI7A 2BFNA 3OCVA 3PTLA 4LHXA 1RJEA 2OO3A 4QQKA 3TR0A 5BW5A 3E9QA 4DARA 4AZSA 2Z6UA 3I0ZA 5KDOA 4I81A 3QVKA 3TLCA 1A9XA 1N0IA 3PR1A 4QPCA 5JI3E 2WHRA 5HBRA 3WMGA 3IVMA 1E6CA 3VZPA 4E2ZA 1QC5A 4E5PA 1YHZA 4WD3A 4IRMA 4LKOA 3D9QX 4JENA 3T0GA 5IC6A 4M7OA 3CB2A 3P9ZA 3ER6A 3DBLB 4QVIA 1LTQA 3G0OA 4I55A 2WD7A 5KTTA 2E5LB 3LIIA 4QYSA 5I47A 1UANA 3LHFA 4A5OA 1N1GA 4IIHA 4IG9A 3OJCA 1LB1B 2GPSA 5DX1A 3ZBTA 4M7WA 4PLYA 2PAAA 5TPWB 1F5SA 4G4SP 1CEQA 1XFAA 3GLHA 3W7AA 2PTGA 1AF7A 2CMDA 1JG6A 2WMDA 3F74A 5GP1A 2BMWA 2BDTA 3E9NA 4N47A 2BFAA 4G6ZA 5HIMA 4YV0A 5BN4A 3F6EX 1DRWA 4OI1A 3EDRA 4NNJA 2NAPA 2PX0A 3DBRA 4XD7D 3U7GA 3KTDA 1SKBA 2IDMA 3I9FA 4ZYTA 1K3FA 1NGSA 4JR0A 4UMFA 5F2KA 1M8GA 4AU1A 1RZRA 1T3ZA 1N2IA 1G1AA 2RG1A 4LJAA 2AMFA 4W7HA 4XWGA 2VPQA 1SU6A 3MWGA 3M81A 4LYFA 2YJ6A 3WQSB 2JPDA 4HLUA 3PS9A 3AHEA 1Y1SA 4F3CA 3ODPA 1WXWA 1Y3AA 4IWXA 2IHKA 3VISA 3JZDA 4O3MA 4LDJA 4BLWA 2PQMA 4JIGA 3WYGA 3HP7A 4B40A 2J4FA 4Y2TA 1IY9A 2H4JA 2X77A 3R24A 4F38A 2R6AA 1ZD1A 4F3RA 1XLWA 1QB7A 2I8CA 4MK4A 5DBIA 2YRWA 5BXQC 1SVSA 3BZUA 5KCMA 4L9WA 4GYJA 5FHRA 5IAJA 3R7BA 3UNXA 1R0YA 1TNDA 1FY2A 1E5XA 3RG8A 4CF5A 2GA9A 1EH5A 1U80A 4FINA 5FUQA 3RFFA 4C5BA 2VXYA 4WESB 3W1EA 2GM9A 5LYJF 1OKKD 4CIBA 2GOYA 4TVBA 3U7HB 4D6PA 3EODA 4MYRA 5EIFA 4LJKA 5IZCC 1GG2A 1PKXA 1P4AA 1TZKA 3QX7A 1P6UA 3GA0A 2YBEA 3IE0A 3LCMA 4QO7A 3UAGA 4CZ2A 2G71A 4DA7A 3T1TA 2JIMA 1MV8A 2R1TA 3VJMA 1I33A 5AVYA 1K4YA 3CGGA 5DH9A 3H2ZA 3UAZA 4MX8A 3ROTA 4RHFA 1SVIA 3A32A 3LLUA 4ZAVA 3CLKA 1JFFA 1YZ3A 2VSQA 1UXKA 3PYLA 2JD0A 5T5QA 4Z3DA 3I58A 4P5EA 2NU8B 2CD7A 4HQOA 4N9WA 2J5KA 4B3HA 2NUTB 1GQFA 2JVKA 3RU2A 4C4ZA 1BXKA 1JILA 1J2RA 1VCHA 2R6JA 4JLNA 4H1WA 4ZJZA 5FUMA 3KQQA 3FPGA 2XNSA 2H08A 4HN4B 5FP0A 3UJ9A 1JLRA 1S1CA 2P3SA 1TAGA 2YL2A 4ERXA 1AOXA 3UWKA 5CB6A 1F2UA 3CUVA 2ARKA 4EHLA 1AE1A 2FGJA 3OKAA 2G1PA 1Y4DE 4BKMA 4EPYA 1HE1C 5LJLA 5GADl 3PA6A 5F98A 2VCEA 2ZQYA 4ZT7A 4M86A 1CPYA 3F7OA 3VZCA 4B3JA 1N75A 4ETWA 4OK5A 2OAP1 1PJ3A 4EB6B 1GA1A 2N46A 1M76A 4H1UA 3VH1A 3DG9A 4IJKA 4C76A 5AM4A 4CQNA 1U4OA 4LHVA 3O2SB 1IWPB 3LSTA 4IG4A 1CY6A 2WTMA 1E0AA 4MIKA 4HZGA 4EGSA 2JK0A 3QELB 1J0XO 4MQFB 4KMOA 4URYR 5JYBA 4Z4IA 2AG1A 3ZDFA 5L4NA 4I1RA 4D4IA 3VU1A 4PZPA 4Y8VA 1N8NA 1TUGA 2JHFA 3O1HB 2PRSA 4L8FA 2DHCA 1KOLA 5HKOA 2HR1A 4OXYA 1EKXA 3D3JA 4B9EA 1XVTA 4TLAA 2PT5A 1XAJA 5J5VA 1O4VA 3I5AA 3MS7A 2F1IA 4QEZA 5JYEA 3IDQA 3GB9A 1IPFA 2GZMA 5SYAA 3O6VA 2PYDA 3W04A 4M9QA 4NMWA 2AKYA 1WEHA 2IK8A 2WJYA 3F8SA 3N28A 3RTGA 1NUUA 3ITKA 1V71A 2LIVA 1BXRA 4NYMR 1DLJA 4BLQA 4B34A 4FB4A 3Q4GA 3RARA 1NUTA 4A26A 4GX1A 3Q8MA 3GLSA 4RIIA 4PPFA 3SF8B 3MWDA 1WB6A 2ZCJA 4KMRA 4AECA 4BIMA 4MVJD 1C1YA 4XJVA 4MLPA 2I34A 3A0UA 3TKYA 3G0HA 4HC4A 4BGEA 4UQLA 1A7AA 2R87A 2I2FA 4RXUA 1KQGA 1TA0A 1HGXA 3QWBA 1RQLA 3C3XA 2GBIA 4QO8A 4R01A 4UATA 3TSYA 3WHPA 2EFHB 2X0JA 4QGHA 4UU8A 2MOKA 5KTNA 3L4SO 1GQ2A 4DIEA 3C87A 5BSRA 4OQYA 2FFHA 5L6LB 3D4OA 3TM5A 3LRTA 1C80A 5KQGA 3A9WA 1ZJYA 2IW3A 4M21A 1STOA 2ZIAA 3TIFA 4KO2S 3IE2A 3JPWA 5ER6A 5DBEX 3RUFA 3UICA 3EDMA 1ISGA 1JJVA 1E7MA 3OUTA 5CVVA 2BCJQ 2GZ1A 5FTWA 3O94A 2JFOA 2X8JA 2I76A 4DMUB 1FJ2A 1Q1GA 3LOQA 4ZVPA 4MQ4A 1XKTA 1NYQA 1CERA 3L18A 2WIJA 4GR9A 4PTYA 4DJEC 5JV5A 2XNKA 1NRIA 2HEIA 5HHTA 3L7YA 1WUHS 2MYNA 3NVDA 1A9OA 1XTJA 1PBNA 2I29A 3MRVA 3OZGA 3R7FA 1U2DC 3VPAA 3P2YA 1JX6A 2IOHA 3I5UA 1QWOA 5IDYA 3MT9A 2X7JA 1FA9A 4WEOA 5F9HA 1OLUA 3GDHA 3KYCB 2V5AA 1F0NA 1VFNA 1QG0A 4D6YA 4Y30A 3IKMB 1L3IA 2DTEA 5LR6A 2NVOA 4ZYYA 4B71A 3CSUA 5LL6P 2ODTX 2JK1A 3SFTA 2C54A 2QAIA 1X7YB 3JQ8B 3WNDA 4A2WA 3QX3A 2ZCVA 2F9FA 5IM5A 4WZZA 4TLEA 1U31A 5LQJA 3PPIA 3KE8A 1P39A 3SC6A 2CKDA 1HTBA 1G18A 1Z6YA 2H0RA 3MT7A 5BN3B 4D57A 1RBZA 3CEAA 2CXRA 3DT8A 1JR3E 1IRXA 1XZEA 4ZT5A 4GOOD 5KQRA 3E70C 1WCWA 2WYWA 3KUXA 1MQSA 1S2IA 4BL5A 3SSMA 2D2XA 4ZZ0A 5EWMB 4MMYB 4WLVA 1KKLA 2WJHA 1VPEA 3FH0A 4LJRA 4OHWA 4MKGA 4Q7JB 4PX5A 2XE6A 3JVVA 2ZWAA 4O1HA 3VSEA 4EYSA 1G98A 4IX1A 1QHHB 4D25A 3H2SA 4W5HA 1R5BA 1W29A 1TD1A 2E7ZA 4YAEA 3FOWA 3HBLA 3T7EA 2FEXA 4RWZA 4P0TA 2IWHA 3BM5A 4TQGA 2IYTA 3KAJA 1WQ4A 3UOWA 5F5NA 1YIDA 2TMKA 3EXAA 5EGSA 5GWXA 5LQKA 4DG5A 1GT91 4UU1A 1OTXA 1K7CA 3EPHA 1CDOA 1L4FA 2D5CA 5BYKA 1U65A 2AJ8A 2RH9B 1O96B 3DBOB 3DEFA 3DZJA 4AO6A 3C7DB 4F04A 4Q9NA 3SZGA 2C42A 5D3KA 1U0EA 3DT6A 4OYYA 3AL0C 2EF1A 5IVPA 2JIOA 1C30B 3ND5A 4MV0A 5HTOA 3LT0A 4MI3A 3TGWA 4DC9A 4DANA 4EJ6A 1VHTA 1CS0B 1VBNA 2WI8A 4XSGA 1XBTA 5K6AC 1E9DA 3INTA 5HKAA 2AMVA 1ULUA 4YJ2A 1Y6FA 2UZIR 2ZJ1A 1XK7A 4M38A 3WL6A 5JD5A 1J8QA 1UJNA 4MQBA 4BVGA 2RDMA 2QUKA 4UUAA 5LDDC 4KEAA 4P3NA 1UPFA 1KR2A 3RIEA 5JZOA 2PGDA 4HRXA 1J5XA 4WUTA 4KQ2A 2V7PA 2HDNB 2I2CA 3P4YA 1UPCA 5H4HA 4DMRA 2JFXA 3RQIA 1YBHA 3MCAA 3O3CA 1YU9A 4I55F 2ZB7A 4Y6QA 5CT6A 5BWCA 2PBRA 2H3EA 4U7PB 2PZAA 4ZPXA 3SQWA 4WXYB 4HTAA 1KI4A 1W4RA 4UTXA 2RI0A 2VDQB 4LRTB 2CXQA 1ZCZA 2JVJA 5EXXA 2JDID 1BDBA 4W9NA 3VZBA 3WIVA 1KPIA 2PSDA 4TKUB 4UBJA 2QNBA 5BT8A 1XMPA 4EITA 3W7VA 4MR8A 4C2TA 5I5GA 3G0GA 1ESCA 1REQB 1C41A 1FNMA 3QU4A 1MPXA 2ORYA 4OHFA 4V2IA 5JNUA 2YZMA 3NTRA 3T4UA 3UGTA 2JGMA 2IGBA 4CHGA 5HKBA 1QE0A 2QUJA 4QYWA 4XGKA 2B92A 4ZXPA 3E7WA 5FULA 3HL0A 1KH2A 1QQ6A 4HMQA 4ZXFA 5CA1B 1AC5A 4HGNA 4LC1A 3B52X 3E1SA 2DT5A 1VP3A 2ZATA 3B5EA 4JQZA 5DCUA 1I9CA 1OFVA 2B8TA 3PIDA 4FILA 1FJGB 4A10A 3F4BA 2H2AA 2OKGA 2R66A 1IUPA 1UC5B 2DPGA 3GD5A 1O58A 4ND7A 3PXDA 3WGKA 3ANYB 3ID6C 3OO0A 4GC9A 1X3LA 1GZHB 3JQAA 1NBMD 4I1VA 2AZMA 2KQUA 2R7MA 3ADKA 3HWWA 4FS8A 5D3QA 2P6RA 1I10A 3LYAA 1PW7A 5AT1A 4CEHB 1O6BA 1QJCA 2JAPA 4KXFB 3VR3A 3DW3X 2FZVA 2XNDA 3GBVA 3STYA 4DL9A 4US2R 3C3BA 1JECA 4YDHB 1KMNA 3KZXA 3EA4A 1NG9A 5IDWA 4BRUA 1DRJA 1HEUA 1O8BA 1ID8A 4NULA 1JQ5A 1VGVA 1KRWA 2HDWA 4K46A 3PQ4A 1MO4A 1RAIA 3F96A 5AK4A 4BMCA 2V6FA 4RK0A 1PJCA 3AI7A 4DA9A 3OMXA 4ZTBA 5AJHA 3P26A 1OB5A 4J4TA 3HP1A 1MJ5A 4URWR 3CLUC 1B0AA 3H6GA 3MF4A 1Z0SA 2ZI7A 4PZUA 1K63A 1ZIYA 1NVAA 3TW8B 1AS0A 1BNCA 1E8MA 2VDOB 3ZCPA 3O03A 3GFFA 1NP3A 1TLFA 2IPMA 2Q9CA 3OE1A 3TE7A 4E12A 3FWKA 1VBKA 2RC5A 1N5KA 2QRGA 5I5EA 4OUDB 1XCPA 2GMWA 3ZGYA 1N3YA 1VDZA 3DS8A 3LPCA 2F8MA 3MFQA 1XQ6A 1E2HA 1PR4A 4L7QA 3PHGA 4QX6A 1DL5A 2AQIA 2HDHA 5TT1A 2C4NA 3CRVA 2H29A 1UOPA 4YC7A 5AK5A 6AT1A 1IATA 2MDTA 1N33B 1Z68A 5EXDA 3E27A 1URPA 3HYNA 1AQ6A 3IMFA 4GMHA 2OHOA 2Q4BA 4RQBA 4XIJA 2HF9A 3UGKA 3WMXA 4LQCA 4BV9A 1VZ2A 2MR5A 1QIIA 4EUHA 2H17A 3NBUA 3SZOA 3WQQA 1N2CE 4TM8A 1OC4A 2PGOA 3ZWVA 1NN0A 4TXJA 4I1UA 2PGNA 1L1RA 1QFJA 3OQBA 1DQNA 1ZWLA 2Y1LA 3FYSA 4JHXA 4X7RA 4AZWA 2O2IA 5KYKA 4PNHA 4OGLA 4PIPA 1F8XA 1OYVA 3L0DA 3MXOA 3SLRA 1KORA 1ICEA 4NG4A 4F97A 3Q72A 2VQEB 1C9MA 4RVFA 2E89A 4EHNA 5KREA 4E2YA 4TS9A 3H9GA 2M32A 2QVBA 4JS0A 5ILQA 4C06A 4OTZA 1LBHA 5G40A 2C04A 2YV1A 2EFYA 3CB4A 4AG6A 5JZBA 4BX0A 4W5QA 1U63A 2UZ3A 2C4HA 3ZJ5A 2WUVA 3GJZA 4AS3A 1AA9A 3HJGA 3PRYA 2RHDA 4MLDA 1H3EA 2VRCA 3RIMA 4LJSA 1E5LA 2VYCA 3CX4A 1YI1A 3P96A 5HEKA 2VYQA 2ZXUA 1WMAA 1RNLA 1HFKA 2GK7A 2O3RA 1PJAA 3V34A 2IHBA 1LVHA 1M72A 3WQHA 4LOLA 3TFOA 2X2EA 2IGTA 4WPGA 1OAOC 2Q1UA 1JSXA 2H5JA 5FRDA 1U0JA 1N0WA 4HNRA 2YX1A 1B14A 2C8JA 4NYMQ 2P5UA 1QNLA 4N54A 4DT1B 1GGEA 1KA9H 3H6KA 1U2GC 3KZVA 3QEJA 1SFRA 1ADYA 3NAZA 4IGIA 4DV7B 4GRIA 1TEVA 2G76A 2XUQA 3RASA 3BPSA 3FPAA 4GBGA 4X24A 5JI2E 1SCKA 1J6UA 2QM7A 3MAGA 5DNVA 3WGTA 4C9BA 2BOVA 2NTVA 3AR3A 3W9BA 4HAOA 2E82A 2Z9CA 3FHCB 3W5AA 5HS6A 3PLAE 3K0SA 1P7YA 1R6AA 4MYCA 5KOHA 1G9TA 2DY0A 1B2LA 1ECGA 2HJHA 4OXRA 2VWGA 6NULA 3HXQA 3A6PC 4JZYA 4PC1A 2GBLA 2PKQO 1H2RS 3Q85A 2WWRA 1ZH2A 1POWA 2Z3WA 3BFXA 4X7BA 2FMTA 1G6OA 2OBLA 1IIBA 1P0IA 4LE0A 1VRCA 2BH9A 1XWFA 2GASA 2ZJ3A 3MQ2A 3N6XA 1QTNA 2CCGA 3FTQA 4LS3A 4MGZR 3OWHA 4KR3A 2P3OA 2O8FB 3N8GA 1H1LB 3JASB 3PUHA 1D07A 3QW2A 3VKUA 3B2QA 1BWPA 1Z2OX 1RRKA 3MYRA 2SECE 3AP1A 3Q11A 3VHLB 4DADA 4C04A 4BMDA 1O95C 2N1MA 3QYPA 3H4TA 4G5FA 1GL6A 4CDNA 5A62A 2MSDB 3W78A 4CLRB 1DGQA 3WSWA 2FZLA 3IEXA 5HGJA 3DJFA 1YE5A 1LPAB 2QOEA 3P1JA 2J45A 2QLBA 4LE1A 2JI7A 5KNBA 2HGZA 3B5JA 1NT4A 4NMLA 2PL3A 4YUAA 2QTVA 2HNKA 4I1IA 2AUMA 1ZXLA 3C1AA 2GJ4A 1ZI9A 2HWXA 1W6RA 3I8OA 1E1YA 1ZA2A 2PS1A 1UBHS 1LU9A 2M6KA 4G5SA 2IX3A 2J9XB 2XZDA 3AFOA 3HP4A 4D4KA 1SURA 2ZG6A 3KCNA 4RCVA 1F6BA 4C6TA 3T5AA 2VH1A 4CQLB 1VLZA 2HF2A 3CG0A 4HXYA 1A5ZA 2XSZD 1F20A 2Z5GA 4P36A 3SXUB 3WKBA 5EMHA 3KZKA 1JL3A 4YP6A 4D9CA 4ZJUA 1S3IA 1NLMA 1A9SA 3GEGA 1AX9A 1UKEA 3QX8A 1N6HA 1X42A 5IM4F 1R74A 4DQUA 2BAGA 2WM2A 1QM5A 3WYAA 1H42A 5IEJA 1L2TA 1FFDA 4REOA 1NWCA 3JD4A 3GAZA 3JYLA 4C7XA 1Z6PA 2AE2A 2X8LA 1B0PA 1MAUA 2ZKLA 1IY8A 1IM2A 2H92A 1DRVA 4YFVA 5F1YA 1CIVA 3C3KA 3ANTA 4FMDF 4E09A 5FTKA 1SIOA 4DIOA 3LPLA 3C14C 4CMIB 2UYHA 1MZVA 3FOCA 3ZV7A 5DM1A 2C9MA 4OHBA 1A88A 1P73A 3CONA 5DHUA 2EVWX 4YPVA 1IVYA 1V5WA 3CLVA 1WVGA 4R6WA 4XGRA 1BS2A 4FYKA 3QHAA 3THOA 1ECFA 4IV5A 4I9NA 3LVRE 4MPPA 1FTNA 3MBKA 4MA0A 4ZOLB 4ZAZA 4F7DA 2J0SA 1RPNA 1TZCA 2QIPA 2GILA 4Q18A 2H4YA 1ZD3A 2CXXA 3K2QA 4L74A 1MQ8B 3FOBA 4QQFA 3KXDA 4XVQA 4TTVA 3LA6A 2VF5X 1HL7A 1RC1A 3B38A 3FTNA 3U0BA 2QU8A 4ETMA 2X23A 1Y8CA 1G7CA 3UFXB 5EZ5A 1H0SA 2AJDA 3BMXA 1UBTS 4NBSA 4PGMA 1D04A 3C6XA 4UZFA 3OCCA 3EDQA 3QF7A 2QX6A 3RWOA 1U2ZA 2GJSA 1U04A 3E5MA 4X3OA 4G4GA 1VA4A 3K8QA 5EPEA 2J7PA 4P7BA 5KNDH 1FVFA 3KQLA 3UV7A 5C4IA 3U3RA 2RCNA 4DVJA 2UYOA 4A8PA 1QZUA 3GLFE 2QE7D 2PIAA 3LUDA 1DZIA 4ZZIA 2WHPB 2GJ8A 2J0UB 1W0JA 3ABIA 2AFHE 1XEAA 3I23A 4GX5A 1F8FA 4ZCPA 4E1BA 5FD8A 1GT6A 3S28A 1J70A 2B2CA 3Q2KA 3ZDBA 1DT3A 4BX8A 2P68A 1Z0JA 4PF1A 5IJWA 1KERA 3WBJA 1FSSA 3WLTA 3CZ5A 4ER3A 3LRXA 4MYDA 3WNVA 1DPFA 3C8UA 5HIIA 1YR2A 3U0VA 4CCAA 2WWXA 3M1AA 3M49A 4YO8A 4CKCA 1PHPA 2XGSA 3Q5EA 2J6CA 5J1TB 1SMKA 3NC4A 2O8CA 2CDAA 4DLNA 4MEBA 3HKDB 3U3JA 2ZJAA 1R15A 3OICA 5KAPA 4S35A 1SU4A 3E0XA 3JD0A 3EEIA 1Y42X 3OIGA 1LSJA 4MAAA 4UUBA 3OTHA 3D7LA 3MUEA 4R83A 1R8YA 2G5GX 1N6PA 2CMFA 3LDHA 3PXBA 4TV8B 4AJOA 5CVUA 1V4BA 4FB5A 4FGSA 2V1UA 1HR0B 3ZK8A 1POXA 3AVYA 3EGEA 1MEOA 2VHTA 3HS3A 3QXCA 2C3OA 4EI2A 5AKKA 1VE9A 1UXOA 1E59A 2JD2A 1D2GA 2X6QA 1HLFA 2I5PO 1TECE 1TVEA 3RYCB 1JFVA 3HJHA 5BVGA 1KKUA 1BWSA 5A5FA 5EJ8A 1ORWA 2WJPA 4KNYA 2PRZA 2ZUDA 4N8SA 4G8DA 3W34A 4QGSA 4YI5A 1YHYA 1NR7A 4GU5A 3NIBA 4PX3A 2BFCA 2WOOA 3MQFA 3QLEA 2RHOA 4ZRMA 4YB8A 1UBUS 1IJKA 2OHHA 3B48A 4ZVSA 5A5VA 2ISCA 1SC9A 2TRSB 3M6UA 4OMUA 1PD1A 5DGDA 3TMKA 2JLVA 1G66A 5EMJA 2CNOA 1N9KA 4PHGA 1EDBA 1JKMA 1L5NA 4PVCA 4ZOQI 2O54A 2ENUA 2P3QA 1E2IA 1Z8DA 1XMXA 3VO9A 2V4MA 2OBMA 1OWPA 2IDZA 3LWBA 4DWVA 1YBAA 2JZNA 2IY8A 2FXIA 4RY8A 5DM70 3E48A 2PH1A 4MGYR 3ZGVA 2Y0DA 2IKSA 4OXIA 4C01A 3PGMA 4JMLA 4DYVA 1JR3A 3IIMA 4ZVOA 1QYXA 3TTYA 4EYQA 2P3LA 1I4WA 3PQDA 5YASA 1VSBA 1JIKA 2QN1A 1QS0A 1Z4NA 2F62A 3BTOA 3PL1A 3IP8A 3HLYA 3GA5A 4ND5A 4WZAE 4C07A 2QTFA 1XSEA 3C3MA 3KHKA 5CNJA 2ACVA 1JIIA 5EZYA 4HX2A 2PFKA 2HCFA 1UJ2A 3HNOA 1NAIA 1QV9A 2F3QA 3L0OA 1QGUA 2FKAA 4UMEA 2J30A 4EG1A 3PR2B 3B1FA 2JGKA 3R1IA 4EG7A 4KNWA 2ESRA 4DV2B 1TUBA 4D97A 3GJ4A 1B76A 3T9AA 3HBAA 5ALLA 3AI1A 3P2MA 5IUNC 1AQLA 3PRJA 1YZFA 1QR6A 1NE7A 2ZR7A 3KG2A 3EGWA 4Y18A 4R6XA 4OSPA 3BHIA 2W58A 4LBZA 3M2TA 3S68A 3TAXA 3X1DA 5A6VA 5TXGA 4KRXA 4QASA 1YBMA 3KT8A 3RSGA 1DAPA 1RHKA 5AW2A 1XJ5A 3TLMA 1GPDG 3GI1A 2QQ0A 2YRFA 3JY6A 3Q7TA 3IVCA 4IDCA 4CFZA 4WBSA 1OWLA 4ZMBA 2C5AA 3R9XA 3PU6A 3AYZB 2V9PA 2HA7A 2A4KA 4GM0A 4AZ0B 1O4WA 1PJRA 3I5YA 4PWZA 3TGPA 5TS2A 1QFMA 1TZMA 1WA5A 3U4QA 3RLFA 4B09A 2CGEA 4PQFA 2FRDA 3I53A 3MAJA 5JWOA 1QZZA 4C0LA 3HVUA 3KHUA 4L2IB 5CTAA 1ISPA 4YT4A