1PZEA

T.gondii ldh1 apo form
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
326
structure length
323
Chain Sequence
PALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMCEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Toxoplasma gondii LDH1: Active-Site Differences from Human Lactate Dehydrogenases and the Structural Basis for Efficient APAD+ Use.
pubmed rcsb
source organism Toxoplasma gondii
molecule tags Oxidoreductase
molecule keywords lactate dehydrogenase
total genus 112
structure length 323
sequence length 326
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2003-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pzeA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1pzeA02
3KYDB 3OJEA 1LI4A 2DAPA 4HWKA 3D3EA 5JAMA 1YB5A 1QG6A 5GY7A 2X8LA 4JLWA 2PKQP 1L1FA 4CMHA 3DAFA 3F9IA 1K6JA 3ROPA 4BB5A 4ILKA 1HLDA 5JDCA 1YDWA 4LGVA 1PZGA 4Y67A 2NADA 4HADA 4IMRA 3GVCA 3RJ5A 5L53A 1Z73A 3DO5A 1QLHA 1SPXA 1SEVA 4IGEA 4DPKA 5IZ4A 5EQDA 2DM6A 1DFIA 1R0SA 3PYMA 3U4DA 3PTZA 1PS8A 3H6KA 4FIZA 4ITUA 3ENKA 2EERA 2FSVA 3DZJA 3ZH2A 1EE9A 5C3MA 5IXSA 2G5CA 3PQDA 5DCUA 2AE2A 5KJFA 4Z9FA 1N7GA 4L4XA 3WMXA 4E2YA 1HYHA 4YRDA 3LF1A 1B15A 1PL8A 2X9NA 1DOHA 1TB4A 3S2FA 3Q3CA 3FI9A 1B8UA 5THKA 4BNGA 1SOVA 3UH1A 4HFNA 1KVTA 3K8ZA 4U0JA 4BUCA 3F4LA 3Q6IA 4WECA 4M54A 1ONNA 3DL2A 1XEAA 4DIFA 3AI1A 1RJWA 4PLPA 3PRJA 1EBUA 3H8VA 2PV7A 3FN4A 4MKRA 5IDXA 4WLNA 3F3SA 1E3LA 4PG4A 2Q4BA 3EAGA 3QSGA 2HCTA 4FR5A 2J8ZA 4XQEA 3KXDA 1P45A 3HQ4O 3EK2A 4EJ6A 1ML3A 3ONEA 5CDUA 1IZ0A 2HRZA 4J16A 1GU7A 2E37A 2IZ0A 2QZ9A 2EP7A 3GAZA 1XA0A 4YT8A 3PJEA 5L4NA 1R15A 1JWBB 4QT0A 5IZCC 3DBLA 3HNPA 3HN7A 2BHLA 1K6XA 4LSMA 2AW5A 1P0FA 2VUTA 1KY4A 1MV8A 4M8SA 4MVJI 3H5AA 1YL7A 1WDLA 3HSKA 2HAEA 3RUEA 1SC6A 5CFZA 2YHUA 4PLYA 3E6AA 4Z6KA 2G76A 3DXFA 1GPJA 5A02A 3ZNOA 1C0PA 3H2SA 4J3FA 1GV1A 4YACA 4LMRA 4CR6A 1WVGA 2PKRA 1IL0A 3TZ6A 3GQVA 3HDHA 5EQFA 1O5IA 1NPYA 2P9EA 3WGTA 3I4FA 2GZ3A 4TWRA 3DZFA 2GDZA 4MVJF 1Z74A 1I3KA 4PZDA 2I6TA 5BQFA 1UZMA 3MTGA 3AFNA 3NDJA 3NDIA 1KOLA 4JJIA 3TZHA 3OH8A 2WD7B 3RQSA 4I9UA 2XF8A 4UAGA 1A72A 3U49A 4R4JA 1OBFO 1MB4A 3A9WA 2VT3A 3C1AA 3DZIA 3L4SO 3PYLA 4NG5A 4WPGA 3RC9A 2JD0A 2BFOA 1T1SA 3EVTA 1A9YA 2X0RA 3F47A 2Z95A 4FFLA 1UR5A 3I9LA 3KV3O 4NJMA 4TSKA 4A73A 1EK6A 1HE4A 1HDRA 1V3VA 5KCZA 3RKUA 3HB5X 3GMSA 4NBWA 3QWIA 3GY0A 4HY3A 4CMEC 1FXSA 1NR7A 3FBGA 4UUNA 1O89A 4EJMA 3QY9A 1MP0A 1PIWA 5AXDA 3OM9A 2VWQA 4KWHA 1EVZA 3HFSA 4FGWA 5IDYA 4CMCA 1ZO8A 2X58A 2VNAA 2X86A 2NLOA 3FF4A 2YV1A 1ISGA 4YAEA 5JW6A 4BNMA 4CQMD 3AFMA 1JA9A 4ZQGA 4TRJA 1VM6A 2YFHA 4BNXA 1CETA 2QZZA 4CUZA 1HDOA 1SZJG 4L76A 1XGKA 2GERA 2ZYAA 4YAJA 2V6MA 2HMVA 2AG5A 1R4MA 2F00A 2AXQA 2P68A 4ZU3A 2X9VA 1DIRA 2FR8A 4KQWA 1EZ4A 3PHLA 4B7XA 2C54A 4B4VA 4XGKA 2O7QA 4IMPA 4MIYA 3TZKA 3DR3A 2PR2A 3VTFA 1ADGA 2HJSA 5FFFA 1H6DA 2DBZA 3D7LA 3NAQA 1CWUA 3ADOA 1LSUA 5GZ1A 1R16A 1GY8A 1IZ9A 1H94A 2EXXA 2IYPA 3ZWXA 2X23A 4B4OA 1PJ4A 1NNUA 4EYEA 2QYSA 4W7HA 1R4NA 2UYYA 2B4TO 4ALKA 2HJRA 1U1IA 5KJEA 2Q46A 4PZEA 1HETA 3I52A 4GX0A 3K6JA 4YJDA 3W8DA 1HKUA 2C7GA 3TPCA 1E3WB 3JQ8B 4A27A 1X1EA 2I9PA 5G4KB 1OC4A 4IS2A 5T57A 2VHXA 4MOWA 4B3IA 1IHXA 4NIMA 3E82A 3TDKA 1GQ2A 3TOXA 3FTNA 4PLHA 4D43A 1WDMA 3GPIA 4CLRA 1CEQA 2WJPA 2GF2A 8LDHA 2OBYA 4M89A 1UP4A 2WD7A 1OZAA 4YJHA 3G79A 3WGHA 1EFKA 4XWYA 4CLXA 3KLPX 2ZKLA 3ON5A 1B3RA 2HMTA 3OECA 3O9ZA 4XGNA 4I5EA 2D59A 4NR0A 5F1PA 3FR8A 1MXHA 2W90A 5CDYA 1NXQA 1VL6A 1YS4A 3WX0A 2FZEA 1X15A 4IDDA 4AJEA 1UP7A 1YQGA 3KOUA 3WR5A 5EINA 1CIVA 1P9LA 1KVQA 3JQEA 2OL4A 5AOVA 3RFXA 4Q3CA 5TGDA 2GR9A 4RVUA 3D1LA 4CM1A 1ZXLA 4ALMA 4CMIA 2NSDA 2VYVD 2EW8A 2FPIA 2OO5A 4KQXA 3OJFA 3UVEA 2X4GA 5DN9A 3KSDO 1DIGA 3S1LA 3NJ8A 4TVOA 4TVBA 5HWSA 5KWEA 4GKVA 4PG6A 2DQ4A 3EZLA 4DVJA 4CMAA 4Z9YA 4A5OA 3K31A 4FPXA 3I6QA 5DBGA 3K92A 2CVOA 1BDBA 1ENOA 5B4TA 2IEBA 3D5TA 3I23A 1R4MB 4AJHA 2I65A 4ALJA 3F5SA 2VYND 1O95A 1VPDA 4J1NA 2GNAA 2I76A 3L6OO 1G0OA 1M75A 4IIUA 1EVIA 2ZTUA 1JKFA 1UP6A 2V65A 4OAQA 2IYOA 2V7PA 3E9QA 3W1VA 5BNFA 4WCFB 2NU7A 1LSSA 4JNKA 1DDOA 2EHDA 4EI2A 3O8QA 1XSEA 3G49A 3SLKA 3GGGA 5HS6A 1LUAA 2O7SA 2EKLA 4BNZA 1ZK3A 2G17A 4J1QA 2I67A 3X2FA 2Y0CA 3I5MA 1S7CA 4M55A 1P33A 4IJWA 4BIIA 3I4CA 2VTEA 4EBFA 2BMAA 4UREA 3JYQA 4DYVA 3KLMX 3RC7A 4IDBA 3FHLA 1HDYA 1T2AA 3PIIA 4M87A 1NVGA 4BNIA 1IUKA 1KEWA 4GQAA 2PGLA 4XR4A 4R3NA 3DBRA 4XA8A 4DLAA 3GDFA 1SO8A 4MP6A 4TRRA 2E4AA 4LRTB 4XZ3A 4BNYA 3PHGA 2D2IA 2SCUA 2NU6A 3W8EA 2PZKA 1FJHA 3U4IA 4M49A 5AXAA 3VHRA 3TSCA 2D4AA 2OBNA 3U5TA 4GX5A 3D3WB 2F1KA 3QRWA 3O26A 4EEZA 4GLOA 4N54A 1XQ6A 3H3FA 3BMOA 1EVJA 3SJUA 3PWSA 3WS7A 1Z7BA 4JXKA 3WQQA 1M76A 5HA5A 1ZMOA 1DLJA 1QXSA 2DU8A 2E49A 2ZJ0A 1E1LA 3QWAA 4W4TA 1ZJYA 5L4SA 1LX6A 2UDPA 3DHNA 4LW8A 1PR3A 1KY5A 1UZLA 4BO4A 2Y67A 4II2A 4QFCA 3AUTA 1UXGA 3R3SA 2FP4A 1RM0A 4KTTE 3T4XA 2W98A 4YJGA 2EP5A 3OF2A 3W4JA 3GRPA 1YB1A 2BGLA 3OJ0A 4G65A 4NH4A 3S55A 4YT5A 2IRWA 4H3VA 4WGGA 3C1OA 1IYZA 1E6EA 4XKJA 2X0NA 5CP8A 2Y68A 4N5MA 3DEYX 2O2SA 3TFOA 5KVCA 1C1XA 1XR3A 2R6JA 4DC0A 1H0KA 3NT4A 2C2XA 1E1MA 2AEFA 1NHGA 1YE3A 1ADBA 2GN4A 3GUCA 1LNQA 5FYDA 1A5ZA 1BDMA 4HNGA 1KEVA 3ZWPA 4TRMA 4D0RA 4D79A 1LTHR 3JV7A 1NBOA 3M1LA 3WIEA 2PZJA 1PWXA 1ZK4A 3DBLB 5TQVA 4YYZA 1DJNA 1NQTA 4B4UA 1N1GA 3WG9A 1Q0LA 4A26A 1YBMA 3VOSA 5KIAA 4GGOA 4BVAA 2WE7A 1JU9A 1ULUA 2CUKA 2BELA 3OQ1A 3BHJA 2J3HA 2Q45A 3HG7A 3UKOA 1ID1A 4RVGA 1E3SA 1GTMA 3LLSA 5DZSA 3X2EA 2EGGA 4W6ZA 5F21A 5ENVA 3TZCA 4BMVA 2P9CA 2W2KA 4CV3A 4AL4A 4AJOA 3KRTA 2G0TA 2C5AA 4CMBA 4MPDA 4AG3A 3GZNA 3PWKA 4BO2A 3WBFA 2O3SA 3SXPA 1MUUA 3A1NA 3NTRA 4KDFA 5KKCA 1HE2A 3H5NA 4J4HA 4JGBA 2O23A 4OOFA 3I6IA 3I1JA 2RBEA 4OM8A 1AN9A 2NM0A 4C4OA 4L9RA 1ULSA 1D1SA 4WNIA 4CUKA 4WKGA 4O6VA 4OXNA 4EUFA 5JDIA 3G3EA 3GDOA 3WBBA 4Y6SA 3IIEA 4A03A 2P4HX 3V1UA 3H5RA 2EJVA 2E48A 4RQTA 3P2YA 1DJQA 2CD9A 3CMCO 2R00C 1A4IA 3LC1O 1JTVA 4FW8A 1FDSA 1PL6A 1HDZA 1I24A 2JHGA 1P1IA 3FPLA 5BSFA 1XDWA 4R1UA 3PP8A 1HSOA 4TKMA 4ND1A 2PD4A 2Z5LA 3IP1A 4GLLA 5A05A 4J4BA 3TJRA 1ZSNA 4PVDA 4KP7A 3NKLA 1XCBA 1LU9A 3INRA 3JQBA 1AHHA 1JKIA 1GYRA 4PG7A 5L7TA 3L9WA 5T64A 3D64A 3E9NA 3Q11A 4BO6A 4ZHSA 4CJXA 3IKVA 4IJKA 3SVTA 1GADO 1I33A 3ZZNA 4CQLA 4UEJA 5AVOA 3TNLA 1Q0HA 3WQSB 2W4QA 3RBZA 4A2CA 1C1DB 2HK8A 3OEYA 4UUOA 3OMLA 3KEOA 3JQFA 4EZBA 4RORA 1NFRA 1CERA 3F1KA 4OJNA 1KC3A 1T1RA 3QVOA 5KJ6A 4J49A 3UHAA 3JTMA 1E1KA 3K96A 4L4RA 3KTDA 2ZCUA 3LDHA 1ZIDA 3WLFA 3BMCA 4I08A 4GX2A 3ZNQA 3G1TA 1ZK0A 1VL0A 2HMSA 1HT0A 3CIFA 4J7CA 4BO5A 2IODA 4JP2A 5JS6A 2DPHA 3WJ7A 1N5DA 2CSUA 4WK6A 1LQTA 1F0YA 4KUEA 2J5RA 5GMOA 4YTEA 3RBXA 1E7MA 4PRKA 3VVCA 1WPQA 2EGHA 4KUHA 3PEFA 4B8WA 4IINA 1BXGB 3WOHA 2YUTA 3VH2A 5I7EA 3KHUA 3KSUA 4Q3BA 3OIFA 1UAYA 2RHRA 5IG2A 3KM0A 3BMQB 4YJFA 1A7KA 4K1LA 4EUHA 3W4IA 3STHA 1YXMA 3C7CB 3IAHA 3M2PA 4JN6B 3KETA 1HDGO 4MKXA 2AG8A 3IC5A 5FEUA 1BG6A 1K89A 1T4BA 4MVJM 2VHYA 4R9RA 4XYBA 4CLRB 3INGA 3U62A 4BKRA 4F45A 1E7YA 4RVHA 5BSHA 2NVUA 3EC7A 3NUGA 1VJ1A 2X6TA 2OGUA 3BMCB 4DLBA 4IM7A 4YQYA 1QYCA 4MJLA 5JDCC 3TRIA 2QQ5A 1DO8A 2WYWA 4GSLA 4YT2A 3L9XA 2Y1FA 2FR1A 2VRCA 1Y9AA 3F5QA 4BNVA 2O48X 3ZHYA 1DXYA 4RF5A 1K2WA 3LT1A 1PJLA 1C0KA 3DOJA 4K6CA 3TN7A 1MG5A 3HDYA 1QKIA 3W8FA 1AGNA 1HTBA 3CEAA 2UUOA 1KVUA 2WE8A 2PY6A 2H6EA 1DLIA 1LLDA 3PHIA 2DT5A 1MX3A 4ZGWA 2G1UA 1OFGA 3JQAA 1PEDA 1EEHA 1B0AA 5ICMA 5JY1A 2TMDA 3EVNA 3GEDA 2YYYA 1U3VA 3BAZA 5KOIA 1ZVMA 4N5NA 1H9AA 4GL4A 4MKZA 3N58A 1P77A 2WTBA 5GZ3A 1P44A 1PJQA 2GZ2A 5JAQA 4MVJD 2VQ3A 4RPHA 1UDCA 4MINA 3ENNA 4RF3A 2IZ1A 5F5NA 1I2CA 3DONA 1LDMA 3TF5A 3ETGA 5FI5A 3LC2O 3GF4A 2IE0A 3OA0A 4BO8A 3BXXA 1YWGO 2YQ5A 4U8GA 2EKQA 2ZK7A 1BW9B 4PFJA 4IIVA 3PZRA 2VUSA 4RV9A 1MC4A 1QP8A 5T6BA 2QRLA 1U5AA 1VI2A 3GGPA 5F3RA 2VHWA 1IE3A 4BB6A 2ZB4A 4LMPA 1R0LA 3H9GA 3VDRA 3GMDA 5I8ZA 4A7PA 5L40A 4PIVA 4R16A 3VAZA 1A27A 1R6DA 2OFPA 4IQ8A 1OC2A 3GN2A 2DLDA 4IZHA 4RDHA 4RZIA 2EJWA 1JAYA 2QW8A 4LISA 5FF9A 4X54A 3W4KA 4R3WA 2H63A 4NBTA 5CDGA 4RPJA 3GNTA 4F6LA 4CM6A 1NR1A 3JD0A 4ALNA 2QHXA 1ISIA 1LDEA 2AQHA 2JD2A 1JVSA 5LCXA 1N9GA 1IHYA 4I1IA 3QWBA 4C7KA 3D4OA 4GGPA 1X7GA 4OKNA 4ID9A 5A3JA 1XQ1A 2NVWA 1GEEA 4HFRA 4ZD6A 2YY7A 4O0LA 1Z7EA 1LC0A 1O0SA 1LRJA 4PLTA 4KMSA 2PZLA 4EEXA 3ANMA 4BO3A 2XOXA 2C5EA 2CY0A 4B3HA 1LRKA 1B8VA 3CKYA 3C24A 2RIRA 4UEKA 2A92A 4BO1A 2FZWA 4DMLA 3DWFA 1DIBA 4OOEA 3JD4A 5TSDA 1GYQA 3AWDA 3PIDA 1BHSA 1PQPA 1A71A 2X22A 3MJSA 1E3WA 4N5LA 4PGFA 1H6AA 3Q9UA 4OHUA 4OIMA 4J1SA 5F1KA 2JFGA 1Y5MA 1DAOA 2PD3A 4FCCA 2VNSA 5DNAA 2VTDA 3CUKA 4FN4A 3EHEA 4BL5A 2NWQA 1FK8A 3OFSA 4E5YA 5KVSA 3F46A 2OMEA 3TWOA 1GFSA 3Q9NA 1GUFA 2VYVA 1ZW1A 3LF2A 3GH3A 3UGKA 1IB6A 4U7WA 2DC1A 2Q2QA 1H6BA 4CM8A 3V8BA 2CDBA 5JCXA 1XELA 4GBJA 4IZIA 2FPGA 5IN4A 5DOZA 2HQ1A 5COQA 4D7AA 3T7CA 1T2EA 1QYVA 1GEGA 4FB5A 5DBIA 3ZNPA 3JQ6A 1VL8A 1HZZA 2C2YA 1A7AA 4OQYA 2B69A 3NT2A 5HTOA 3ANNA 4FFPA 3S2GA 4N18A 1I0ZA 1WLYA 2O3UA 1F14A 1LA2A 2Y66A 3WQRA 4C7JA 1J49A 1E0DA 1QV6A 2NACA 4DQUA 1YOVA 3OQ6A 3DAPA 1D4FA 4B4WA 2HO5A 4WLEA 5A1TA 3VPHA 1H6CA 1Y9EA 1WP4A 4LN1A 4PLFA 4CMKA 1K0UA 1M66A 4S3MA 2YV2A 3U0BA 3PI7A 2IDZA 9LDTA 3MWDB 4HBGA 4E3ZA 3AU8A 3OA2A 1PL7A 3WLEA 1HRDA 4BGUA 5IFLA 5KJ1A 2TMGA 1ADFA 1TT5B 1VKOA 4CLDA 4IXTA 1IY8A 1J0XO 4GMGA 1SBYA 4M86A 3GDGA 3AM4A 1D3AA 3PXXA 2HLPA 1TI7A 3MJTA 3RC2A 3H2ZA 2YHIA 4NBUA 1DB3A 4J6FA 1GYPA 1T2FA 4OGWA 1U9JA 5EESA 2GUGA 2UV8A 4RPKA 1T24A 1YKFA 2DTXA 1GR0A 1NM5A 1V8BA 1I5RA 1NHWA 4P4LA 1B26A 2EV9A 4Q3NA 2ZQZA 1LLCA 2CF6A 2O3QA 1ORRA 1GUZA 2D8AA 3IJPA 2D1YA 3BHIA 4Y8VA 3U09A 1RM4A 3W6ZA 4DUPA 3JYNA 4MP3A 1F17A 5EL0A 5JAIA 2OP1A 2NU8A 3EW7A 4LVUA 3M6IA 1QYXA 4HFMA 3DHEA 4RF2A 4H16A 4WLOA 3ADPA 1H2HA 1N1EA 5A5FA 2Q3EA 4DBZA 1CRWG 3QV1A 4I9NA 1RKXA 1U8FO 4IS3A 4R68A 4EDFA 3VZSA 1U28A 2J3IA 2B36A 4R1NA 1PWZA 5CEEA 4YR9A 5G0SA 1YH3A 1FDWA 7MDHA 2JHFA 1RM5A 3D3WA 1YL6A 1LQUA 3BHMA 2V6FA 1GPDG 2UUPA 3BMNA 4CODB 3RASA 3G17A 4FC7A 2W2LA 2FOIA 3ZWMA 2HKIA 2ZCVA 1UAGA 4J9UE 4WOKA 3SLGA 4CV0A 3L07A 4E33A 5G4KA 4UUPA 3ZU3A 1KETA 4Q3EA 3EDMA 5CG1A 1YQXA 3FR7A 1NQOA 1LEHA 1CYDA 3ETDA 5JFOA 1KS9A 2B83A 5DP2A 5B1YA 4IDEA 3DZHA 4I5DA 1DBVO 4U6QA 2PKQO 1ZEJA 3ZHZA 1LBEA 3UAGA 4FOOA 3CXRA 3MTJA 1W8DA 3B70A 3PDJA 2AEJA 1ZK2A 1HZJA 1QLJA 3DFUA 5BT9A 1HSZA 1ENZA 4I9HA 1ZMTA 4XB1A 4ZQHA 3IJRA 3JQBC 5G0VA 4FJ1A 1DAPA 2QX7A 2BI7A 3WFIA 2VZ9A 1I10A 4BQPA 3JQCA 3CINA 4R01A 4D42A 1MXFA 3GVPA 5DOVA 1BVUA 3E5MA 9LDBA 2Q2VA 1EQUA 3WXBA 1UZNA 1O94A 4J43A 4ZRMA 4JROA 4E2ZA 1PZEA 3OHSX 4YRAA 5L7WA 3T4EA 5A03A 4IQ0A 3AW9A 1NVTA 2W2KB 4WCDA 4YB8A 5B4UA 2GYYA 3S2IA 4JBHA 3SX2A 5A9RA 3BA1A 4MDHA 3ZW8A 3AI3A 1CQIA 2PGDA 2YQ4A 1SB8A 4J2HA 4GPD1 4W9NA 1PSDA 3HE3A 1ZNQO 4M1QA 3O38A 2Q1UA 4JK3A 4GVLA 3MCVA 3KYCB 1ISFA 1PJCA 1SNYA 4Y6PA 3D0OA 5G4LA 3MOGA 4CM3A 3JYOA 3ZWNA 5CAEA 3TQHA 4IXWA 1RWBA 3AUUA 2HMUA 4CLOB 5CPBA 4MVJP 1LJ8A 3VH1A 2B4QA 3GLQA 2DBVO 4J9VA 4PZCA 3JQGA 3KB6A 2HDHA 3DTYA 4OO3A 2VWHA 3NGXA 4IPTA 5MGBA 5A3VA 1WXDA 1LLUA 1IULA 3LT4A 1BMDA 3WYEA 1SEPA 3V1TC 1J5PA 2BRUA 3LYLA 2E82A 5EIOA 4QUKA 2XXBA 3QLJA 4ZQFA 1HWYA 3WGZA 4LRSB 5TS3A 3L77A 4NK4A 5KTKA 4RO0A 1H93A 1X13A 1X0XA 4E5KA 4BNJA 4RVFA 3VKUA 4JCOA 5JPIA 3ITDA 1Z75A 3NTQA 1A4UA 2DFDA 5JDIC 4RLSA 1O8CA 3FTPA 1ZZEA 1OMOA 2UAGA 3C7AA 1C1DA 4OSOA 3PQFA 1NASA 2CDCA 4ZRNA 1XIVA 3ETEA 3GAFA 5K6AA 1TT7A 4FFMA 3ONDA 1B16A 2YJZA 4HNHA 1VJ0A 4D3FA 3ZHXA 3I83A 4WOJA 4QSMA 2A9FA 1SCUA 2V6GA 4NI5A 4FC6A 1EE2A 4Z9XA 1GL3A 1Y8RB 2DUWA 1P1JA 1KC1A 3PFFA 3RCBA 4XJSA 4ZQEA 4XGIA 4J2OA 1BWSA 4YRBA 5H81A 3WYCA 1U7HA 1X7HA 2NQ8A 3LK7A 2GPTA 3K5PA 2GN9A 4E30A 3DZBA 4GH5A 1LSOA 3C7DB 1IPFA 3MOIA 1DRWA 3BMQA 4YJFB 3DBRB 1P74A 4DA9A 3BIOA 5DBFA 4DREA 1LLQA 4CM9D 2JKVA 1QV7A 2NNLD 3RIHA 3LC7O 4RDIA 5A06A 2BFAA 1LDNA 5ES3A 1NPTO 1E5QA 1VSVA 5COBA 4QX6A 1T26A 2ZATA 4R9SA 4Z0TA 1NTOA 2EF1A 1AXEA 3A06A 3JD2A 1D8AA 3FD8A 4G5HA 2Y1EA 2VUUA 1WMBA 5ADHA 1R12A 1PJTA 3VZPA 2X9GA 3GEMA 4ROSA 2HU2A 2WSBA 1NAHA 2VRCD 3DAGA 4BGVA 1X0VA 4TZKA 4Y6RA 4HFJA 1P1KA 3H9UA 4BGEA 4GX1A 3AUSA 4CM4B 2VT2A 5IDQA 2O4CA 3G1UA 4Y98A 5DCYA 3F1LA 3UN1A 3OQBA 1NFQA 2QYTA 1KBZA 1V6AA 1IOLA 3SC4A 4RJTA 3NGLA 4BMNA 1Y8QB 3JD1A 1ZSYA 3L6EA 3PWZA 2PNFA 4IDFA 1ZUD1 2NTNA 3E9MA 1YOVB 5JO0A 3DC2A 3FCOA 4AFNA 3L6DA 4E31A 1W6UA 1Z82A 3GVIA 3ICCA 4H7PA 1JW9B 1UH5A 1U5CA 3RSHA 3IKTA 4PLZA 3KYDA 1DSSG 2GSDA 1VKNA 1ZH8A 2BI8A 3P7MA 5BSEA 1M6WA 5I7FA 1VJTA 3H9QA 7ADHA 5ITVA 5J23A 3RAJA 4GI2A 4WLFA 1T25A 1K6IA 2D3TA 4YXFA 3E18A 4UVHA 5KJCA 1EQ2A 4BNTA 2B0JA 4MIEA 3FBTA 4HP8A 2YFQA 1GV0A 1UXJA 3LLVA 4GAEA 5IZCA 4FS3A 3JQAB 1GQQA 1NYTA 5TT0A 3QW2A 3VTZA 3M1AA 5JBIA 3CPSA 3IUSA 3O03A 5ER6A 3WWYA 4QO7A 1FDVA 4NHEA 3QVXA 4QEDA 2FN7A 2VZ0A 4NMHA 1JWAB 4GWGA 5A9SB 3DQPA 3K9QO 1ZJZA 3E48A 4PN3A 3PQEA 4MP8A 2FSSA 3OP4A 4BO7A 2VCYA 3JQ9C 3NX4A 1IPEA 3ONFA 4BNLA 4FD3A 1NFFA 4FSHA 2OHXA 3ROMA 3MJCA 5JE8A 2IXAA 1ISJA 3FWNA 1TXGA 3JYPA 4P4NA 1VE9A 1UJMA 2I66A 1BXZA 3C8MA 2GN8A 5A5EA 2PA3A 1ZXBA 2NU9A 3HFGA 1BTOA 4J0EA 6ADHA 3SBOA 2ZIZA 3T7EA 1WAMA 3DHYA 4L74A 1PJ2A 4R54A 3GK3A 2NV6A 3ZI0A 3LT0A 2C7VA 3GPDG 1C0IA 2H1SA 3NJ4A 4J4TA 1G6KA 1WMAA 2IEDA 4K9DA 3HDQA 4DWVA 1PJSA 3AOEA 5JYEA 1T4DA 3H9JA 3VKVA 5F5LA 2Y1CA 3JSAA 2HK9A 4FDAA 1WWKA 3HJAA 3ZDFA 4QTZA 3V5NA 4JP3A 2EW2A 3FSRA 3PYXA 4LCEA 3IL2A 1KIFA 3B6ZA 4ND3A 4NZ9A 4D0SA 1Y81A 1Z6ZA 3PGXA 1H5QA 4OKIA 1O9BA 4B7CA 4RQUA 4DC1A 1Y1PA 1XKQA 4D46A 2FWMX 4DPMA 3RBVA 4P8RA 1HEUA 2O3RA 1ZEMA 3PJFA 1L7EA 1R37A 1SMKA 3QVSA 1PU2A 4AJPA 3LSYA 1F06A 1YQDA 2ZB7A 1UXHA 3ZV3A 3WDSA 2HUNA 4GMFA 1PZFA 1GAEO 2LDBA 2JL1A 1PGOA 2BFMA 1B14A 4N7RA 2XPCA 4D3SA 2X7HA 5JSFA 2DPGA 4TZTA 2HSDA 4Z3DA 1L7DA 2B35A 2O2YA 1W4ZA 1XLTA 1P1FA 4XYGA 3RROA 1B7GO 5L51A 1SB9A 3UF0A 4EUEA 3COSA 4XRGA 5CHEA 4O5OA 3R1IA 4GSKA 1GD1O 1CQJA 2C07A 4CMIB 3K2EA 4DXHA 1F8FA 5T8KC 4R1TA 2OOSA 3V1YA 3IMFA 4WCFA 3GHYA 4JIGA 3DDNA 1MLDA 3QVWA 3PHJA 3JYLA 1YJ8A 4ALLA 4F46A 4OYRA 3CZRA 3ZU2A 1NX6A 1JN0A 4GVXA 5KVQA 3H9EO 4NK5A 1P0CA 1QYWA 2AMFA 1S6YA 2AEMA 1PGNA 1E1NA 1X7DA 2HRBA 4WASA 1K5HA 4INAA 3DBVO 4WE3A 1Q0QA 1D1TA 1E5LA 4RLHA 5B12A 4NDNE 1JDJA 2R00A 1AUPA 4ND5A 4NJMB 3UCEA 4EJ0A 4CV1A 1YONA 5C7LO 2EKPA 4FJ0A 4E21A 2RHCA 5H82A 2A35A 3UCFA 4CLEA 5ENDA 4JQCA 1YO6A 3DOOA 3WGOA 2C29D 3I3OA 1GCOA 2DVMA 4QO8A 5TT1A 3PDUA 3IQDB 2DKNA 4J7UA 4E32A 5TF4A 4NFSA 1LDBA 1YB4A 1PZHA 2ZB8A 3CTMA 1DIHA 3QQPA 4R1SA 5JCJA 2NQTA 1YBAA 3RUCA 4XDYA 2VHZA 2VWGA 1FF9A 2NTJA 1EDOA 3GC6A 4HUJA 1I01A 5IXYA 1DHRA 2C59A 4H15A 1I3MA 4HKTA 2Q1WA 4KOAA 4XB2A 3FNGA 3GG9A 3I9JA 3JD3A 4D44A 5K9ZA 1I30A 4NNJA 2Q4EA 2ZJ1A 2P9GA 4NPCA 1E92A 1QORA 4S1VA 3RU9A 3TZQA 5I9NA 1RYDA 2J6IA 1ISMA 3WTBA 4B79A 4OXKA 4YJGB 3FNFA 4BMSA 1HXHA 2C0CA 1AE1A 3AOEC 5JCJD 4YBZA 4XX0A 1ADCA 1YBVA 1LSJA 2B37A 4J7XA 1R4NB 4PLCA 2AA3A 4Y9DA 5DDIP 3RI3A 4IDAA 5EERA 5TX7A 4NFYA 1JAXA 3RVDA 3EUWA 3EGOA 4OL9A 4IDGA 3UFXA 2WYVA 4BNNA 3F4BA 2NVBA 5ILOA 5JO9A 3JQ9A 2JCVA 5JMWA 5H83A 3PLRA 1M2WA 2GCGA 3AM5A 5FI3A 3ZWYA 1DFGA 3MZ0A 4BV9A 3V2GA 2CNBA 3HADA 4FOSA 4L75A 4O1MA 4PRLA 4PG8A 4DYDA 1JLLA 1DEHA 2D5AA 2JCXA 4PVCA 3KBOA 5G0UA 3U9LA 1LRLA 4BS9A 5B4VA 5TIIA 1MFPA 5JNLA 4IGFA 4YWJA 1PQWA 2X5OA 2Q99A 1J6UA 4L8VA 4CL8A 3OBBA 4E0BA 3U3XA 2BD0A 4W82A 2A4KA 3GHHA 3ZWCA 4ND4A 3INTA 1RM3A 4FFNA 3I9MA 4FBGA 3ROQA 1N92A 4WCFC 4IY1A 1HE5A 1ZFNA 4K28A 4UVDA 5FWNA 3JQFC 3CSDA 1V35A 4AICA 2FPPA 4ZQBA 3EZYA 3FNEA 3WGGA 4IBOA 1E3IA 4WNCA 2ILTA 4BNFA 4QQRA 4YQZA 3B1JA 3Q0EA 1WDKA 3PZBA 2EWMA 3PVZA 2BGKA 2NUAA 4XQGA 1EK5A 5G2OA 4CM7A 4W99A 4PG5A 4UUMA 2IXBA 5I7SA 2OZPA 2WEKA 5AXBA 3VPGA 4CM8B 4GKBA 1I8TA 3RU7A 2GZ1A 1EDZA 3LZ6A 4XQCA 3C3XA 4EW6A 2PGJA 4Q39A 2YDXA 3K30A 4YVFA 1G1AA 4FFRA 3S2EA 3FRJA 2HMWA 3A28A 2PTGA 4AJIA 1PTJA 5IF3A 2ZYGA 3HWRA 3N7UA 3OICA 3O8QB 1WZEA 4LVCA 1SAYA 3ORFA 2Z1MA 2BH9A 1XG5A 3UXYA 3RFTA 1DC6A 3SC6A 4R5MA 2PK3A 4CMJA 1TLTA 3BTSA 4L73A 4XJTA 1PS9A 1U3UA 1AXGA 2VHVA 1E6UA 1E7QA 2AQKA 4CMGA 5IAAA 3ZU5A 3Q2KA 1PJ3A 3A14A 3HN2A 3VH4A 1FDUA 3L4BA 4F3YA 3KYCA 4NFHA 3DZGA 1T2DA 2POQX 3ZV4A 4CQLB 1PGPA 4BNKA 1H2BA 3OJOA 1CDOA 3E8XA 4CQMA 2P2SA 3PJGA 4XYMA 3PK0A 4NQZA 5TC4A 2X0IA 3WWZA 2ZTVA 1N9GB 3TFQA 4AVYA 2QRKA 3WNVA 5CEFA 2BLLA 1OI7A 2BFPA 1YL5A 3B1FA 4CM5A 3ASUA 3OEWA 4P4GA 3GRKA 4FQ8A 2J5KA 1XU7A 2YHIB 1E7SA 2DTDA 3H4VA 1U8XX 3ZV5A 3GUYA 5JY6A 1Y6JA 1MGOA 2ET6A 3C1TA 3GN1A 3GT0A 3UUWA 4E5MA 4YJHB 2P91A 5MDHA 5L4LA 1QR6A 1DC5A 3SJ7A 1A9ZA 3OJLA 3DBHB 3RWBA 3ZN2A 1NQ5A 4ONEA 1BXGA 4XQ9A 3RD5A 4CPDA 4CUJA 3P19A 2DFVA 3CMMA 4QXMA 1V3UA 1ZBQA 2GGSA 3JQDA 3QA9A 4OXYA 1U2DA 3K2BA 4AJJA 3RUIA 5K6AC 1GCUA 3LU1A 1JVBA 3JQGB 1NWCA 4YAKA 5CDSA 1P1RA 1E77A 1PGJA 1Q7CA 2GD1O 3S8MA 1F12A 2NTVA 1DIAA 4JBGA 1T2CA 1PJBA 1V3TA 3D4PA 1KEPA 2E6UX 2X5JO 4XDZA 5HBRA 3ASVA 4CM9A 1D7OA 1UXIA 2V6BA 4BKOA 1P31A 2UVDA 3HDJA 3KYBA 3GZNB 1V9LA 1Y5RA 4E2XA 2Q1SA 4J91A 2FY8A 1M6HA 1WZIA 3AOGA 3QHAA 5F1OA 2OUIA 5IJZA 2EEZA 3R3JA 4ZJUA 1KYQA 4RPGA 3ZNNA 4BHTA 2B4RO 3ZWAA 2WD8A 1Q7GA 1ONOA 1VC2A 1TEHA 3KO8A 3WICA 3ZU4A 5C37A 4CQMB 5L45A 4I8XA 1YGYA 4LSWA 3ZV6A 3U4HA 4I5GA 3NRCA 2LDXA 2ZTLA 3AU9A 2GN6A 2CVZA 2B5WA 1R66A 2ZQYA 3IP3A 2JD1A 1OAAA 3KSZO 2PFGA 3A4VA 3MJ4A 4NU6A 5DT9A 5TJ9A 2Z1NA 3UW3A 1WW8A 5C5IA 1PGQA 2XAAA 3ZWWA 5LDGA 3RKRA 4IQGA 4P22A 4TQGA 1LDGA 5DCWA 3UCXA 1ZCJA 3MJVA 4MVJE 3ABIA 4LCJA 3DMTA 1PX0A 1FDTA 4WLUA 2WDZA 1TT5A 5B37A 4JBIA 4BKPA 5AXCA 4XIYA 3DOCA 3FPCA 3TL3A 4OH1A 3ZW9A 3D5QA 5JMPA 4R51A 2DBQA 3ZHBA 1PS0A 2VYNA 1EUDA 3PFWO 3ZWVA 5JLAA 3AY7A 1N2SA 4I5FA 2Q50A 3UICA 4KDEA 4DIBA 4K26A 5TLSA 5A9TA 3DBHA 4XCVA 4OSPA 2DTEA 3JQAD 3AK4A 5CPFA 4A10A 1EBFA 5A4DA 2FHSA 4DLLA 3AY3A 4DQVA 4ZA2A 5BNTA 4KWIA 3WMWA 2CMDA 3HB4X 3GEGA 2QRJA 1C14A 1MA0A 4XIJA 4ESOA 2VWPA 3BMOB 5LDHA 3D4NA 2WWRA 1EVYA 4K6FA 3I9OA 2EG9A 2D0IA 4GWKA 4BQRA 5LC1A 4II3A 3ROKA 4YPOA 4IJVA 5T8KA 1EFLA 2QG4A 1CJCA 4DL9A 4NBRA 3NTOA 1I2BA 2W8ZA 2GRAA 2RAFA 2CF5A 5AQ1A 5JC8A 5EMHA 4BOYA 4O59O 3GOHA 5U4QA 3B20A 3OSUA 1N8KA 2AE1A 3JQ7A 3LT2A 3NDRA 3Q1LA 3Q2IA 4AJKA 3P5SA 3VH3A 5HM8A 2Y05A 5BNIA 2JFHA 2ZYDA 3VPSA 5ER9A 2AQIA 3NT5A 2X1HA 1AHIA 1PQUA 4U6SA 2FR0A 3QE3A 1I3LA 4KZPA 5ICSA 1R0KA 1NWHA 4DGSA 4D3DA 3RUHA 4TRNA 2WMDA 3EMKA 3I9KA 3CZMA 3IOYA 4ZICA 3W6UA 2H5LA 1E6WA 2P5UA 3RUDA 1YJQA 5JC1A 3E5RA 1RPNA 3GGOA 4CR8A 4A0SA 4AJNA 4B7UA 1Q1NA 2DBRA 5JAZA 2I5PO 1YVEI 3VZRA 2J5QA 2WM3A 3GVXA 2Y0EA 4O63O 1Y8RA 1KEUA 3PGJA 1CF2O 5COAA 3V2UA 3ANLA 2X0JA 3QJ5A 4XR9A 3E1KA 5L95A 4RCVA 2CZCA 4PLVA 2BKAA 4UVIA 3WSWA 3GFBA 2IZZA 3QVTA 3GZ4A 3IS3A 3JQ8A 1I36A 4J0FA 1MG0A 4CLHA 4WEQA 4B3JA 3OIDA 4XEHA 3WSVA 8ADHA 5ITWA 3R6DA 1JKJA 1E3JA 4UULA 1QMGA 1BRMA 1BVRA 2I3GA 1X14A 3QP9A 5CEJA 4W9NC 2G82A 5I9MA 3IDSA 4TKLA 1W73A 4G2NA 1VSUA 2RCYA 1U3TA 5DULA 4LK3A 4FJ2A 2RH8A 4RVDA 2P5YA 3AM3A 2VRBA 3JQ7B 3WYBA 4MIOA 3QWHA 4URFA 1HYEA 3WJAA 3WTCA 4XRRA 4E5NA 4RVSA 3RJ9A 4FGSA 2GASA 2XXJA 2OORA 3MJEA 4XYEA 3ULKA 5K0ZA 1HL3A 1VLLA 3O4RA 4CLOA 3VPXA 2C20A 1ENPA 3RUFA 1W0CA 2YW9A 3QWFA 4CL3A 2VN8A 2OXIA 5TRTA 3LQFA 4JX8A 4R69A 4NU5A 3WFJA 2JJYA 5THQA 3E03A 4D45A 2CDAA 3ITKA 3RFVA 1ZK1A 2Q1TA 2DUUA 5GZ6A 4PLWA 1NP3A 4FFOA 5L9AA 1KERA 4ALIA 3B1KA 2I3AA 3FNHA 1DRUA 2PZMA 2WYUA 3JCZA 4J1TA 1YDEA 4UVGA 4TROA 4WEOA 4HX5A 1E7RA 4E6PA 4P38A 5G0WA 3OETA 4IUYA 4E4YA 1BSVA 1TVEA 1DRVA 3FWZA 3DTTA 3DMTC 1EMDA 2YZ7A 4E2WA 4WJZA 4Q9NA 3ZCXA 1M67A 1X1TA 2BF7A 1BGVA 2J3JA 3R0IA 2PH5A 4MO2A 3CH6A 4U0KA 2PWZA 2Y99A 1I3NA 4QFDA 2CVQA 4RZHA 3VPFA 1E7WA 1Y7TA 2O4UX 4MVJH 1HYGA 5G0TA 1U2GA 3VC7A 1GDHA 1QRRA 2AQ8A 3U4CA 5KVVA 3PPIA 3KEQA 1Q2XA 2VOJA 1XWFA 1HDCA 1NQAO 1K3TA 6LDHA 3NV9A 4PCVA 3BMNB 4QECA 1G0NA 1UUFA 3ZWOA 4YA6A 3K73O 3DB2A 3PLNA 4RGBA 1MC5A 2P4QA 4ND2A 1NAIA 5HRUA 1UDBA 3GNQA 3AY6A 3ST7A 4BGIA 4YAIA 3IUPA 1DC3A 3WIDA 4DIOA 4BV8A 1OOEA 1HF3A 2EIHA 3HUDA 5DF1A 4DMMA 1ISHA 3ICPA 4B8ZA 5T5QA 2Y93A 5HS4A 1JQBA 2OP0A 2Y0DA 1EUCA 3MWEB 4HV4A 1Z45A 5L7YA 5BSGA 3GFGA 2H9IA 4R41A 2J3KA 1O6ZA 1HDXA 3KVOA 4Z3KA 5AYVA 2Y1OA 5U9CA 3C85A 2PLAA 2QIOA 4EITA 4XYLA 4KTVE 5BR7A 5I8WA 1XYGA 3GG2A 5A9SA 4RF4A 4WLVA 1UXKA 3UOGA 4DQXA 1PR9A 5L3ZA 5C7OO 4NBVA 3ZWBA 1LC3A 3KUXA 1WNTA 1DC4A 1QYDA 4CR7A 1ENYA 3AJRA 1N7HA 5IN5A 3TL2A 1U4OA 1GZ3A 1C3VA 4WUVA 1HE3A 4Z0PA 1GUYA 2B5VA 1ARZA 4BNHA 5IDWA 4W7IA 2Y1DA 2HK7A 2VZ8A 5I7VA 1EUZA 3GNSA 4IJUA 3WB9A 3DFZA 4CV2A 3CE6A 1Y8QA 1KVSA 5DP1A 2D5CA 4MVJA 1GZ6A 4L0QA 3RUAA 3VVBA 2JCYA 2O3TA 4BO0A 3RC1A 1XHLA 1V0JA 3MEQA 4Z0HO 1DFHA 4JJGA 1RYEA 3F6YA 2O50A 1BXKA 3TOZA 3WGQA 4OQZA 4NJOA 4CMEA 3PHHA 5JXWA 3OIGA 4DPLA 4YEDA 3I9NA 3HHPA 3HZZA 4UVEA 4RPLA 3H7AA 3NEPX 3BTVA 5EJ2A 3L4BC 3DZKA 3P2OA 4DTIA 4BNUA 1XU9A 4YAGA 4XD2A 1TA4A 4J90A 4Q3DA 4ZN6A 5U1PA 1GQYA 2ZTMA 4MVJG 2JAHA 5CG2A 1GZ4A 4HXYA 1QSGA 2VOEA 3G0OA 1VRWA 1DHTA 1KVRA 1U7TA 1YRLA 4U5QA 2C82A 5ILGA 4EGFA 2NVUB 4AJ2A 2PH3A 3BTOA 3AI2A 4E5PA 1LXCA 3SEFA 3WGYA 2W2LD 5EPOA 3WNQA 1C1XB 4BNWA 1J4AA 1H9BA 3GVHA 3EY4A 2O3JA 1I32A 3H3JA 4R5HA 5KNLA 4RL6A 4D41A 2BGMA 4IDCA 4YCAA 4YDRA 4KUGA 3VDQA 2FRDA 3BTUA 3VZQA 1LDYA 1U3WA 1B8PA 4OMUA 3BYZA 1FMCA 4AJLA 3DMYA 5TNXA 2JAPA 4JJFA 3V2HA 3BZUA 3NYWA 3KZVA 1Q7BA 1F8GA 1B2LA 1MFZA 1P3DA 1HLPA 4L4SA 3WGIA 4DBVO 3GR6A 3H65A 5I9LA 2CFCA 5T67A 4AJ4A 4F6CA 4PLGA 5KKAA 3AUAA 5C7IO 4YT4A 4E12A 1B3BA 2FMUA 2ZB3A 4E13A 3L0DA 1E3EA 4UEOA 2AHRA 5TJHA 4DRYA 1SOWA 3GA0A 2YV3A 3N74A 4CM4A 4G81A 1U4SA 5EN4A 4AJ1A 3LVFO 4Q3AA 4BKQA 2YDYA 1BW9A 2A94A 1ZSVA 1UDAA 2GLXA 4TMFA 2Y1GA 2JFFA 2GO1A 4BKUA 5CDTA 2PD6A 2RH4A 2R2GA 2I99A 1P1HA 3M2TA 4ZVVA 1DPGA 3ZGYA 3QIVA 1NVMB 1I2ZA 1NPDA 5A04A 1ONPA 1ZKMA 2Q49A 2X5KO 3PJDA 5JYDA 4BO9A 3EYWA 1C0LA 2Q2WA
chains in the Genus database with same CATH superfamily
4X91A 1SVOA 4JLOA 2WZQA 1FYXA 2PXCA 1MVNA 3D3EA 1YB5A 1QG6A 3OEHA 2IPAB 2X8LA 3B13B 3FZQA 1PR2A 5LOVA 1GM5A 1F2TA 5DYNA 3J7AC 4GPZA 1BEEA 1I9CA 1T0UA 2WSSD 2MSLA 4ILKA 1Q6YA 2I8AA 4LJ4A 4FHZA 1HLDA 3MTDA 4LGVA 3PC6A 4MQUA 5P21A 3RJ5A 4BE7B 4CKBB 1Z73A 1AQIA 5L53A 1TCCA 1O4WA 3KTOA 4JNCA 5CYGA 1KRHA 4IGEA 1SEVA 3CNNA 2YX1A 4DPKA 5EQDA 1CD5A 5JS7A 4R2KA 5EE9A 2CJFA 3L7KA 3BSYA 4N7BA 3M3PA 1XJ5A 4NENB 4FIZA 2IEIA 2CE2X 2C2OA 1DNPA 3OWOA 4HQOA 2XQVA 4QPDA 3TSZA 4BASA 4KFRA 3ENKA 5KTPA 2FSVA 1R3DA 1JHXA 5M3BA 1ZW6A 2W7TA 5FOSA 3E81A 4C4PA 4NONA 2AE2A 3B2NA 3KNZA 4B6FA 1VBMA 1PCXA 2YS6A 3BWVA 3LHIA 2OCXA 1PLKA 1H4SA 4KX5A 1CV2A 4JQSA 3IELA 3CNHA 1QNLA 1BX3A 1E2NA 1H0SA 1IBMB 2QORA 2KM1A 1PFQA 1UJ4A 3HJCA 2I8CA 2UYGA 3MELA 3Q3CA 4IEEA 1B8UA 5AJHA 4D8YA 2JKYA 3OZRA 1DJMA 3T7RA 3JZMA 5I7AA 2I7DA 4AB1A 4TMTA 2XVMA 3MAAC 2PZAA 1PI3A 4K40A 4QAJA 4POOA 4X85A 4L8FA 3D7RA 4V0ME 4UZSA 3SHQA 3V8VA 1YZQA 4DG8A 3FLMA 2JEOA 1W36C 1IAVA 4JLDA 4KAJA 3RK0A 1Q17A 1WVIA 4IDNA 1JJ7A 4MKRA 2BEUB 2XYVA 4WLNA 5BN3A 1E3LA 4PG4A 2ZP1A 1KOGA 4F3TA 3CRZA 1VCHA 4YJFA 2HCTA 3ZPXA 3OO1A 5AM3A 2J8ZA 1ZAYA 1V8FA 2IYXA 1P45A 3VU9B 1A82A 1U1DA 1DKOA 2BMJA 3EK2A 3AJEA 3M9XA 4ISBA 4C0LA 3ONEA 3L6UA 3PUJA 4YJ3A 5CDUA 2DERA 2CMGA 2ZBGA 2ZIEA 3A6JA 1YFKA 2HZBA 2HRZA 2J32A 2X3YA 4KODA 4WERA 3LBYA 5J59A 4ZKEA 1M1UA 1EFDN 1U5BA 2OWEA 4GOKA 5L4NA 2R6FA 3QMMA 3HJGA 3BGVA 2O06A 3VR5D 3DBLA 4R8RA 5I3ZA 2RD2A 3F67A 2HPHA 1R8XA 1VDMA 1P0FA 2AW5A 4GT1A 2GXUA 4D9JA 4ZQIA 5B36A 4PINA 4MUNA 2HWWA 1XQWA 1NX9A 3NONA 3FXAA 1HUQA 5CVUA 2ON6A 3VTAA 3KQHA 2HAEA 5JOQA 1V4BA 3RS4A 2PLRA 2H1WA 3FFTA 4KJZA 1W85A 1JGTA 1KXJA 4N01A 4HLQB 5FJJA 4EH1A 4WBNF 4X65B 3KQPA 2YINC 4GF5A 2QJWA 1A7UA 2F62A 2FE1A 1C0PA 2XB4A 1D5WA 3CHYA 3CLTC 4J3FA 4O0MA 4MI3A 1G8MA 5F4ZA 4FXOA 3JPYA 4YACA 5LOVB 1ZOIA 1R6AA 3JALA 4U7FA 1Q14A 3VNRA 1WKBA 4B6QA 3U9SA 4CR6A 5A2GA 2ECOA 5H3HA 3GQVA 1GP2A 1Z0ZA 3GIWA 1L2TA 1T6NA 4H7DA 3WRVA 1Z8NA 4TQUS 1R6BX 1DO0A 3T7TA 1EHCA 3QYJA 2IS1A 2GK3A 2WM9B 2HW8A 1I3KA 1ZRHA 1XRSB 3MTGA 1KZ9A 4IHAA 5H9WA 5GJVC 3ZE9A 5JLJA 1JFLA 3NDJA 2VDNB 3NDIA 1KOLA 2VR1A 1MJGM 3KZMA 2O1WA 1K8XB 2ODAA 2A9VA 1YRYE 5GP1A 2PCJA 4ZJPA 4GZ5A 2AF4C 3USZA 2XF8A 4UAGA 4QYMA 4P4SB 3JVUA 5IP5A 2CNDA 5BV1A 3L2OB 2Q9CA 1NUHA 4QUAA 5BWMA 1SCKA 3PS9A 4RZQA 1HQYE 2P6PA 4WFKA 4B4OA 4AYTA 4AKHA 1QAQA 1X6VA 3CEJA 4AO8A 2O2HA 4K6HA 1A9YA 1E2KA 1IOVA 1PV1A 4A3SA 5L6LB 3DJYA 3HGTA 2Z95A 4X1YA 1E0AA 4LDQA 2YC2C 2DWUA 3MLEA 4A73A 5CHYA 2R8OA 1YZ3A 3L8DA 1CQWA 1W94A 2WLTA 2YVAA 3RKUA 2RHGB 4DDKA 3KWLA 1NR7A 4PTZA 5ITZA 1MP0A 2CXNA 1EPUA 1ODTC 1LNZA 2RGGA 5HKAA 1KPIA 1EVZA 5IDYA 1EFVB 3Q10A 4FGWA 1UMDB 2PLNA 4BLSA 1KK1A 1N2ZA 1PJAA 2X86A 3EGDB 3FF4A 1OV4A 1RJ9A 2VP3A 2CD7A 4ZOAA 4V0QA 5JW6A 1U7WA 4TT8A 1OLSB 4FGJA 3WDLA 2OHJA 1XZJA 4D25A 4WAUA 1JNXX 2V8OA 4ZQGA 1HZZC 2YKGA 3GX1A 1VM6A 4BNXA 3TNFA 2QZZA 4IIGA 4BEWA 2ZYAA 3GJ5A 4TL8A 4P4SA 3TD2A 4U2CA 2AG5A 3FOCA 3TIVA 4CU5A 1NP6A 2YXPX 3C6BA 2HZ7A 3UC5A 3W5HA 5AKEA 3GFFA 2XE4A 5L3VA 1EZ4A 3PHLA 2BFEB 4B4VA 4XGKA 3SNKA 1QTQA 3GA7A 3H5OA 5TPWB 3ZJ5A 2YVQA 3DNMA 3QOXA 3MGCA 1AQYA 4MIYA 3RYFB 3U44B 1E3DA 1CZRA 1VJCA 3VTFA 2ZPAA 1ADGA 1NW5A 3I39X 4I36A 3P27A 4MUIA 4B84A 5E4TA 3NAQA 1CWUA 1OI4A 1NUUA 2OAGA 2OLJA 4R0NA 1IN1A 3Q15C 4DCNA 2VSXA 1NNUA 4OI2A 2CBGA 2QYSA 1LFDB 1R4NA 2W6PA 1JEDA 1RI1A 2ENWA 4MI6A 3BQMB 2HJRA 5CNMA 5LLSA 1YASA 1HETA 1GXSB 4GX0A 3IBGA 1SUDA 1J39A 1D2NA 1KP2A 1XRJA 2QX4A 4KIWA 1B74A 1YZUA 4FHEA 3SQOA 3JQ8B 3UMRA 4QDUA 4GXNA 4A27A 4MWZA 5JJLA 4L7VA 1QHIA 3KK0A 1YRAA 3EVBA 3W7AA 3ZXSA 1JHAA 5T4HA 3X1MA 1A5SB 4MW4A 1UT5A 1VSQA 2Y1WA 2JJ8A 3OPYB 4S2EA 5EIHA 2WJVA 4J29A 3FTNA 4PLHA 3K8QA 3UJ8A 2O5RA 1TYAE 1WDMA 3C3MA 3GPIA 2ZJ3A 2WJPA 4GBED 4JYPA 5LB4A 4CLRA 3O95A 4DWOA 5CIYA 3HL0A 2W6ID 2C0QA 5A7HA 4YJHA 3G79A 2HLNA 1TU4A 4XWYA 1DAGA 4RH1A 4QTXA 5EKDA 2IV3A 3KLPX 4J0QA 2O19A 3DCIA 2F55A 2GZRA 2GK4A 5E7IA 2YBDA 3ON5A 2IL1A 2HMTA 5BSRA 2XNDA 3JVIA 1FPQA 4MQFB 2YRFA 4LBYA 4RK5A 1ZH2A 4I5EA 3N76A 5EE1A 2QM3A 1OIXA 2FX2A 3IBYA 3NHPA 3P71T 5F1PA 4KYVA 5K0CA 4OL0A 1I2MA 2HT1A 5B1HA 1YS4A 3BL6A 3WX0A 4IDDA 2OMKA 1A1SA 2W37A 3FKSA 4CWAA 3N6RA 1P2DA 1P9LA 1KVQA 1ZGGA 3EGCA 2OKCA 3HABA 3HRKA 4NY1A 1NNEA 5LQDA 2G88A 1QFXA 4O2BF 4YMVA 3HVJA 2Q4RA 3KSDO 4KN5A 4URZR 5DEIA 3CURA 3PGA1 3VJLA 4E46A 5KWEA 4GKVA 4D9KA 1T8WA 5C5EA 3LVQE 3F5FA 4R2IA 3DE5X 4XWKA 3IFSA 5LQJA 3AFGA 4M1KA 1Q15A 2NW6A 4A5OA 1R8SA 2IYAA 2VDQB 3L79A 3I6QA 5L95A 1Y4UA 3CUYA 2OZKA 5JRDS 3K92A 2H29A 1BDBA 4HZGA 1N25A 1XKLA 3OQHA 1NW3A 3L7IA 4X84A 3GLGE 5C4MA 1NN5A 2AIRA 3UW1A 2ZIXB 3F5SA 1T5BA 3RO7A 5DGHA 5BQ3A 3ASYA 2G9VA 2V3VA 2BZGA 4K9LA 2XVZA 4MUBA 2GYWA 3SR3A 1VPDA 5KAPA 3OOSA 1BKDR 5BV8A 1E2GA 1M75A 4IIUA 4UCWA 3RYHA 2CZQA 1THZA 1UC4B 1W47A 2X7JA 3O94A 1JKFA 2V65A 1NKSA 1NW7A 2V7PA 3E9QA 3T5PA 4P0QB 4R8KA 1MAUA 1LSSA 5BSVA 1PSWA 1U9IA 2PDAA 3E0QA 5DGXA 4C3OB 1QNFA 2QPOA 4DIMA 4E22A 5BRJA 3GGGA 1SD1A 5ANRB 4MV0A 1N9ZA 5K0EA 2IF0A 3ZE2B 1Z0IA 2H2IA 3EBOA 4J1QA 1J00A 4YJ2B 1M2FA 4ZC8A 3MAJA 4KIGA 5F3WB 4F97A 3BRCA 3AR3A 5A4AA 2IHZA 2ZIGA 1CR4A 1NBMA 1S7CA 1JG7A 1FP4B 4OQMA 1JIQA 1NE2A 4RJLA 1QQAA 2WM2A 2YR0A 3EGVA 4OJTA 4QELA 1OTHA 4JVNA 5IKEA 4EBFA 1K9SA 4K9QA 4TLEA 2PJZA 4ZHQA 3B6MA 4GVPA 1F6DA 3E15A 3E9CA 3LRPA 1KMQA 2XI4A 3JYQA 3I2FA 1IG0A 3RC7A 4FILA 1B6TA 1EWQA 2HSGA 4UDYX 1UBFA 2WP0A 1HDYA 2VYFA 1YFLA 1KPHA 1T2AA 2ZVPX 3CRRA 4UKDA 5AI4A 1IUKA 1KEWA 4O2AF 1ZISA 2Y1LA 2KQUA 1YFJA 4XR4A 1DRJA 2D0OB 3CBGA 3GDFA 3VRHA 4BC1A 4U9HS 4AY4A 4OFXA 3HWX1 4LRTB 4Z1MA 1AK9A 4N5DA 1EM6A 1VHJA 2SCUA 4R2JA 1ZJWA 2Q4OA 3B12A 4B8YA 2GZDA 2Q27A 4ITVA 4GX5A 3WXMA 1ZM4A 2PRIA 3D3WB 4B34A 1QVWA 2V4UA 3ZG6A 5BO5A 2D5BA 1TAGA 1LPPA 3RVSA 1GPAA 3OZSA 2XCTB 2R7NA 4G8BA 4YYEA 4DSUA 1EVJA 4PSDA 5FUXA 3ZD8A 2XNHA 3SJUA 5I6DA 2QX6A 1Z7BA 4CCSA 3WQQA 1CCWA 1DDIA 1ZMOA 1ECBA 1QXSA 4LE1A 4W4TA 1D4AA 1E1LA 1NBAA 3GW8A 1GNQA 3JS5A 4TLMB 2CLMB 3ICOA 1GZ5A 3SDZA 3SFTA 4DVGA 2J4DA 3EIUA 1KY5A 3I30X 4J7AA 3JAWA 4EYKA 4XVUA 2WF5A 1HLFA 3AM1A 3R3SA 3DE1X 3W2GA 5AW0A 3ZBUA 4IIJF 3EXEA 1KI9A 2EP5A 2BGLA 4G65A 1RHJA 4OMCA 5ISMA 4YT5A 1RRMA 1AMUA 4PQEA 1UXOA 2YICA 1VBKA 3O1HB 1F2VA 2KS6A 1IYZA 1X38A 1C29B 3NHUA 3VC3A 2E3JA 2X0NA 2ODEA 5CP8A 4N5MA 4NYJR 4Q05A 3WGLA 4EL0A 2O2SA 4IO1A 4V0SA 5HQ3B 2FQ1A 4A2WA 3OLQA 1C1XA 1X1SA 2E87A 3TUZC 2O8DA 3D6HA 4DC0A 3IQGX 4LNHA 3NT4A 3FWPA 2C2XA 1QGYA 1P5ZB 4HAZA 3RS8A 1NHGA 1YE3A 2QKYA 4PR3A 2J9ZB 2GN4A 1JXQA 1LNQA 3QM1A 3MWFA 4GD3Q 1DUVG 1NXVA 2R85A 3HJHA 4HNAB 4MWTA 2IS2A 2NUBA 3EH2A 4HNGA 5EKXA 3EQ7A 3V1LA 3ZWPA 3TSOA 1C8BA 2AR7A 1U6IA 3GD7A 3ISJA 3JV7A 4ZAVA 4G5QA 1LCIA 2XCLA 3WIEA 1A98A 1QBGA 4NTZA 5IABA 1PWXA 1QRDA 2R86A 4AIRA 1NQTA 2XMZA 4B4UA 1N1GA 4PO3X 4D97A 4A26A 3PEUA 1YBMA 3FHJA 4G9BA 5M29A 4ECEA 2JGRA 1VPVA 3AHGA 2IEZA 1WXFA 3LPAA 3EXFA 4GGOA 1ECPA 4Q37A 4B7ZA 2YNMA 2CUKA 2QTVA 4ZTBA 1P2SA 2BW0A 2WWHA 3QY0A 3TH5A 2J3HA 3KU4A 1KFJB 2WU3A 3K1YA 3RBAA 5HIKA 1R0ZA 4GI1A 4JQOA 3U7HB 3U81A 4GS5A 5F9HA 1TF2A 1E5XA 3HA5A 1YBHA 2ROQA 4HDKA 5F21A 5E6RA 4UTRA 2W2KA 4CV3A 1DTSA 1U7OA 1JQKA 5FADA 4BN0A 1LV7A 3KRTA 1JHQA 1AZWA 3C5WP 1PEYA 4TS3A 1NN0A 2PLWA 3I6MA 5TQ2B 4J0IA 3SBEA 4L72A 1WQ3A 3GZNA 3MCWA 3PWKA 1XTQA 1YQQA 4WY2A 4BO2A 2GO7A 3ZXYA 1SKYE 1QZUA 3I12A 5KKCA 1HE2A 3C2QA 3LZCA 1JFVA 3ZCQA 1C5KA 4JGBA 5FUQA 4Q0MA 1JIVA 3I6IA 4DT1B 1D1PA 2WSYB 3K1JA 5BUZA 4CQNA 3HUEA 1ESCA 1Z47A 3OU7A 3PUKA 1YB6A 2CLHB 1ULSA 5JSKA 2QN6A 3SHWA 4C4OA 1Q5PA 1LNSA 3SQDA 1SWVA 5LA6A 1USKA 4OYLA 4EUFA 4LXTA 4LRWA 1M6NA 3WWDA 3U40A 3G13A 2VQEB 1QPZA 3VU3A 4D9HA 5BY2A 4C7MA 4EM6A 3COZA 4DQ0A 3IIEA 3U26A 3DOHA 3GPBA 4OP1A 4O4JA 2EJVA 1KZHA 4NRDA 1T8SA 1XMSA 4RQTA 4JKYA 2XNCA 5AIBA 5B58C 1QV9A 3LAWA 3PJRA 3K5WA 2LRHA 4AY2A 3DKKA 4OCZA 3LECA 3LC1O 3HS3A 4DTCA 1FBTA 4X64B 4E07A 4YCNA 2ZE6A 2JIPA 1AQLA 1SG6A 3GT4A 3PXEA 3UZUA 4D8UA 5LP6A 1P1IA 5E0OA 3D02A 2XWSA 4MYSA 4EF5A 3PP8A 2XNJA 3IP1A 4PNPA 4CG3A 4D4MA 2R62A 5LU9A 1QH1A 2AD5A 3TJRA 2FPKA 3M33A 5I7RA 1ZN2A 3WADA 2GI4A 5GONB 1IXYA 3S0JA 1X8KA 3JQBA 1O95D 1GYRA 4PG7A 5L7TA 3L9WA 3OZDA 4X66B 3TCKA 1ZD2P 5IVPA 3N9IA 3TI7A 4R9VA 4BO6A 1SBCA 2JFWA 4CEIA 5AHWA 3QEAZ 2YMPA 3STWA 2OK7A 2BJVA 1E8DA 3Q8LA 2XNSA 3R74A 3WQSB 2C83A 3RBZA 3NHRA 3OEYA 4UUOA 4M0UA 1EFTA 2WICA 3P94A 4RORA 3VU0A 4ZV4A 1CNEA 3N1UA 3Q3EA 2Q2NA 4V0RA 3VU9A 1KARA 1YJ5A 4ER6A 2LCQA 4EVQA 1E1KA 4NULA 3WGVA 2RE8A 4GR5A 4JI2B 3V48A 1ZK0A 5CFLA 2HMSA 1X70A 3CIFA 3VR6D 4K2AA 4BZPA 3I1FA 1CE8A 1JSXA 1N5DA 5BSGA 4WHMA 1LQTA 1F0YA 5FH9A 1OKKD 2A33A 3BGSA 3IEKA 3ICEA 3OESA 4Q1EA 3VR5A 1USWA 2X4DA 3ROZA 3PEFA 3OLVA 4IINA 4IXNA 3U4AA 2FFBA 1BXGB 2Q3LA 1OASA 3N2GA 3L3BA 3OC6A 1QZ3A 3KSUA 4KI7A 3ITNA 3OIFA 1CJTC 3OUUA 3BXZA 3KM0A 4MWBA 1BWRA 2OZVA 1G3RA 4K1LA 3OTGA 5EXPA 4EUHA 1BJRE 2CYCA 4LX0A 1DBIA 4C3UA 3V2IA 1WBDA 4QNNA 1F2UB 4YRTA 5AOAA 4C6SA 5HW0A 2IXGA 2E89A 1FTNA 5DNEA 1EFAA 3MTQA 1HDGO 1E1QD 2G8NA 2AG8A 3A3OA 3K0KA 3DYIA 2VHYA 1JR6A 2N1MA 3EGXB 1AA9A 4R9RA 2XKAA 4EB0A 1JHDA 3QFRA 3INGA 5AM5A 4TX1A 4HGNA 3OTWA 3TM5A 1E7YA 1PFWA 4RVHA 5IU6A 2BR4A 2NVUA 5NLLA 3EC7A 3JQPA 3QKRA 2BBSA 3C7TA 5DE3A 3KZ1E 5KOJA 2R4QA 2ZWAA 2QTNA 1P8AA 5C8VA 1QYRA 4DLBA 2H4ZA 3D0QA 1LI7A 1QYCA 3T1TA 2YUIA 4MJLA 3KSAC 3RS5A 1DO8A 4EABA 2BEUA 4JCCA 2FR1A 1X7WA 4BNVA 4RZXA 4D92A 1KI7A 8AT1A 4BFVA 1DXYA 3GT3A 1SBTA 1J70A 3M9WA 4K6CA 1PJLA 2Y6VA 3TN7A 3FMIA 2AUMA 2XE8A 1FLVA 4KYUA 3V8EA 1AGNA 1HTBA 1KKLA 4X6UA 5EE3A 3HI4A 3OKAA 4QYWA 4E5UA 2ANBA 5DMXA 1IQRA 2WE8A 3CLSC 1XTIA 4NZZA 3ROXA 1BFUA 4HSEA 1LLDA 4O2BA 2NXNA 3LUHA 2A14A 2KX7A 3OHPA 3MMZA 2V7UA 2G1UA 3T41A 3JQAA 3L06A 5HCUA 4AY5A 3EFEA 2H2GA 2ONKA 1PEDA 4RCYA 5SY4A 3LKBA 3EPJA 1FE8A 3FNIA 3I0NA 821PA 1PFUA 3WV4A 3GEDA 5JY1A 1ZA2A 2BP7A 2YYYA 3I2GA 4Q1FA 1U3VA 5JSUA 3C4JA 4ETIA 1W0KA 5KOIA 4LDJA 5LP1A 3GQBB 1EK2A 4GL4A 3DOUA 3N58A 3WGJA 5GZ3A 2PX8A 3SM9A 1B42A 1V1RB 2HV9A 2G63A 2QTLA 2VQ3A 2VQ6A 4JJKA 1DDGA 4ZREA 5ES4B 3GLGB 4MINA 4OQEA 5C32A 1WV0A 1ZNXA 3U16A 4L1KA 3AJDA 3UWPA 1XTTA 1CIPA 1E60A 2IZ1A 1I2CA 3FYDA 3KVVA 1KGSA 1T8RA 3DONA 2BR5A 4J16C 4KACA 5FI5A 1NU8A 2ID9A 3QH4A 3IAS6 5EYPB 2WKRA 3FVWA 2GM4A 3BXXA 4N7JA 1DBRA 1SUAA 1XQYA 1NRXA 1BW9B 3ZXUB 4IIVA 1RC1A 3RW9A 3G7UA 4FTWA 3ED5A 1XOIA 3EHDA 4W1QA 3IUMA 2I2WA 2O7NA 5T6BA 2QRLA 2IH5A 4K9NA 1IE3A 2RARA 1X2EA 2ZB4A 1QC5B 2IYZA 3HBNA 1YQUA 1R0LA 3H9GA 3VDRA 3GMDA 4A7PA 5L40A 1LVUA 4AF8A 3FDZA 4EGQA 3K0EA 3Q7TA 1U31A 1R18A 3PFKA 2X5XA 5F2OA 3WHLA 4XD7A 4RDHA 4LZLA 4MZXA 5FF9A 1JAYA 1F2UA 1KU0A 5IRCD 5CDGA 5WRFA 5IM4A 3FOAA 4BLWA 4RPJA 2WTNA 3R0VA 4CM6A 3T3EA 3W5CA 3CSUA 1GTJ1 2QHXA 3CF4A 4O25A 5G02A 3MXTA 1E2JA 2CNWA 1IHYA 1DJPA 1W4LA 3IAAA 3R3UA 1HI9A 1OX6A 1X7GA 3R5TA 2QYOA 1X77A 3L8CA 2Z2IA 5A3RA 4P7GA 1PNOA 3HXLA 4HFRA 2QGFA 2YY7A 3QMWA 4O0LA 3ZGOA 1Z7EA 2UUCB 3OM1A 4BX8A 1O0SA 1EK1A 2G08A 1ECGA 1PDWA 2QRPA 1TO6A 2PZLA 3DAYA 5D3MA 2XCQA 2M98A 5JXJA 3ANMA 5AQEA 4ZARA 2C5EA 4C9BA 1N75A 4ZEMA 2QV0A 3CKYA 3C24A 4ZIRB 3RJZA 2YN2A 1PVDA 2BR3A 4JDUA 1BEZA 1J2RA 5EE0A 1T13A 2Q9AA 3VKHA 3A1SA 4LJRA 2ECPA 2X22A 4Q19A 2H7CA 4PN7A 4OJYA 2OFOA 3IUBA 1FTSA 1XNJA 2GJAA 3LUFA 5F1KA 1QJ4A 1YI8A 2VL7A 3CONA 2Z2KA 3WLRA 4LOKA 2YOGA 3QKSA 5BUQA 1A8UA 4DUGA 4GO1A 2WYHA 4FN4A 4YUVA 1WVMA 3H4MA 1JQDA 1FK8A 1FXWA 1OZHA 2NWQA 3F46A 2O8EB 1TADA 1GUFA 3C3CA 3KE9A 4TKVB 1SQ6A 4P82A 2YJ3A 3GH3A 1ZQ9A 2HDOA 3IB6A 3OQPA 5THXA 1ZLXA 2DC1A 2WMOB 3MCAA 5KINB 1H6BA 3TFWA 2REQB 4CKCB 1HG1A 2VJYA 2CDBA 3BIJA 1KDYA 3KJGA 2F3RA 4IZIA 4N40A 4UBLA 2PXHA 4K03A 2WKQA 3H17A 3P2IA 4DSZA 4NJEA 4LRXA 3T52A 1BNCA 4ME6A 1FMFA 5E4YA 3REQA 3R0QA 3GRVA 1U0NA 1MQ9A 4Z2AA 3OM8A 1GEGA 4B40A 4ZDKA 4H0CA 4S35A 3FPAA 1JMYA 1UCFA 2ZVQX 3ZNPA 2RAVA 1YVDA 1RYNA 2LZ0A 2OZEA 1HZZA 3TL6A 2C2YA 3T0GA 1A7AA 1O5TA 4O2RA 3T1YB 1QIHA 1H8EA 2XWQA 3ANNA 1MC1A 4I1PA 1HDEA 1RT9A 4TV8A 1I0ZA 3S2GA 2W93A 3VR5H 3N2EA 1EH5A 1RBQA 1YZKA 3WQRA 3MWKA 4DLTA 4LK2A 1QV6A 1ZC4A 1KH2A 3QLTA 2F43B 1NC1A 3OQ6A 1D4FA 5FTNA 4G0YA 1XE3A 4B4WA 2R84A 1WETA 5A1TA 4MIKA 3HM2A 4RFVA 1YR3A 2V9PA 1S02A 1I9GA 3RR2A 1IM2A 2VBCA 4M2LA 4JU9A 1K0UA 1SVNA 2FCRA 3BZBA 3HLTA 3NWOA 5IJAA 2ONJA 4JLBA 2GLUA 3T34A 3DVRX 3U0BA 1NVBA 3ACDA 4UUQA 5AR1A 4AW9A 4F1KA 4ZZ0A 4GZLA 3EY9A 3MWDB 3SC3A 3OI7A 1FFDA 3TTWA 3WLEA 1GAXA 3WK5A 1BD3A 5CX1A 3SG0A 4J8PA 5KJ1A 4C2BA 1KYXA 1TT5B 1AN0A 4P80A 4QUBA 1YA6A 3QBJA 3LKDA 4AXXA 4NCIA 2BEWA 3QFHA 4GMGA 1OFVA 3AM4A 2J09A 4RVCA 1OFUA 3Q7SA 2OPHA 3UJ7A 1SELA 2HSEA 4J03A 1JLHA 2QENA 2YHIA 2DHDA 1T2FA 2VDOB 1S2DA 1U9JA 2VAMA 4MO9A 1T6ZA 4Q24A 4O4LF 4M99A 3T3GA 4DEYA 2G1PA 5UKDA 3D8HA 3Q41A 1FUIA 4QQNA 3VAYA 5LFAA 1TKBA 4I1SA 4JJAA 2EL9A 4LY9A 3EGEA 1JT9A 4LGYA 1NHWA 2XSZA 1OWNA 2QL9A 4C6TB 2UUBB 3ER6A 4ZVNA 1V96A 2WP8J 2ZIXA 2WAMA 5L3SA 3KOMA 1QM5A 3BBPA 3QKUA 1N7IA 3K9NA 1GUZA 1RI4A 4ED9A 5IJ0A 2D7DA 3U09A 3U4QA 3I1IA 1NMSA 4JC0A 1RM4A 1HTTA 3TNDA 4BEVA 2ZUVA 3F3YA 1P8JA 5EL0A 4D9EA 6REQB 5F2KA 2X13A 4RQBA 4MDEA 4HQ0A 3KAQA 4QTTB 2NU8A 2PT9A 3K1AA 4RJIA 3ZLVA 1A2BA 4E11A 1RWWA 1D7AA 1W59A 1WCIB 4H16A 4OFBA 2EOAA 4YDSA 1N2CE 2OGTA 2WWXA 4H1UA 1H2HA 4YP0A 2AFHA 4ISCA 2Q3EA 4JFRA 5DSZA 5A5FA 3GYBA 1U2DC 1CRWG 1PG2A 4I9NA 1RKXA 1U8FO 1CR6A 3IRUA 2EX0A 1R5JA 2B36A 4INOA 3W9BA 3D9QX 3N0RA 3IKLA 4R1NA 1KDRA 5D01A 4QFBA 5CEEA 3I0ZA 1YH3A 2HSJA 2JHFA 3W7VA 2GT1A 2VDVE 3D3WA 3IDQA 4PX5A 1SKUA 4I4IA 2YQZA 5BPFA 2V6FA 1RBMA 2P11A 4G1EB 1T4CA 2UUPA 3BMNA 2P9HA 2LBPA 4CODB 3PA6A 4QBKA 3MPOA 4FC7A 1WUIS 1HQDA 5IG2A 4CV0A 3OU6A 2PYDA 4MUEA 3LWNA 2FEAA 5TV2A 3LBHA 1KETA 1XRQA 2ZWVA 3A6KA 3E7XA 2YJNA 3P5BA 2WJAA 2V6JA 3UY4A 3FR7A 5FA6A 1LEHA 3T9AA 4LYAA 1KS9A 2O6LA 1Y3CE 2IOHA 3DHVA 4I5DA 3D8RA 4X61A 4KWCA 2PKQO 5AKLA 4EKDA 5BOSA 5MN6A 1LGYA 3UAGA 4ARVA 4AKEA 3A10A 1E9AA 2PS0A 1EFHA 4TWJA 4CNQA 2QTWB 3CXRA 1J7JA 1P2FA 4W8HA 1W8DA 1H05A 5JVDF 2AEJA 3Q40A 5BT9A 4ILEA 4R83A 1HSZA 1OLUA 5AM1A 3KB8A 2Y1XA 1AX9A 4HB4A 4I9HA 4MUXA 4XB1A 4DCJA 5G1PA 2GMWA 2P6UA 2W4MA 4FJ1A 5KNCH 5BW5A 3EMDA 2QX7A 5LZ4A 1EWRA 1PVVA 1NJSA 2VZ9A 4F56A 4I55A 2RK6A 1E63A 1RQPA 2RHBA 3UBTA 2NO9A 1P9WA 1U9CA 3H0CA 4YDHB 5ALDA 5ABPA 2IT1A 1JDUA 5DOVA 3IUJA 2JFUA 9LDBA 2FZ4A 3DUFB 2F3PA 3IAFA 1ZVKA 2KLHA 4B6SA 4J43A 4JROA 4IX9A 2DLNA 1PT8A 5KQGA 4YRAA 3T4EA 2XMSA 5KX5B 5EHQA 4IQ0A 1NVTA 1RWVA 2OUKA 5B4UA 4UNRA 3QVUA 2BTOA 4WX2B 5FBKA 3FYSA 3UMCA 4AZ3A 5A9RA 1KYYA 1S2LA 4ESHA 2GBLC 4G86A 3ELYA 4HWGA 5DM2A 3ZW8A 4F04A 4KI0A 4MW2A 4S1WA 4MV6A 4J2HA 4GPD1 1U7DA 2WKPA 1PSDA 2WNSA 4A0FA 3HE3A 1ZNQO 3LQ1A 4ENRA 1QQTA 3U7FB 4I3HA 2OXTA 1T5TA 3MCVA 1IB0A 1ISFA 2ZYWX 2GYUA 2PHZA 3M70A 4RSHA 3ESQA 3PTAA 2EF0A 1VMDA 2Q5EA 4ER5A 3D6UA 1H4QA 3MOGA 3V8RA 1WNFA 3JYOA 1E1RD 2A78A 4CFYA 1UBGA 2J5BA 3HJTA 1P0PA 2BGJA 2IYQA 3BA6A 5SYAA 4CLOB 2E5LB 4WRRA 5CPBA 1FTQA 5J5VA 4YMTA 1DV2A 1LB1B 2DF8A 5DB4A 3VH1A 2NSLA 2DBVO 1XD2B 4PZCA 1E3MA 3JQGA 2Q5JA 3KB6A 4WZ6A 5MGBA 2AJBA 1IN5A 1GVHA 3R8CA 3AB8A 1LLUA 2BE9A 1M10A 3AUJB 2QLBA 5IC5A 4BYMA 3WYEA 3AP1A 3FX2A 4TT3A 5BYJA 4AUMA 4REQA 5BYAA 2BRUA 5JJIA 3IUQA 3LFTA 3MJRA 4N8SA 3UMYA 1DEAA 3OD5A 3P2MA 4LMAA 1HWYA 4HTFB 5GAJA 4QICA 1XZDA 1YCGA 3E7PA 2ZOSA 4CG2A 1YVPA 1WD7A 3R44A 4TTSA 2PL3A 4X6LA 2HPVA 1QUEA 1X13A 2IYFA 1F2DA 1VHWA 2C94A 1P2UA 2HLDA 4I0WB 4MITA 4NBSA 4RVFA 2MR5A 4BFLA 3LKZA 2GEUA 1RJFA 4DV1B 4OI0A 4BTLA 3EDQA 1A4UA 1QO7A 1JYSA 3SMQA 2C2GA 1ANKA 1CUHA 3COYA 4HH3C 1OMOA 3C7AA 3LUAA 1BYIA 1G17A 3HVUA 5HIIA 1A8QA 1T4GA 2JGDA 3GAFA 3TOSA 4M9XA 4Q9KA 1E3QA 1Y63A 4Y2TA 4ETNA 3LO8A 5K6AA 4RH3A 1YZGA 3ONDA 2EG5A 1Q19A 4GKKB 4HNHA 4JUAA 1Z5VA 3K20A 4F21A 2HNBA 3PGVA 3AB7A 4QSMA 1FP4A 2EZ8A 2H5JA 3S7ZA 4S04A 1NVAA 4GLFA 3ZHTA 1RJEA 4QGHA 1GL3A 4FLFA 1FA9A 1G98A 2CLKB 3S70A 2DHQA 1P1JA 2DUWA 1T8PA 1XALA 4OQNA 4XJSA 1AGPA 2RB4A 3KTFA 4XGIA 5JT1A 1R2QA 4YRBA 3H1TA 3LKVA 2NV2B 4CIAA 1M1YA 4OPMA 1X7HA 1Z2OX 3KELA 3LCMA 3BEOA 4H18A 1SC9A 2W2VA 2Z4TA 3GZJA 5CD9A 2INGX 1H2RS 3E1SA 4DA9A 1YS1X 2XUZA 1LLQA 1VYVA 2F59A 3N8GA 4GOMD 4WOCA 1QV7A 2C9ZA 3CF4G 3K1TA 3JZFA 1KI1A 1NT2A 5A06A 2BGWA 1ZN9A 4OHWA 4OATA 4BFWA 1VE3A 2RDMA 1VSVA 3LUKA 4M3NA 4EPWA 5HIJA 4LJSA 5J4VA 4QX6A 3GGSA 2ZATA 4NKRA 1ORWA 4YMGA 4Z0TA 4JUCA 3ZDEA 2H4HA 2IQ5A 2WUEA 2UZIR 1UEJA 4JOQA 3THWA 5BUSA 1O0BA 1UMBA 1E6LA 1EWVA 1UKYA 1ZCZA 4POAA 5IVIA 4B5LA 3VZPA 2IIPA 2IYRA 3GEMA 3Q7PA 3DDUA 4M1ZA 4CXMA 1X7WB 4HFJA 5EZQA 1N5LA 3PQ7A 3H9UA 4P36A 3PDHA 4EI7A 4G0PA 2VJLA 4WCVA 2NO0A 2LE0A 1STOA 2VT2A 1G21E 2FPSA 3O0TA 4YNBA 2OTCA 4P93A 5E6SA 3W2HA 2O4CA 4BMOB 4DSAA 1C9KA 1HY3A 3NWPA 4L0CA 4IJMA 2CWDA 4U00A 2NPIA 3QPWA 3MHPA 5LBTA 1E4VA 1ONSA 2QQ0A 2CFSA 3OQBA 2H07A 1AGYA 1RDFA 4HQFA 4EKNB 2VXBA 1C1HA 4OHKA 2WG0A 1V6AA 3REOA 3SC4A 2JGIA 3A9VA 3IMKA 1LBQA 2LIPA 5FBLB 5FL7A 2UVPB 3D6AA 3UAVA 4BMNA 1Z6TA 4DBLE 2PNFA 2NX2A 121PA 2OQIA 2GVNA 4ZMSA 2R8YA 4RWZA 3UFBA 5JO0A 4AFNA 4OAPA 4E31A 1W6UA 1YULA 2PU5A 3GVIA 4EW2A 3ZCUA 2ZJ6A 1DXHA 4Y2QA 3S2SA 3SM3A 5LLDA 3KYDA 1IK4A 1M6VA 2IV7A 5I7HA 1JV2B 3P7MA 2BI8A 2AL7A 1G1MA 1LV8A 1HMYA 1M6WA 2A5FA 2V59A 1VJTA 4HRVA 3RVBA 3EIOA 5AJUA 3PX7A 4JKIA 1Q0UA 5ITVA 2PUAA 4HO1X 4U02A 3RAJA 3W77A 4OHXA 1RQRA 2WAAA 4M0LA 4ENWA 4X5OA 3BFKA 3KKMA 5EP4A 2O5EA 3ROGA 2J30A 1XXHA 1L7XA 2D3TA 4YXFA 2GRUA 1KZ4A 5EFOA 2AFRA 4MYDA 4TLLB 3O2JA 4UVHA 1KZYC 1GZDA 4MIEA 4BLRA 5A3SA 1GV0A 2QRHA 3LLVA 3O74A 5LXTF 1L5KA 3AEQB 2BZ1A 4M88A 5H3CA 1FUKA 4ZV9A 4ZYXA 2JLUA 3KTAB 3A9UA 5TT0A 4KQGA 3AVXA 4TXMA 2OQ2A 1EKXA 3IQFA 4J07A 4EG5A 5JBIA 4BTEA 4ERNA 3CPSA 3IUSA 3P4UA 4RHTA 4EEKA 2ZE5A 2P75A 4CDGA 4NHEA 4NL4H 3KQTA 2FN7A 2DT8A 4MA0A 5EI5A 1DKMA 1IY2A 1T36A 4GWGA 2AG6A 4X20B 1GITA 1I3CA 3PT5A 1DRKA 2ZI9A 3E48A 3EVZA 3N5CA 5ALOA 3W7BA 3OP4A 1CULC 4CIXA 2H92A 1RQXA 1XTSA 2R6CA 3BF7A 2VCYA 3ONFA 4AUEA 5EGNA 4D3XA 4D6YA 3BH0A 4RM3A 2J41A 3X3HA 4FU0A 5D6OA 4Q9DA 4F5WA 4PXYA 1NDHA 3AC0A 5CA0F 1ZIPA 3X1YA 2Z9BA 3JYPA 4RZSA 4ECAA 5M7EA 1ZCBA 3V4SA 1Z4MA 2W2PA 1N5MA 2JRCA 4OJQA 2J9FB 3HFGA 1CDDA 3NDPA 4Y0VA 3H2IA 2QUJA 1RWMA 1E18A 1U5BB 1DINA 2G7MC 1OVMA 4M53A 3T7EA 2LTAA 1NURA 4N5HX 4L74A 5CCBA 2DFTA 4BRUA 4ZYUA 2NV6A 1RAEA 5HF9A 1T5LA 1ZL2A 1GPYA 4JLPA 2DOKA 1V3QE 3TIIA 3NJ4A 4J4TA 4O4JB 1G6KA 2IEDA 4K9DA 5IM4F 3HDQA 5TGZA 1PJSA 3JYHA 1HNXB 2Q0XA 4GBGA 2JW5A 5ICCA 5LN1A 2J3EA 1CJBA 3VKVA 3GELA 2IH2A 3JSAA 2HK9A 4LIPD 4F85A 1WWKA 4QHSA 4A1OA 3E58A 5GWXA 1EXWA 4YS6A 4LCEA 3V5NA 3DCNA 2BM0A 4TKZA 4NZ9A 1IN6A 2E4YA 1Z6ZA 4GXQA 4A15A 2QP3A 4RQUA 1VXRA 4I2NA 2DFKB 4HGZA 3USCS 3A0UA 5KSPA 3GUZA 3RPEA 5AOBA 1ZX1A 2K5UA 4GZ3A 3R7DA 1ZEMA 3FIUA 3PJFA 2BCGY 4RD3A 3O1LA 4GC5A 1S1MA 3ZS9A 3AL3A 1T1JA 3WDSA 3HR8A 1DQYA 2JIQA 3O21A 4GL2A 2FX3A 2LDBA 4DLRA 2BFMA 1B14A 1DKQA 4D0LB 5A4JA 5J2TF 4I19A 3UJCA 5LDDC 1IJKA 2PMWB 3BL5A 4Z3DA 2ZXFA 1HT3A 5FOVA 2I7XA 2VH2A 2J6CA 4XYGA 4UE2A 5K0JA 1VLJA 3A37A 1QQ5A 3R2JA 5KMGA 4PYNA 4XRGA 1REQB 3EIWA 5CHEA 3R1IA 4GSKA 5SYMA 4CMIB 4MICA 1Z4JA 3O84A 1N2JA 1F8FA 4D5EA 3A58B 5T8KC 4ARZB 3I04A 2F1JA 3AQ4A 3IMFA 3RARA 3GHYA 5MN5A 1PR1A 2QW0X 1SZCA 3M9LA 4JIGA 1QOZA 3DDNA 1MLDA 1JLSA 4IXDA 3BKWA 1YJ8A 5IH7A 3AMVA 3H2YA 3K05A 1EG7A 1WXEA 5CFRA 1JN0A 3EYAA 3A6EA 4MB0A 2O2DA 3KAKA 4KH1A 5BQ5A 1NXOA 5LQNA 1AOXA 3AF4A 4HDSA 1X7DA 3PX3A 5H8WA 4WASA 4CYMA 3ECAA 1I4OA 1TKCA 4INAA 4KEAA 4H7EA 4PO8A 1CPYA 1F4VA <