1PZEA

T.gondii ldh1 apo form
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
326
structure length
323
Chain Sequence
PALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMCEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Toxoplasma gondii LDH1: Active-Site Differences from Human Lactate Dehydrogenases and the Structural Basis for Efficient APAD+ Use.
pubmed rcsb
source organism Toxoplasma gondii
molecule tags Oxidoreductase
molecule keywords lactate dehydrogenase
total genus 112
structure length 323
sequence length 326
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2003-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pzeA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1pzeA02
4BO3A 4C4OA 2I9PA 4NBRA 3VH3A 4ALKA 1VPDA 1EK5A 1M67A 3DBLB 3JQFA 4QX6A 4B79A 3ZWYA 1XU7A 4UVHA 2HUNA 5DOZA 4Q3NA 1LA2A 3ZH2A 2YDYA 1DIAA 2LDXA 1N5DA 4Z0TA 3X2EA 1EVYA 2I3AA 4YJFB 4CLEA 2HSDA 3PI7A 2GN6A 4NK4A 3RBXA 2Q46A 4A7PA 4BQRA 1BSVA 3Q9UA 4R5MA 2V65A 1LDNA 1CJCA 1GTMA 3SLKA 4CLOB 1QG6A 5MGBA 3BHIA 3GZNB 1HT0A 5TRTA 4IDAA 4QQRA 1ZSYA 3IKVA 5JYDA 5TT0A 3L6OO 1A9ZA 1PL8A 4PZEA 2Q2QA 4AJHA 4ALNA 1A27A 4RV9A 4KDFA 1ZFNA 2FSSA 4J1TA 5F1KA 1WDKA 4P4NA 3I52A 4KTVE 4AL4A 4Z3DA 2VUTA 3VPGA 4XQ9A 1HDGO 1Y6JA 1NYTA 1XHLA 3EZYA 1ZMOA 2Q45A 3IC5A 4NR0A 1SEVA 3VVCA 4CMIB 4QEDA 4I1IA 4WLOA 2ZATA 3QVTA 4YAGA 1P33A 2BRUA 4AICA 4DPMA 4CMCA 1U8FO 2QG4A 2G76A 4ZQBA 1LEHA 1WAMA 4K6CA 4XCVA 5GMOA 4Q3BA 1Z6ZA 4S3MA 3CMCO 1GZ6A 1ADGA 3PYLA 1JTVA 4NI5A 2NTNA 4HFRA 5JDIA 4LCEA 1V3VA 3QP9A 1DHRA 3H7AA 3DC2A 3DB2A 1ENYA 4FQ8A 4MP8A 2VOJA 1PJ3A 2O48X 3VH2A 3VPHA 5DULA 1YL6A 2JCVA 3H9QA 1K6JA 1Z75A 4ESOA 5COAA 1B2LA 3T4XA 4FW8A 5KJFA 3OMLA 4RCVA 1DBVO 1XIVA 3NRCA 3QWBA 2EGHA 5AQ1A 1XR3A 3HQ4O 1I10A 2VNSA 3INGA 4BV8A 4BMNA 2JFHA 1I3NA 3GNTA 2AQKA 1JA9A 4FFMA 1HZZA 1C0PA 2Y1CA 2X0JA 4WNCA 3WOHA 2E4AA 4YAJA 2NADA 4UVDA 5FFFA 4NU6A 4M49A 3KUXA 1H2HA 2CFCA 2V6MA 4NFHA 4OO3A 3I6QA 4BGVA 1U28A 1CEQA 3MJEA 4EDFA 4LSMA 4RVGA 1PQWA 1R4NB 3RVDA 4D42A 3FR8A 1PGNA 3RD5A 5ADHA 2WSBA 1ZKMA 2NU8A 4RLSA 4FBGA 3X2FA 4FSHA 5L45A 3AOEA 4E13A 1NQ5A 3H8VA 4XQEA 4DQVA 4FC6A 1T2CA 4RGBA 2AE2A 3IS3A 2AG8A 2W90A 3PDUA 1LDBA 2FR1A 4P4GA 1MGOA 1ENOA 3WYEA 3JD3A 2X8LA 4DRYA 1PWZA 1YE3A 5CP8A 5IF3A 1P31A 1XQ6A 1JW9B 4YTEA 4YQZA 3LF2A 1IYZA 3FHLA 1JWAB 3E1KA 3TSCA 3GFBA 2DC1A 3Q0EA 5TGDA 3CTMA 2AQHA 2QW8A 3VPXA 1TT5B 2WD7B 2Y1GA 4BOYA 4WASA 2OP1A 2VYVD 4R01A 4B3HA 2H1SA 4DIFA 3JD2A 3UH1A 3HWRA 4D3FA 7MDHA 1NQAO 1VJTA 4J1SA 1ISFA 2YV1A 2O4CA 5JS6A 2OFPA 2Y66A 1WP4A 3IIEA 5ER6A 5BQFA 2Q99A 3B1FA 4R54A 4Q3AA 1IULA 2AG5A 1ZVMA 2B35A 2DPHA 4Z6KA 9LDBA 5CPFA 1N8KA 5L3ZA 1YQXA 2ZJ1A 5IXSA 3F5QA 3KLPX 5GY7A 4E33A 3VKVA 2O4UX 1P1JA 1E7MA 2ZKLA 1BXGA 2HO5A 5LDGA 2UV8A 4DGSA 4LW8A 1Z45A 1R4MB 4YWJA 2OOSA 3EK2A 3RUHA 5KJCA 4WEQA 1NFFA 4WJZA 1U2DA 1CDOA 1JWBB 5JDIC 1LSOA 2NSDA 3JQDA 2RCYA 4YAEA 4CQMB 5DBGA 5LCXA 5CDTA 3C1OA 4HY3A 4DC0A 2OL4A 1ZZEA 3KBOA 4KMSA 1PS9A 1I2ZA 2WD7A 3OEYA 1YQDA 3RSHA 1GQYA 1NHGA 3NJ8A 4MINA 1DC6A 3AK4A 2HRBA 1PJBA 5EMHA 1X1EA 4GSLA 4R41A 4BIIA 2FSVA 3C7AA 3ZWBA 5HM8A 1UAYA 2EWMA 1H6AA 1NVGA 3HG7A 3GEGA 2G82A 2IXAA 1LNQA 1V8BA 1HRDA 4L74A 2JL1A 3KYDA 2OORA 2XXJA 2DBZA 4GVXA 3T4EA 1EDOA 3PWZA 5I7EA 3DZFA 1I2BA 1UP4A 4CLHA 1GYPA 4MP6A 1ZMTA 1KY4A 3KXDA 4N5LA 2NVUA 1U9JA 3HFGA 3WGQA 3NT5A 1TLTA 1DLIA 1KBZA 4N5MA 3E9MA 3EW7A 3NX4A 1LLCA 3VAZA 4ND4A 4IXTA 3LT4A 1SAYA 3AUSA 3WTBA 5C5IA 2I3GA 5JW6A 4BB6A 4OKNA 2BI8A 3GZ4A 1E7YA 4UUMA 2VYVA 2Y1OA 3PFFA 4Y98A 4CUKA 5CG2A 3W6ZA 1PR9A 3D3WB 4WEOA 2ZCUA 3FD8A 4IJKA 5ES3A 5G4KB 4QECA 1K2WA 4XJSA 2YY7A 1B3BA 2YHIB 4KQWA 3DOCA 3FNHA 1MV8A 5FF9A 3VHRA 1U7TA 3I9JA 4UEJA 3ONEA 1E5LA 1I36A 4FJ1A 1X15A 4J91A 2CVOA 1GV0A 3BHMA 3TWOA 1VM6A 3QSGA 1HSOA 3ZWVA 3RUIA 1LC0A 4GAEA 1X7DA 5KVSA 1GCUA 2Q4BA 5K9ZA 4IDCA 4FD3A 2IEBA 1NNUA 3ZW9A 5JO0A 1N9GB 1OBFO 4GX5A 4F6LA 3TFOA 1EQ2A 1DRVA 3H3FA 3PHHA 3Q2KA 4IQGA 4BV9A 1KC1A 1MG5A 1R16A 2GR9A 2EJWA 1DC3A 1KERA 3BTOA 3OJ0A 3UXYA 2EGGA 3WMXA 3EZLA 1DDOA 4LCJA 4GVLA 5ILGA 2Y0CA 1PQUA 2E49A 2I65A 4E32A 3BMOA 2I76A 2W2LD 3STHA 4MJLA 4BGUA 3S2FA 3WSWA 2D5AA 4JBIA 3ABIA 3TOXA 1NVTA 2X9NA 4ZQEA 3RBZA 1H0KA 3UF0A 4CL3A 4BKRA 2Y1DA 1S6YA 4CMHA 1HE2A 2IDZA 2YQ5A 2QYSA 3JQGB 3N7UA 4MVJE 3GEDA 5A3JA 4XYBA 5JCJA 3GT0A 3OQ1A 1PS0A 2D3TA 3BAZA 4UUOA 2CD9A 3IJRA 3IUPA 4BNTA 1QMGA 4YJFA 5JNLA 5JCXA 3OBBA 4NBWA 3BMQA 3GG9A 3WFJA 1F0YA 1RYEA 2DU8A 3KSDO 1PEDA 1TEHA 5BNTA 2BFMA 5DOVA 5K0ZA 1DO8A 1FMCA 1UUFA 2XXBA 4RQTA 3I9KA 4HNGA 1YWGO 4E0BA 1JU9A 3DBRA 2BGMA 4NFSA 4LVCA 2PH3A 4PCVA 1WZEA 1N7GA 2WM3A 1NFRA 2B0JA 2AW5A 2GN9A 1U5AA 2GZ3A 5IDQA 1O95A 4AJNA 4YT2A 6LDHA 3ZNOA 2RHRA 4GMFA 1J0XO 1YOVB 1M6WA 5KNLA 2VNAA 4FCCA 4L73A 4BO0A 1DIHA 3ONDA 2NLOA 4N7RA 3ROQA 5ICMA 4JJFA 4UAGA 4DYVA 4G81A 3C3XA 1W0CA 1Q1NA 4CQMD 1YL7A 1D1SA 4E5NA 3G1TA 2A4KA 4BNVA 1RKXA 3SJ7A 4BNKA 2OHXA 3R1IA 4TZTA 2O2YA 3FPLA 2HU2A 3QHAA 3TRIA 1JLLA 3E9QA 2I99A 4M54A 1NX6A 1BWSA 2R00A 3EVTA 3GLQA 1P77A 3PHGA 3K30A 1VSVA 3EC7A 1E6UA 1GFSA 3U3XA 2NU6A 3QJ5A 4Q39A 5KTKA 3VDQA 1WW8A 2VZ8A 1LQUA 3FF4A 4EEZA 2AEMA 4HBGA 3I9MA 2JHGA 1P1KA 4BS9A 2YFQA 5L95A 2ZB3A 4U5QA 4GSKA 3TFQA 1F17A 2GDZA 4I5GA 1E0DA 1K6XA 4RQUA 3RIHA 4MVJP 1GDHA 3ZWXA 3PLNA 4Z9FA 5AXBA 4PG5A 3AI1A 3SXPA 4BO9A 1LX6A 1WNTA 3A4VA 3D5TA 1R0LA 3CMMA 4WLFA 5JDCA 2DFVA 3I5MA 3L0DA 3F47A 1DHTA 1YOVA 3G0OA 3JYNA 4O6VA 1RJWA 1E6WA 2PR2A 4A73A 3NJ4A 1HLPA 2IXBA 5G4LA 3AM5A 3FCOA 4PLTA 1LDGA 2NTJA 4L9RA 1UXKA 2PGJA 2VTDA 3DQPA 2WWRA 4CMKA 2VRCA 5BT9A 4RPLA 1U3VA 3W6UA 3NTQA 5JSFA 1O8CA 4Y6PA 2BI7A 3PWKA 4D0SA 4PFJA 1T4BA 3H5NA 4CM4B 2VUUA 3PIDA 2Z95A 3DHNA 1ULSA 4ALMA 1EK6A 3GAFA 4IGEA 1ZEJA 4E5KA 3GVIA 1YDWA 3RC9A 4M8SA 4MKXA 4FFPA 4LRSB 1WVGA 5JDCC 2BGKA 4QT0A 4OIMA 1HEUA 4F3YA 2PKQO 1U2GA 5L40A 2ZB4A 4J1NA 4J49A 2VWQA 4XDZA 3WGOA 1DPGA 1ONNA 2O7SA 4Z9XA 2I6TA 2A35A 3BMNA 1LC3A 3MZ0A 4Y8VA 5IZCC 1IB6A 3QVXA 2DFDA 1ML3A 3W8EA 3E5RA 5AVOA 5T8KC 4BNXA 4RF5A 1LRJA 2DBRA 1EQUA 4MO2A 1CRWG 2NQ8A 3A1NA 4Z9YA 3JQAB 2FZEA 3I9OA 4CQLA 4YDRA 4U0KA 3JQ7A 3GMDA 4UEOA 4WPGA 1SEPA 4R5HA 1XDWA 4WGGA 2GZ2A 3K73O 2UYYA 4D44A 1GAEO 3WQSB 1Z74A 2WTBA 1E7WA 4IY1A 1FF9A 3ZZNA 1DJNA 3IJPA 3F1LA 3ZU5A 1I3KA 1A4IA 5DCWA 2HK9A 4DLBA 3JD0A 5DT9A 3OH8A 3PZRA 3TL3A 1KEWA 3JQBC 4CR6A 3GRKA 1JKFA 3TZQA 3PXXA 4DYDA 3TN7A 3PYMA 1EFLA 2EW2A 3JQCA 1YB5A 3GN2A 1C1XA 5U1PA 4DMLA 3DBHA 4EI2A 3T7CA 5H82A 1C0KA 1ZK0A 2X4GA 1QXSA 3L6EA 1LDEA 1EE9A 3I4FA 3DOJA 1DRWA 2HAEA 3GPIA 3GQVA 4XD2A 3VPFA 1PX0A 1R66A 2Y0DA 4ND1A 4CPDA 2ZYAA 2QRLA 3AI2A 1NQOA 3QIVA 1W8DA 1XU9A 1ZK4A 4XX0A 2NU9A 3NKLA 3SEFA 1Y9AA 1AHIA 2Y93A 1KIFA 2NU7A 3H5RA 4UREA 3I9NA 3E5MA 1NPTO 2DUUA 3WGZA 3EMKA 4E30A 3HFSA 1UP7A 3DXFA 4CJXA 1UZLA 1PL6A 3COSA 1NFQA 2Q2WA 2BF7A 1KETA 4INAA 4NBTA 2B37A 2BLLA 4MP3A 5ITVA 3GA0A 4FGWA 1DOHA 3VZRA 1N1EA 4YA6A 3WB9A 4R1NA 1VE9A 4RPGA 2CDCA 4TVOA 3ZHBA 1LJ8A 1C0IA 3TJRA 1DSSG 2VWHA 4TVBA 1UXIA 3K96A 3LDHA 2IYOA 2B83A 2BFOA 3HB4X 1NR1A 3RUDA 5A5EA 4ALIA 5KIAA 2A9FA 4IJUA 5HWSA 3OQ6A 4FR5A 1EEHA 1BXKA 1QYCA 4XDYA 2PWZA 5JY6A 4BGIA 1Q0QA 1MX3A 2JAHA 2EV9A 4YAIA 4RL6A 1LBEA 1IHYA 2NVBA 2H9IA 2DPGA 4X54A 4W9NC 4ALLA 4J6FA 4F46A 5BSFA 1HYGA 2X22A 3WFIA 2TMDA 2D59A 2V6FA 2D2IA 3NUGA 1I3MA 3KYCA 4RVDA 1DLJA 1R6DA 2HCTA 2UUPA 3W4IA 4DIOA 4DLLA 5L7TA 4JIGA 1R0SA 4PLHA 3B20A 3ORFA 4YCAA 1DC4A 3PGXA 3VVBA 3B6ZA 5CAEA 4R1TA 1Z73A 1ISIA 2Q49A 4LVUA 3WLEA 5TIIA 2C7VA 4J7XA 4YACA 4MIOA 3O03A 5EIOA 4AJPA 2ZJ0A 3C1AA 2PFGA 5F1OA 1QV7A 3M2PA 4S1VA 3H6KA 2GN4A 3D64A 3UOGA 3ZNQA 5J23A 3NDIA 5C7IO 1PJCA 3PFWO 5CHEA 4BNYA 1LI4A 5I7FA 5KOIA 1MFPA 1I32A 4ITUA 3VDRA 4AFNA 4DA9A 3AUTA 1YGYA 3ASUA 1FDVA 2NNLD 5TS3A 1ZEMA 5T8KA 5IN5A 5IXYA 4WK6A 3A28A 1EVIA 2IE0A 3KM0A 2X86A 1PGQA 2AE1A 3GDGA 4IDFA 5I9MA 3S55A 3D3WA 2SCUA 1F14A 3V1YA 2G1UA 3K92A 2PNFA 3M1AA 1SMKA 4BHTA 1LXCA 3WDSA 4UUPA 4O1MA 2GCGA 3FN4A 3PRJA 1YVEI 5JPIA 3DBVO 3DO5A 2EXXA 4RPJA 1T2FA 4MVJG 4PIVA 1T25A 4XRRA 1UDCA 3KLMX 4CMBA 2I67A 2XAAA 1HE3A 2J5RA 4TRRA 4CUJA 3D4NA 3GHHA 3QW2A 2YZ7A 1W73A 2NQTA 4ND3A 1GZ4A 1Q2XA 3RFVA 2OO5A 1VKNA 1PGJA 1HKUA 3LC2O 4ROSA 4OOEA 4L76A 3U4IA 4MKRA 3N74A 5CDUA 1IE3A 1XCBA 4Y6RA 2ILTA 1TXGA 4B4WA 4B4OA 1FDTA 5IDXA 4ZU3A 2B5VA 3CE6A 4YPOA 3KRTA 4TKMA 3ROKA 3H9JA 1U4SA 2C5AA 2DAPA 1ZNQO 4IUYA 4YT5A 1XG5A 4RVHA 3JYOA 5A3VA 1XELA 1ZUD1 2NVUB 4JROA 2Y99A 4BO4A 1KS9A 4BO6A 1YB1A 3ENKA 4RPHA 1ORRA 1BRMA 5ER9A 1Y1PA 4O59O 3JV7A 4PLGA 4DTIA 1UDAA 1HDRA 2IZ1A 4NU5A 4WCFB 3RBVA 3MCVA 4ZQGA 3UAGA 2EW8A 3P2YA 4RPKA 4AJKA 4W4TA 2RBEA 2VHVA 4WCFA 1SB9A 1B3RA 4EW6A 3KVOA 4CV2A 4EYEA 4JJGA 3R3SA 3GGGA 2B69A 3CINA 2J3IA 1JDJA 3M2TA 1AGNA 4XIYA 2Y67A 1LDYA 2Z5LA 4BMSA 1VL8A 2HKIA 4RZHA 2X5JO 3CPSA 5F5NA 3U5TA 4IBOA 3CKYA 4ZGWA 3FPCA 4CV3A 2YW9A 2WYWA 2I66A 1PJSA 2BD0A 4E2WA 3ONFA 4E4YA 4J9VA 1T1RA 1P74A 5THKA 1VRWA 4WCFC 1Z82A 4NHEA 1H94A 4CMEC 2CNBA 4EUFA 4W99A 4AJIA 1P0FA 1PGPA 3TZKA 2FOIA 3JQ9A 1E3IA 2F00A 4RDIA 5A04A 4FFOA 1DEHA 2J6IA 5EPOA 1HDOA 1QSGA 4TMFA 4RJTA 4TRMA 1LDMA 4ZRMA 1BW9B 5COQA 1NPDA 1Y9EA 3UCEA 1R37A 2D1YA 2HK8A 2IEDA 4A10A 3RJ9A 3TDKA 1W4ZA 4GWKA 3KEOA 4H7PA 3IP3A 5CPBA 4IIVA 3ZU2A 1IOLA 3RAJA 1LSJA 3JYQA 1ONPA 1ZK3A 2VYND 3OIDA 4B4VA 2C59A 2GSDA 1H93A 2O7QA 3PZBA 3WNQA 3IQDB 3D1LA 4KDEA 3A9WA 2QHXA 1LRKA 3PGJA 1PQPA 4OM8A 4E6PA 3TZ6A 4NFYA 3HZZA 2JHFA 2EF1A 2HLPA 5JAZA 1J4AA 1XGKA 4PG6A 2HMTA 5BNFA 3BMCA 3CEAA 3C85A 3GPDG 2RAFA 3K2BA 4N54A 3F9IA 4U0JA 4YRBA 3A06A 2JCXA 3EUWA 1I30A 4URFA 1Q7GA 2G5CA 3OF2A 1DXYA 2ET6A 3GH3A 3PK0A 3GZNA 1N92A 3L77A 2AMFA 5TC4A 5TJHA 4HKTA 3EDMA 3QWAA 3ZWAA 1T24A 1JKIA 4XQCA 2VQ3A 3DAPA 4U6SA 2DUWA 3QA9A 5L4SA 3BZUA 1QP8A 4KUGA 3LT2A 4OQYA 1M2WA 3Q2IA 4FJ2A 3DTYA 3L9WA 2A94A 1KY5A 2CUKA 2D5CA 4YT8A 4R68A 5B12A 4ILKA 1WWKA 4I08A 2V6BA 2O3QA 5T64A 2Q2VA 3JQ9C 4WECA 2E6UX 2DM6A 2O50A 3V2HA 1O94A 2NVWA 5GZ3A 4H15A 1GYRA 4HXYA 5L4LA 3Q3CA 4BKOA 3EHEA 4CM8A 4CV0A 1LQTA 1A7KA 5H81A 5CDGA 2FR8A 4I9UA 1KEPA 8ADHA 1HWYA 4XR9A 4AJ2A 1LLQA 1VC2A 2P5UA 1EUDA 2NV6A 5B4TA 3AOEC 4D45A 1ZBQA 5JBIA 3S2GA 1MFZA 1HDCA 2NTVA 1TT7A 1GZ3A 2GYYA 3FWZA 1PZHA 3ZV4A 4CM7A 3D3EA 1H2BA 4BKPA 2JKVA 4PG7A 3OQBA 3S2EA 1YBVA 1ZK1A 1GUZA 2P68A 1GPDG 1ZO8A 4IINA 4E2ZA 2GERA 5COBA 1YBMA 1Z7EA 4GQAA 4ALJA 4KWIA 1PJLA 3DONA 2BKAA 1UZNA 3RCBA 1VSUA 1Y7TA 3EGOA 2GUGA 2JJYA 4FJ0A 1VKOA 1EVZA 4AG3A 2E82A 3F4BA 3GY0A 2DQ4A 4WKGA 4PLFA 4CLXA 1P1IA 5CEEA 4XR4A 1ENPA 1RWBA 4J4HA 4RF3A 1O89A 4XRGA 5MDHA 4PLZA 4RORA 4XWYA 3MJTA 2TMGA 4BMVA 1GU7A 3H4VA 3ADOA 1CIVA 4ZQHA 5BR7A 2Z1MA 3HADA 2ZTUA 5HA5A 3E82A 5LDHA 3RC1A 1WMAA 2Y05A 1ADCA 1JVBA 4R51A 2JFFA 2VUSA 4P22A 1Y5RA 3DEYX 2YV3A 1PZFA 3G3EA 4ND5A 3V2UA 1Q7BA 1D8AA 1UXGA 2VOEA 3KEQA 1Y5MA 3NGXA 3JQ8A 1LLDA 4EJ6A 1E1KA 4DL9A 3BTUA 2W4QA 4IDGA 4IZHA 3WX0A 4XKJA 3DBLA 4GBJA 5IFLA 4XB1A 3PJGA 3GDFA 5A1TA 1L7DA 3Q6IA 4IS3A 3AUUA 3ZHYA 3B1JA 4MVJH 1SOWA 1NAIA 3OP4A 2PZKA 2GPTA 1AUPA 2FHSA 2PKRA 3NT4A 4Q9NA 4Z3KA 1UH5A 2P9CA 4MVJA 3KOUA 5TSDA 1PR3A 3RROA 3ITDA 4AVYA 1ZJZA 2WD8A 4K26A 1D1TA 1QYXA 2O3JA 4XIJA 2D8AA 4OMUA 5DP2A 4JBHA 1U7HA 1IUKA 2GO1A 2P4HX 4JBGA 5KKCA 2DBVO 2ZB7A 1B8VA 2DVMA 3AJRA 1ADBA 1I01A 2X0IA 5DBIA 3GRPA 5F1PA 3GFGA 2P9EA 1D3AA 4BNUA 3L4BA 3AOGA 1EUZA 3TNLA 1ZSVA 3DDNA 1CWUA 2VHYA 3ZV3A 4E31A 1BHSA 4MVJM 1T2EA 1YH3A 2B4RO 1X7GA 3AM3A 5GZ1A 1ZIDA 4QXMA 4JP3A 4JJIA 5I8ZA 1NXQA 4PGFA 4NMHA 2HRZA 4DQUA 3H65A 4GX0A 3WMWA 1X0VA 3GOHA 2NWQA 3LC7O 3QVSA 2X58A 4CMGA 1FXSA 4WOKA 1D7OA 5EINA 4UVGA 2PK3A 4HV4A 3C8MA 3GDOA 2CY0A 1U3TA 2VRBA 1D4FA 2CF6A 4G2NA 4MIYA 4QUKA 1OI7A 1H6CA 1EMDA 3DZGA 3WTCA 4JK3A 3D0OA 4K1LA 4PN3A 1A7AA 1BW9A 1GQ2A 3FBGA 5B37A 3R3JA 3E03A 1T4DA 4L8VA 5TLSA 2GASA 2HJRA 2GD1O 3VH4A 4RO0A 2VWPA 4XB2A 1J5PA 4XYLA 3DBRB 1K89A 3PJDA 4BL5A 2BFAA 3SX2A 1OZAA 2LDBA 4NBUA 4OSOA 4KQXA 3ULKA 3ON5A 3DAFA 1DAOA 5DF1A 3G79A 4IMRA 1PJ2A 1E92A 1FDWA 1UAGA 3FWNA 3TF5A 3RQSA 3PQDA 4TQGA 3S8MA 4CM1A 4JN6B 5G0WA 3NDRA 3G49A 1QYVA 1PU2A 4O63O 2C2XA 5A4DA 4ZA2A 3VPSA 3B70A 4XGNA 4UEKA 4AJEA 1GUFA 2AEFA 3AWDA 3SJUA 1MXHA 3KTDA 3UKOA 2QZ9A 1C3VA 4PLWA 4D3DA 1EBUA 1PIWA 3IMFA 3MJCA 1XLTA 3SVTA 2Y1EA 4WOJA 4DVJA 5L7YA 4CM9A 1U3UA 1HDXA 3U4CA 3OA0A 1NP3A 2VHZA 3JYLA 3RASA 1AXGA 1YXMA 3LU1A 1XSEA 4WE3A 1YBAA 1BDMA 3U0BA 1ULUA 3PYXA 1KVTA 3BMQB 3H9EO 3IL2A 3WGYA 3ZW8A 3DMTA 1SCUA 1UR5A 4EJMA 3HN7A 3BMNB 2AXQA 4E2YA 5C37A 2IYPA 4JNKA 1X0XA 1HXHA 1MP0A 1VL0A 3QY9A 5DDIP 3HJAA 1HDYA 1MC4A 1I33A 1ISGA 2Z1NA 3MJ4A 1FK8A 1HL3A 3LVFO 3LLSA 3RJ5A 3O4RA 2C2YA 4WLNA 4J4TA 3F6YA 3PTZA 3QWHA 4OSPA 2B4TO 5JAMA 2HK7A 2JD2A 1P44A 4NJMA 4DPKA 5DP1A 1NQTA 2NM0A 3UCFA 1E1LA 4B7XA 3RU9A 1U3WA 3NV9A 3OSUA 4IGFA 2PLAA 1I2CA 4QFDA 3UUWA 4FOOA 2YV2A 3GG2A 3P2OA 1MC5A 1GY8A 1DC5A 2CDBA 4YR9A 2EKLA 3ETGA 4WLUA 3JSAA 3GAZA 5IZCA 4PLCA 4WNIA 5U9CA 1BVRA 1HSZA 1GV1A 4GH5A 5A9RA 1UXHA 3LC1O 3ANMA 3HB5X 5EERA 2P91A 3WYCA 2VHXA 5ITWA 1JVSA 1U4OA 4ZN6A 2PD6A 2IZZA 4QSMA 2C82A 2ZK7A 4GLOA 5L53A 1KC3A 1UP6A 2F1KA 4QTZA 3RFTA 3QWIA 5KKAA 1SZJG 1MUUA 4YBZA 3JQAA 2EKQA 5CEFA 1LLUA 1NTOA 1NPYA 3DZJA 2EERA 1P0CA 4HADA 2J3KA 4Y67A 3U4HA 1TT5A 2Q1WA 3AI3A 2BMAA 4FC7A 5CEJA 1Y8QB 4II2A 3ZWPA 1KVQA 4MDHA 1F8FA 1T2AA 1Q7CA 4PRLA 4JXKA 1AXEA 4R1UA 4Y9DA 4R4JA 1PGOA 2DTXA 1TA4A 2FY8A 4J16A 2J5QA 1OFGA 5BSGA 3VC7A 1ISMA 4BNLA 2XOXA 1WZIA 2UVDA 3TQHA 1O0SA 3INRA 3K9QO 1U1IA 4HX5A 1XA0A 3CIFA 4KUEA 1Q0LA 1V9LA 5T57A 3W8DA 3U62A 4YJDA 2IRWA 2EIHA 3HE3A 1OC2A 1FDSA 1VL6A 4FFNA 1BDBA 2C5EA 3KYCB 4YEDA 3JTMA 5KJ6A 5CG1A 4YB8A 1IY8A 5BNIA 2R2GA 4R69A 3KV3O 4OYRA 3I6IA 1IZ0A 1LSUA 2HJSA 3L4BC 3OEWA 4MVJD 3K31A 4LMRA 4BQPA 2R00C 4CM3A 4PVDA 1I24A 3ICPA 3JD4A 4ZD6A 1BG6A 1WLYA 4OGWA 3RU7A 1O9BA 4TRNA 3DR3A 1H9AA 1VI2A 1M6HA 3DBHB 3WBBA 1QLJA 2C29D 2FMUA 2P4QA 1HE4A 4IPTA 4OQZA 3WGTA 4RZIA 4XYMA 3WIEA 4BKUA 5AYVA 4UVIA 5EESA 4DBVO 1PSDA 3H2ZA 3MOIA 2GF2A 4E12A 1SO8A 5HRUA 2GRAA 3DMTC 2QRKA 2FPPA 1ZXLA 3PJFA 3LYLA 1C0LA 4W82A 4AJLA 1E7RA 2CMDA 5C7OO 1SC6A 4R3WA 3UN1A 3DAGA 5G4KA 4DIBA 1ZCJA 1BXGB 1E3EA 4XGIA 2YDXA 2Q1SA 3F5SA 5A03A 3PDJA 3D5QA 3HNPA 1X14A 4H16A 2Q3EA 4Z0PA 3HDJA 3F46A 3PPIA 1ISHA 3F4LA 2UUOA 1DFIA 5IZ4A 2CVZA 3BXXA 1HF3A 4M1QA 1LRLA 1HYHA 1V6AA 1NASA 3VOSA 1QORA 4CM5A 5IN4A 2ZTMA 3O26A 2BELA 2NACA 2Y68A 2B4QA 4DQXA 1E3WA 1P1HA 1V3TA 2IZ0A 3KYBA 3OECA 3PLRA 4IS2A 5JC8A 4B3IA 3DMYA 3GVCA 3DFZA 4PG4A 4DPLA 3NYWA 3JQAD 5TQVA 4IZIA 3DZHA 3A14A 1CYDA 1AE1A 2WE7A 3WWZA 2W2KA 4MIEA 1YB4A 4IQ0A 1ZXBA 6ADHA 3AFNA 3IOYA 3ST7A 2ZCVA 4GWGA 3NTRA 5A9SA 2B5WA 2GN8A 2DTEA 3P5SA 2PD4A 3E18A 1E3LA 3RUEA 1GEEA 1Z7BA 3QRWA 1PJQA 2JCYA 3MTGA 1BMDA 4BNWA 4HFMA 3WXBA 4L4XA 3WSVA 5TNXA 1DIGA 1YDEA 5BSHA 5IDWA 3PVZA 4OXNA 4ZICA 3I4CA 3C7CB 4CM4A 2X5KO 1SPXA 3L07A 2ZYGA 4P8RA 1CERA 4J2OA 1CETA 1B7GO 1NVMB 3WBFA 3E9NA 4BB5A 3WJ7A 2X23A 3ROMA 3FNFA 3PQFA 2GZ1A 2DT5A 4A0SA 3BTSA 3LT0A 3WGGA 3IKTA 4E5MA 2FWMX 1BGVA 4I9HA 2HQ1A 2CF5A 1O5IA 3BA1A 1E7SA 3ZWOA 1YRLA 3G17A 4Z0HO 4D41A 4BNMA 2P9GA 4Q3DA 5JYEA 3K8ZA 2X9VA 3EYWA 4BO8A 2Q4EA 2C20A 2EP5A 3CZRA 1ONOA 4UVEA 1FDUA 4J0EA 1HYEA 5JE8A 4DMMA 4RVUA 3IP1A 3PWSA 1ZJYA 2C07A 4H3VA 4XYEA 1Q0HA 4GKBA 4TSKA 1L1FA 2YFHA 3LLVA 5KVCA 3WGHA 1E3JA 4RF2A 4EUEA 1LU9A 4A03A 5JXWA 1WMBA 3BYZA 2JD1A 3R0IA 4D79A 3ZN2A 4IDBA 1O6ZA 2FPIA 5TJ9A 2ZQYA 3FSRA 5FEUA 5A9TA 1GUYA 3NT2A 3TL2A 3UFXA 3WYBA 4NNJA 1NBOA 4NIMA 3GGPA 4YJHB 1M66A 5CFZA 3TPCA 3D4OA 3QV1A 1E7QA 1I0ZA 4OKIA 1QV6A 1BXZA 4OHUA 2PGDA 4J2HA 4L4SA 1HETA 1PJTA 1R12A 3BHJA 4CR8A 2WEKA 4B8ZA 3F3SA 4IQ8A 3M1LA 2YJZA 1QR6A 4OH1A 1TB4A 5A06A 4BO5A 1PJ4A 4HFNA 4CM8B 2HMVA 4E3ZA 5IG2A 4NK5A 2UDPA 1AHHA 1CF2O 2Q1UA 1GD1O 2PZMA 3AY6A 1C14A 4MKZA 2FN7A 3ROPA 5L4NA 2VTEA 4DREA 3PHIA 2PA3A 1EFKA 4GMGA 2JAPA 2ZTLA 1HZJA 3AU8A 5AXCA 5LC1A 3GF4A 3GUCA 3HN2A 3MTJA 4BNFA 1LTHR 1I5RA 2C0CA 1CQIA 4ZRNA 4A26A 2X0RA 1U8XX 4YXFA 2D0IA 2VZ0A 2BH9A 1K6IA 5A5FA 5TT1A 4NBVA 4ZQFA 3NEPX 3CH6A 5HS6A 4WCDA 4J7UA 2P2SA 4CODB 3INTA 1ENZA 3ITKA 3OFSA 1ARZA 3RKRA 4R16A 4M55A 3PHLA 4CM6A 4WLEA 1MB4A 1FJHA 1GL3A 3MJVA 2CDAA 1IHXA 2VHWA 2RIRA 3DZKA 4EGFA 4ONEA 3W8FA 4EBFA 3U09A 3NDJA 5EL0A 3CZMA 4HWKA 4J0FA 3KHUA 5U4QA 1P3DA 3WR5A 3UCXA 4ZHSA 4FFLA 3BMCB 3ZWWA 4BNHA 4DWVA 4EITA 1E3SA 4IXWA 2I5PO 1MLDA 1YS4A 4TWRA 4AJ4A 3ENNA 3E8XA 3GGOA 4NQZA 1ZW1A 4OAQA 3OJEA 4QFCA 3ZCXA 5AXDA 3QQPA 1HLDA 2W2LA 1DRUA 2DLDA 3WIDA 3RKUA 4F6CA 3GHYA 1P1RA 2X0NA 3U9LA 2E37A 3I9LA 4Q3CA 3HDYA 5IJZA 1SB8A 1RPNA 1R4MA 4YJGB 1J49A 4LK3A 4QO7A 2JFGA 4CMIA 3AUAA 1E3WB 4YRAA 1KVSA 1N7HA 1T1SA 2Q50A 5TF4A 3TOZA 3JQFC 4MOWA 3QVOA 3OIFA 2EHDA 3AY3A 2EG9A 4I5EA 1G0OA 4E21A 5ENVA 4XGKA 4U8GA 1Y8RB 5I8WA 1IPFA 1XKQA 3ZDFA 3WLFA 3ZU4A 1M76A 2FZWA 1L7EA 2VCYA 3R6DA 4PRKA 5JMPA 5FWNA 5CDSA 1PWXA 2QZZA 3BMOB 2VT2A 2D4AA 3RUAA 3RC2A 3UHAA 4GLLA 3VTZA 1ID1A 3FI9A 4XEHA 1T2DA 3LSYA 3EVNA 2WE8A 3JQEA 5G0SA 3ZWCA 1UZMA 1H9BA 2W98A 4W7HA 1JKJA 2J3JA 1B0AA 1UDBA 4RVSA 5KJEA 2O3TA 1KEVA 1V3UA 4L75A 3L9XA 3KB6A 3GK3A 3C24A 3NAQA 3UW3A 1H6DA 3GEMA 1B8UA 1SOVA 3E48A 2OMEA 4JX8A 2C54A 1RM5A 1RYDA 3JCZA 1YKFA 4FN4A 3OICA 3ZV6A 4YQYA 4CL8A 5IDYA 5DCUA 4DUPA 5B4VA 5F5LA 3ANLA 4YRDA 1NHWA 1KVUA 5GZ6A 4DLAA 3I23A 4U6QA 3DFUA 4XQGA 4K28A 2E48A 4GGPA 3HSKA 4IJWA 4RLHA 4QO8A 5ILOA 2ZB8A 4CLRB 4NPCA 3TZHA 3OA2A 3VKUA 1IZ9A 3HHPA 3S1LA 1MG0A 3EAGA 2EP7A 3C7DB 4MPDA 4NH4A 2PD3A 1N1GA 1IPEA 2DTDA 5FYDA 2QIOA 3K6JA 3ZHZA 1K0UA 1OC4A 1QYDA 1EUCA 1JAXA 4BGEA 3CXRA 3WJAA 3FNGA 3DL2A 1LUAA 3JQ6A 3WQRA 4R9RA 4AJOA 1A4UA 2PTGA 2VT3A 2RH8A 1DB3A 3PHJA 2H5LA 5G0TA 3ZU3A 1G0NA 3GVXA 1HDZA 4CLRA 2GLXA 4M87A 1NR7A 1DAPA 3GVHA 5JLAA 2PY6A 4R1SA 3V1TC 1A71A 4KZPA 3W1VA 3WICA 5L51A 3C1TA 3LQFA 2XPCA 1HTBA 4GPD1 4JLWA 4R9SA 1K5HA 5C3MA 3UVEA 3O8QA 5BSEA 2QQ5A 3ZGYA 4CMEA 4RVFA 4LISA 4HP8A 3VZQA 4EJ0A 3AFMA 5EN4A 3SC4A 2OZPA 5THQA 1R0KA 2PZJA 4JGBA 4EEXA 3ASVA 3KO8A 2ZIZA 3AY7A 4B7UA 3VH1A 2O2SA 4D0RA 3H9GA 2V7PA 2GGSA 1PTJA 4O5OA 1UXJA 4LGVA 2IODA 3O9ZA 1WPQA 3VZPA 1B26A 1IL0A 1NAHA 4KTTE 3O38A 1BTOA 2WYUA 5TX7A 4D7AA 1F12A 3DWFA 2V6GA 2YUTA 3VZSA 4YYZA 4P4LA 4L0QA 5T6BA 1F06A 3HUDA 1BVUA 1Y8QA 4NZ9A 3V8BA 4CR7A 4L4RA 1C1DB 2AEJA 3TZCA 4D43A 1X7HA 1LSSA 1VJ1A 4IDEA 1RM4A 2VZ9A 4WLVA 3Q9NA 3T7EA 3OJFA 3G1UA 4E2XA 3GR6A 1W6UA 2DKNA 4E5YA 4YVFA 4KWHA 1OMOA 1WDLA 1B14A 4ZJUA 4BNIA 4FFRA 1C1XB 5A02A 2FP4A 3H5AA 5F3RA 5KCZA 4I8XA 4II3A 2Q1TA 4BUCA 2EJVA 5F21A 3E6AA 3OM9A 3KYDB 3MJSA 2RHCA 3UICA 3D4PA 1AN9A 3ETEA 4N5NA 2X6TA 4PLPA 3W4KA 4W7IA 4N18A 3LZ6A 3UGKA 5C7LO 1QRRA 3RC7A 2CVQA 2WMDA 1S7CA 1E6EA 1I8TA 3ANNA 4RF4A 3ETDA 3H2SA 1TI7A 1SNYA 4CV1A 4O0LA 4UULA 5DCYA 3DZBA 3FNEA 4IMPA 2FPGA 1P1FA 3MWDB 2Y0EA 4TRJA 1B16A 2FRDA 3WG9A 1E5QA 3MEQA 1X1TA 4IDDA 2HMWA 3I1JA 4TKLA 4CQMA 1DIRA 3JQGA 1GADO 4ND2A 3GNSA 3JQBA 4BNNA 3HDQA 4BNGA 4KUHA 5IAAA 2ZYDA 2X5OA 1MXFA 3CUKA 3ZWNA 5KVVA 2VN8A 3V1UA 4BVAA 1EBFA 3H9UA 3KETA 1DJQA 4A5OA 3F1KA 3EY4A 3PIIA 1WDMA 3PP8A 1H6BA 3V5NA 3W4JA 3GN1A 4G5HA 3L6DA 4PLYA 5JCJD 4TROA 1GYQA 3NGLA 3ZV5A 4K6FA 2OGUA 4J43A 1PZEA 4K9DA 3B1KA 3PJEA 7ADHA 1C1DA 4PZDA 1OAAA 4UUNA 1UJMA 4J4BA 5ICSA 4GKVA 3JYPA 3KSUA 2BGLA 1TVEA 2B36A 3RFXA 4IM7A 2PGLA 3DZIA 5DN9A 1B8PA 1EE2A 2BFPA 3U49A 5KWEA 4EUHA 1XWFA 2CZCA 1P9LA 5FI3A 4J1QA 4D46A 4MVJI 1RM3A 4LN1A 1X13A 5L7WA 3WQQA 2J3HA 4CLOA 4B7CA 1RM0A 4CLDA 1JAYA 3GNQA 3P7MA 2PV7A 4CMJA 4FIZA 5JAIA 2POQX 3GC6A 4KP7A 2WJPA 2VRCD 5H83A 2ZQZA 4GX2A 4Q3EA 4W9NA 1QLHA 2XF8A 1YO6A 4I9NA 5JAQA 5AXAA 2W2KB 3OIGA 5K6AC 3FR7A 3LT1A 1Y8RA 5JFOA 4PG8A 1PS8A 2O3SA 3OETA 5JY1A 4GX1A 4CQLB 3WGIA 1WXDA 1XYGA 2O3UA 5I9LA 5HTOA 4M89A 2PKQP 4HFJA 5B1YA 2H6EA 3I83A 5T67A 1NM5A 4YJGA 4E5PA 2AA3A 5B4UA 3CSDA 2UAGA 3FBTA 1GCOA 4IIUA 3SLGA 1E77A 1ZH8A 2QYTA 2EEZA 4OJNA 5I7SA 4F45A 4BNJA 1V0JA 1PL7A 1ADFA 3IUSA 3GUYA 1H5QA 1DFGA 1YJQA 2NUAA 3S2IA 4CUZA 2P5YA 1J6UA 4GL4A 4P38A 4DXHA 4A27A 2DBQA 1PZGA 2OBYA 3QWFA 5DZSA 2O3RA 4C7KA 4XZ3A 4HUJA 4W6ZA 4B3JA 1EVJA 1YONA 3FTNA 4DC1A 3ADPA 1I3LA 5EQFA 1G6KA 1YL5A 2OXIA 1YQGA 2YHUA 1SBYA 4AJJA 2AQIA 1HE5A 5K6AA 2X1HA 3IDSA 4EZBA 4LSWA 1KEUA 3ZNNA 3L4SO 3IAHA 4OL9A 5A9SB 4GI2A 3ZNPA 1DFHA 4I5DA 4HNHA 3QE3A 2A92A 1CQJA 1JQBA 1R15A 1Y81A 1KYQA 4FOSA 5AOVA 3V2GA 4AJ1A 4BNZA 1ISJA 2YQ4A 3DHEA 2PH5A 4BO2A 1K3TA 3H3JA 2OUIA 1P45A 5G0VA 1R4NA 3RI3A 3NTOA 2QX7A 3WS7A 3MWEB 1A72A 1MA0A 4LRTB 2WYVA 5DNAA 3AU9A 4OOFA 1GR0A 3BIOA 4R3NA 5I9NA 2HDHA 2G0TA 4FDAA 1ZSNA 5G0UA 5G2OA 9LDTA 1B15A 2G17A 4JCOA 5KJ1A 1EZ4A 1M75A 3M6IA 3AM4A 3P19A 4PZCA 2VWGA 4BKQA 2GNAA 1E1MA 3BTVA 3DOOA 1JN0A 3LF1A 4B8WA 3WWYA 3U4DA 2J5KA 1QKIA 4J3FA 2H63A 4XA8A 5HBRA 5CDYA 2Y1FA 4C7JA 2OBNA 1GQQA 3ZWMA 4NJOA 2OP0A 4FS3A 4DBZA 2HMSA 4NJMB 3DHYA 3OJOA 2WDZA 2RH4A 2FR0A 4YT4A 4J9UE 4BO7A 2CSUA 5HS4A 2J8ZA 4XJTA 2AQ8A 1A5ZA 4RDHA 3MOGA 4D3SA 1OOEA 1DIBA 2QRJA 1N9GA 2C7GA 3SC6A 3ZI0A 1GPJA 4B4UA 3N58A 4FGSA 2AHRA 4CMAA 3HDHA 3VTFA 1XEAA 2X7HA 3DTTA 3D7LA 1YJ8A 2VYNA 3OJLA 5I7VA 4BO1A 3ICCA 4A2CA 3ZHXA 3PQEA 3JQ7B 3Q1LA 5KVQA 3OHSX 3O8QB 4OXKA 3KSZO 3RUCA 1QYWA 5JC1A 2O23A 3K2EA 1VJ0A 4I5FA 1GEGA 2YHIA 2PZLA 4IJVA 4GGOA 1NWCA 5JMWA 2ZTVA 4G65A 5EJ2A 4JQCA 4YJHA 4KOAA 3RWBA 8LDHA 3K5PA 4Y6SA 1V35A 3JD1A 4OXYA 3KZVA 1EDZA 1KVRA 3AW9A 1ZK2A 3GVPA 3GMSA 2R6JA 4FPXA 2EKPA 2W8ZA 4ZVVA 1T26A 3WNVA 3FTPA 4PLVA 4U7WA 5DBFA 3I3OA 4M86A 4LMPA 1A9YA 1XQ1A 1N2SA 4JP2A 4NDNE 5T5QA 4TZKA 4CM9D 3JQ8B 5ENDA 4PVCA 4XYGA 5FI5A 2BHLA 3LK7A 1VLLA 1E1NA 4FB5A 4NG5A 5A05A 4J7CA 1F8GA 4J90A 3RUFA 1NWHA 4WUVA 3QVWA 3Q11A 3QLJA 4ID9A 4MVJF 5L9AA 5JO9A 2YYYA 3FRJA 3SBOA 1U5CA 2JD0A 4YAKA 2HMUA 1KOLA 5EQDA 1G1AA 3PEFA 2X9GA
chains in the Genus database with same CATH superfamily
4C4OA 3M5CA 1QZTA 1USIA 3UXEA 4ALKA 1VPDA 5LUBA 2J6BA 3KLNA 4DRXA 2VTBA 1AJEA 1GA6A 4HAWA 2W43A 4PANA 3AF5A 1LA2A 4OKSA 2C04A 1DIAA 4QQNA 4UMEA 3X2EA 3ZCPA 1DU4A 2HZBA 4CLEA 4RHUA 4MDFA 1I51A 421PA 1Q91A 5FTKA 1QMPA 4NK4A 3RBXA 4HNAA 3GQBA 4PNEA 1GTSA 2IIQA 1PD0A 2A4MA 2V65A 4LDAA 3GZTB 4MQUA 4QPJC 5MGBA 3K0BA 2P9YA 1HT0A 2C4HA 1KAMA 3GZNB 4MKGA 1QOQB 4DWJA 2GEBA 4QQRA 5C3UA 1ZSYA 3IKVA 3K0EA 2FI1A 3L6OO 4CBVA 1QIEA 1J1UA 2RHJA 2ZRKA 1PL8A 4KXWA 4JWTA 2F1HA 4ALNA 3MXTA 4N82A 1I3OA 2HHCA 2QRGA 2ZWOA 2ZT8A 4OD0A 1ONSA 2J33A 1J90A 4BVLA 1EX7A 1UAAA 2BTEA 2PSDA 2FSSA 1QVAA 1VCNA 3PC4A 5DGXA 2G9QA 5F1KA 4QLOA 4P4NA 3UJHA 4KTVE 4XVRA 3EIWA 5LA6A 5D1HA 3VTAA 4DJ5X 1HDGO 4D80A 3N2NA 1Y6JA 3BCRA 3DFMA 5F51A 1I4DD 5F9HA 1S89A 4D0LB 4NR0A 2BBOA 4TYQA 4RABA 4TSRA 3VMMA 1EXVA 2ZATA 5MFPA 3O4JA 3V8NA 2A67A 1NF2A 3P9CA 4AICA 2CV2A 1KRXA 1TMKA 1Q1EA 1QH9A 2NW6A 3I2YX 2QG4A 4MA0A 4ZQBA 3RS8A 1LEHA 1WAMA 1H2YA 2VKTA 5GMOA 2O8DB 1T8SA 4YP6A 1GZ6A 1ADGA 5KNDD 3NR2A 3NBXX 2J07A 2JI8A 3WZLA 5JZVA 3W6PA 1RT9A 3ELWA 1N3BA 4AKSA 2PG3A 2DQZA 2I1VB 1V3VA 4LCEA 1DHRA 3H7AA 4FQ8A 1LBHA 3I9V1 2NV0A 2PBLA 2YBDA 3VH2A 2JVJA 2HJWA 1E6LA 1H4QA 4JJZA 4TT3A 4KXLA 4BJHB 1PZMA 2JCVA 5I45A 5L3VA 1OPRA 3O3CA 3QLTA 3SSNA 4XSGA 3CC8A 3T4XA 2LVBA 4RSRA 2YIVX 5KWIA 1ORTA 4RCVA 4U9HS 4L95C 1DBVO 5FADA 5IUKC 5L3SB 3NHLA 5JRZA 2CLHB 1W6RA 3QWBA 1TCVA 5BW6B 3RRBA 4EGQA 1XR3A 5HPYB 1MNQA 3TLGB 3INGA 4BMNA 3CX4A 2C0PA 2AQKA 3GNTA 1GITA 2Y1CA 2X0JA 3WOHA 2E4AA 2YTZA 5FA5A 3H2YA 4YAJA 1A88A 1JSZA 2PMKA 1Z06A 4M49A 5JMOA 3I58A 1EXMA 3OOHA 5BQXA 2XNJA 1PBNA 2WA1A 3NHYA 2V6MA 2PYZA 4BRWA 5CITA 5JNSA 2WIDA 3USCS 3UV7A 4AC9A 5LZ9A 2WF8A 4RVGA 3UPTA 2JGMA 4PNHA 5B57C 1NI5A 1TM3E 3DL7A 2QBYB 3FR8A 4R8LA 1WCXA 4LF8B 1PGNA 4M60A 3V7UA 4FLMA 5ADHA 2WSBA 1J0EA 2UZIR 3Q0IA 3BFKA 4H7FA 4DHWA 1E1QD 1KEZA 2XDWA 1SXIA 3OQPA 4FSHA 2LKDA 1XDZA 3NHJA 4D74A 3IUJA 2PLFA 3DA8A 2DR3A 2W6JD 4UTXA 4EX7A 1T2CA 4RGBA 2AE2A 4GBED 3SOPA 1DT5A 4OXIA 2F90A 3UWKA 2X76A 4N0MA 2ZJ4A 4BAUA 3PDUA 1LDBA 3A6GA 2FR1A 4JT2A 3AJ8A 4TMKA 1IN4A 3DVSX 3HLYA 1ENOA 3JD3A 2X8LA 3I8OA 1PWZA 2HNAA 4GEGA 1E2IA 4B6PA 4B3RB 5AVWA 4YQZA 4TWAA 3F97A 4WWHA 4YIHA 3H2BA 3LF2A 5K3EA 4RULA 1UC9A 3D59A 3EVFA 3K0CA 1YGPA 2XYRA 3OIWA 3SFVA 1WZ2A 3N2YA 1WXFA 5CT5A 3TTXA 3CTMA 2RCNA 3L05A 1ZA1A 3K94A 1TT5B 1W1UA 3ZPXA 3SZMA 1MJGM 3GLFB 4EELA 3ORYA 1KYYA 2OMKA 2RGNC 2VYVD 4B3HA 1JIUA 1OI4A 4PQGA 5GONA 4EENA 1EA7A 4CF4A 5JZBA 1CW2B 1EK0A 1ZN9A 1U5BA 2PZBA 2R25B 3SM3A 7MDHA 1JWLA 2ZSIA 1VJTA 3Q9LA 2WWGA 3NIDB 2KMLA 4J1SA 3NBUA 3QF7A 2UYHA 1Z0ZA 2O2XA 2PO5A 4OMFG 2OD2A 2Y66A 5ER6A 1IVSA 5DFAA 4W63A 1IULA 4YRIA 2ZUTA 2IY7A 5KYWB 2BE9A 1PHRA 3Q88A 3IPLA 1GAXA 1N8KA 5L3ZA 1YQXA 1FMJA 3B36A 1K8YB 2LD4A 4MV6A 3NIWA 3Q7IA 3KLPX 5IXSA 3GLGB 10MHA 1SVIA 721PA 3VKVA 2O4UX 3QE4A 4YCJA 2QI9F 1GT91 5CJJA 1DEXA 2UV8A 4LZJA 3OEHA 5LDGA 3WLJA 5BY2A 1Q14A 2R4QA 3DV0A 1PP4A 1S01A 1HFEL 4LFAB 3TQFA 3GRAA 1BX1A 3RSQA 3WC4A 5CK4A 1V5GA 3E9YA 1NFFA 4WJZA 1Y4DE 1Q3TA 1SUBA 1CSEE 1ZR4A 1IWBB 1QO7A 4KK3A 2FX3A 2IY8A 3IXMA 3JQDA 2RCYA 1R88A 3MQ2A 4YAEA 4DY4A 2ZYWX 5J59A 4EPRA 2F9MA 4QREA 5I9BA 3SMQA 5CDTA 5BYBA 2JBWA 4HY3A 2HF9A 2WP0A 2OO5C 3R4VA 3OD5A 4PSCA 5C8XA 1PS9A 1VI5A 1X86B 1WUYA 3JPWA 5DH9A 3W5IA 5JALA 2IS4A 3JRWA 3GEEA 3QVVA 4D8TA 4K2AA 1G4UR 4MSUA 1ZUIA 1SCQA 2Q5IA 5H7XA 1JJ7A 1U1DA 3KQMA 1ZOIA 2HX1A 1ZA2A 4M0PA 4CCSA 4MX8A 3ZOKA 1QS0A 3C7AA 1QRUA 4XFJA 3C6MA 2OYCA 5A6VA 5J43A 1M0WA 1H6AA 1GGEA 4BN4A 3SI7A 3ENWA 4PAMA 2G82A 2VPTA 1UPXA 4AZ3A 4PC6A 3DWEX 5EHZA 4JASB 1XD2A 3ETHA 3AVUA 1HRDA 4HQRA 2F8MA 2FFRA 1FP6A 2Q9CA 3AKEA 4Y2HA 4L74A 3LJKA 2XXJA 2WW8A 2DBZA 4I2VA 3D3NA 4H4DA 1IM5A 1E1DA 5I7EA 3SHWA 2PAAA 3DZFA 4ARSA 1K4YA 3LVBA 1UP4A 1SHZA 1FNSA 1GYPA 2P4SA 3WDMA 3ZY6A 2WKWA 4K3VA 1KY4A 2P27A 3H13A 3ZXUB 1SBHA 1SUIA 2OY0A 4BMYA 4ETMA 2E1RA 2EZUA 2R1UA 4XVHA 2H9YA 4RTQA 2HSJA 3BPSA 4R2IA 1QG0A 4TM8A 4WSOA 4G23A 4QOHA 4ZOQI 3I12A 1TLTA 4KLRA 1TX4B 1TYZA 2GOYA 1IUPA 2PVPA 3MHPA 3K09C 2H8KA 5EIWA 2WJJA 1T4MA 3C3DA 4QEZA 2F17A 1HNNA 5K0GA 1H3EA 3R6GA 1IJBA 1SAYA 3HCDA 1B6SA 1MN6A 2VI5A 3IO3A 4B35A 5LL6P 2R65A 4BB6A 1VDZA 1RWNA 5LYJF 2BI8A 1DADA 4Y98A 3TSAA 1TQDA 4MUNA 2Z2XA 2X1LA 1V8OA 3IP8A 4TWZA 5CG2A 1MF7A 2FN9A 1U5BB 4UHFA 2O52A 1P75A 3V9AA 2YZGA 3LOPA 4LQ4A 2G9VA 1QX3A 4IJKA 5FOWA 3WJ2A 1X7XA 5A1JA 4P0PB 4HN9A 1JG2A 4KQWA 5AWFC 1C1YA 2NXNA 5FF9A 1RQXA 4DT1B 4O4HA 2NUTB 4R8SA 4RY9A 4Y0AA 4FJ1A 4TS9A 1PUXA 1RXSA 2MU1A 4A8TA 4EUSA 2I1LA 4PX3A 4DSOA 5A0TA 3BHMA 4BYMA 4DCVA 1PFWA 1U2TA 2GN0A 2KLHA 2RG7A 2IUUA 4YLGA 3KR1A 1X7DA 4GXQA 1V39A 1D2EA 3CGGA 4HUQB 2CSXA 3A26A 4FD3A 3PFKA 3ZW9A 3B78A 4OXXA 3VNRA 1DRVA 3A4IA 2V59A 3H3FA 4LNHA 5AT1A 1D5CA 2DR0A 2NXJA 4IQGA 1QDLB 2EYQA 3HZRA 2EJWA 3L7JA 1KERA 3L6BA 3N8DA 2G40A 2EGGA 4MRMB 4TS1A 3WMXA 1HL7A 4ESEA 1CZOA 4ISBA 1D2CA 5LLDA 5ILGA 4FU0A 4EMUA 5H3LA 3LUHA 1J8YF 2I65A 5CB6A 3BMOA 3OO1A 1AMOA 4MJLA 4BGUA 1T1JA 1U0RA 3IAAA 2A88A 4JBIA 2X7JA 1O6GA 1NVTA 5DW3A 3TOXA 2QSZA 2CJYA 1NMQA 5HKBA 2VSFA 3ZDEA 1OY1A 1ZIXA 3HXPA 2BGRA 3UF0A 1XUOA 4CL3A 3NAZA 4EHDA 2Y1DA 1OLSA 1HE2A 2WA2A 3PQ8A 4CMHA 5A3JA 1CRZA 4MVJE 5K6RA 3ISJA 5E38A 2BFEB 2CB0A 5JCJA 2W2QA 4B40A 3KOOA 2D3TA 5KDDA 2G09A 2EARA 2Q28A 4PICA 1OLSB 3W05A 5EJ5A 2H11A 3RC8A 2DHCA 1WUKS 3SZUA 4S35A 3VU3A 3VJMA 5LKRA 1WTCA 3BJMA 4FWTA 4FGUA 4BNTA 3WL6A 1QMGA 1XC7A 3HKDA 1E62A 3PC8A 3C14C 5JNLA 2R7LA 3GG9A 4EQ6A 2ILVA 1F0YA 3QYJA 4TKUA 2QF7A 2HM7A 3WFJA 5BNTA 4RMJA 3NM5A 4P4SB 5JSYA 1YBHA 4IYRA 3W1WA 3OJCA 3P97A 3FWPA 3I9KA 4Z2YA 1N5MA 1JU9A 3LX4A 5DXJA 4O4JB 1FP1D 2PH3A 3AHDA 2H2DA 5A2QA 4IR7A 3UB3A 5KOJA 1FUYB 3HA3A 2JI6A 4PC3A 3TK1A 4CU5A 3DKKA 2NGRA 4NCIA 1N6PA 3KLOA 1O03A 4X90A 5K3AA 1O95A 4KBGA 4YPVA 5IDQA 5IJWA 3F7NA 5JRJA 2PWAA 1J0CA 1T5TA 3EVZA 3TUIC 1F51E 2DB3A 2JIRA 4EYSA 1M2VA 3FY4A 3JS5A 4NS1A 2C03A 3IB6A 5KNLA 1YOVB 2CXRA 1N3LA 3CKLA 1TK2A 5JJKA 3HBAA 4UAGA 3E27A 4BLQA 1P80A 2ZT5A 4FHCA 4DYVA 1D1SA 4EY8A 3IPAA 3EIFA 4IUBS 4KRYA 2OHXA 3L18A 1MX5A 3N0WA 2E5FA 2O2YA 1ZGGA 2QM7A 3KFVA 3OT1B 4NG4A 1I80A 4EY7A 2ZBPA 3TRIA 2PVCA 3IEMA 5LPNA 3FTCA 2YWRA 1BWSA 2PHZA 2R62A 4MQ4A 2F1OA 2HQRA 3OG9A 2WMOB 4HWRA 1P77A 5LA6B 3SFZA 5EY5B 1JPNA 3ZCSA 5JH7B 3U3XA 1N6HA 3CNLA 3A9RA 3QJ5A 4MRAA 1I13A 2AYZA 3DS8A 1P0MA 2QTWB 3FF4A 2B8WA 2BCEA 3SBXA 4EEZA 1UXOA 1T9DA 2AEMA 3EQ7A 3I9MA 3ZLBA 4BLWA 5KNBH 1CXZA 5CK5A 1Z7WA 1R8SA 1WX1A 2AT1A 3K1AA 2WHYA 1F0NA 3NWEA 4BS9A 2V4MA 3F3YA 4MLCA 5FUXA 2I9KA 3DCJA 1KSHA 2NU9B 1M6VA 1NA5A 1H2AS 1YKGA 4LKOA 5KNBA 1X3SA 1U99A 3C7TA 1WUTA 2FXVA 4U5QA 2QPLA 3G0BA 1F17A 5E6SB 3A2NA 1QPGA 2GDZA 1E0DA 2XGGA 1K6XA 1QGOA 3Q6MA 4I5GA 5EP3A 3H5LA 1PR2A 3RIHA 5D3QA 3PLNA 4Z9FA 4P3KA 4FNMA 3AI1A 4PG5A 3H9BA 4XW2A 4F6RB 5JHHB 2B98A 2PGIA 3WLKX 1ZD8A 3ZD9A 1DMRA 3O83A 4GHWA 4KX3A 3X1YA 4B6QA 3L0DA 1JG7A 2M6SA 1DHTA 4O6VA 4IKOA 3V4LA 2EP8A 2RJNA 2VTBB 5KNCH 2FP3A 4QU9A 5ALJA 3JAKB 3AM5A 4PLTA 1NBHA 4MQLA 3GLIA 4GRAA 3LUPA 1LF5A 4GYYA 4L9RA 3P0JA 3DBOB 1T6YA 4M1WA 4UNPA 4YBRA 3SSMA 3T0FA 1U90A 1JHXA 1GKUB 2R1TA 5JBNA 1N6OA 1VYHA 5AM1A 2W22A 1CR1A 3PE4A 4RPLA 2VDMB 1BXRA 1U3VA 3CT4A 1PDWA 3MGAA 2W2VA 4HVAA 4QFMA 3IQFA 5CLJA 1T4BA 4DM7A 1IG0A 2QTRA 2XQJA 4H0FA 3OM1A 1Y42X 4I4TB 4DTCA 2ZQ5A 3DHNA 4QU0A 3WXMA 1TK3A 4NVRA 1V2GA 2ZR8A 2OM2A 4MCJA 4V0NA 4GZ5A 4NBSA 2V98A 2NTYC 1Z6GA 1FFSA 1M2JA 4I36A 4RANA 3S2IA 3T1VA 2PFKA 3GVIA 4E5KA 1XVAA 2JIOA 4M8SA 4MKXA 2QM0A 4I4CA 5JDCC 1FFGA 4QT0A 1T2NA 4MKFA 2IHTA 1D04A 1TA0A 1EGHA 2PKQO 4NSNA 4P98A 3RVJA 4D4HA 4B3DA 2VH1A 3F2IA 3EJWA 3WNZA 1BMTA 1UDWA 1Z68A 4G0PA 2VDJA 5TQ2B 2B78A 1SG0A 3G8DA 2O7SA 1G2QA 3G68A 1FVOA 3MILA 2I6TA 5IZCC 5FWYB 3MZ0A 3MS7A 5F33A 3V3TA 1KJ9A 1Q15A 4ER6A 4G24A 3Q98A 1Y37A 3W8EA 4G56A 1XWWA 1J21A 1AB6A 1L5HB 4DWOA 3BT7A 3W1EA 4RZXA 1NUHA 4ZAZA 2OTCA 5I3CA 4NESA 4ZZ0A 3GRUA 2QN1A 1RYMA 4KQ6A 1CRWG 2NQ8A 1R6UA 7ABPA 1EWRA 2FZEA 5LD2B 1YKSA 4AM8A 4M9ZA 4YDRA 1S2MA 3JQ7A 4RFSA 4RD1A 5AKGA 2JFVA 3NH6A 2EAUA 1NU6A 5JADA 3Q72A 5SV2A 4MUGA 4WGGA 2GZ2A 3CW8X 5ANRB 3PUXA 1E96A 1BD3A 2GSWA 3H1EA 4DLYA 2AWNA 4D44A 2OHJA 2VQFB 3GJ6A 2BZ1A 2F6RA 1EAYA 4PBSA 1QAQA 5GONB 3ZZNA 3RFCA 1TW2A 1YK1A 1YDMA 4RTMA 2K7FA 2J41A 1OROA 4KAAA 1XMPA 5LB4A 1VL5A 5C51B 4RXUA 3A6EA 3ZU5A 4K87A 4EKDA 3DE1X 3FMFA 3G2HA 1I3KA 3QVGB 1A4IA 4XM1A 1JHUA 5ARCA 3LLMA 2HK9A 3N2IA 4F2PA 2Z5FA 5KREA 2AR9A 3MBOA 1F8XA 1KEWA 3EIUA 4CR6A 3GRKA 3N75A 3ZDQA 4ON9A 2Z2JA 3FZEA 4IFTA 4RZUA 2JFPA 4YRJA 3PYMA 3TN7A 1JZTA 1YB5A 1C1XA 1DC7A 1G7RA 3GN2A 4R1LA 4B17A 4EI2A 4C22A 1E2HA 1X94A 2J67A 3L6EA 4QDOA 4AROA 2Q3MA 3ESQA 5C46F 5CCEA 2BHSA 4RJ2A 1EE9A 1V26A 5H1YA 3DOJA 1DRWA 1JNYA 4KRGA 4NATA 1FEZA 3O90A 4LWOA 4XD2A 2F1IA 3VPFA 4LHXA 3RYCB 1PX0A 4IJMA 2P65A 1LPBB 1T0UA 3VZBA 4HD8A 3B1VA 4ZAFA 2W70A 4U02A 4YUWA 5HOEA 4Y2GA 1Y3HA 2ZS8A 4XX0A 1ZK4A 2H4ZA 4R98A 3WB0A 4N3BA 5FBVB 1Y9AA 4ZCQA 2Y93A 3N07A 2F48A 3S1AB 5GOTA 2NU7A 1KMQA 1M1ZA 1OZHA 2DZDA 2QN2A 3LQQA 5HCUA 4JLVA 1NUAA 1NPTO 1XZQA 5ESRA 5IABA 1KAEA 2IXEA 5LQSA 3QE0A 1UP7A 1J8VA 1UK9A 2GBCA 2QWXA 2W2TA 4CJXA 3S68A 1L8QA 1PL6A 1JG6A 3U17A 3WKEA 4DADA 2ZYRA 2QN9A 3V46A 4KU4A 2XCSB 1E69A 1NN3A 2J7PD 3NO4A 3W2TA 1L5MA 4NBTA 2B37A 1FUKA 1KSJA 1VHQA 4MP3A 5ITVA 1ZMRA 4O1HA 4YA6A 5TXGA 3OOWA 5CJ2A 1LJ8A 1MVLA 3QOYA 4P36A 3TJRA 3N2ZB 1JQJC 4QUAA 1BEUB 1X1SA 2AOVA 4Q9JA 4KWCA 2R68A 2BFOA 2JIQA 5A5EA 4OP3A 3HK2A 1XCPA 2YN4A 4ALIA 2NP7A 5KX5F 3DKVA 2RB5A 1MORA 4X66B 2XRMA 2AI3A 5LFAA 1LW6E 4FEYA 4RACA 4W9MC 4BNDB 1QYCA 3TZCA 1WG8A 3CB2A 5K0BA 1MX3A 1KNXA 4YAIA 1GQSA 4Z54A 4W5JA 3TIGA 3N6RA 1GKLA 2DPGA 1M6NA 2HI0A 2WMNB 4OHRA 1UFQA 1UWKA 4W9NC 2BVNA 4PFKA 2GRUA 3MN1A 1KYZA 2BJHA 1M2OB 1LVHA 2D59A 2W0SA 2BUBA 1EFCA 1I3MA 1KMCA 1DLJA 1R6DA 2EBFX 2GS9A 2HCTA 1DG9A 4I6GA 4LBWA 1VLMA 4YRKA 1ILEA 1R0SA 3TQSA 4PLHA 3H42B 3OESA 1JBKA 2RGCA 5BYJA 1DC4A 1S2NA 5BXYA 1C9NA 1A82A 3B6ZA 1G8MA 4BVKA 1MAHA 1JEQB 2FK7A 5BMVF 3CPHA 5PNTA 1U0EA 2BCGY 1NJ8A 3VSAA 2GVDC 4S0XA 3HKBB 3SYLA 1M7GA 1EINA 2ZJ0A 3JVIA 5KVAA 1BWQA 5F1OA 1F0PA 3H6KA 5DI3B 4DVGA 3RIMA 2AK2A 5DYTA 2FPXA 3PGA1 4DQKA 3AJEA 3K70C 1OH6A 1P5FA 3QXHA 5GJWC 5C7IO 1PJCA 1RQLA 5CHEA 4KNYA 4B3GA 3LCCA 4I4TA 2CNLA 1DAHA 3KWLA 3DTVD 1NRIA 1LI4A 1O08A 4FX2A 4ZFNA 5A04A 1E3QA 5KOIA 4DAOA 1BXRB 1VHWA 4F5WA 3VDRA 4ZZ1A 2Q2OA 3GMTA 2J4CA 3I92A 2R1TB 3ASUA 4OBEA 2IXFA 4CNBA 4RGVA 4IXNA 3N1UA 4XAQA 3DB1A 4F5YA 3GT3A 1Q1BA 4EATA 2AV6A 1A77A 1FE8A 3A6LA 2X86A 2HSGA 1EAMA 1GFZA 1M2FA 2HDNB 3E3LA 3GDGA 4IVRA 4CGZA 3B5EA 3G2PA 4MJ3A 3L8MA 1FRFS 4JBNA 3D3WA 5I9MA 3S55A 3UKJA 3V1YA 2G1UA 1J0DA 3JTEA 1MOZA 4BHTA 2CV0A 1UOQA 3T5GA 3PUZA 1LXCA 4BEBA 3EULA 4UM7A 2ZEJA 3BSFA 1N4DA 1A96A 3FN4A 3N59A 4XM0A 2Q4RA 3T34A 2EXXA 3E7WA 3W9YA 5JYCA 2ZRMA 3DE2X 5D7NA 3FWYA 3MK31 4EUKA 2F1RA 4RXTA 1H4SA 3R7NA 4PYJA 3AJAA 3HJTA 4FMCB 3TX6A 5KYWA 4PF1A 2I67A 1Z6XA 4CMBA 4EY4A 1XZPA 2XAAA 4TXHA 3IP6A 4TRRA 3MINA 3K1AB 2C61A 1CNFA 1HLGA 3GLUA 4GLFA 4UZFA 5DCLA 3GHHA 3EE6A 1XTJA 3QW2A 5ECWA 3THYB 2YZ7A 3PX2A 4MR7A 3EJ6A 1GZ4A 7MHTA 4G8JA 3L01A 4TWBA 5E1MA 5IC6A 1W5SA 2CLSA 3K9GA 1SVMA 4BV3A 4EDHA 3OU7A 1C8LA 2G4LA 5EQTA 2YJNA 1KO4A 2G8NA 3U4IA 4KHPB 1V9CA 3KE9A 1XFAA 3FZQA 5EOVA 4YO7A 2EFGA 2O1XA 4M1EA 3L7DA 4Y6RA 4EMSA 3LXRA 3KKQA 3WWDA 3I04A 4D4GA 4TXJA 3GAMA 1TXGA 1KTVA 2OZVA 1II9A 1FDTA 2OCYC 2B5VA 2OBXA 1S9HA 3E5NA 1IAQA 2QD4A 3LQ1A 3FVRA 1L5FA 1NVFA 3KRTA 5EGSA 2AH5A 3ROKA 1EU1A 3FI0A 4EP1A 1N32B 1W5FA 3H9JA 2OPHA 4DV1B 3BH0A 2DAPA 1ZNQO 4YT5A 3KJFA 1GXSB 4RVHA 1F0KA 4E5DA 1KI1A 4N0DA 3GEPA 1H2RS 1CG6A 2GB4A 3DLPX 2IUEA 3ETNA 3F0TA 4MTLA 1L5OA 2LW7A 4LOKA 3SZRA 4F8YA 1W36B 3ENKA 4OPMA 1J33A 1V5WA 5EEHA 1ORRA 1BRMA 4A2PA 5SY6A 2YQZA 4PLGA 2RGXA 1RBYA 2IZ1A 3CUEF 4NU5A 2RHLA 4MR7B 2PZGA 4LYFA 5K5EA 5EI5A 4TN5A 3F6CA 1O8BA 1GT6A 1U7ZA 3AESB 2ZJZA 4AJKA 1U0TA 1XDBA 4J0JA 3F49S 4ECAA 5IM4F 1SB9A 1B3RA 1YR6A 2F55A 4W5HA 4AW9A 1VI6A 3ROZA 4EYEA 1DWOA 3H1GA 4JJGA 4QHYA 3GGGA 3UC9A 5BP7A 7REQB 2I33A 4KIGA 2NZYA 5IYZA 2HA3A 1A3CA 3BE5A 1YDGA 1LDYA 1QIMA 4IEIA 1NOKA 3R77A 5TMDA 2A0UA 3STVA 3WKAA 4BXOB 2ATEA 2FZVA 2B99A 3CPSA 5F5NA 4Q48A 2RE8A 3F7OA 4IBOA 4RKRA 3TLMA 3NFRA 2Y1KA 3AR4A 2QOEA 4K86A 4CV3A 2XRZA 1J2EA 1VSTA 2I66A 2QJTA 3EZ2A 3L7YA 1Z36A 4HPJB 4HMQA 4E4YA 2VA8A 3EOZA 3NQ41 2GZRA 4PXYA 1DBWA 2JIZA 3PNKA 5THKA 1KJIA 3MWJA 1N57A 5FRDA 1Z82A 4CMEC 1M6VB 3ZE0B 3PNBA 3ANSA 3UHPA 1OX4A 1KK2A 2D7JA 2FAXA 1QTIA 3R5SA 4X94A 4EUFA 1ND5A 1AUOA 3TLKA 1XKTA 2BR4A 3HY4A 1YS9A 5CVEA 5FWAA 5B1EA 2CHUA 1JA1A 3DWIA 2KI5A 1ISRA 4KDCA 4Q1EA 4O02B 1COWD 4RDIA 1SU8A 3P8ZA 4HLDA 3PC7A 4UBOA 5CXSA 1DEHA 5ENZA 1W9MA 1A7UA 2ZSDA 5EWMB 4AX4A 4XUEA 1HDOA 4DMHA 1QSGA 3DNPA 4RJTA 3N5CA 4TRMA 4BUJA 4ZRMA 1BW9B 2M9MA 4GOLD 3GJQA 1S8AA 3NC0C 5COQA 1W2WB 2IEDA 4FI3C 4A10A 4DJDC 2WVAA 2FW8A 3BGVA 3N2KB 1UBSB 3IP3A 3N8IA 2OWEA 5I7AA 1QPZA 4INZA 4IIVA 2RAUA 1R9JA 4H7KA 4A8JB 9MHTA 3VR5H 1FS6A 5HCNA 3VKWA 1YRBA 1ZK3A 2VYND 3OIDA 4GDMA 4UNSA 3DM9B 3O95A 1T3HA 3O4FA 4B4VA 1M2NA 3IA7A 4E94A 1IBLB 1YTLA 2FVXA 2YZ2A 3JQPA 4LC1A 2XSZA 2OGSA 1IY1A 4MXDA 2VJMB 1PQPA 3Q85A 4B71A 4E6PA 5HMMA 2P41A 3A0RB 5CVUA 2OBBA 4BAGA 1J4AA 1YZYA 1BMFD 5EXEA 4ARVA 1IK6A 3CEAA 2Z8YA 2GPBA 3PPYA 4U0JA 2DCUA 2RAFA 3WRYC 3FGNA 1I9GA 2C9ZA 2JAUA 3A06A 3OLXA 4JI8B 3TEMA 5C32A 3QKSB 4FM9A 4GKJB 1IG3A 4ZTBA 2HT1A 4RZQA 4JITA 1X1AA 3VR6D 2EIXA 2G5CA 1PYGA 5KNCA 2YVUA 1SCAA 1F60A 3IOMA 1G21B 2E4WA 5A4MS 5B6IA 3LY5A 3ONVA 4G41A 4LV5B 3MHTA 3LXXA 2JFBA 3PK0A 1V1RB 5ALRA 3GZNA 1N92A 3DZCA 4QUBA 5TC4A 3EDMA 2PNJA 2G3YA 1CUUA 1SXJA 2C2WA 2XTNA 3DAPA 3KZKA 4M36A 4U6SA 4X3OA 2DUWA 1P5JA 2PUFA 2NXCA 3VR4H 3BZUA 4D97A 4Z49A 1FDOA 3V8VA 3QU2A 1S8NA 1KHHA 4P32A 4AQ7A 1QQBA 4RTPA 2V97A 3CX7A 1Y80A 2CUNA 1TUGA 1ZESA 2FPSA 2H1LA 3GBPA 5IMSA 5IYZB 2ZM6B 2VHTA 5FJJA 4YT8A 5K51A 4RTJA 3NCTA 3K8QA 2V6BA 1E4EB 2VH5R 5LWHA 3JQ9C 1EFVA 2VPIA 4BVHA 1U9ZA 2NVWA 3LZDA 1C80A 3W5JA 1X7ZB 3WLAA 2Q0QA 3T3HA 4AP6A 1CYEA 3CB4A 3FHOA 3EHEA 3MCAA 4J07A 3FVTA 4RK0A 1UWCA 4ZRDA 1LQTA 1UBCA 1WSWA 1A7KA 2W6QA 3OOSA 3U3ZA 4CG0A 4DV7B 1QR2A 9GPBA 3AVYA 3KR9A 1IFXA 3PHBE 1WY7A 1Q92A 4BFTA 5TPZD 1KEPA 3BG5A 4XR9A 4WOPA 1Z6AA 3N3BC 2NV6A 1QHFA 1L7QA 2QQ0A 3NASA 5EUCA 5EMMA 1VPWA 3RPEA 3PD1A 2EC5A 1GKKA 2B1IA 2E6KA 4JKOA 4D45A 2JK0A 3A1TA 1SXPA 1M54A 1MFZA 2WR8A 1HDCA 5E2IA 4BUZA 1Z62A 2JHPA 4MUIA 1DP4A 3SPXA 2GYYA 1PZHA 2EJUA 3M3PA 4CL2A 4OA5A 4ZT2A 1ZIPA 2B1RA 3BQMB 2A0YA 1Y3DE 4PG7A 3IPYA 4KREA 1IJFA 2WLTA 4LXXA 1CX9B 5SYAA 3ESXA 2Y4OA 3RTGA 2ZRPA 3KAPA 1CRQA 1EGVB 1GPDG 2WFZA 4OJYA 5L6LB 3CF4G 4LJLA 2XQIA 2BUCA 1YBMA 1Z7EA 3NHUA 5AKHA 4ARBA 4KWIA 1PJLA 4R7ZA 3DONA 2FUNB 2BKAA 4C29A 3QU4A 5M5BA 3BULA 2H4YA 4Z1MD 3GLGA 2I7TA 4MV7A 1CU1A 4GKKB 4NOMA 2L82A 1JPJA 2ZZNA 2I91A 3V6MA 2E82A 4NJEA 2OCLA 3GY0A 3EXAA 4X20A 4N47A 4WKGA 4D99A 4CLXA 2F8TA 3LDGA 3NYIA 1UPUA 4XR4A 3ZE2B 1RWBA 1WLSA 4H7IA 4RF3A 4JR0A 2OKCA 4XRGA 1SUFA 4RORA 1BVHA 4XWYA 5TMBA 4D81A 1T5SA 2ID8A 4HB3A 4EKYA 3GIWA 3NTUA 4C76A 4L6CA 5CH3A 1XCGB 3ZE8A 2IYTA 2PSSA 1D6JA 4S1WA 2CBZA 2XVXA 3B6EA 3HP4A 4V3BA 4QKQA 1IHOA 1KYTA 1JEEA 1QE0A 2CNNA 3HADA 4FYYA 4ZVRA 1V8FA 1UC4B 4DQ0A 3E82A 3H0EA 3OPXA 4X6UA 1J25A 3DNFA 3QEBZ 1WMAA 1B2RA 1JLSA 3H8WA 1MEJA 4NBNA 5FEMA 1JVBA 4PQFA 1NW6A 3T6KA 2JFFA 3NBMA 3VC1A 4YCNA 3UMYA 3DEYX 2JAOA 4YCSA 2OBLA 5IFKA 2EKBA 4K9LA 2GBLC 3G3EA 3SEAA 1UXGA 4MB0A 1TJYA 1MPTA 2JJQA 2VOEA 3H11B 4FT4A 3NGXA 1S0UA 4JLAA 3AR6A 1ZJJA 1LLDA 4RTOA 2W4QA 3T7TA 3BRQA 3MT7A 4IKPA 1PVOA 3MJHA 5HJ2A 4J0GA 5IFLA 2WSLA 4BLOA 2QK4A 3PJGA 4J75A 4LWPA 1DAKA 3GDFA 4DYHA 4E14A 1KU6A 4RIIA 5B36A 1DBSA 2C9CA 1Z2PX 4MQ6A 1NAIA 2PX4A 4IFEA 1ITZA 3BE8A 2HFKA 2IYRA 5AOAA 2PZKA 3I4LA 1AUPA 2PKRA 3OE5A 4J0IA 5BWBA 3NT4A 1KKUA 5HUHA 3FUWA 1UH5A 2JGAA 2ZRBA 2DFTA 4OREX 2Z58A 3JY6A 3K1ZA 1MQAA 1TYBE 4QYSA 3WLMA 5JI3E 2ZIEA 3M82A 1VYVA 1T8PA 3I0NA 4JBHA 3D2BA 5IEJA 4K0KB 4R9UC 3AEXA 1DJMA 2GO1A 4JBGA 3WLHA 1R5BA 3ZVRA 4D4MA 2D2EA 2ZB7A 5FPSA 2IXTA 1UQTA 5J9FA 2FRVA 3VKGA 1ECCA 4M46A 2Y6UA 3AJRA 3NEYA 3IIMA 4EAAA 5AKLA 3PNLA 4QWMA 5DBIA 4B43A 5A3RA 5C81A 5I7RA 3EFOB 5F1PA 3TMYA 3NC4A 5KYUB 3HR4A 1JECA 4HGZA 4EJ2A 3KBBA 2OAP1 3KKMA 4D96A 2JJMA 1FX1A 3D3KA 1CWUA 2E5WA 3NANA 4E31A 1J70A 2I2DA 1BHSA 2W6IA 3IA2A 5EXSA 4BVFA 4QM6A 4DSNA 2GJKA 4M8NE 3TECE 2BFBB 3FVQA 4HNSA 3TAUA 3PQ3A 1ZGCA 4G37A 2IOYA 2Z43A 1CY8A 4YFVA 5B58T 3OZWA 4PGFA 1W2HA 4WN9B 4DQUA 4DCCA 3TTTA 5HVNA 2GD2A 3GOHA 1QE3A 2SHKA 2DQSA 2NWQA 1K97A 3EN0A 3LC7O 4JV5B 3QVSA 1IZZA 5HRAA 3L7LA 1R18A 3MPUA 3PNMA 2OFFA 4A6PA 5J5AA 4C0LA 4CMGA 4UVGA 4HV4A 4KYUA 2AMJA 3G13A 1JL3A 4G2NA 1OWMA 5C1OA 3CBQA 4BLVA 1MV5A 4IIHA 1F9AA 4JUFA 3CA8A 3VU9B 1F5NA 1JGTA 2I55A 5BOSB 2BW0A 1BW9A 3U60B 4YCLA 1Y48E 4L8VA 4OQLA 4ENQA 4H17A 1E6CA 1RFGE 2HJRA 3BORA 4YI3A 2QG9A 2DXIA 1J5PA 1P0PA 3LH5A 4PQEA 4ZKEA 4PR3A 5SYNA 1QH1B 4QBTA 2R60A 4BLRA 5AK5A 4HAXA 4OSOA 4KQXA 3RF6A 3ON5A 3DAFA 5J2TF 3ULKA 1PCXA 5J3JA 1DAOA 4DA8A 2GZAA 3K9CA 5KTOA 3HP1A 2A5LA 4M9XA 1KQGA 3TLJA 3ZY5A 3ABOB 4N7JA 2BGUA 2QD3A 2I1QA 1Q7RA 1ZZGA 2WI8A 4IEFB 4FNGA 4RDCA 3T61A 2M6LA 3ZGVA 4EPYA 5A4DA 4ZA2A 1MGPA 4CF5A 4CGYA 2LCFA 3R9XB 3VTKA 1V4BA 2JRLA 1GUFA 1NI3A 3W5HA 1IXRC 1ZWKA 1DCKA 2O2DA 4HGYA 3WHKA 4KAJA 5B7QA 1MXHA 3UKOA 1LBQA 4JMLA 4B6OA 5G02A 2XWJI 4JYBA 5SYMA 3SWWA 1OTHA 3G7UA 1OXTA 4CIBA 1YU9A 1ABEA 3VYTB 3AUXA 3P9QA 4HB0A 1IEVA 3SVTA 5FOTA 2QTLA 2WVHA 4WOJA 5L7YA 2QMUA 1HDXA 2QGFA 5DHAA 1GGVA 1FTQA 1WKBA 2VHZA 3BN3A 2CDRA 3TNJA 2O5EA 5DLEA 3RASA 2R48A 4DA4A 1ZN2A 2EL7A 1PO7A 2HJVA 2NUPB 3H6GA 4LE1A 1V5IA 1MAUA 3O3NB 1JR4A 3BMQB 3H9EO 2ONCA 3LP8A 1S4QA 3F6PA 4HB4A 4EHIA 1OH8A 2QGNA 4V0KA 1KO5A 2R1VB 2VP5A 1KJWA 1RVV1 4KIFA 3QEMB 3QY9A 4REQB 3P5BA 2JG3A 4DKJA 1ISGA 1V6CA 3E58A 2Z1NA 3KZMA 4Q9DA 3IVXA 1C7IA 1N3IA 3M3DA 5LMZA 3RJ5A 3TUZC 4V03A 1T3GA 2KLBA 3PKJA 3T3MB 4WLNA 1W36C 2QZSA 5FAKA 2Y27A 4B75A 2HQOA 1R4AA 4OB6A 3W2HA 1FOEB 2HK7A 4BMCA 3L82B 1XZNA 2RONA 3LKBA 1ATZA 3UCFA 4B7XA 1ODSA 3L0YA 2FZGA 1NUQA 2ZI3A 2B9VA 4IGFA 3NFYA 1I2CA 4QFDA 1SKYE 5FDFA 3EVCA 4FOOA 2QRVB 4GNRA 1QX4A 1QV9A 2N1MA 4KR2A 3EVEA 3OPMA 1DC5A 2CDBA 2BR5A 5DKFA 2VS1A 5E8JA 3SKYA 4WLUA 1G2PA 1E2MA 4XASA 3GAZA 3UXHA 4A0QA 4ZYXA 1D7AA 2JFQA 5C5DA 4JKYA 3RS5A 3RSGA 4N9QA 2Y0BA 1T6BY 3FSGD 4RS3A 1L5LA 2RHDA 1HSZA 2DLCX 4BZWA 1C3XA 4G1CA 1KJJA 3ORHA 1YFZA 2PRJA 5IAOA 1VFPA 5EERA 2WHPA 2P79A 3RRXA 1PEYA 2HCRA 4CEJA 4OJKA 1JVSA 2FRDC 4H1WA 4ZN6A 1ZM4A 1Y7LA 4QSMA 2Z2YA 1IBSA 1V16B 1W85B 3TG8A 2RGAA 5D5QA 2AG0A 2EKQA 1NTOA 4OX9B 1WHSA 3ENQA 4L5AA 3NBZC 3ESDA 4FMDB 4HADA 3U4HA 5BURA 4WKNA 1NC1A 2HA4A 4BMXA 1CUCA 3WWPA 1EWYA 1THTA 4FEEA 4IGKA 1NF8A 1SN7A 5BR1A 1E2UA 3D8BA 4R4JA 4DMGA 1GFWA 1TA4A 4J16A 4ASUD 4HDOB 2P30A 1V5EA 2YOGA 4YMVA 1TU0A 1ISMA 4CF3A 4IGIA 1WZIA 3TQHA 4KR6A 3K9QO 4CUJA 5F3WB 2UYQA 3MGBA 2OXCA 3L7IA 5KWJA 3DBIA 1XA0A 2IYSA 3FUTA 1G3UA 2Z56A 4P2BA 1GGKA 2XBUA 5T57A 3U62A 4F4HA 4YJDA 2JAXA 4B4DA 2IRWA 1T5HX 2EIHA 3HE3A 5AJUA 1C9DB 5H9WA 4G63A 1T5OA 1VL6A 4BBPA 2ZAMA 5JFTA 1WULS 5AK0A 2CV1A 1W5BA 5DNCA 4JLKA 5CG1A 1ZCBA 3HXMA 2R2GA 2XMSA 4R69A 3KJEA 4NDZA 1OH7A 2AD1A 3I6IA 4TQAA 1LSUA 3KXIA 3L4BC 2JVKA 2ZIAA 4Q5IA 2FEPA 4JOCA 4DCMA 1JJVA 3ELDA 2X0KA 3FMVA 3PRKE 4WKCA 5IASA 2QW1A 4FFBB 1O97C 3ICPA <