1PZEA

T.gondii ldh1 apo form
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
326
structure length
323
Chain Sequence
PALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMCEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lactate dehydrogenase
publication title Structure of Toxoplasma gondii LDH1: Active-Site Differences from Human Lactate Dehydrogenases and the Structural Basis for Efficient APAD+ Use.
pubmed rcsb
source organism Toxoplasma gondii
molecule tags Oxidoreductase
total genus 112
structure length 323
sequence length 326
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2003-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pzeA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1pzeA02
2A4KA 2YQ4A 1JVSA 3UXYA 2ZIZA 1QKIA 1UJMA 4CLDA 4WLVA 1WMBA 3WGGA 4FS3A 4IJUA 1R16A 2AQHA 2P9CA 2RHRA 3QVOA 4KP7A 4KWIA 1IE3A 4K6CA 3G1TA 2QYTA 3RAJA 3RI3A 1JN0A 5G4KB 2NQ8A 2NNLD 1H94A 3BYZA 1GDHA 2V6GA 1JKJA 2ZB4A 3PJFA 3DBHA 3A4VA 3GF4A 5H83A 5TRTA 5LC1A 3T4XA 3R3SA 3HHPA 4MVJH 4R1TA 3O8QB 3DHEA 5COAA 3GNQA 4QQRA 4PLTA 4DTIA 4UREA 2VYND 9LDBA 3F6YA 3UUWA 2HK8A 3PFFA 2F00A 4P4NA 4YJGB 2VUUA 3ENNA 3WWYA 2HMSA 4NJOA 1GUZA 2V7PA 2ZTLA 4Z9YA 2O3UA 1QRRA 5JC8A 1MC5A 1RM0A 1PS8A 3FBGA 4WCFB 3QSGA 5KCZA 1LSOA 4FN4A 2NLOA 2FPGA 3OJEA 4BNMA 4H16A 3H9JA 1KETA 4YJDA 3ZV6A 3WG9A 1AXGA 3MOGA 4ITUA 3UHAA 1NFRA 1WZIA 5F1OA 1EBUA 2PKRA 3QHAA 4GQAA 4BMSA 2Q1SA 2Y1EA 1W0CA 1U9JA 4NHEA 4XX0A 3D3EA 1H6BA 4PG7A 5HA5A 1Z74A 1I0ZA 3PGJA 5ADHA 3IJRA 4JBIA 1RKXA 3RIHA 5CDGA 2J5KA 3JQ9A 4PCVA 4J9UE 3ANMA 5F5NA 4CM3A 3I4CA 3DMYA 1D7OA 1LLDA 1FXSA 2HMTA 4I8XA 2PH3A 3P19A 5DNAA 2UDPA 3GPIA 4R9SA 4OAQA 3VAZA 1SMKA 5ICMA 5B12A 2QQ5A 1XGKA 1YWGO 4Y67A 5KNLA 5IDYA 4L4SA 4AJKA 2FP4A 2QIOA 1PWXA 1ZSNA 3CE6A 1S7CA 4RL6A 4BNZA 1ENPA 3A1NA 3R1IA 3D4PA 5CEJA 1NFFA 3PQEA 1WMAA 2EXXA 1NAHA 3VHRA 4D3DA 1UXGA 3LK7A 1EDOA 4B7CA 1KOLA 4MDHA 5G0WA 2H6EA 2O2SA 2ZYGA 5I9NA 3MWEB 2X5JO 3DAGA 3WIEA 2J3JA 4MKRA 2AE1A 3FNGA 4E2ZA 3C3XA 3I6QA 3BMNA 3O03A 1FDSA 3QIVA 1EE9A 3KM0A 2O50A 4HKTA 5CG2A 1WAMA 1BW9B 1QP8A 1DC4A 4A73A 5F1PA 1SAYA 3ZDFA 4DPMA 1DJQA 1QXSA 3H65A 3DEYX 3TOZA 5JAIA 3F9IA 4CM4A 3H2SA 3TZHA 3DFUA 1ZNQO 3H5AA 4YJHB 5ENVA 1I33A 1KEPA 4AJNA 3VTFA 3PGXA 3JQEA 4CL8A 4DUPA 3CMMA 3F5SA 5DCYA 3VKUA 1UR5A 5CHEA 1F14A 1RPNA 2EF1A 2Q50A 3OMLA 2C59A 3PP8A 3VZRA 3JQBA 3GUYA 1W4ZA 4LRSB 3CEAA 3MOIA 1OMOA 4JCOA 3RBXA 3AY6A 3KXDA 4CM8A 1E7WA 3K73O 5IJZA 1LSSA 3VVCA 3ICPA 2JFGA 3PHGA 3K5PA 4GKVA 1SEVA 2AQKA 1HSZA 4IMRA 4NBUA 2Q49A 3AFNA 3BMQA 4S1VA 1M66A 5B1YA 2AEJA 4WCDA 1N9GA 2EW8A 1NVGA 3GZ4A 4ZRNA 1ZXBA 4U6QA 1YBAA 5AXDA 1RYDA 2XXJA 4MKZA 3BMCB 2Z95A 3MJTA 3ASVA 4YEDA 4KMSA 2R6JA 3NTRA 1NPYA 5EERA 5G0TA 2IEBA 4EJMA 4RZIA 1OI7A 3DMTA 4JJFA 1PJ4A 2HAEA 3E18A 3MJVA 4P38A 4A2CA 3ASUA 2DU8A 2PLAA 5DT9A 2X7HA 3I9JA 1MXFA 4XZ3A 3TJRA 2ZB7A 4BVAA 3ZW8A 1Y8RB 1QLJA 1UZLA 5HS6A 2H63A 4W82A 3WGYA 5K9ZA 1UUFA 4B3JA 4E30A 3KYDA 1YE3A 1ZKMA 2HQ1A 5B4VA 4YT4A 2PFGA 1R66A 2EG9A 4M1QA 4PLYA 3GHHA 2EWMA 4TVOA 2X58A 1XLTA 3H4VA 5TNXA 5MDHA 1EMDA 1XCBA 2ZCVA 3RD5A 3HG7A 4BNWA 1DIHA 1VL6A 2NTNA 4OSPA 3TF5A 1DEHA 1YH3A 3JYQA 2P4HX 1WNTA 5G0VA 3FBTA 2GGSA 4IQ8A 2Q2WA 2ZQYA 3GA0A 3OP4A 4R4JA 2J5QA 3TZQA 4U0KA 3RFTA 1KVUA 4HV4A 3G79A 3OH8A 2BI7A 5DBFA 3QWIA 4AJ4A 4CMHA 4EGFA 2IYOA 3WWZA 1QSGA 2O7SA 5KVSA 4CJXA 1DOHA 3PYXA 3GN1A 1PJBA 2BGLA 4YT2A 3VPFA 1D3AA 2IEDA 3ZWAA 4RZHA 4IQGA 4WUVA 4IBOA 1LDBA 1P1RA 3GRPA 4EW6A 1GV0A 2JFFA 3MJSA 4XQEA 4ZQFA 1YBMA 1IY8A 3HJAA 1DLJA 4LISA 1H6DA 2VZ0A 5CAEA 2OL4A 2JHFA 2RH8A 3ROPA 5BNTA 5G2OA 1LBEA 3LC1O 1JAYA 2EGGA 3AM5A 5DOZA 2BGKA 1T25A 2VOEA 1A72A 4XR9A 3GEGA 1MUUA 3ORFA 4PRLA 3O38A 3N74A 4ZJUA 3I9NA 4A03A 3ON5A 3B1KA 3ZNNA 4TRNA 1YS4A 5CEFA 3G17A 1RM4A 2EJVA 1C1XA 4MJLA 4MVJD 1E6UA 2P91A 4DWVA 2JD2A 3D3WB 3NTOA 5I9MA 3RVDA 2C54A 3MJCA 5TQVA 3K6JA 1AN9A 1CYDA 2EIHA 5ICSA 3M1AA 3PWKA 5T8KA 1LDMA 1DIBA 2DTDA 3G49A 1E3SA 4FPXA 3OBBA 3S2IA 2OO5A 2PV7A 1A7AA 2JCVA 4YPOA 3JQAB 2VNSA 1X15A 1B8PA 4ZRMA 4P22A 3PIDA 1VJTA 3PXXA 4QO7A 3VC7A 1YGYA 4A7PA 2JKVA 4BO2A 5IDQA 1ZJZA 3GPDG 3T4EA 4J1QA 4DQVA 3D5QA 1OC4A 3JD3A 3V1TC 3ADOA 2AMFA 1L1FA 3CZMA 4B4VA 3RQSA 3OICA 4EUFA 4BKUA 4GAEA 2NVBA 3DBVO 3KEOA 1O9BA 1ZFNA 5ENDA 4BGUA 4XIYA 3GH3A 1BDMA 3GLQA 4J2OA 3SVTA 2YHIB 2BF7A 4UAGA 3JQDA 5BSFA 5KOIA 2VWQA 4E12A 2VYNA 2JCXA 4MP6A 3ZNPA 4IPTA 2JAPA 4Y6PA 1JAXA 2Y05A 4MIYA 1LDGA 2Q2QA 4LSMA 4OYRA 1D4FA 1Z45A 2NUAA 1ZK1A 2LDBA 4GX0A 5CG1A 1YO6A 3FTNA 3GDFA 3DO5A 3VPSA 5G0SA 1DFGA 4EJ0A 1ZK0A 2O48X 3BMOA 3ROQA 1Z75A 4K9DA 1DRVA 4XIJA 3V8BA 5ER9A 1IPFA 4RVFA 1P1KA 4JJIA 3QVTA 2HRBA 3FSRA 4S3MA 3K9QO 5GZ1A 3GG9A 3KYCA 1ISFA 2CVOA 4P4LA 2AG8A 1H2HA 4YTEA 4PN3A 1T4DA 1JWBB 1UAYA 5EJ2A 2UAGA 3KLPX 1UZMA 1YBVA 4XJTA 4GMGA 5L4LA 3A28A 3GZNA 4J6FA 5ITWA 3TNLA 3DC2A 3U4IA 4BNHA 5F5LA 1PGOA 4P4GA 4TRRA 3B6ZA 4PZEA 2FR8A 1TT5A 4UVHA 3H9GA 4NNJA 1N2SA 1PZFA 1EFKA 4RF5A 4IJKA 3WFJA 1DHRA 2DBRA 3AFMA 3LF2A 3PJDA 1Z73A 1X13A 4AL4A 3QWBA 5I8WA 3D1LA 3B20A 3D4NA 3EVTA 3PHJA 1H6CA 1HZZA 1JU9A 5BT9A 1MXHA 3D4OA 1TT7A 4YRAA 1P1HA 4Z9XA 4F3YA 1T4BA 3ZGYA 1AHIA 1WDMA 4Q39A 3JQFA 1VKOA 4CMJA 4HFNA 1HE3A 1SOWA 4OGWA 4EJ6A 3TQHA 2NU7A 1EVIA 1U7TA 4JP3A 4XDYA 3W4IA 3FHLA 3ETGA 4ONEA 1CRWG 4PLCA 5A5EA 1HETA 2JFHA 2X9GA 4IDDA 4CMEC 4RF2A 5I7EA 3E48A 2C07A 2A9FA 3D0OA 2PGDA 4NDNE 3JYOA 4CM5A 4A10A 1JWAB 3NT4A 4FOSA 2G82A 2Q2VA 4R51A 3BTOA 5I7VA 1C0IA 1HXHA 2OZPA 5B37A 1ZMOA 1CQJA 3M1LA 4OM8A 1DFHA 2QW8A 1AGNA 2VHXA 2WJPA 4J0FA 4NH4A 4NIMA 1LI4A 1R0KA 1UXJA 2I99A 3K8ZA 1HDOA 2GZ2A 4QT0A 3WS7A 1U3UA 5A3JA 2PZKA 2JD1A 5KVVA 4EZBA 4PG8A 3KSUA 5A02A 1GZ3A 3PLNA 3PQFA 4Q3BA 5I7SA 4QECA 3ZWYA 3U4DA 4RJTA 3X2EA 1YONA 5C7OO 4E2XA 1NTOA 3A06A 3GVHA 1XELA 4IS2A 4FGSA 4JJGA 3ZCXA 4LK3A 4N54A 1AE1A 2FR0A 3FPCA 2ZTUA 3RC1A 3UH1A 1UDCA 3KTDA 4DPLA 4NU6A 1P33A 3F4LA 2VWHA 4QFDA 1A7KA 2UUOA 4CMCA 3UCFA 5FWNA 4ALLA 1N7GA 3UCXA 3BXXA 5IG2A 1SNYA 3P5SA 4CMIA 2B35A 3CTMA 1P31A 2Q99A 3VTZA 1ZJYA 4AJIA 2DPHA 1ONPA 1BGVA 3HDJA 2Y66A 3BA1A 1XU7A 3CZRA 2Z1MA 1PJCA 4GH5A 4ALNA 4NK5A 2GF2A 1PSDA 4IINA 4BUCA 3E6AA 1E7RA 4YRBA 5F21A 1E5QA 4PLVA 2DVMA 3KBOA 1ISHA 5JS6A 3AM4A 2CNBA 1HDCA 2OOSA 4MVJF 1AHHA 1BDBA 2GNAA 4URFA 4Y6SA 2Z5LA 3OFSA 2UUPA 3W4KA 2WD7A 4I5EA 4Z9FA 1ULUA 1P9LA 1PZEA 2ZTMA 1MB4A 3C7DB 4EITA 1E6WA 1YJ8A 4N5MA 5CDSA 5L45A 4UUPA 4FFPA 1V9LA 5FF9A 2J3HA 4CM9A 1K89A 4MOWA 3JTMA 1V3UA 3IUPA 1MGOA 5I8ZA 4YAKA 3HFSA 3GNTA 1QYDA 5CEEA 4YVFA 4D7AA 2FR1A 3PVZA 2EP5A 3FR8A 4GSLA 1K6JA 2HMWA 4IUYA 1OC2A 1UXKA 4RCVA 3ZV4A 3RCBA 4RGBA 4Y8VA 5JAZA 4R01A 3G0OA 4B4UA 2BFOA 3AOGA 4DIFA 3ICCA 1I2ZA 5CP8A 4D45A 5JCXA 4R3NA 3ZWPA 3PDUA 1E1KA 2W4QA 3GAFA 4IDBA 2ZCUA 2EKQA 2X5KO 1ZO8A 3BZUA 3SJUA 1UDBA 2HKIA 3JCZA 3PHHA 4B7XA 4LRTB 1NHWA 3LC7O 4JIGA 4G5HA 1P74A 3RROA 3U62A 2QX7A 1ML3A 1MA0A 1NM5A 2HJRA 3TFQA 4PVCA 2NTVA 1BG6A 1GAEO 5ILOA 4JP2A 2G17A 4BB6A 5DBIA 1NQTA 1O94A 5HM8A 1EFLA 2ET6A 1K2WA 1I36A 1TI7A 3PYMA 2E6UX 2W2KB 1Y5MA 3PDJA 3BHIA 4WASA 3RKUA 4B8ZA 1DRWA 4Z3DA 4KUGA 3INGA 2IE0A 5GMOA 4QO8A 5IN5A 3SXPA 3VZPA 2AQ8A 3AUUA 1VSVA 2DM6A 2CD9A 4ND2A 5TX7A 1HE5A 4OSOA 5CDYA 3S2FA 3CH6A 2YW9A 2G1UA 1SPXA 4J43A 2FSSA 3R3JA 3ZHZA 4RLSA 3OA0A 2D4AA 2O3JA 2QRJA 3QVWA 4BMNA 3H6KA 4YAIA 3NT5A 2C5AA 2D2IA 5EN4A 3DHYA 4TMFA 1KIFA 3FN4A 1GPJA 1YDWA 3BTVA 3HADA 4NBRA 4WK6A 4DQXA 2G76A 5L7WA 1HWYA 1X7GA 2E82A 3NJ4A 1M6HA 1EVJA 2IXBA 2DC1A 4P8RA 1UXIA 3ULKA 4NPCA 4I5DA 3S2EA 2O3QA 4AG3A 2QHXA 1V8BA 1NXQA 1E3EA 4RLHA 5JY1A 3PZRA 2Y1FA 2EGHA 1F0YA 3V5NA 4XEHA 1HE2A 4TVBA 1DIGA 3HB5X 4TKMA 4AJLA 5AXBA 1XDWA 2FOIA 2DAPA 1XWFA 1KEWA 2BLLA 3KOUA 2IZ1A 4G81A 3JYLA 4YYZA 2NVWA 2OXIA 4K6FA 1WZEA 1L7DA 1T2EA 3EMKA 4WLNA 4U5QA 4R54A 1SEPA 4E2YA 1N92A 1JKIA 3GMDA 3QP9A 3C1TA 1C0LA 1FJHA 4UUNA 1YL7A 3E9QA 4ID9A 5DCWA 4JX8A 1JDJA 4WNIA 1HTBA 1E7QA 1BXGB 1ZMTA 3DHNA 4ZQHA 1WPQA 2X9VA 4CQLB 1R37A 1JW9B 3JQAD 3R6DA 1B2LA 2Q46A 1Y8QB 3H3FA 3OJ0A 1KERA 3HDQA 3L6EA 2GRAA 3ZNOA 1IULA 2V65A 3L9WA 1PJ2A 3M2TA 4R1NA 4EDFA 4FFNA 3EVNA 1GV1A 4PLHA 3RUCA 4DL9A 5G4KA 3LLSA 3KHUA 4J0EA 4TWRA 4IDAA 3TZ6A 4NFSA 2DFDA 4OQYA 3OHSX 5U9CA 1EVZA 5GZ3A 3O8QA 2I67A 2GD1O 3P2YA 3GGOA 5A1TA 3IQDB 3GAZA 4YJGA 3Q6IA 4LMRA 3QY9A 2YDXA 5EQDA 5IXYA 3ENKA 1HF3A 3LT1A 5CPFA 2P5YA 4IZHA 3SLKA 3ZWOA 3ONDA 3V2GA 4EI2A 4OOFA 4DVJA 1MC4A 3A9WA 1KC1A 2NSDA 4L4XA 4WCFA 5FFFA 2YQ5A 1HYHA 2VZ8A 5KTKA 2ZB8A 1ENOA 2P2SA 2B37A 4CV1A 4XYGA 4CLHA 4J90A 1JQBA 4E5KA 1M2WA 2GDZA 3FNFA 4HNGA 4CM6A 3LYLA 3F4BA 5A9SB 1LLCA 4FJ0A 1Q0HA 1CEQA 2OP1A 2P9GA 1DPGA 5T6BA 2E37A 2NU9A 4RVSA 1NR1A 4FFRA 1YQDA 1PZGA 2GR9A 3GQVA 4M55A 2D8AA 4D44A 1OFGA 3L6DA 1E1NA 3E8XA 2PD4A 3Q9NA 1GPDG 4E5NA 2VUSA 4NK4A 5GZ6A 1T26A 3U9LA 4CLRB 2BRUA 3D64A 4Q3CA 4RVUA 2VCYA 3EGOA 3DBLB 3M6IA 1ADBA 1PWZA 4YR9A 1U8FO 2Y93A 1YOVB 1U3VA 1PGQA 4MINA 4WKGA 4DIBA 1IYZA 1G1AA 1EQ2A 2BHLA 3I3OA 3OIDA 1DHTA 1T2FA 2R00A 1TEHA 3ITKA 3V2HA 3WTCA 4UUMA 9LDTA 1A27A 3ZWCA 1DIRA 4Q9NA 4TZTA 3EAGA 1ZK2A 3OJLA 3UGKA 4HFJA 4CR7A 4CMBA 2EKLA 2A92A 2GN4A 1ISJA 1E92A 4OIMA 3O26A 4RV9A 2I65A 4MVJP 3ZV3A 1MFZA 4OQZA 2GERA 1IUKA 5JDIC 1DSSG 3O9ZA 3IAHA 4UEJA 4K26A 1P77A 1BW9A 1ISIA 3AI2A 4AFNA 2X1HA 3DDNA 1Q1NA 2JJYA 3GVIA 3VVBA 4WLFA 4WGGA 1HKUA 1HDGO 1QV7A 1X7DA 1H9AA 4CLOB 4D42A 1ADGA 1HT0A 4CQMB 5EL0A 4U8GA 4AJ2A 2FHSA 4YJHA 4DC1A 1LQTA 1V6AA 2CVZA 1A4IA 2NTJA 5AQ1A 1JLLA 1XHLA 4YRDA 2OUIA 3QW2A 3TFOA 4ALIA 4LCJA 3UFXA 2FWMX 5GY7A 5LCXA 2AE2A 5COQA 3AOEC 3CIFA 3HSKA 1GZ6A 1T2AA 5JO9A 1VI2A 5IZCC 3PI7A 3E5RA 1ORRA 5L53A 4PG4A 5U4QA 3WMXA 2BI8A 4WOJA 3T7EA 1E1MA 3UKOA 2LDXA 3TL2A 4MIOA 3HDYA 3LZ6A 4E5YA 1ZH8A 5DP2A 5CFZA 1K3TA 4F45A 2HSDA 1PL6A 2CZCA 1LEHA 1EVYA 5ES3A 1EK5A 1U3TA 5JNLA 4KZPA 5TF4A 4R1SA 3NDJA 3HWRA 4NR0A 3BMCA 4XQ9A 3VZSA 2XAAA 3SX2A 4E5MA 5C37A 2NVUB 4BGEA 4YAGA 3OECA 1I3KA 1GEGA 1W73A 3QVSA 4QXMA 3HNPA 1SBYA 1I3MA 1B3BA 3DTYA 2BFPA 2V6MA 4GBJA 4B3HA 1BHSA 4BKQA 3U4HA 1Y8RA 3DBRB 5FYDA 2IRWA 2NU6A 4IY1A 4E6PA 3VZQA 2GSDA 2D1YA 1K6XA 1PS9A 4IDEA 3UAGA 4CMGA 1NQAO 3GGGA 3DZFA 3C1AA 1N1GA 4YJFB 3ZU5A 1E77A 3V1YA 3JQ7B 5TLSA 5MGBA 3TZKA 4D0SA 2W90A 3D5TA 4FD3A 4WPGA 5BQFA 4ALJA 4HADA 1BXKA 1PTJA 2GCGA 1E3LA 4IM7A 1PQWA 5BNIA 1EUCA 4OO3A 4XYMA 4A0SA 2WSBA 1IOLA 3C8MA 1R15A 2SCUA 3I83A 3WMWA 4ZD6A 8LDHA 1J4AA 2X86A 4R68A 4QX6A 3I9LA 4PVDA 4BNKA 1I30A 1UDAA 3OQBA 3PJGA 4L4RA 1Q7CA 1RM3A 4E4YA 4RQUA 5DCUA 2EEZA 2B0JA 2HJSA 3ZU4A 1PS0A 4JQCA 4M89A 4B79A 4LMPA 1DDOA 3H9UA 3RBZA 2Y0DA 4BHTA 2AHRA 5CDTA 3NV9A 1BMDA 1XKQA 1A9YA 1OAAA 4R41A 1KEUA 2CMDA 2FRDA 3A14A 4BV9A 3Q9UA 4EYEA 4EEXA 3WFIA 1HLDA 5B4UA 1K6IA 1B0AA 3GT0A 4JNKA 4FGWA 1KVTA 4CLEA 3UOGA 3C7AA 5U1PA 1GUFA 1U7HA 4CMAA 2RH4A 5A9RA 1YVEI 2CVQA 4A27A 2RCYA 1X0XA 5JDIA 1HL3A 3EC7A 4U6SA 4JLWA 2RHCA 4M87A 3H7AA 3PWSA 4FDAA 4LVCA 4H3VA 3NEPX 4XGKA 3OSUA 1QV6A 4PFJA 2PZLA 3JD2A 5TS3A 4LGVA 4NFHA 1U2DA 2F1KA 1GY8A 2YV1A 2PGLA 3TOXA 2Q45A 4C4OA 4IJWA 5LDHA 2VYVD 2X9NA 2QRKA 3INRA 3F46A 2WMDA 2AA3A 4J16A 3D3WA 3KV3O 4XRRA 4RDHA 3I9OA 2CUKA 3QE3A 5JC1A 3OEYA 5JLAA 5TJ9A 4CV3A 3UN1A 1ZBQA 2WE8A 1P1JA 3RUAA 4O0LA 4GSKA 2Y1DA 3AI1A 1PJTA 4WJZA 1DRUA 2O3RA 1PU2A 5IZCA 1NR7A 4ILKA 3IL2A 5KKAA 3PIIA 1F8GA 1UP4A 3JQAA 4B8WA 2BFAA 4BQPA 2DT5A 3P7MA 3F1LA 4D79A 1UXHA 1I8TA 2GZ1A 3LVFO 3SEFA 3ZHXA 4BNGA 4ZHSA 3TWOA 3DOJA 1G0OA 4XGIA 1LLUA 4YXFA 3JV7A 1ZSYA 4W6ZA 3H5NA 4J1TA 3FTPA 1NAIA 1DLIA 2YHIA 1RYEA 4UEOA 2PGJA 1ONOA 2WWRA 3V2UA 4CLXA 1J0XO 1EK6A 4J49A 4F6CA 3KETA 3VKVA 1R4NB 2E49A 2FY8A 4Y98A 5L4SA 2Y67A 3PHIA 2HLPA 4J7UA 5COBA 5L3ZA 3QRWA 4BO1A 4ALKA 1YB4A 1I10A 4XGNA 5L95A 3GVXA 2AXQA 1E0DA 1OOEA 2WYWA 4E3ZA 2PWZA 1AXEA 4WEOA 4N18A 2HK9A 1YQXA 1EUZA 3GGPA 1NHGA 1S6YA 2X5OA 4MP3A 5G4LA 1GADO 5H81A 2VHZA 4FSHA 1HRDA 1PL7A 1R0SA 4J4TA 3AUAA 1LTHR 3HQ4O 3RUHA 1V3TA 4LSWA 1E6EA 2BD0A 1U1IA 1A71A 1BWSA 2AW5A 1HDRA 4IGFA 2O3TA 1R4MB 4Q3DA 4GGPA 2O23A 3W4JA 4TSKA 1KVQA 2EERA 1FMCA 4TKLA 1C1DB 1LLQA 3HFGA 3KZVA 1B15A 2ZTVA 4PG6A 3HUDA 2BH9A 2XXBA 1H0KA 3CINA 5JE8A 1GR0A 4ND3A 5G0UA 2Q1UA 2VT3A 1EUDA 3DAFA 4XYEA 2BKAA 1HEUA 2C2YA 1P3DA 2CDCA 2I3GA 2Y1GA 3AJRA 5J23A 2O7QA 2VT2A 1KVSA 2X22A 2CY0A 1PL8A 3CKYA 3CPSA 4WLEA 1W6UA 3GNSA 4DBVO 5BR7A 4OKNA 3VPXA 5KJFA 4AJEA 4IMPA 4G2NA 2VNAA 2PH5A 4ZQGA 3GG2A 4HWKA 1BRMA 4IIUA 4JBGA 3NDRA 3ZU3A 2H9IA 4R9RA 1M76A 1LA2A 4FC6A 4ROSA 4R5HA 4DYDA 3MZ0A 2RIRA 1I32A 3EY4A 4R16A 1XQ1A 2C82A 3HDHA 3IC5A 4YBZA 2PZJA 3DZIA 3IP1A 1Q2XA 3VH4A 3FR7A 3IS3A 3IDSA 3OQ6A 3Q2KA 1K0UA 1O5IA 1XR3A 2FPPA 4CPDA 3Q3CA 4N5NA 5L7YA 2QYSA 3FWZA 2ZATA 3W8DA 3L6OO 1I3LA 1D1TA 4INAA 2UYYA 4QSMA 3MEQA 3BHJA 1I01A 3JD1A 1NPTO 3GFGA 1CDOA 1GZ4A 2X8LA 3WLEA 1B26A 4DLBA 3B70A 4I5GA 1VSUA 2B4QA 2EHDA 3AU8A 5C3MA 1SB8A 4WNCA 3JQ8B 3PRJA 4R69A 4KWHA 5A3VA 5JYDA 2FSVA 1EE2A 1M67A 4HY3A 2HK7A 2WD8A 2PY6A 2PNFA 1F8FA 3LLVA 4IIVA 1LC3A 1U28A 3PEFA 2ZKLA 3KVOA 4U7WA 1VJ1A 4UVEA 4E32A 1IPEA 1NNUA 1Z82A 4MKXA 2X6TA 5TT1A 4G65A 4XB1A 5HTOA 2VOJA 1IB6A 2ZJ0A 1KY4A 4CODB 3GN2A 5KJEA 2OBYA 4NU5A 2A35A 1F12A 1ADFA 1YB1A 4KQWA 4L74A 3U3XA 4BV8A 1CQIA 4DXHA 3P2OA 3X2FA 1SC6A 2WDZA 4BNVA 3TN7A 2NQTA 2XOXA 3JSAA 2HUNA 3K30A 2X4GA 4E13A 1PJ3A 2P5UA 2E48A 3PQDA 3W8FA 1YL6A 1I24A 2YFHA 4NQZA 5THKA 4BO8A 4K28A 4BS9A 4NJMB 4YDRA 2GUGA 3RUDA 3OIGA 4NBVA 4GMFA 1WXDA 3D7LA 4IDFA 1DC3A 3DZKA 3FRJA 4YCAA 3TDKA 5A5FA 3IJPA 4EEZA 4TZKA 3FNEA 1FF9A 5T67A 1PJSA 3VDRA 4Z3KA 2PKQO 4GX2A 2BELA 3FPLA 3G1UA 3QWHA 4DGSA 3T7CA 3WIDA 2YJZA 4BO4A 1Q7GA 3F3SA 4R1UA 1WW8A 5IDXA 3DXFA 1FDTA 2GZ3A 1MX3A 1E3WB 4MP8A 4HBGA 4UVDA 4CQMD 1UZNA 3OEWA 1EQUA 1ZK3A 1ZW1A 3PTZA 4EBFA 1N5DA 2XF8A 3WSWA 4XD2A 2W2LD 3E1KA 1YB5A 1ZSVA 5JSFA 1PQPA 3CSDA 1BSVA 2YFQA 3LU1A 3HN7A 3NX4A 2C7VA 3QLJA 2I66A 4IZIA 3MJEA 1WP4A 2ZYAA 4HP8A 5JMPA 2WEKA 4DIOA 1LU9A 5T57A 1R12A 4AICA 4NZ9A 2B4RO 4CMEA 2GYYA 4QEDA 4MVJA 2G0TA 4BNXA 3G3EA 4W99A 4GLOA 1E7SA 1TA4A 1VL8A 2WE7A 3W1VA 4PIVA 4J7CA 5K6AC 4Y9DA 3FF4A 1YL5A 5AXAA 1VPDA 4IXWA 1UP6A 4N5LA 3GR6A 4CUKA 4E31A 4F46A 1NQOA 2C7GA 1YQGA 3EHEA 5JAMA 1IL0A 2EV9A 1NX6A 2JHGA 4CL3A 1O6ZA 3I5MA 4BNFA 1F06A 1XA0A 3W6UA 1QORA 4L8VA 4DC0A 2PZMA 4OKIA 1ZUD1 1N7HA 3WQRA 5A06A 1XQ6A 5EIOA 1B16A 1F17A 1WWKA 1YKFA 1AUPA 2BGMA 2OFPA 3GK3A 3JQGB 4BO7A 4XRGA 3GEDA 1ZCJA 2NADA 2WYVA 2YV3A 3LC2O 4KTTE 3AUTA 3I4FA 1DC6A 2JAHA 3ZZNA 4E21A 1NVMB 3OF2A 4NI5A 5AYVA 1D8AA 5EPOA 5L51A 1M75A 3HE3A 2I9PA 4RPHA 4OJNA 1KEVA 2D59A 5C7IO 3MCVA 3DONA 3UW3A 2W2KA 5DDIP 3LT2A 2B5VA 1JTVA 5K0ZA 1GTMA 1TB4A 4FOOA 4ND4A 4RPKA 3WB9A 5JCJD 4XA8A 4UUOA 6ADHA 3DBHB 5TSDA 3RU9A 1Z6ZA 4E5PA 5L9AA 4CR8A 4YWJA 4YAJA 4O63O 4L9RA 3KLMX 3WGQA 3EDMA 3WGZA 3AM3A 1P1IA 1X1EA 3LT0A 3DQPA 4FC7A 1QYCA 2PA3A 1VKNA 1I3NA 4II3A 2Q4BA 3HB4X 4BKPA 4WE3A 2PD3A 2DTXA 3RSHA 3EW7A 4IXTA 3JQBC 3NGLA 3ZWMA 3QQPA 4ZGWA 1Q0LA 1GYQA 4O5OA 1T1RA 4W4TA 4GGOA 1IHYA 1LSJA 3LSYA 4B4OA 5JO0A 1FK8A 3ADPA 3GOHA 5IZ4A 3UCEA 2H5LA 1TVEA 2ZJ1A 3MTJA 4KOAA 1QYXA 3WNVA 1Q0QA 5ER6A 4OMUA 1Y5RA 4BNLA 2RBEA 3WR5A 1LUAA 5KVQA 5IFLA 1FDVA 2C5EA 1YJQA 2GASA 3JYPA 3Q11A 4GX1A 1ZZEA 3NTQA 3WOHA 1P44A 5A4DA 1DO8A 1HDYA 2GN9A 3I9KA 4PZDA 1QMGA 5JFOA 3E5MA 4BNYA 3FD8A 3LQFA 4YQYA 1PX0A 3FNHA 4AVYA 4L76A 4DYVA 4GX5A 3N7UA 4DRYA 5A03A 1HDZA 3DMTC 1ENZA 3WBFA 4RPGA 3E9MA 1A4UA 4Y6RA 4JROA 3W8EA 1XYGA 1CERA 5FI3A 3I52A 2CSUA 4O6VA 5TC4A 5JDCC 3AI3A 1IZ0A 4TRMA 1PJLA 3KB6A 2H1SA 4KDEA 3V1UA 1P45A 2IZ0A 2D3TA 1VJ0A 4XQGA 1GYPA 4I08A 4LCEA 1KC3A 2C0CA 4HFMA 4XYLA 4MVJG 3BHMA 1NQ5A 3DL2A 5IAAA 3BMNB 1BXGA 2VTEA 3B1FA 5TJHA 4DPKA 1H6AA 1DXYA 1O95A 1XG5A 1HZJA 2VRCD 3F47A 4BKOA 4CQLA 1Y8QA 1V3VA 4XJSA 3IKVA 3PHLA 5K6AA 3SC6A 4ALMA 2A94A 1U5AA 5DP1A 4CM4B 3AU9A 1O8CA 1O0SA 2VRBA 5AXCA 2BFMA 5KVCA 2GPTA 1W8DA 2DBVO 2ZYDA 2Z1NA 1Z7EA 1LDYA 1I2BA 3ZN2A 3WYBA 1RWBA 1PR9A 3EUWA 1NWCA 3OIFA 4RF3A 1DAOA 1GUYA 2O2YA 4B4WA 1V0JA 4H15A 3KEQA 1PGNA 4I1IA 1YRLA 5FI5A 1Y7TA 3EK2A 3L4BC 3QA9A 4CM8B 2ZQZA 4PLGA 1ARZA 2WM3A 1LRLA 3NJ8A 3IKTA 2PTGA 1ZIDA 3EZYA 3Q2IA 4NFYA 2W98A 4PLWA 4I9NA 5JYEA 1J6UA 1QYWA 3LDHA 3OJOA 4LVUA 3BMQB 2TMGA 3ROKA 3WJ7A 5A9SA 2YY7A 2IZZA 1N9GB 1TLTA 1QLHA 3GHYA 3MJ4A 2FZWA 7MDHA 5DZSA 2VN8A 3WYEA 4BO0A 4CUJA 4J1SA 1E3IA 3AY7A 4C7KA 5A9TA 1DC5A 1LDNA 1ZK4A 4JGBA 4OXYA 4PZCA 3WTBA 5IXSA 3OA2A 2X0JA 1DFIA 2VHWA 2HU2A 4CLRA 4GPD1 5T8KC 4H7PA 3JD4A 4BNUA 3DBLA 3I23A 3L0DA 3DB2A 4O59O 4L0QA 3TZCA 1YOVA 3WQQA 5HRUA 4HNHA 4ZQEA 4YACA 2D5CA 1N1EA 4BGVA 5JAQA 1K5HA 2OGUA 3KYDB 3UVEA 2B5WA 1X1TA 2DTEA 5BSEA 4CR6A 3SJ7A 5I9LA 4I9HA 3UICA 4AJHA 1XU9A 2I3AA 4ZN6A 1ZEMA 2DKNA 5H82A 2YDYA 4KUEA 2CDBA 5BNFA 4BO9A 2CF5A 3ANNA 2Y0CA 4Q3NA 1EDZA 3RUFA 1Q7BA 4TROA 4J1NA 2O4UX 1NP3A 1PGJA 3DZJA 3DFZA 3INTA 1IHXA 4OOEA 4WLOA 4AJPA 1U4SA 4CLOA 4K1LA 4MVJI 5L40A 4FIZA 1Y9AA 1GCOA 4ZVVA 4CQMA 4J9VA 1MG5A 2PD6A 1LNQA 1LRJA 2UV8A 5IF3A 5F1KA 5JDCA 1HSOA 1E7MA 3KRTA 3QV1A 5L7TA 2W2LA 3KYBA 2DUWA 3AWDA 5I7FA 1ZXLA 2CDAA 4YB8A 2IODA 2P4QA 2VWGA 4YQZA 3EYWA 4J4HA 4D41A 1IZ9A 4NBWA 3WYCA 1U2GA 5EINA 1JA9A 3FCOA 3DOOA 2VZ9A 3U09A 1KBZA 1LDEA 1LX6A 2AEMA 3GVPA 2WTBA 1T24A 4W9NC 3RKRA 4IS3A 4NBTA 2J3KA 4NMHA 3PJEA 1GQYA 4DBZA 4A26A 1B14A 2Y99A 4XQCA 3S8MA 1U4OA 2IXAA 4GVXA 2RAFA 2Q1WA 1LSUA 3WGTA 1X0VA 4GWGA 4CM9D 1N8KA 4J2HA 3ZHBA 4BO6A 5L4NA 1ID1A 3OJFA 3VH2A 1C1XB 4BL5A 4EUEA 5BSGA 1SB9A 3VDQA 3PK0A 3COSA 3WNQA 3GDGA 3NRCA 4PLFA 3DTTA 4Z6KA 2NVUA 4MIEA 3JQ6A 1XIVA 5FEUA 3WGOA 4RVGA 3ABIA 2QG4A 5JPIA 2OP0A 1U3WA 2J3IA 1B7GO 3L4BA 3H3JA 2OBNA 3IUSA 4MVJM 3RC7A 3ZNQA 1Y81A 5DF1A 2DBZA 1GFSA 3PPIA 3DBRA 3RWBA 1A5ZA 3OQ1A 1I5RA 1NPDA 3CMCO 2FPIA 3U0BA 3ZHYA 3JQFC 1L7EA 4O1MA 3E9NA 1BVRA 2IDZA 4YJFA 3JQ7A 2VUTA 4YA6A 5DN9A 5JCJA 4BMVA 2P9EA 4XWYA 1VL0A 2X0NA 5JW6A 1HYGA 2ZK7A 3FWNA 1TXGA 4W7IA 5KJ1A 2C20A 3E03A 4RVHA 2JCYA 4YT5A 3CUKA 4M54A 1CIVA 1OBFO 3H8VA 3KUXA 4EUHA 3TRIA 2GO1A 1QG6A 1ISMA 4Z0PA 3ZU2A 3LF1A 6LDHA 1M6WA 4TQGA 2OORA 3VPHA 2XPCA 1J49A 2I6TA 7ADHA 3L4SO 1Y1PA 1VC2A 2PR2A 4FFLA 4J91A 3WXBA 2YZ7A 3GDOA 2J5RA 1SO8A 4IDGA 2DPGA 2GN8A 4GLLA 1RJWA 4M49A 4RVDA 2G5CA 4D3FA 4R5MA 2J8ZA 1E5LA 3ZWBA 4E0BA 4FB5A 3C24A 1QYVA 3IMFA 3BMOB 3BTUA 1BVUA 2CF6A 2HDHA 2Q1TA 2HCTA 5A05A 1DAPA 4FJ2A 4OH1A 2NM0A 1SCUA 1H9BA 3AOEA 2PK3A 4BGIA 1P0CA 3PZBA 5AVOA 1GCUA 3F5QA 4BKRA 3ZI0A 4D3SA 3KYCB 1ISGA 1G6KA 1UAGA 2B69A 4JN6B 5JXWA 3KSDO 5HWSA 3SLGA 1GYRA 3WX0A 1CWUA 1MP0A 3ONEA 5LDGA 4IJVA 2PKQP 4OHUA 4IQ0A 4JXKA 3JD0A 2E4AA 3VPGA 3U5TA 2YUTA 3GZNB 2VTDA 4GL4A 4YAEA 3ZH2A 5DBGA 4C7JA 1KYQA 1WDLA 3C1OA 5CDUA 3LT4A 4DLAA 5KIAA 4HUJA 5DULA 1NASA 1C3VA 1TT5B 2QRLA 4MVJE 1RM5A 2I76A 2HMUA 4M8SA 4OXNA 5AOVA 2Y0EA 4BNJA 2WYUA 2AG5A 3RJ9A 3Q1LA 3Q0EA 1DB3A 2D5AA 3DAPA 5T64A 3W6ZA 3ITDA 4BO5A 3DZBA 4PGFA 2HRZA 3WGIA 4W7HA 1LQUA 4DQUA 1E7YA 1H2BA 3IP3A 4RDIA 4JK3A 1EEHA 3GEMA 2O4CA 2VRCA 4FFMA 4W9NA 3K31A 2FZEA 3U4CA 5HBRA 3MWDB 1C0KA 2Y1CA 3H5RA 3GFBA 4GKBA 3SC4A 3NDIA 2I5PO 3I6IA 3TSCA 3DZHA 1C0PA 3NGXA 5B4TA 2DUUA 2CFCA 2TMDA 3S55A 4B7UA 1GEEA 2NACA 1MG0A 1PZHA 1JKFA 4IGEA 1NWHA 2IYPA 3H9QA 4HX5A 4L75A 2VWPA 1DBVO 3AK4A 3PLRA 2YYYA 4WLUA 2X0IA 4GWKA 4BIIA 4M86A 3VH3A 4KUHA 1H5QA 1R4NA 2D0IA 4UEKA 1GL3A 1YDEA 3KO8A 4IDCA 3ROMA 1HYEA 4WECA 4PG5A 3L9XA 4CM1A 1B8UA 3JQCA 4CM7A 3ETDA 2NV6A 4WEQA 3FI9A 2B4TO 3WDSA 3ZWVA 4FJ1A 3RC9A 2FMUA 4FBGA 3H2ZA 1KS9A 1GQQA 1KY5A 3C85A 4XB2A 1HLPA 4RPLA 1LC0A 5KKCA 4ZU3A 1VLLA 1JVBA 2AEFA 3TPCA 5F3RA 3WGHA 1HDXA 4BNTA 3IIEA 3R0IA 4TRJA 1XEAA 1R4MA 1G0NA 1PQUA 1FDUA 4FQ8A 1X7HA 1Y9EA 3HZZA 2OMEA 2GN6A 3ZWWA 3QJ5A 1C1DA 4CMIB 3I1JA 1VE9A 3DWFA 4J7XA 2Y1OA 4BB5A 3ST7A 5EMHA 2EW2A 3GY0A 1GQ2A 3DZGA 5C7LO 4QTZA 1U5CA 3NYWA 1CJCA 1OZAA 3ANLA 2C2XA 4KDFA 2EKPA 1R0LA 4X54A 1B3RA 4CMKA 1EBFA 4II2A 5KWEA 3PFWO 3WICA 2ILTA 4CUZA 3NKLA 1CETA 4MO2A 3MTGA 3WJAA 1T2CA 4RF4A 5ILGA 3RFXA 4DREA 1ULSA 2WD7B 1LJ8A 1WLYA 4GI2A 4LW8A 4NG5A 5TT0A 3RBVA 2OHXA 3STHA 1BXZA 3OM9A 3WSVA 4XR4A 3RFVA 4ZQBA 3GVCA 4AJJA 1C14A 4RPJA 2JD0A 2BMAA 3WQSB 3NUGA 1O89A 4AJOA 1BTOA 3L77A 1GD1O 1B8VA 3UF0A 2HO5A 3N58A 5KJ6A 1ZVMA 1SZJG 4J4BA 5HS4A 4RO0A 4BO3A 3JYNA 2X0RA 2C29D 1D1SA 3ONFA 3VH1A 4OXKA 4B3IA 3F1KA 4Z0HO 2DBQA 3WLFA 3RUIA 4BNIA 4D43A 2UVDA 4LN1A 5EQFA 3CXRA 4JBHA 3B1JA 1E1LA 1DIAA 3ZW9A 1LXCA 3RUEA 2VQ3A 2Q4EA 4DLLA 4BQRA 4QFCA 5KJCA 3JQ8A 3NAQA 3ZV5A 4RORA 3GC6A 4PRKA 2DLDA 4PLPA 3M2PA 3K2BA 1HE4A 5THQA 1ONNA 3GMSA 1ENYA 2VHVA 1H93A 1YXMA 2YV2A 1NBOA 3H9EO 4E33A 3ZWXA 5TIIA 5ITVA 4FCCA 3C7CB 3S2GA 3K96A 1PR3A 4DMMA 2V6BA 4CV2A 4R3WA 4HXYA 1X14A 3K92A 3DR3A 2HMVA 1CF2O 4GVLA 5A04A 2W8ZA 4I9UA 3O4RA 4ND5A 5IN4A 4XKJA 4FR5A 4Q3EA 4XYBA 2P68A 4D0RA 1MLDA 4QUKA 4HFRA 4UULA 3VOSA 3OETA 3IOYA 4Q3AA 4A5OA 5JY6A 2FN7A 2Q3EA 4KQXA 4NJMA 2AQIA 5JMWA 4UVIA 4J3FA 1PJQA 3QVXA 4FW8A 1U8XX 2DFVA 2V6FA 2VHYA 5DOVA 3JQ9C 4FFOA 4MPDA 2QZ9A 4OL9A 2ZB3A 3L07A 1NYTA 3AW9A 3KSZO 2QZZA 1LRKA 2JL1A 4U0JA 4UVGA 1I2CA 1XSEA 3BIOA 4RQTA 3GRKA 2O3SA 3ZWNA 3RJ5A 1E3WA 1V35A 5T5QA 4KTVE 1Y6JA 3ETEA 3HN2A 4WCFC 1EZ4A 3AY3A 3QWFA 1QR6A 1UP7A 4XDZA 2X23A 2Y68A 4AJ1A 3PWZA 2R2GA 1Z7BA 4ZA2A 1GU7A 5IDWA 1A9ZA 5TGDA 3BTSA 3U49A 1KVRA 4I5FA 3QWAA 4ND1A 1UH5A 2DQ4A 2POQX 1NFQA 5CPBA 3TL3A 4CV0A 1J5PA 2J6IA 5EESA 1MFPA 1PGPA 4L73A 2B36A 2VYVA 2NWQA 1E3JA 1NVTA 3DOCA 5C5IA 1DJNA 4DA9A 3RC2A 4WOKA 3GUCA 1P0FA 1T2DA 3E82A 1PIWA 2GLXA 1FDWA 1VM6A 4ESOA 3NT2A 4Z0TA 4DMLA 5JBIA 3S1LA 4E2WA 1VRWA 1MV8A 4BOYA 4YT8A 8ADHA 4F6LA 2NU8A 3EZLA 3I9MA 4D46A 1R6DA 3BAZA 5BSHA 3RU7A 1WDKA 1ZEJA 3WBBA 2EP7A 2R00C 1SOVA 3SBOA 4BNNA 3K2EA 1ADCA 4ZICA 2EJWA 4N7RA 3PYLA 3AUSA 2YHUA 1P1FA 3JQGA 4PLZA 3RASA 2B83A 1WVGA 4XCVA 1PEDA 1T1SA
chains in the Genus database with same CATH superfamily
2A4KA 2YQ4A 1IEVA 1JVSA 3BE4A 4JEIA 5HG0A 1QKIA 3LA8A 3WGGA 1T6YA 4CXMA 2XTZA 4IZ6A 2AQHA 4QYSA 4OI2A 2YN2A 1MOPA 5DGXA 4HN9A 3VC2A 4QTYA 4DR1B 4D4GA 2VPTA 1TM2A 4Q66C 4TLBA 4YQFA 3OPXA 2A1UA 4MW5A 1UWLA 4YRKA 4R0MA 1JN0A 2FFRA 4BVFA 1TJYA 2VA9A 3BYZA 4WY5A 4QE3A 4DJEC 2V6GA 2PR7A 3W79A 1XZ8A 2D8MA 2YOGA 2JGDB 3DBHA 4EG6A 5AVTA 5LC1A 1ULHA 3HHPA 1KK1A 2QROA 2QRPA 4MVJH 1O6CA 1XZMA 3GNQA 2C3PA 3C14C 2FG5A 4JT9A 2VYND 1G55A 9LDBA 1ZHHA 1NJSA 3G2PA 3IBFA 1F2TB 4P4NA 2V8OA 2QVLA 1VBMA 3WWYA 2GNOA 4ZYWA 5KTOA 1QF6A 2I4OA 2QUZA 1YKSA 1E58A 1QQ7A 3VSAA 3KG2A 1C3LA 4B5LA 5FL7A 2O3UA 3A4MA 4BATA 4DANA 2OVFA 1RIIA 1XXHB 2WJ4A 1A95A 1PK7A 1ZWLA 1PS8A 1SOMA 3C39A 4Q24A 4WBXC 3S2ZA 3Q8LA 2VJPA 3MQ2A 2NLOA 4DIUA 3OJEA 3FMOB 1KETA 1QONA 3WG9A 1UM8A 1UM9A 4HXGA 3F6SA 4G5RA 4QUBA 4LYGA 4ZVTA 4GOKA 4E5UA 1CB7A 2WF5A 2R11A 5IVIA 3UXMA 1PHPA 2NZUG 5HVNA 1OV4A 2CHUA 2BBSA 1BWPA 1U9JA 3E2MA 3EW9A 3W7VA 1M1ZA 4FWTA 1CX9B 5JHGB 1QO9A 1H85A 2AKYA 3HV2A 1W581 3RSSA 1XV5A 1VYVA 1RKXA 3E7PA 4JBIA 4R7GA 5E9QA 2ZRMA 4URUR 3ES9A 5F12A 3ZU6A 3EXFA 2IHTA 1I2MA 4EJ2A 3WLKX 3BGVA 2ECFA 2XGOA 1HTTA 1FXSA 2HMTA 2HTEA 3ZGZA 1TAHA 2GD2A 1TTHA 1CVLA 1AGXA 2XCOA 3LJKA 3A1WA 2V9CA 1SMKA 2XAUA 3ESCA 1I4LD 5KNLA 1YI0A 4W63A 3BJZA 1EHIA 5HCNA 4AJKA 1PWXA 3NIGB 4A2PA 5IBCA 2BKLA 2PA0A 1M34A 4OEHA 2BGTA 2AN9A 3OQJA 4BNZA 1AXRA 1HMYA 3A1NA 3R1IA 5ITZB 5CEJA 1NFFA 4KRFA 3D02A 4RHTA 2MR6A 1Z6XA 3EGIA 1G3UA 3PQEA 3VHRA 5L8VA 4D3DA 4NCHA 5DN6A 5MN5A 5F3WB 4D82A 4B7CA 4DRXB 1G7TA 3SQDA 1YUNA 1TQHA 4MDHA 1OFVA 3A4NA 5DE3A 2H6EA 3SR0A 1TA9A 5DU2A 3SQWA 4QGAA 5EIFA 3NGMA 4B6SA 2Q5CA 3MWEB 4EHDA 3WIEA 2ZAIA 4MKRA 3FNGA 4E2ZA 1C4WA 3BMNA 1H8HA 1GITA 2O0KA 4QA9A 2QRQA 3AH8A 3KM0A 4JLKA 4JVOA 2ONKA 3R5FA 1CUWA 4BQEA 3MRXA 1BE1A 5HF6A 1ZA2A 3ABQB 5F1PA 3UB4A 1FX1A 4QHSA 4JL6A 2VS1A 3RS3A 3BRQA 2ESRA 1XF1A 2GUWA 3K8QA 3KZKA 3OM0A 4PYMA 1C50A 2QDXA 1OYVA 4AZTA 1YZLA 5LZ5A 4YJ2A 3MXOA 4RJJA 4Q6BA 2BR4A 3T5BA 3ME5A 2J9RA 4ZVNA 2OK7A 1AQIA 2Z8XA 3NFYA 4YRGA 4B80A 4ND8B 3SKXA 4ZHQB 3Q10A 2C8LA 1LLFA 1Z6QA 2P9HA 4BLVA 2YVQA 3F5SA 2W00A 2G4LA 3O8LA 5CHEA 1RPNA 3PP8A 1S9HA 1YQ9A 3ESZA 2IXFA 4FEGA 3G88A 4C21A 1W4ZA 2FEMA 4JUBA 5MGNA 5K4GA 3CEAA 4IW3B 3R8XA 3MOIA 2AKEA 2GDJA 5AVYA 3OQNA 4F3CA 2QX9A 3AY6A 1BJKA 3H5IA 3Q12A 1LPAB 1DBSA 3VVCA 3ICPA 3VU3A 3PHGA 4OLHA 1TQ2A 4CN8A 4MIKA 4CG3A 2H8KA 1CZOA 3TAUA 1F2UB 4XJVA 3IUMA 2R1VB 2BZ0A 5ICGA 2B9VA 3ANTA 1HSZA 1MAAA 2ZI3A 3CN7A 2W6QA 1JFTA 4IMRA 4R2HA 1US8B 3AFNA 3BMQA 3KD2A 4C43A 3VR4D 2ZIAA 1BOFA 2GEBA 3N2ZB 4YI5A 4XFKA 3KOZA 3GGCA 1VMKA 1SH7A 1DQNA 3KPYA 1N5MA 4Q37A 4V0NA 2CN1A 4YLGA 3J81A 1M2KA 1SVOA 2J4FA 4U6QA 1QIHA 3ECSA 3LAWA 1IJKA 1FC0A 1ZKDA 4MKZA 3N5CA 3O8CA 4KMSA 3RSQA 2WVJA 2IOFK 1WUKS 2EC5A 3PNKA 5EWJA 3KYJB 1NPYA 3GUUA 4QJ4A 4RV5A 3QYJA 5G0TA 4CKWA 3HDVA 1PTKA 1Q21A 1Y4SA 1PJ4A 2H3HA 2RSLA 1NGSA 2MJLA 2XOKA 1II9A 4P38A 5E2BA 4F8JA 2X7HA 2WOJA 4P7KA 2PMFA 2C58A 4B34A 1JQDA 2Q9BA 4NATA 1JHUA 3UAYA 3TJRA 2AN5A 2Z6QA 2ETXA 3IALA 2WHPA 4S0XA 3ZW8A 4C0AC 3ENQA 1PT7A 1QLJA 3ZY6A 4PWZA 5EKSA 3JYHA 4JR1A 4YFVA 2GLUA 5FL3A 1JZSA 1VDZA 2R6DA 5HF9A 3QLUA 5HKKA 2C3UA 2I29A 3AFOA 2NPFA 4E30A 2P9JA 3KYDA 4ZCIA 2XI4A 5JJBA 3E7FA 2PFGA 1V95A 3UWOA 5IYZA 4LNUB 4NESA 1WULS 4BV2A 1Y1QA 5LZ4A 4PLYA 3E84A 4IVPA 5JSUA 4CFYA 5TNXA 4DV7B 3GT4A 4J1TC 3OZGA 1V3QE 5BUQA 1XCBA 2XCLA 2ZCVA 4CTOA 1KH3A 5BW4A 3K09C 3RS0A 1J0EA 2NTNA 1EUCB 5GP1A 2WTNA 2YICA 1YH3A 2XDQA 2XWJI 1ACJA 1AS2A 2P4HX 1SC1A 2C4MA 1NRJB 5G0VA 1ODFA 3OQIB 5A5GA 2GGSA 4FE4A 5DEOA 3RV4A 4EQ6B 2VF4X 4EPYA 3TZQA 1VSQA 3DKRA 1KVUA 4EFMA 4HV4A 2HA4A 4ZJPA 1E1YA 4AP9A 5ADWA 2GEDA 5DBFA 4AJ4A 5EHXA 3VNQA 2IYOA 1L8XA 1EDEA 1DOHA 1RADA 3PYXA 4RFLA 1PJBA 4DYHA 4EKIA 1K4MA 1CRQA 3QELA 3VPFA 2FXIA 4AULA 4BJ3A 5B36A 4W5RA 3GRVA 4RZHA 2ZBUA 2YJ5A 4IQGA 2I71A 5GJCA 2VHCA 1CE8B 5B1IA 3FOZA 2X1VA 3HDTA 2BFDA 3PCXA 1QU3A 1PP4A 3GRPA 1QV9A 2O2DA 4U7JA 2A1IA 1JDVA 1GV0A 3HVHA 1FBTA 4Q9IA 2JB9A 1ST2A 4Y9RA 3UW1A 2PM8A 1IY8A 1I0IA 1Q12A 4TM8A 1EBBA 2ZPAA 2HOQA 3MOSA 4KQHA 3ROPA 1TCCA 2NX2A 1DE0A 4L5BA 2IHJA 4CFSA 4F86A 7MHTA 2PU7A 4MITA 5LIRA 4RY0A 3H17A 4XR9A 1E2PA 2FGJA 2H1VA 3GEGA 4BP3A 4LDZA 4PRLA 3X1WA 2FA9A 1V45E 3I9NA 3GWZA 1OBVA 4DLRA 4I1RA 3B1KA 3L6RA 4TTIA 2C98A 2J59A 4IV5A 5JTUA 1RM4A 2EJVA 2OD2A 2WIJA 5CLGA 4RSHA 2JD2A 1IOWA 3QE9Y 2W58A 1W9HA 1HLFA 3MJCA 5AFSA 3K6JA 5TQ0B 2VQEB 1AN9A 2F64A 1JB1A 4R9NA 4ZV7A 3VI4B 2YCBA 2O59A 5A4IS 3C16C 1IBLB 5ELMA 3OO1A 1T1EA 2J9XB 3PWKA 5D51S 1LDMA 1V6CA 4E7OA 4Q4AB 5ALIA 1MTOA 3SY8A 1GQSA 3G49A 2CXRA 3OBBA 3R7WA 2WQ6A 4FZ3A 4DT1A 3CE9A 1QTIA 1J70A 1P7CA 4N0DA 1A7AA 1J0CA 1NV8A 1PZNA 2D62A 4TWZA 5G1OA 1XUOA 5BOVA 4D8XA 5JDIC 1UPXA 2HF8A 3FJYA 3IA2A 1SXHA 1VJTA 3MAJA 1YGYA 2VPPA 1A1SA 3VR5D 2CMHA 4DWWA 1XAGA 4HTAA 4JENA 3VKGA 4LZAA 5K3FB 2QW1A 2YNMD 5IDQA 3IERA 2WWIA 3GPDG 4J1QA 3I64A 3VYTB 4BLPA 4DQVA 5AD1A 4B4VA 3KB2A 3CZMA 1JMKC 4EUFA 1NTRA 1Z4MA 2C9CA 2JVKA 4UCXA 1ZFNA 5ENDA 3OZXA 2BDUA 2G08A 3VO8A 4XIYA 1IBKB 2WLSA 5F1YA 4P7GA 4GPZA 5E38A 4XIGS 1BX0A 5AJZA 4UAGA 3QVVA 4L22A 2JIMA 5DNDA 1XZDA 4PZZA 4CI9A 1BFUA 2VWQA 3C3JA 4PICA 4YJKA 4IPTA 4JC5A 3ZVNA 4KX5A 3UQYS 3QW4B 2FPOA 1G2QA 2Y05A 2EL7A 1OXUA 3GLFB 1EE1A 4D4MA 4ENRA 4DKJA 1UQRA 2Q2QA 4WHMA 1JALA 1XNJA 1G5RA 2ASVA 1D4FA 1Z45A 2OV6A 4OYRA 3H4IA 1ZG3A 3EEFA 3V46A 4DSAA 1WMDA 2PZBA 3BX1A 4IHQA 4YX9A 1TQ8A 3O7MA 3VQTA 3EBLA 3FTNA 4O4HF 4GM1A 1NT4A 1QH9A 2B4YA 2X5NA 1XNGA 3AV0B 3FCCA 1SBCA 3CNOA 3VR3D 3VPSA 3A6HA 1DFGA 1K0FA 3V4FA 1TVKA 2HBQA 5CLFA 1ZK0A 5LXTA 5H02A 1SR8A 5LQNA 2OO7A 2B0CA 4HBZA 4CF3A 2B1JA 1U4NA 1KSFX 2I6SA 2NVOA 3FETA 3HO6A 4JJAA 1IPFA 4XIJA 5ER9A 1RWPA 1XTBA 2J4CA 4KL8S 5H0IA 3B2EA 3F7OA 4KJXA 3V80A 1VLJA 3FSRA 4MZXA 3BB1A 3K09A 3G9XA 1ISFA 3OU6A 5CBPB 2J85A 3ZJ5A 3HY4A 3JR7A 2QB5A 1DELA 5JD5A 2DR2A 4RYDA 2GFHA 1JWBB 3BZWA 1UT6A 1UZMA 1YBVA 4BMOB 1KS2A 3JR3A 4WVFA 4DS3A 3QM1A 4OCZA 3BCSA 3VR2A 5I4KA 5KU7A 5F5LA 1WBBA 4KR2A 5CJ2A 3SYLA 3TKLA 1YAHA 2GCPA 5E95A 3WRYC 4C4PA 4C7XA 1QQTA 3QFFA 3FPGA 3B6ZA 4U7TB 3K3PA 1N2SA 4JOSA 2NNWB 2ZRIA 1I5OA 4A16A 4X66B 1CFJA 2QN1A 2DBRA 3AFMA 4LC9A 1LV8A 2IHYA 5IW8A 1RJFA 3R6TA 4QTUB 4G56A 2WU3A 4AL4A 5C8YF 1SU8A 3FIJA 2H2WA 4EAAA 2XCIA 2AN1A 2XODA 1X9IA 4P84A 3B20A 2Q3JA 1YFKA 1X8XA 1XTZA 5ALXA 3M6WA 5BT9A 1YULA 3GW8A 3FVWA 4M7WA 1QOQB 5DRYA 3D4OA 1Y8ZA 3OX4A 4J94A 1VLQA 1IFXA 5EE0A 5CIWA 1XRLA 1AA6A 4F3YA 1M1YB 2AOUA 3SOZA 4KQ9A 3MWDA 4EZIA 3M3HA 4ISCA 2ISQA 1AMOA 1YJCA 2WP0A 3ANYB 4HFNA 1HE3A 3F8TA 4OGWA 1MX9A 1UPBA 2FPPB 4JSRA 1N33B 3U13A 5ERXA 1EVIA 5JCPA 4DLZA 1W34A 2KWIA 4WH0A 1R27A 3L8DA 3TQCA 2QVCA 2D5IA 3W4IA 2Q5EA 3DV0B 3HXMA 4ONEA 1CRWG 4PLCA 5A5EA 5IBQA 3FYDA 4P3PA 3X1MA 1LI7A 1D4AA 1ZNWA 3MTQA 3GP8A 3AHCA 2WKWA 3D0OA 4YUZA 4QU8A 1BH6A 2UZ3A 4YQEA 5FBHA 3G7SA 4FOSA 2OCKA 4RAOA 4ACAA 3T3MB 1HXHA 1NATA 1KYYA 3FLEA 1MA3A 3OQPA 3WIOA 5KX5B 1LW6E 5B37A 5DT2A 4C07A 4EM6A 2Q7DA 1H2ZA 1JEAA 3FLBA 1DFHA 2WJPA 4YMGA 4P1ZA 2P1RA 1G5PA 3F67A 2RONA 3JXEA 2IOYA 3G9UA 3HYCA 3Q40A 4RETA 4KR9A 4BC1A 4DUGA 5A3JA 1ZIOA 2JD1A 4KK3A 3RO7A 4EZBA 4PG8A 5K8JB 4TTQA 4WZAE 1CUFA 3A6LA 3PLNA 2BGUA 2HIGA 3PQFA 2CGEA 2R5NA 1Y7IA 3ZGLA 2H2AA 2CFTA 2JIOA 3TLXA 3ZWYA 1GTVA 2DQSA 1AKUA 4CG0A 5C7OO 4E2XA 5K1ZA 2BH2A 3A06A 2H2DA 2DKOA 4IS2A 4EUKA 4FGSA 3ZCXA 2MSWA 4LK3A 1W5FA 3OQVA 1AE1A 4YC7A 1HT3A 3TTUA 4D1YA 1MO4A 1JAHA 2VXYA 3HUEA 1U0FA 4JAVC 3BJMA 5EIBC 4LRUA 4UOZA 5A2QA 3P9KA 1ZU5A 1MW8X 4MQMA 2JW5A 1EHYA 3M9LA 1I13A 1CT9A 1OX6A 4QYIB 3HGTA 5ERGB 5IG2A 3BXXA 1SNYA 5FPTA 1DS6A 4V0SA 2ZEJA 2Q99A 2Q5OA 2OHVA 1F0PA 3AEUA 3MW8A 5TMBA 3G0DA 3UKDA 4M1OA 1NUAA 4X5OA 4YRZA 3B8HA 1PSDA 1P2VA 3BMXA 3EIUA 3K9NA 3PUWA 1F6BA 3E6AA 1V7QA 2FNAA 3Q3IA 1E7RA 1MN6A 4TS9A 4U2EA 5F21A 4YRBA 3B48A 1E5QA 4PLVA 5DB4A 5F4ZA 5LSAA 4OHYA 2DVMA 1Z5UA 2WVHA 3KBOA 2ZM6B 4OY3A 1AUOA 4BB0A 3IIKA 3MBOA 4QREA 4YDSA 5KYKA 4OQQA 1AK1A 1HDCA 3VU9A 4MVJF 1BQEA 4MJXA 1Y1SA 2VTBA 5IKXA 1XEWX 1DXOA 1K63A 3I1FA 3KQKA 8GPBA 1XTJA 1L4UA 4MQLA 1KJ9A 3LI2A 5CITA 1PV1A 1ULUA 4Y0AA 3DPUA 5HE9A 4EGAA 3C7DB 3L1IA 1JIIA 3U7RA 4EITA 2QTBA 1O08A 4ACBA 1HKHA 4LTDA 5ALEA 3RH0A 1W76A 2YRFA 1V9LA 2IDMA 4DMFA 3UWDA 5FLYA 4U7PB 2H52A 1R0YA 4YAKA 1V3UA 3ND6A 1MGOA 5I8ZA 3BDIA 3D2AA 2RB4A 1G18A 1ULZA 2I8AA 3LCMA 1MQSA 3OD1A 3O4FA 3UO8B 5CEEA 1QNFA 2JA1A 4JASB 5HE8A 2OLEA 3VUFA 3CF0A 3JZMA 4N3CA 1M8FA 3JASA 3P9RA 2OAEA 4GSLA 5AW9A 3VMMA 4D5GA 1VPEA 3HACA 1OBOA 4RCVA 1KO7A 1CUZA 2HBRA 3LWZA 3WL3A 4WBNF 4RE6A 5I7RA 3NM5A 3OM8A 3AB8A 3BSYA 5AHRA 5JAZA 4I1UA 4UZEA 1R2QA 2BFOA 3LPMA 2UXCB 2NSLA 1JSZA 2ANBA 1G8AA 2CHGA 1E9BA 1DVRA 1YZQA 2E89A 4I55B 4C0WA 1WA5A 2N47A 3ZWPA 4DV6B 1S8FA 3PDUA 6Q21A 4A15A 1E1KA 3FPEA 1E8MA 3GAFA 4IDBA 4MS1A 3RJTA 1H69A 2X5KO 1FXUA 3BZUA 1UDBA 3M5PA 1F9AA 1K3UB 2W6MA 4HGQA 4OM7A 2Q1YA 2A84A 1VDMA 3EDOA 4HS4A 4AM8A 1NHWA 2ZBQA 3GCXA 4JIGA 1FL9A 1P74A 4BAGA 2WKPA 2QX7A 5CLLA 4FU0A 4NCIA 4BBJA 2XMZA 3AR7A 3FZGA 3TLBA 4NXMB 1MT3A 1BG6A 1NJ5A 1JHZA 2PCJA 2G17A 4RVNA 5ILOA 1M83A 2A9PA 4BB6A 3RVSA 3T5CA 4DQ0A 3M0EA 3ENWA 3QF4B 4XTRA 1L3BA 5BT8A 1KNXA 3G5LA 3TIVA 3IHKA 2E6UX 3C41J 2W2KB 1Y5MA 4WASA 4AUKA 2FE1A 1ULAA 2AYZA 1TRHA 2D2VA 4AKIA 3D6HA 3H2IA 4HI0E 5KDLA 1G9SA 5IN5A 3M4YA 1Z07A 1SBQA 1A9XB 1VHLA 4V0KA 3AUUA 4MR8B 3M49A 1WOMA 3JRNA 2YMLA 4ND2A 5SY4A 1WUTA 1KMHA 4ZT7A 3R74A 5AUNB 1SXIA 2IZ7A 2G0NA 3LIPA 3BEOA 2ATEA 1FS6A 3DUFB 4KFTA 3KL2A 4XPIB 1CZNA 4LZWA 1AA9A 4HGOA 4J43A 1FLVA 3IPCA 1OFUA 3EEOA 4BTEA 2H2HA 2BRUC 3OA0A 1A5BB 1OREA 2O3JA 3EDYA 3JAKB 4JH0A 3WV4A 3CVXA 3M4ZA 3H6KA 4YAIA 5JROA 1DJLA 5JI3E 3NT5A 4BE9A 2D2IA 3IBGA 4WX2B 1JTFA 4EYKA 7ABPA 3K15A 3EXG1 3ANXA 2JFQA 4PYOA 4KYUA 1S4MA 1GPJA 2NPOA 4JJKA 1N25A 4LMBA 1YDWA 4H6WA 4LWQA 4NBRA 2PPVA 3QLEA 5CVUA 4IGAA 2G76A 4DQXA 1G64A 4JGIA 3WV5A 5CFOA 5L7WA 1EFAA 1HWYA 3NIBA 2H17A 2E82A 4RH3A 1M6HA 1EVJA 2JLRA 4MR9A 4PS0A 3L40A 5CUQA 3ULKA 4PC7A 4WCVA 1EFVB 3UMCA 2ORED 2XMCA 2NO7A 1XVIA 3S2EA 2O3QA 2X8BA 2EJCA 3LBFA 1Z25A 4Q9LA 3RS9A 3WC4A 4C03A 2RH9B 2ZSEA 4Q6WA 1NXQA 1E3EA 2GFIA 3BXEA 2DFNA 5JY1A 2A3NA 1QPBA 2J0EA 2OKGA 4UBKA 4TYMA 2GPYA 2ZWIA 3HC7A 3V5NA 2KX7A 1HE2A 2AR0A 2GXUA 2VDQB 4HAWA 4OXRA 3TUJC 5DNVA 3SF8A 1DIGA 1XVAA 2DRIA 3HB5X 5BR4A 4PO8A 4GR9A 4WRRA 4AJLA 1XDWA 1D6NA 3WVNA 1IUOA 2ONCA 2BLLA 1W4CA 4G81A 1ZNZA 5GQSA 4YYZA 1CR2A 2ZTSA 3QXSA 3RLIA 2NVWA 1ND5A 1C3OA 2G9ZA 2GEKA 1V39A 2ZRQA 1A2OA 3JS5A 3MINB 3OCCA 5KDOA 3DLCA 2I1LA 3GEBA 4WLNA 3WFZA 3KOXA 4HRAA 1SEPA 3OY2A 1N92A 3FAZA 4NV0A 4MJ3A 2C1EA 4AO7A 2H29A 3GMDA 4P4UA 5HQ3B 2LKDA 3L93A 4HPXB 1YL7A 2JPDA 1O57A 2FW1A 4UUNA 1JHMA 4DA8A 5CFMA 3DPSA 5JXJA 4JX8A 1BDJA 2OBBA 3HCFA 4TN1A 3ED5A 4LJYA 1BXGB 3RIGA 1GFIA 1P72A 1WPQA 2WIAA 4S24A 5TARA 4BV3A 3ONVA 1ILWA 4MQ6A 3OIVA 3EXHC 3JQAD 2O9JA 4HRVA 1XMQB 1A5TA 3VBCA 2TS1A 4N3BA 1IWOA 1E2IA 1SOUA 3MJDA 1KERA 2FW8A 3HDQA 4G24A 4M9XA 5LP6B 5EEGA 1FLDA 3IAS1 1E66A 2AW3A 2ZSBA 3M2TA 3WLAA 2PRKA 3BPSA 4FFNA 1VA5A 5LLSA 3DT8A 4F96A 1FNDA 4LJLA 4DN6A 4G4GA 3RUCA 3MTBA 3GLTA 3FSJX 2A0XA 4DL9A 2H11A 4UXJA 3AVOA 4PXYA 1QQ5A 3X1ZA 1DUSA 3KU4A 1MX5A 1RCFA 5EZYB 1WQ3A 2JGNA 2DFDA 3CB4A 4OQYA 4EFLA 1N8TA 1U8CB 3Q8MA 5E6SB 1WEKA 2XUAA 2ZIFA 3F9RA 3ZWQA 4XVUA 2O8EA 2HREA 3DJYA 2I67A 3P2YA 1WJGA 2BFWA 4X7RA 3I9V1 3KK0A 1OX4A 1JU4A 5ICEA 2B82A 3N75A 2A7QA 1NG9A 3SEQA 4ZZ2A 3AHDA 3AL2A 3ENKA 1XEFA 4LGCA 2Q3FA 3SLKA 2PXHA 2CJWA 2X76A 3FOCA 2CNDA 2D1RA 3IRUA 3LX5A 3ONDA 4DVJA 5MN4A 1MC4A 1B6GA 3PNBA 5ALSA 4WCFA 4TMWA 3OCZA 3DE6X 2B92A 1D8TA 1RI2A 1QGUA 1ENOA 2ZB8A 2FK7A 4PYIA 1CRLA 2CNKA 4M37A 1YE5A 3CLRD 1R9JA 4FSDA 4WZBE 5BQPA 4HNGA 3ANSA 1A8UA 4HYYA 3LYLA 4CM6A 4ASUD 4FJ0A 1W36C 1KJZA 3ZD9A 2IYNA 2GEUA 5LM3A 3EODA 3UV3A 1DPGA 2PCLA 4CGYA 2E37A 2V0NA 1NR1A 3V8PA 2WABA 3GJXC 1O03A 1YQDA 4I1VA 4MNTA 3L7DA 4NWIA 4M55A 2IYYA 1QK3A 2D8AA 1ODKA 2WVGA 4G9EA 4ON9A 3E8XA 1ATZA 4HH3C 3EUEA 1M6YA 5F52A 3OTOB 2VUSA 2AB0A 2C8JA 2CYBA 3VYWA 1T26A 2Q4OA 2BRUA 4FWBA 3ZQJA 2XT6A 3NC4A 2XVXA 4FDLA 2AEEA 3DBLB 3OIWA 1ADBA 4I1YA 4RVUA 1O8BA 3K35A 1U3VA 4DDTA 4B6PA 2EQ5A 3K1JA 1QZ3A 4Z54A 1IYZA 4X8MA 1M1XB 2XA9A 3WTCA 3GDHA 1TEHA 2PVCA 2C83A 2WFAA 3HJHA 1NBAA 2FUNB 3OZSA 4HZIA 4UUMA 4B7AA 3GAAA 9LDTA 2I2AA 3V4RA 3RS8A 1TZMA 5AKZA 2G06A 5ALHA 4HFJA 1VL1A 2HGZA 2XMPA 4CMBA 1FRZA 1QANA 1BKYA 1ISJA 4KIJA 4YMWA 5LYJB 4DV0B 4O4LA 1QC5B 4Y18A 4RV9A 4DR6B 4FNGA 1HX7A 5J2TF 1MFZA 4LJKA 5EKDA 1VKZA 1A9TA 1ODLA 4ZCPA 1QGDA 2HSJA 1M0SA 3IAHA 3HKEB 3O9ZA 4AFNA 3AI2A 1ISIA 2X8JB 4AMGA 4J75A 1ZESA 3EGDB 1DG3A 3GRFA 4GOLD 1WKVA 2VJBA 2JBWA 2WTMA 3DDNA 2QPAA 2H85A 3AL3A 4D42A 2POCA 1NZDA 2F43A 2WNIA 3VKFA 1F6DA 2I4RA 3ILXA 3ADCA 1EP2B 3D6AA 2ZROA 4FCTA 4AJ2A 4O4JB 3B85A 2EZ8A 5CXXA 4UARA 4DC1A 2INGX 2DB3A 2CVZA 3C70A 2Q41A 2XIQA 3BFPA 1Y42X 2NTJA 4ZOQI 5AQ1A 1JLLA 4YRDA 5I5EA 1Y8AA 5I51A 5LB2A 3L6UA 4LCJA 1GDDA 2V96A 1H8EA 3RGGA 3QU2A 1NXPA 3FMVA 2AMLA 1UADA 1QIFA 2OC9A 4Z9AA 3ILHA 2ZB2A 1T2AA 3AF3A 1NBEA 4DHWA 4EHNA 3OZTA 3PI7A 1ORRA 1II0A 3LGSA 1RPTA 2Y6UA 2C8KA 4XWKA 5KSOA 3IT2A 2OT3B 2LGJA 2ZCJA 3WMXA 2BI8A 3AHFA 4YP0A 3T7EA 1SU7A 1H05A 1VL2A 2LDXA 2V8BA 4JU8A 5CB4F 1QFSA 1SWWA 5HJ7A 4D97A 2QJWA 2B1QA 2QX8A 2QD2A 1YK1A 2UZIR 3HDYA 4MIOA 5AW0A 4S2UA 1GLNA 3LZ6A 4L02A 4JFRA 1UMCB 2HCFA 2ZVDA 5JVDF 1RXCA 4NCNA 2HSDA 2Z09A 1EGHA 1BMFA 1EK5A 1AHPA 1VA4A 4TV9B 2R6AA 4IEEA 4NAUA 1TEZA 4RIHA 5TF4A 5LFAA 2B5OA 1UKEA 3BMCA 3ER6A 3W3AH 3K0AB 4KLZA 1VPTA 2I3BA 5ADUS 2KMLA 3DR5A 3EDQA 4BGEA 5BSTA 1XCJA 1DXQA 1GTL1 4N5DA 3JWHA 1VCHA 1ZAKA 3C3MA 4BLWA 3I37X 3QVSA 2W43A 1I7PA 4QXMA 4ZFNA 3LUBA 3D6VA 2J0UA 3IRVA 3Q3VA 1TOAA 5ALDA 3DTYA 2BFPA 2GK7A 4B3HA 4NMXB 3VM6A 2AOVA 4KIUA 3H16A 3UG6A 5DIFA 4I4LA 2NU6A 1SHZA 1JJFA 1LPBB 3B38A 4TS1A 4F3KA 2F2TA 1T9GS 2GSDA 2UUAB 2A5JA 3H4MA 3ABOB 1PS9A 4NF2A 2ZYVX 3TG2A 5EYPA 1E1CB 3N0WA 3TSYA 1AUQA 1RLUA 3DZFA 5C31A 3ZU5A 1MZPA 5FD8A 2J30A 2R8XA 3QKTA 4G5FA 2WWTA 5BQFA 1UBFA 1NE7A 4ALJA 2OQIA 3BJEA 4PAQA 3L0OA 4DA6A 3CVYA 1EIZA 3W90A 2FB9A 1WPGA 1HPLA 2CDNA 2CJFA 3PQ5A 4IM7A 4WK4B 3A11A 2VYQA 2WW8A 1Z5PA 4GOMD 3JU3A 3A37A 2JGAA 4GYYA 4XYMA 2JARA 2J3QA 3C8MA 5FLKA 4DHEA 2SCUA 2OSVA 1Q16A 2E1PA 3PUHA 1YA8A 2H06A 5AK3A 2C2BA 2IY7A 3KJIA 3WIVA 4EA8A 4ZI5A 5B7QA 3KQMA 1L6IA 2ZJ6A 1RDFA 2I55A 1U3FA 2QT1A 1RNLA 2XMSA 3DKIA 4FD2A 3KKZA 5IP5A 2MSDB 3U6KA 1ES9A 1OW3B 1HY3A 1V1MB 3CUTA 3DOEA 1ZGBA 3OG9A 4MRMA 4QPZA 4HWSA 5FBQB 3RTCA 1VGRA 2B0JA 1JEEA 1PS0A 1VQ1A 1Y3HA 2UU9B 4B79A 5AQEA 1B41A 1CS0B 1DDOA 1WHSB 3RBZA 2AHRA 3LBNA 2YX1A 4U5XA 1OAAA 2BMFA 2IYEA 4F92B 1II8A 3WLIA 2ZJBA 4AMUA 1KEUA 2QN2A 3A14A 4EA6A 3ZKWA 1U0LA 3T0IA 3P94A 4EEXA 5GVSA 1OJLA 3Q98A 4C3UA 1K6IA 5E3HA 4RY9A 2WA2A 2ZE8A 1V41E 2P9TA 3MA0A 1QCCA 1CY8A 5IJ9A 4HH4A 3U16A 1GUFA 3KDSE 1G42A 4O0MA 1EP3B 2ZSJA 3QBVA 2HNKA 4CMAA 3GT7A 4KQKA 5FI0B 2B25A 1S8OA 2RCYA 2ODEA 5F76A 5LB4A 3AG5A 4W1PA 4DSOA 2GKSA 4JJZA 3PWSA 2QP9X 2ZIXA 3EGWA 5EFOA 5CVJA 3NEPX 4Q1AA 4XGKA 3RS4A 1QV6A 2HLHA 4Q48A 2O8FA 4JODA 4A0HA 5TS3A 4RTOA 4LGVA 4NFHA 4TKZA 4D92A 1QCYA 1GY8A 2YV1A 2WB2A 3B9QA 2Q45A 2PUGA 1GKKA 2HXGA 2JLZA 3KFXA 3VU8A 1SC4A 3LWBA 3TM5A 3TPFA 3VC1A 2MYUA 3IKLA 5LLDA 1VE7A 3FWPA 2X9NA 2QRKA 1QHEA 1L8LA 4OUDA 3A9CA 2HJWA 3CR8A 3CX8A 4DNPA 1O4VA 3I9FA 1YQUA 3D3WA 4XWTA 3ZEIA 1JF8A 3AY0A 3GUZA 1X39A 3QE3A 2HN9A 5E7JA 2N0SA 5TJ9A 5AHOA 1Z3CA 2H2IA 4CV3A 1EP9A 1CUHA 4YAUA 2WE8A 1U65A 5HR5A 1P1JA 4DA0A 1R50A 4HCJA 5AKKA 3USZA 2QZ4A 1PK9A 4NCAA 1RPAA 2GM5A 4WJZA 4DXAA 4LY3A 1P7YA 5K0JA 4ILKA 4JR0A 3IL2A 5HFNA 4MI1A 1F8GA 3RNLA 1UP4A 2QTNA 2D2FA 2P41A 4HF7A 4BC0A 4B8WA 3U4GA 4BQPA 5LR6A 4TYPA 1H23A 3AZPA 3D1VA 3OE7A 1BNCA 2GZ1A 4BNGA 4B81A 2OHOA 3DOJA 1TUGA 7AT1A 1AC5A 4N8DA 5CHYA 4F6RA 1LLUA 2JDID 1NNLA 3DV2A 2PBRA 3AQ4A 1MABA 2ZDGA 4WXEA 5KOHB 1A50B 1I6WA 1C8BA 4X00A 1KTVA 1QYIA 1WUYA 3FTPA 3UMRA 2JA2A 2BGWA 1OWNA 2EHJA 3U7GA 2YHIA 2ADOA 5AI9A 3GLIA 2PGJA 2DOKA 2WWRA 3V2UA 4I9GA 4J49A 3WL6A 4CLXA 4DCVA 1XCGB 1R4NB 2NSHA 4XUEA 2E49A 3B51X 5FRDA 2IU0A 4EY7A 4DUYB 2XBMA 4J7UA 4XIFA 1MQ9A 4DADA 4DIMA 2ZRLA 3QRWA 5CCEA 4DMGA 1JEQB 3ZLUA 3JZDA 3KTFA 3AKZA 3L06A 1S8NA 4H31A 4LJ8A 1I10A 4PQFA 5DTIA 1UEJA 5HJ2A 4BYGA 1C4OA 4KODA 4E03A 1M33A 2AXQA 2FZ5A 1E0DA 2Q1XA 2RKOA 1N4DA 2WYWA 2PWZA 3BBLA 3EG5A 4M9CA 2P6PA 1AXEA 3UJNA 4JSYA 1DZIA 4RESA 1NHGA 3B3QA 4W9MC 2L0XA 4BMCA 1HNNA 1WB6A 5G4LA 1Q1GA 1ZM4A 2YJNA 3BEDA 4X1YA 1R6XA 1M8JA 2Q3HA 3M33A 1MAVA 2VHZA 1HRDA 3EPRA 2E9SA 4Q7EA 5B64A 1RWOA 5FL7D 1ZRHA 4J4TA 1LTHR 1PYGA 4LK2A 5DWQA 4LFCB 1Y9DA 1TCAA 1QR2A 4G6ZA 2AW5A 3VAAA 3R4CA 5EJ5A 3LBAA 4Q3DA 5FUYA 1LH0A 2O23A 3PX7A 4AIIA 4YNBA 5FJJA 1KVQA 3AHHA 1EG7A 3RT1A 4UBLA 1FMCA 4TKLA 1C1DB 1LLQA 3DMFA 1B15A 1Q44A 2O2IA 2XCQA 4HDQB 4KU4A 3OE1A 3V55A 3ZTYA 2BH9A 3KX2A 4ETMA 5DNYB 3PL5A 1GR0A 2G09A 4QDXA 2Q1UA 5L6LB 2WM2A 1M1UA 1N8NA 4EEKA 3RK1A 1PBTA 1UMDB 1HEUA 1VMEA 2F9LA 3SBEA 5JUWA 1XAIA 1COWD 3QKIA 2HU7A 5J23A 2O7QA 1X38A 2FFJA 2VT2A 2CY0A 3GO4A 4HN4B 4YRSA 4OHXA 3PPXA 2ZKIA 4H6VA 3GLHA 3ZD8A 4IMPA 1T4CB 4YREA 2EIXA 2JAWA 3VJRA 3RVKA 3L41A 1ZA1A 4OJQA 3H1PA 3ZU3A 4ETIA 5H3HA 4R9RA 2CZGA 1BH2A 1DADA 1KR5A 4NU8X 1AGRA 3E1GA 4DYDA 2QPLA 3E1SA 3MZ0A 2C84A 2OVBA 3DD1A 4F4JA 2NSYA 4R16A 2C82A 1Y4ZA 2QQ0A 2VVTA 4I3GA 1ZC3A 3H1AA 5JCOA 1W88A 2PZJA 4JT2A 3UK0A 3DZIA 3V8EA 3RSZA 1Q2XA 5IEJA 4X84A 3VZCA 3WADA 3OWOA 3FR7A 3KP1A 3IFSA 4QOFA 1JQJC 1UPAA 3NNSA 5DN6D 3IDSA 1Q7EA 4ZCRA 3GROA 4CKXA 3OIUA 4FYMA 3LUPA 1XR3A 2X9LA 3QZUA 4CPDA 1OLUB 4JKYA 5KMGB 3M4XA 1AB6A 4PSAA 2QYSA 3S7ZA 3FWZA 5BR8B 1L5YA 2PYZA 3AR8A 1AT1A 4TXMA 1D1TA 3IV6A 1H8HD 4YWHA 2HSWA 3A4LA 4CKCB 1OU4A 3DVLA 2QX6A 1YMUA 5IT0A 1P80A 1IHDA 3WA6A 3L7CA 4CETA 3VKWA 2C78A 2GAOA 1B0PA 2IU3A 2X8LA 4QOJA 2ZM5A 3AU8A 5C3MA 1K7XB 2FZLA 1SB8A 5D1NA 2JLYA 3WO0A 2IW1A 3JQ8B 3TQOA 3VR6D 1JVNA 1JMVA 4PYNA 3T1NA 1M67A 2DJIA 3EEBA 2DR3A 2QM0A 2JASA 3O93A 4B82A 5CCXA 2ZUVA 4GP9A 3B52X 2ZRDA 3G9QA 1OT3A 5KYXA 3PEFA 2ZKLA 3H8JA 1U9IC 3HY3A 3KVOA 4L27A 4U7WA 5EHIA 2VK8A 2A5LA 2I62A 4E32A 2GWRA 3O4IA 1P19A 3IDOA 3G02A 2X6TA 5TT1A 3KTAA 1J8MF 5IULC 1JYEA 4XB1A 1RYZA 5HTOA 2JLWA 1FJGB 2ZJ0A 1KY4A 2G6BA 5CA1A 3LHFA 1ZM3A 2XCRB 3TTXA 3D6UA 4YBRA 2AMJA 1MQ8B 1P7WA 4FYWA 1FPMA 3Q5EA 4G1EB 5KU1A 1YB1A 4QXOA 3VRHA 3VNAA 4TLCA 1AQYA 2XD4A 1UDWA 4L74A 4TYQA 3UA4A 1FP2A 3U3XA 3L8EA 1T2VA 3EGVA 4Q02A 4CNQA 3OVMA 5HILA 3ZGVA 4J0QA 1SC6A 1XXHE 4BNVA 3DVQX 5IAGA 4ZP1A 2NQTA 3KQLA 3DL7A 5G40A 1W59A 2ZJ3A 5FUXA 5F98A 1M73E 5HJEA 3PQDA 3MUEA 1YL6A 1OAOC 2CL5A 3RVLA 2FLKA 5THKA 1ZJ5A 4K28A 3VHXA 1KO1A 1K4KA 2NQ2C 3ZCPA 4B3XA 1W85A 1IVYA 2GUGA 2V1XA 1XZHA 4L9AA 3LY9A 1PEKE 5T4BA 3ZKAA 3BK7A 2O8FB 5LBUA 1M0EA 2JAQA 4QWMA 1X8KA 4YCAA 3TDKA 5A5FA 2JEOA 3IJPA 4EEZA 1C41A 3H2JA 4CKYA 2F3UA 4LOHA 1YKGA 3FNEA 5T67A 3LE8A 5DM4A 5KKNB 4DLXA 2OXCA 3E58A 3OZVA 5K3CA 3FPLA 4DCMA 4IGKA 2HU8A 5EIAA 4LHXA 4DGSA 3T7CA 1U63A 2P0EA 1E8NA 3DE5X 5JCZA 3TOSA 2ZWMA 1AGPA 1FDTA 1SCBA 3OJXA 1EXVA 1L1QA 1MX3A 4ZVMA 1E3WB 3Q5GA 4YRRA 2UZ0A 5EP3A 4EYOA 4ZYUA 1KAGA 3ZH9B 1SQGA 5HEKA 1PNRA 3T1OA 3ELDA 2YL2A 4EBFA 3K9GA 4BWGA 3TGLA 5B1HA 1GKLA 2ECKA 2PV0A 4XD2A 3IAEA 3SVLA 3C4QA 1YB5A 1ZSVA 2CNNA 1JHXA 3W2FA 3Q72A 3R0JA 1RHQA 3QVLA 1MO2A 4GMXA 2YFQA 5DK6A 4C04A 2F1OA 3NHYA 4BTLA 4FGJA 2C7VA 3PNLA 1H65A 4PN7A 2CMGA