1PZGA

T.gondii ldh1 complexed with apad and sulfate at 1.6 angstroms
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
328
structure length
327
Chain Sequence
PALVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEAALTGADCVIVTAGLTKVPGKPDSEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMEASGVPTNMICGMACMLDSGRFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSAYYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKAVAALQAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Toxoplasma gondii LDH1: Active-Site Differences from Human Lactate Dehydrogenases and the Structural Basis for Efficient APAD+ Use.
pubmed rcsb
source organism Toxoplasma gondii
molecule tags Oxidoreductase
molecule keywords lactate dehydrogenase
total genus 108
structure length 327
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2003-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pzgA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1pzgA02
1ISHA 4LCEA 3AM3A 3NTRA 1C1DA 1HEUA 1I01A 4FJ0A 4GX0A 4D79A 4DC1A 4RPLA 4M8SA 3K6JA 4DLAA 2CDBA 1GV0A 1WZIA 4R1NA 4M55A 1ZJZA 2Y1GA 1HETA 4AJ2A 4CQLB 5EINA 1UDCA 1SB8A 5DBGA 1C0PA 4DRYA 3CEAA 4BO6A 5DBFA 1WDMA 2HQ1A 1CETA 1ZIDA 1KVTA 1JWBB 4CJXA 5L7YA 1ZO8A 1EBUA 2GD1O 1SC6A 3RUDA 5BSHA 1EFKA 2PGDA 4NDNE 1SEVA 1DLJA 1KS9A 4KP7A 4NFYA 1PQPA 1R4MA 4FDAA 4OYRA 4E32A 1PGQA 4ZJUA 4Z3DA 1DHRA 3PHJA 3BTOA 4HNHA 1ONPA 3PJGA 4CODB 4MINA 5U4QA 3GEGA 3QA9A 1I3LA 3P5SA 4ZICA 4I08A 4E6PA 4ND1A 4HBGA 4ONEA 4MVJI 4RDIA 2XAAA 5G0SA 3E18A 5IG2A 4BNJA 3I4CA 4CQMD 5AXCA 1ZCJA 2QRKA 3GPDG 1HKUA 1QYCA 5BNFA 1R4MB 2VZ9A 4CM1A 3PXXA 1PJTA 4NMHA 4GX5A 4S3MA 4D42A 1NHWA 2I99A 2R6JA 3GEDA 1Q7BA 3RFVA 1I24A 1JVBA 1EUDA 1XHLA 4UUOA 3JD1A 3EAGA 3LU1A 3H5RA 1XA0A 1G0NA 4K9DA 5K6AA 1GADO 1B16A 3VTZA 1NQTA 1P1IA 4K6CA 1PJ3A 1EVZA 4GLLA 2C82A 4YT4A 3GOHA 3JQAD 5BT9A 3EVTA 1FDSA 2P68A 3QVOA 4Z9YA 1LLUA 1EVIA 1JA9A 1GR0A 3QQPA 1PS9A 3FNEA 5KVQA 2NU7A 2P91A 1W8DA 1Q2XA 3JYNA 2ZJ1A 4FD3A 4P4NA 4E2WA 1A72A 3WTCA 2QZ9A 4HWKA 3EYWA 1DC3A 1HDXA 1X1TA 2B5VA 1ULSA 2NLOA 4CV0A 2HLPA 4HUJA 4BGEA 2C29D 3HDHA 3AUSA 2I67A 4RORA 2BGLA 5DF1A 3A28A 4GH5A 3ONEA 5IN5A 1UP4A 3WQSB 5JAIA 2V6MA 3IKTA 3ZH2A 1Y9EA 3D4OA 1YVEI 4KDEA 2D2IA 2P4HX 2C2YA 3BZUA 4OJNA 1OOEA 3PWZA 4D44A 4ZN6A 2YHIB 2B4RO 4F6LA 2W2LA 3ASVA 2QG4A 4HFMA 1DXYA 3JQBA 2PD3A 4MVJH 4CMBA 4RQUA 4OH1A 2EGGA 4PIVA 5JYDA 1PX0A 2PNFA 4NU6A 3ULKA 3VPSA 1Z45A 1GPDG 4AJPA 1B3RA 5G0VA 2Z1MA 3WGTA 5F1PA 1ENYA 3DAGA 3C7AA 4XQ9A 4YACA 5IZCA 2IXAA 2YHUA 3DC2A 2WWRA 1SB9A 1L7DA 4RZHA 1LDGA 3R3SA 4ID9A 5IF3A 1E1KA 2ZIZA 1WPQA 4QQRA 2JHGA 1Y9AA 2QRJA 3DFUA 4YRBA 3AFMA 4J4HA 2HMUA 4WLNA 5JMWA 3KHUA 2OP0A 1DIGA 2BF7A 4DQUA 1ZXBA 3P19A 3GC6A 1ZSYA 4MVJG 2BI7A 1I3NA 2QQ5A 3DB2A 4CM6A 4RPHA 5COAA 5U1PA 5ADHA 4PVDA 2X58A 3GUCA 4DREA 1KETA 2NU6A 5F5NA 2RIRA 5IZ4A 3NTQA 3DOCA 3IC5A 1JAXA 4J91A 3CIFA 4XB1A 1AUPA 3VZQA 4ZU3A 2VWHA 4EUEA 4RJTA 5JAMA 2X6TA 4L75A 4PG7A 4YYZA 2DFDA 1HE5A 3A9WA 3Q2KA 4B3JA 5GZ3A 1N2SA 3DAFA 1Y8QB 3VH4A 1AHHA 4FC6A 4AG3A 4JP2A 5BSFA 3TFOA 4IJKA 3KTDA 1C1XA 1U7HA 3JQAB 3PK0A 5DULA 3T4XA 5HTOA 1NXQA 3UH1A 2IEDA 3PWSA 4CMIA 5TSDA 1EVYA 1FXSA 1QLHA 1JKIA 2J5RA 4HV4A 5B12A 5HM8A 1MG5A 2QZZA 4AJ4A 2CY0A 5A1TA 4KWHA 2LDBA 4QFDA 1U9JA 2G1UA 4YDRA 5I7VA 3PDUA 4N5NA 2XF8A 2C7GA 1DLIA 3JQDA 4WCFA 2DQ4A 4LSMA 1ISIA 3WWZA 3E9MA 2FSSA 2JCXA 5KWEA 4UEOA 3ROKA 1NFRA 4MIOA 3MWDB 4L74A 3GQVA 4BNKA 3OQ1A 4IINA 4ILKA 2JKVA 5CDGA 2OHXA 1C1DB 3OQBA 2VHXA 4G2NA 1HDOA 3JD4A 4GWGA 4YQYA 5L95A 3GF4A 4YEDA 1AHIA 3V1UA 1J49A 1DAOA 2W2KA 4E4YA 1GAEO 3E5RA 1IYZA 4NBUA 1LQUA 2NVWA 1YGYA 3VOSA 2Y05A 3AK4A 3FNHA 1JW9B 4A5OA 2XPCA 1DC5A 2VHYA 1CEQA 1R66A 3FR8A 4PLHA 1P1FA 1GPJA 4JK3A 1J0XO 4QO8A 5IJZA 3U5TA 3ZHYA 4J43A 5CEFA 2PWZA 4NJOA 1DRVA 3WGOA 4CM4A 5HWSA 3BMOB 3IL2A 1GYQA 1OAAA 2V6FA 2C59A 4TKLA 3QHAA 4BO5A 5A04A 3G1UA 2HJRA 3WGGA 5CEEA 1MG0A 4E2YA 3KSZO 2OXIA 3HFSA 2EERA 5IN4A 1E6WA 1M67A 3EY4A 2WD7A 4PG8A 5ICMA 4KQXA 1PZFA 3BAZA 1LJ8A 4R1UA 1Z82A 3ABIA 4XR4A 3W1VA 3TDKA 4WEQA 1RPNA 2WYWA 4BOYA 2R2GA 2VHZA 3H6KA 1AE1A 1YE3A 3DR3A 3I9KA 1YL6A 3ZN2A 1EFLA 1KC3A 3BYZA 4EBFA 1E3JA 1T2AA 1YDEA 7ADHA 2VUTA 2EEZA 4IZHA 3ROPA 3OQ6A 1EBFA 1M66A 3DXFA 1ARZA 3DBRB 4BNXA 1H5QA 2Q2QA 2B69A 2GNAA 1HE3A 1K3TA 4OMUA 2YV3A 4FGSA 1MFPA 3K92A 4AICA 4YRDA 3LLVA 1N1GA 4XD2A 4TKMA 3PIDA 1O5IA 3M2TA 3TOXA 5F1KA 4HNGA 1JVSA 4IJWA 4OKIA 5U9CA 2OUIA 3JV7A 1HDGO 1BVUA 1YJ8A 3L0DA 1GYRA 2YZ7A 3F4LA 1M6WA 3FCOA 1N7GA 1VKOA 1KY4A 2Y93A 2YUTA 1A5ZA 3IQDB 1KVSA 5DNAA 5JDCA 3OECA 2G5CA 4LW8A 3UGKA 1PZEA 4DMLA 4PLPA 1BXGB 2QYTA 4IDAA 4CV2A 1O6ZA 2Y67A 4RZIA 4PLWA 3UCFA 3MTGA 3BHIA 3C1TA 4ZGWA 3Q9UA 3AOGA 3KLMX 1KVUA 3WJAA 3ZU2A 1GD1O 2YQ4A 1N92A 1C0KA 4CMJA 3INRA 8LDHA 1GEEA 3KUXA 4ITUA 4XYMA 3VZPA 3I83A 5JAQA 1KVQA 4XYGA 4B7XA 4XEHA 2XXBA 1VRWA 3QLJA 4PFJA 1E3WB 4BNWA 1V3UA 1WAMA 4YAGA 3HJAA 4GGPA 3JYPA 4YXFA 4PRLA 4INAA 1NM5A 5I7FA 3ZWCA 4NJMA 3GHYA 5AYVA 3DL2A 4N54A 1I36A 4CR6A 1EUZA 2WE7A 3NUGA 4YWJA 1BMDA 3BTVA 4PLFA 2WYUA 4C4OA 1ISFA 4YB8A 3RC9A 1ZVMA 4FJ2A 3UVEA 3V5NA 3PVZA 4QXMA 4FFNA 3MJCA 4IBOA 3JQ8B 1X14A 1QP8A 1W73A 2WSBA 2YFQA 5BR7A 3GMSA 3O38A 1WXDA 3IKVA 4LGVA 2P9GA 3U49A 1NAHA 2Y66A 3BHMA 1DJNA 3SVTA 3TL2A 4FB5A 3IP1A 1V3TA 4CQMA 1KEPA 3N7UA 3PHIA 5BSGA 4JJFA 5FI5A 3ZWBA 4AL4A 3WQRA 3TPCA 5I7SA 2OGUA 3PJFA 1HE4A 3ITKA 3ZV6A 3RC7A 1QR6A 1XKQA 3R1IA 4II3A 1XIVA 3KBOA 5EQFA 5MDHA 1B26A 2C54A 4F45A 3OM9A 1DPGA 1I30A 1ORRA 2JD2A 1P45A 3QWIA 2RAFA 4CMEA 3G3EA 3GRKA 1B14A 3MOGA 4DPKA 4NBVA 2QYSA 4BNHA 1I5RA 1B8UA 4L4XA 4G5HA 2O3UA 4FFPA 3HG7A 5ENVA 3D4PA 4HXYA 3IJPA 4P8RA 3OEWA 4W9NC 4ZRMA 5A06A 3JQAA 1DIBA 3A14A 9LDBA 3P2OA 5JY1A 1U4SA 3SXPA 3TN7A 1U8FO 2C20A 3ON5A 2Y1FA 3FRJA 4S1VA 4EITA 1JQBA 2P9EA 4IDCA 1YB5A 1YB4A 3C1OA 1EDZA 4K6FA 4CLXA 3C1AA 3VVBA 1YOVB 2BLLA 2CF6A 3S55A 3LT1A 1GTMA 3COSA 5G0TA 4AJEA 2EKLA 3QVTA 3KZVA 2YHIA 2WE8A 4HFJA 1NTOA 2I6TA 3V1TC 4P22A 3I4FA 4BS9A 4XQCA 1E7QA 3KYDB 5IDXA 3FPLA 4NNJA 3WNQA 6LDHA 3NT2A 1PJ2A 5A03A 2JFHA 4HADA 3PYMA 3OICA 4U7WA 5DZSA 4QX6A 4CLRA 2CDAA 4PLCA 4ND2A 2X0NA 1DB3A 2O3TA 4BGUA 2OMEA 1WVGA 3DMTA 4CLOB 1KEWA 5L45A 1V8BA 3AOEC 3HDYA 4D43A 3PYLA 4ESOA 2YQ5A 1WZEA 3WMWA 2IYOA 3WXBA 3JCZA 1I32A 1FDWA 3HB5X 4BNLA 4EEXA 3GDGA 2PKRA 1QRRA 2NVUA 4DQXA 4EUFA 1BW9A 1DC6A 2WJPA 2EKQA 4AJJA 2OL4A 2IZZA 1QYDA 2IE0A 1CJCA 1I2CA 4E33A 4DTIA 3I9OA 1NASA 1SNYA 5T5QA 4CL8A 2VRBA 2B83A 2HK8A 4KWIA 4NIMA 1ENPA 1E7YA 5JMPA 5GY7A 2Q1UA 1TI7A 1LNQA 4P38A 3IAHA 4XB2A 4H16A 1PGJA 3BHJA 4YJFB 4FW8A 5LDHA 1CDOA 3B1KA 3DBHA 3EVNA 2NM0A 4YTEA 1O9BA 4ZA2A 4IDFA 3T7EA 3W4JA 4DIOA 5I8WA 1D1SA 4O1MA 3JQ9C 3PZRA 3VKUA 4U6QA 4D3SA 4D7AA 2C5EA 2Q49A 3H9QA 3AY3A 3PJEA 2CVZA 3MJTA 1NFFA 1I10A 2ZJ0A 3FBTA 2TMGA 3W6UA 5CDYA 4BMNA 5TLSA 2E4AA 4CLDA 4ND4A 3NGLA 2VQ3A 1Y5MA 2YY7A 1EK6A 4Q3NA 5L4SA 5IDQA 4RGBA 4KDFA 2X0RA 3C7CB 3JSAA 3GR6A 4HFRA 2VWQA 4Z9XA 4GI2A 1MXFA 3L4SO 1NVMB 3JQEA 1ZFNA 3BTSA 1PSDA 3OHSX 2YV2A 4DL9A 1DFGA 5C5IA 3RROA 1W4ZA 5JAZA 2YJZA 4W6ZA 3QE3A 1U7TA 2NSDA 5G4LA 2UV8A 4EJMA 1GZ6A 3ADOA 3F5SA 1G6KA 2NV6A 4EJ0A 5ER6A 2EJWA 1EDOA 3GFGA 4KQWA 1WWKA 2AXQA 4YJHB 3TJRA 4GVLA 1E1LA 2ZCUA 1XYGA 4PZEA 1DEHA 3ONFA 1Z74A 1MX3A 1OI7A 3WLFA 2X9VA 2X5OA 3KB6A 4NJMB 1YL7A 1Y8RA 1O0SA 4C7KA 4H3VA 2BD0A 5CDTA 1Q7CA 1T25A 4OL9A 3FNFA 1Q0LA 3E9QA 1ZKMA 4E12A 3NDRA 1KBZA 3GEMA 3GNSA 3WGIA 3K96A 2DBRA 1PL7A 3F1LA 1PTJA 5H81A 4TMFA 3DBVO 2ZB8A 4E5MA 1I2ZA 2DUUA 1HZZA 4WLVA 5A9TA 3ZZNA 4P4LA 1H6AA 2PH3A 3DZKA 3HZZA 4G65A 2BKAA 1W6UA 4YT2A 1E1MA 1PJCA 3D7LA 1VE9A 1QKIA 3EDMA 3ENNA 3B1FA 1LLDA 2O4CA 5KVVA 1P44A 5JLAA 1LSSA 4CMKA 3BMNA 3JQ8A 4TRNA 4CLHA 5TT1A 3D3WB 3DFZA 1YO6A 4I8XA 3SC4A 2H5LA 5AVOA 1XDWA 4MIEA 2JD0A 3CSDA 3AU9A 1KEUA 3VTFA 3FHLA 1B7GO 1U3UA 3TZ6A 3GG9A 3RUIA 4J6FA 2PZLA 5CG1A 1NPYA 5T57A 4R01A 1AGNA 4M86A 3F46A 4XR9A 4RCVA 3KEOA 4OM8A 1ZMOA 4I9NA 1JWAB 2O3SA 1I0ZA 2D59A 4IDGA 2J5QA 2ZYAA 4IDEA 4M87A 1Y5RA 4DYVA 1A4IA 4BL5A 2D5AA 4J2HA 3ZW9A 1LRLA 1PS8A 2BMAA 2VHVA 4YJDA 1ADGA 1SPXA 4XZ3A 1T2EA 4YBZA 4CMGA 4ROSA 1WMAA 3WFIA 5JC8A 1QXSA 4B4UA 1R0SA 2IZ1A 3DZGA 2UDPA 5DP2A 4YJHA 1KY5A 2Q4EA 2UUOA 3AFNA 3U4DA 5JBIA 5KOIA 3BMOA 4IGFA 5DBIA 3IUPA 1M2WA 3ZWOA 3UAGA 1ZNQO 2O2YA 1NAIA 5L53A 4TWRA 2BELA 2DFVA 3H5AA 3HDJA 4R4JA 2Q2VA 2Y68A 1RM4A 3FWNA 1TA4A 4Z6KA 3LVFO 3N58A 1L7EA 4J3FA 2UUPA 4R9SA 5KIAA 3E8XA 3W8EA 3WBFA 2O3RA 4CMEC 3ANMA 3GGOA 1E3LA 3ZU4A 5L7TA 2GF2A 5TGDA 1JTVA 3BMCA 3RUEA 5AXAA 3O4RA 4RQTA 4BO2A 3JD0A 4CLOA 4OIMA 2WMDA 2QRLA 4TVBA 2IZ0A 5C37A 1N1EA 1QYVA 4GSKA 3QVWA 4AFNA 5G2OA 1GQ2A 2ZYGA 1F0YA 2EV9A 2JFFA 2HJSA 4PG4A 4M1QA 5A5EA 5L40A 1IL0A 1GYPA 5I9LA 1OBFO 2WYVA 1G1AA 4UVDA 2AQHA 4DIFA 2H6EA 4CL3A 2FPIA 1NVGA 3WWYA 1I3MA 1PR3A 4A0SA 4JP3A 4PN3A 4MKXA 4MVJM 2EWMA 2A4KA 1E3EA 3H9GA 3LC7O 3AU8A 3OF2A 4NBWA 1VJ1A 1DIHA 3KYBA 3TZCA 3WS7A 4QTZA 3RUHA 4YAJA 2E37A 3KOUA 4DWVA 1MC5A 3RAJA 3OSUA 4BNYA 4DUPA 1XLTA 2FRDA 3VZSA 4J9UE 3DZBA 3JYLA 3P7MA 1HE2A 3NAQA 4FFRA 3BA1A 3LK7A 1U4OA 3LDHA 1ONNA 2CNBA 3MOIA 3EZYA 1P0FA 3NJ8A 1RJWA 4JLWA 1LLQA 1IPFA 1YBMA 2IODA 3ITDA 3WBBA 3GY0A 3R3JA 3ZHZA 2VRCD 3D1LA 1PGOA 3MJVA 3QIVA 1GUZA 4RDHA 3QWBA 5DOZA 3TZHA 3ZWWA 4ALMA 4BKOA 1LTHR 2E6UX 1TLTA 3ZNPA 3PFFA 5A9SA 1B0AA 2D8AA 1PQUA 3I9NA 3K8ZA 3L6EA 1V0JA 4Q3AA 4YCAA 4BO8A 3GHHA 1BSVA 2HO5A 2XXJA 3GAZA 4L8VA 1HSZA 4DYDA 3E03A 4TSKA 2ZTUA 4YT5A 3ONDA 1ZJYA 3L77A 1DO8A 1KIFA 4CM9A 4JCOA 5DCUA 1YQXA 4PRKA 4AJNA 3INGA 2Y0EA 5F3RA 4I5DA 3H65A 3A1NA 4KTVE 1DRWA 2NQ8A 4KUEA 4IIVA 4NK4A 3WYEA 4R9RA 2Y99A 4WNCA 3U62A 4BNIA 2W98A 3NT4A 4CM3A 3V2HA 1Z75A 4WEOA 3ZWYA 3VDRA 4OSPA 2OO5A 4ZQHA 2A94A 2AEJA 2VCYA 4Z0TA 2PTGA 1O94A 3ADPA 3NGXA 3ZV3A 4A03A 1E92A 4B8ZA 2PV7A 1NX6A 1BDBA 1IE3A 5TS3A 3RBXA 2JCVA 3SJUA 3W8DA 5HA5A 1WLYA 2H63A 2RHCA 3HSKA 4XA8A 1DRUA 2JHFA 4EGFA 4FPXA 4TRRA 3BMNB 2P2SA 4RVGA 5TJHA 3ETEA 5T8KC 2LDXA 1KEVA 4FS3A 1P1JA 1SOVA 3W6ZA 3W4KA 1HL3A 4AJ1A 1P33A 4JBIA 1GQYA 4RPKA 1NBOA 5C7LO 1GEGA 2VT2A 3ANLA 4MP3A 4OOEA 5AOVA 4R3NA 1JDJA 3LT2A 4ND5A 3S2IA 5F21A 4YPOA 1NWHA 3U3XA 4PVCA 5ILGA 3LLSA 4LVCA 4CR8A 2BRUA 1J4AA 1WDLA 3K30A 4XQEA 4PLTA 1GFSA 2PD4A 4MOWA 3DAPA 4OO3A 4BUCA 1P3DA 3WTBA 5AXBA 3BXXA 1VPDA 3GMDA 5DOVA 3KVOA 1DSSG 4CM4B 3QP9A 3H7AA 4PLGA 4WUVA 4XQGA 5KJEA 4J16A 3ORFA 1B15A 2IXBA 5KNLA 3GT0A 4DBZA 5JCJA 1EK5A 1O89A 5JCJD 3OIGA 1LSUA 3ENKA 5H83A 5ICSA 4Q3DA 4K26A 1SEPA 4IXWA 2X86A 1P1HA 3FF4A 2JD1A 4II2A 4C7JA 1SOWA 2O4UX 2OBNA 5GZ6A 1VM6A 4GL4A 3RWBA 4CLRB 1EE2A 2AEFA 2V6GA 3TZQA 3C7DB 1E7WA 1S6YA 4JBHA 1HYGA 2WEKA 5IXSA 3PHHA 3U09A 2J6IA 3IS3A 3G0OA 1SBYA 3QVXA 5ILOA 3JQ7A 3OP4A 4BNVA 1WDKA 2JFGA 1AN9A 3LC1O 4F46A 1T2CA 3DWFA 3PDJA 1PJQA 1EQUA 1YJQA 1T24A 1A4UA 4I9HA 2PR2A 3GZNA 3C85A 3SLGA 4GSLA 2ZK7A 2HMTA 3N74A 2HKIA 3G1TA 2VYNA 4U6SA 5IAAA 4M54A 3GH3A 1NQ5A 4DQVA 1ENZA 4GKBA 2ZB4A 3RU9A 3PHLA 4WASA 4ALIA 3FPCA 4FCCA 4DPLA 5K6AC 1QYXA 4YJFA 2W90A 3AOEA 3KEQA 3TFQA 2FSVA 1BG6A 4RVDA 2HUNA 3TNLA 2J8ZA 4L76A 4N5LA 4BO4A 2Q1TA 2O48X 4YQZA 1E7SA 1JKFA 1YONA 3INTA 4Y98A 4W99A 3BMQA 3OJLA 3FN4A 3D5QA 2AQIA 4CR7A 4FFMA 1I2BA 2FP4A 3H9EO 2AG5A 4JJIA 1HZJA 1EZ4A 2YDYA 1AXEA 1JAYA 2DBVO 2PA3A 3KM0A 1B2LA 4WGGA 4CV3A 5TF4A 5A3JA 3IOYA 5CG2A 2NWQA 4J1TA 1T2FA 3ST7A 2X0JA 2Z1NA 3F9IA 4YA6A 3G49A 4EUHA 3GVPA 3NRCA 1RM0A 2W4QA 3PJDA 4PCVA 5FFFA 2W2KB 1HLDA 4CM7A 5TQVA 1VC2A 2VN8A 2RCYA 1E77A 3OJOA 3KLPX 2BFPA 4R41A 1Q7GA 3RBZA 3PZBA 1QG6A 2AG8A 1XEAA 4EZBA 5IFLA 4JIGA 1UXIA 4XJSA 5CPBA 2GLXA 1ZEMA 1Y1PA 1PIWA 1I33A 4IMPA 3H8VA 3ZV4A 5LCXA 4MP6A 1Q0HA 1R0LA 4IMRA 1BTOA 5B4UA 4XIJA 3RCBA 4NFHA 1LLCA 3EZLA 4Z0PA 1RYDA 2O3QA 3CMMA 3RJ9A 2DKNA 3HFGA 7MDHA 1F8GA 1NFQA 4TRJA 4YAKA 1PQWA 5KTKA 2I76A 1K5HA 2R00A 4H7PA 3CPSA 2BHLA 4E31A 3CINA 3H4VA 5TJ9A 4OXKA 5G0UA 1IZ9A 5TC4A 3AWDA 4GPD1 4BNNA 4BMVA 4J9VA 4JNKA 4J7UA 1K6JA 1PWZA 2EW8A 1GY8A 4D41A 4OHUA 1ISGA 4ZQFA 5G4KB 4EI2A 2ZB3A 5J23A 1OFGA 3UXYA 3LF1A 1I3KA 4W9NA 2DAPA 1KERA 3RQSA 4Y67A 4BNUA 3RASA 4W82A 3GVHA 1GZ3A 3RVDA 4MP8A 1E3SA 1LRJA 1Q1NA 2OP1A 1PJBA 5KCZA 4W7HA 2YW9A 1B8VA 3EC7A 3GG2A 3K9QO 2P5UA 4Q3BA 2ZTMA 3JQGB 5T8KA 5COQA 4EW6A 4LISA 5G4KA 4ZQGA 4D45A 2A92A 2VZ8A 4JXKA 1H9BA 4RPJA 5T6BA 1X15A 4XX0A 3PYXA 2RH8A 2ZTLA 5EIOA 1V3VA 2YDXA 3VPGA 1C1XB 2VWPA 1A9ZA 2WTBA 1PGNA 3RC1A 1P1KA 3TZKA 4J0FA 1HT0A 3G79A 1CYDA 4Y6RA 5JW6A 3JYQA 3DTYA 2UYYA 4GLOA 5A9RA 1ADCA 2NADA 4MVJP 3PRJA 2CZCA 3UKOA 4DPMA 2C2XA 4NBRA 2NTJA 1N5DA 2VYVD 1MV8A 2G0TA 3QRWA 4G81A 1RYEA 2EJVA 4Y6SA 1E0DA 3I6QA 4UVIA 4O6VA 3WOHA 3T7CA 1ZK3A 1HF3A 1ZK2A 2HMSA 1FJHA 3I3OA 4E5NA 1PZGA 2WD7B 3TRIA 2BFMA 4J7XA 3D0OA 3OH8A 1OC2A 2J3JA 4R54A 2DLDA 3UW3A 4PZDA 1TT5B 2Q1WA 3VDQA 4E30A 1CQJA 2X5KO 4IQGA 4BVAA 4UEKA 3AUTA 2D5CA 1TB4A 4UEJA 1LA2A 1XR3A 3ZWXA 3PIIA 2GYYA 4I9UA 2SCUA 3RKRA 1FDUA 3PQEA 2ZQZA 3HWRA 5C3MA 1X7HA 2BFAA 4FSHA 4OKNA 1NPTO 2EP7A 1QLJA 1HLPA 2FWMX 2ILTA 2JL1A 3C8MA 3JD3A 4BNGA 2CVOA 4E2XA 5ER9A 4GKVA 3RD5A 1QMGA 1Z73A 5KVCA 2NU9A 4IS2A 4UUPA 2HRZA 4CMHA 1T4BA 4E2ZA 1YOVA 1CIVA 4J2OA 5L4LA 3CZMA 2GCGA 4BV9A 4JX8A 1N9GB 2H1SA 3U4CA 1GCUA 4AJKA 4BNTA 4XDYA 3JQFC 1Q0QA 4PLYA 1DJQA 1E6EA 4ALLA 1E1NA 4KUHA 4NBTA 1SZJG 3IIEA 4XRRA 5BNTA 1DFIA 4QECA 4TZKA 2FPGA 4NQZA 3I9LA 4JQCA 4EYEA 3QW2A 2FMUA 4FFLA 1N7HA 3GVIA 4R3WA 1UJMA 2FZWA 1C14A 3GK3A 4RO0A 1Y7TA 2O7QA 4NH4A 3OIFA 4YAIA 3EGOA 1RM3A 5EESA 1LC3A 4GMGA 1U5AA 4BKQA 5JDIA 3Q0EA 2IRWA 1D4FA 2RBEA 5B4TA 1X0XA 2HK7A 3E6AA 3RIHA 1NVTA 3ZWVA 4LVUA 4YT8A 4WJZA 1CRWG 2VUSA 3U4IA 1ZMTA 5F1OA 4B8WA 5JY6A 2X5JO 1A9YA 1DDOA 4UREA 3H3FA 4Y9DA 3C3XA 1DHTA 3OEYA 2HCTA 4CV1A 2NACA 3O03A 3MJ4A 3VC7A 1N8KA 5DCYA 3FI9A 3PGJA 4P4GA 3OETA 3EUWA 4L4SA 1HXHA 3W8FA 4URFA 4FJ1A 5CFZA 3R6DA 5JFOA 5H82A 1XG5A 3E5MA 1LQTA 3RJ5A 2YYYA 1D3AA 1JLLA 1Y8QA 4A27A 1LDBA 3DBLB 4AJOA 3UF0A 3WGYA 4GX1A 2Q3EA 8ADHA 2VT3A 2V7PA 3HN7A 1P74A 1FMCA 3ZHXA 1GCOA 4R5MA 1CWUA 1XELA 4CM8B 3IUSA 4PZCA 5GZ1A 1NWCA 1U2GA 4KTTE 1B3BA 4NI5A 4J1SA 5CDSA 4AJHA 1NYTA 2Z5LA 4MVJA 2QW8A 1MA0A 3Q11A 4WLUA 1KOLA 1NQAO 4DMMA 5JS6A 4ZQEA 3PI7A 1DBVO 2E48A 4Q3CA 4PG6A 4A7PA 2DTXA 4LSWA 1H9AA 3CH6A 4GGOA 3DZJA 1ISJA 3I23A 4I1IA 1A7KA 2FN7A 1UAGA 2EIHA 3M6IA 3WSWA 3GVXA 4ALJA 4I5EA 3MWEB 3BMQB 3L6DA 1X7GA 4DBVO 1BXZA 4WCDA 2Q2WA 2GGSA 2O3JA 3DQPA 2AA3A 3D3WA 4XYEA 2A9FA 4LCJA 2CVQA 2PY6A 4BGIA 5KJFA 1KVRA 3DOOA 5I8ZA 3KETA 2IEBA 3O8QA 4J1NA 4E3ZA 1WP4A 1X0VA 3D4NA 2ZATA 3U9LA 4EJ6A 2JCYA 3DO5A 1LRKA 4Q3EA 1IPEA 2GZ1A 4YJGB 4YVFA 3NTOA 4BIIA 3JQ6A 4B3IA 4O63O 5ITWA 3WR5A 3ICPA 6ADHA 4U5QA 1UP6A 2V65A 4XDZA 3CE6A 3D64A 3TWOA 1GU7A 2C07A 4PGFA 2VUUA 5A3VA 2GERA 5ITVA 3RC2A 3W4IA 2UVDA 3DZFA 3F3SA 4RLHA 1NQOA 3WDSA 3WICA 3PGXA 5EPOA 4UVEA 1VL8A 3WMXA 2ZCVA 1CERA 3DHNA 4R68A 3QV1A 2I5PO 4ALNA 5ES3A 4MVJE 4CPDA 3PFWO 5A4DA 1J5PA 5I7EA 3R0IA 1P31A 4XGKA 5HRUA 1XU7A 2OZPA 2G17A 3NDJA 1I8TA 4DLLA 2F1KA 3AM5A 3JQBC 4WOKA 4KOAA 4IY1A 2GZ2A 4FOSA 2J5KA 9LDTA 1UXKA 3ZGYA 2NQTA 3M1AA 3UFXA 4IPTA 4L4RA 1ZUD1 3AM4A 5FI3A 3KYCA 2HK9A 1PJ4A 3ICCA 3O26A 2C5AA 2UAGA 1PR9A 4F6CA 3VH3A 2IYPA 4JJGA 2ZKLA 3GGGA 4HFNA 1OZAA 5L7WA 2B0JA 3LT4A 3GA0A 2AHRA 1IUKA 5KKAA 4BHTA 3OJEA 4RF5A 1E3WA 1GUYA 4B4VA 4D3FA 3PQDA 1U2DA 5KVSA 3FNGA 1ZSNA 2YFHA 3JQ7B 2OBYA 3ZWPA 1MXHA 3K2BA 4D46A 4BQRA 3L4BA 2I66A 4WLOA 5THQA 4MIYA 4QFCA 1R12A 1TEHA 4IQ8A 1R6DA 4DC0A 1HDZA 2O23A 1YWGO 4CM5A 1UZNA 2QHXA 2PZMA 2VTEA 3A06A 4J7CA 4GQAA 1AXGA 2HMWA 4WCFC 1E6UA 2NNLD 4J49A 5F5LA 1X13A 4MKRA 1LDNA 2FY8A 2Q46A 2ZYDA 1HTBA 1QSGA 2PD6A 1U3TA 4J4BA 4OGWA 4CLEA 2X1HA 4BKUA 3CKYA 5T64A 1VJTA 2EG9A 4MVJF 4ZQBA 1LX6A 1PJLA 4N18A 4JBGA 2HSDA 1D8AA 4TROA 5IDWA 1O95A 5JYEA 2G82A 1NHGA 1PS0A 4FC7A 4A10A 4A26A 4DGSA 1BWSA 2Q1SA 1VSVA 3D3EA 1JU9A 4E5KA 3JD2A 1OMOA 4L0QA 5HBRA 1F14A 4L73A 1MC4A 3OFSA 3AI1A 1C3VA 2F00A 5KJCA 1BRMA 1UDBA 3GZNB 3KYDA 3F5QA 4D3DA 2XOXA 1A27A 4IJVA 3IDSA 5JDIC 3PLRA 2BFOA 1VLLA 1EUCA 5AXDA 3SJ7A 3UCXA 5EN4A 3K73O 2AMFA 3ETGA 4WKGA 1P0CA 3LYLA 3AI2A 1K6XA 3DOJA 3ETDA 3F47A 5TIIA 4XYLA 1U28A 3FTPA 1U1IA 1R0KA 1W0CA 1DIAA 3CZRA 3GVCA 1R16A 4MO2A 5I9MA 5IXYA 5JPIA 1S7CA 4BO1A 2DUWA 4MPDA 4WLEA 1YH3A 2VYVA 5COBA 4BKRA 2G76A 4L9RA 5JXWA 1ZSVA 3Q2IA 1Z6ZA 2GO1A 3V1YA 3FWZA 1BXKA 3Q9NA 3VPXA 3WB9A 1YBAA 3GDOA 3SEFA 3M1LA 3HE3A 3MEQA 2GN9A 4LRTB 4OXYA 1K2WA 2BH9A 1PZHA 3DZHA 2R00C 3MCVA 4CUZA 3D5TA 5L3ZA 1M6HA 3S2FA 1QV6A 1DIRA 1U5CA 4QSMA 3O9ZA 1H2HA 5FYDA 1B8PA 2HRBA 4Q9NA 3RU7A 3ZI0A 1V9LA 1U8XX 5K0ZA 1QYWA 5KJ1A 1NPDA 2ZTVA 1UP7A 1FDVA 2NTVA 4B79A 2VTDA 1KYQA 3AY6A 1K6IA 3GPIA 3UUWA 1T4DA 4BO9A 5BSEA 1H6BA 3E9NA 4KUGA 4I5GA 1MP0A 3WYCA 4J1QA 2X8LA 3JQ9A 5CHEA 2BGKA 3S1LA 5DN9A 3OJFA 1IULA 2X9GA 5AQ1A 2YV1A 4GAEA 1PU2A 3WLEA 4HKTA 4U0KA 1V35A 4ZVVA 1ZW1A 3AUAA 2D3TA 5B1YA 2GASA 3Q3CA 3P2YA 3MZ0A 4R1TA 1SAYA 1EVJA 1XCBA 4E13A 3M2PA 4CM8A 2E82A 2Y1EA 5EJ2A 1VL6A 1PEDA 3QY9A 4MJLA 4Z3KA 1QORA 3GNQA 4FOOA 1Z7BA 3WGQA 3BMCB 1GV1A 3VH2A 4O0LA 5DP1A 1J6UA 5BQFA 1PL6A 4B4WA 4B7CA 2PGJA 4BB5A 4CQLA 3AUUA 4YR9A 5LDGA 4LK3A 3QSGA 4R1SA 3DZIA 1K0UA 4WPGA 1MLDA 3OJ0A 3RUCA 3WIEA 3ROQA 3T4EA 4OQZA 3KV3O 3MJEA 4EEZA 4GBJA 1ZEJA 1T2DA 4EDFA 2NU8A 1Y81A 1TT5A 3GGPA 1LXCA 2O50A 1YKFA 3RFTA 4BNZA 3EK2A 4XGNA 2O7SA 2FZEA 2Y1DA 4WCFB 3PTZA 4LMRA 4I5FA 1HDRA 2AQ8A 4OOFA 3KRTA 5CPFA 3RI3A 5FEUA 5EL0A 3PP8A 1LC0A 5IDYA 1WW8A 3JQCA 5L51A 2W2LD 1UZLA 1GDHA 3LF2A 5L4NA 4RVHA 2A35A 3VH1A 5JDCC 1YL5A 1HSOA 2HU2A 4RVSA 3ZW8A 1H6CA 1HYHA 2DPHA 3LC2O 2GRAA 3DBLA 2Q4BA 3WJ7A 3AI3A 2FR1A 2PGLA 3AJRA 3H9UA 2P5YA 3EHEA 3JQFA 1FF9A 3DHYA 4BO0A 3UCEA 1ISMA 5IZCC 1EEHA 2TMDA 3ZDFA 2PZJA 2I9PA 2C7VA 2DU8A 3I52A 1XWFA 5DDIP 3UOGA 2WDZA 2VOJA 4LRSB 2GN6A 3QWHA 5EQDA 4IGEA 3QWAA 3H3JA 5DT9A 3GNTA 4UULA 1P1RA 3L9WA 3OA0A 2FPPA 1ENOA 3TL3A 1U3VA 2JAHA 3WFJA 3B20A 3FR7A 1LDEA 4B3HA 3HN2A 4ZD6A 2PFGA 4DLBA 5A5FA 4UAGA 2D0IA 2PK3A 1H6DA 1LU9A 1YBVA 3B1JA 4MDHA 3GZ4A 2BGMA 5FF9A 2GN4A 2Q50A 1NNUA 2RH4A 1YDWA 2GR9A 4BO3A 3K2EA 5JSFA 2DM6A 1F12A 3UN1A 2Q45A 4BNMA 2AE2A 3K5PA 4RV9A 2E49A 3ZWAA 4BMSA 3VHRA 3HHPA 3LT0A 1WNTA 1PWXA 4K28A 3RFXA 3IJRA 3EMKA 4N5MA 3NEPX 1NR1A 3H5NA 1RWBA 3VZRA 4WNIA 3SC6A 3V8BA 4GMFA 4WE3A 4R69A 5JNLA 1ZXLA 3VAZA 4RPGA 1JKJA 2NTNA 3IMFA 2NUAA 5LC1A 4BKPA 3ZCXA 2NVUB 2PKQO 3AY7A 3SLKA 1T1RA 3S2GA 3UHAA 1X1EA 3RSHA 5CAEA 4HX5A 3HNPA 1PGPA 4FGWA 4NHEA 4XYBA 1OC4A 1UH5A 3C24A 1E5QA 4X54A 1U3WA 5G0WA 3S2EA 4OXNA 2FR8A 1LUAA 1DAPA 4KMSA 1ONOA 1YS4A 2Y0DA 3VPHA 1T26A 2X7HA 3L9XA 1D1TA 1R37A 3RUFA 4WECA 3SX2A 3AW9A 3ZWNA 1XGKA 3WQQA 1M76A 4BNFA 1ZK0A 3QJ5A 4AVYA 4U0JA 1ZBQA 2VWGA 4BGVA 3KXDA 4NZ9A 3GFBA 1H93A 4XGIA 1G0OA 2EXXA 2DBZA 2ZQYA 4QUKA 4TZTA 3JTMA 4FIZA 3S8MA 1BXGA 1NR7A 3CTMA 1VKNA 2VRCA 1BHSA 2EHDA 3ANNA 3HADA 3KSDO 1ID1A 2HMVA 2DTEA 1LI4A 4IUYA 3I9MA 4CMAA 4E0BA 3F4BA 1NP3A 2CDCA 1BDMA 1Y6JA 2H9IA 5EERA 3HUDA 1O8CA 3WIDA 5B4VA 3EW7A 3QWFA 4ND3A 2OFPA 4XWYA 1A71A 4J90A 4TQGA 5JCXA 1BGVA 3GN1A 3NDIA 1KC1A 4W7IA 4YJGA 3X2EA 3NYWA 1HWYA 3ZNQA 2I3GA 3FBGA 3PQFA 4NG5A 4YAEA 4K1LA 4WLFA 1LDYA 2JAPA 2Q99A 5DCWA 2Z95A 4RF4A 1BW9B 1RM5A 3CXRA 4LN1A 1P77A 3ZNOA 1H94A 1MFZA 3HB4X 3JYOA 1HDCA 5C7OO 4Z0HO 1UXGA 4TVOA 2D4AA 3SBOA 3TSCA 4JGBA 3OMLA 5THKA 1IB6A 4RVFA 1E7RA 3DONA 5TX7A 5C7IO 3I1JA 4Y6PA 1UXHA 2DT5A 1IHYA 3K31A 1XQ1A 3STHA 1ML3A 1HRDA 3PHGA 2IDZA 1UAYA 3OBBA 5TRTA 2P4QA 3NV9A 2I3AA 4R16A 3ZHBA 4R51A 4M89A 2FR0A 4XIYA 2I65A 2EW2A 2Y1CA 3GDFA 5BNIA 3X2FA 2QX7A 3L6OO 3TOZA 4Q39A 1IHXA 3WG9A 3RUAA 3F1KA 3WSVA 1GL3A 1VJ0A 3FD8A 4IDDA 1X7DA 4FQ8A 3NJ4A 4JN6B 5I9NA 3VVCA 4BQPA 3MTJA 4MVJD 5MGBA 2B37A 1DC4A 4B7UA 2J3KA 1UDAA 4AJLA 3L4BC 4NR0A 5HS4A 3U0BA 2VNSA 3DHEA 3QVSA 4XKJA 2AE1A 4WOJA 4J4TA 2PZKA 3RBVA 3CMCO 4M49A 1WMBA 3H2SA 1K89A 1MUUA 2FHSA 1P9LA 3ROMA 4AJIA 4JROA 1DOHA 1YXMA 1ZH8A 2D1YA 2J3IA 3L07A 1UZMA 5A9SB 1H2BA 2GDZA 4PLVA 3F6YA 4IS3A 4QO7A 1HYEA 4RLSA 1XU9A 2GPTA 3UICA 5KKCA 4BV8A 1IZ0A 4B4OA 4F3YA 5TNXA 2CSUA 2W8ZA 2VNAA 4UUMA 1DFHA 3E1KA 5JC1A 4QEDA 3E48A 3I5MA 1LSJA 1N9GA 2EP5A 2PKQP 3I9JA 3ZWMA 3LQFA 1M75A 2EF1A 4CM9D 1H0KA 4IM7A 4DIBA 4D0SA 1F17A 1SCUA 3DEYX 2ET6A 5HS6A 1E5LA 1FDTA 4KZPA 3G17A 3DBRA 2Y0CA 3Q6IA 5KJ6A 4O59O 1HDYA 4W4TA 1R4NA 1UR5A 2RHRA 3RKUA 3WX0A 4HY3A 4E5PA 2VZ0A 1TXGA 1FK8A 5CP8A 5TT0A 2X0IA 1ULUA 2WD8A 1E7MA 1XQ6A 1ZK4A 2V6BA 3BTUA 1UUFA 2CFCA 3I6IA 2QIOA 4XCVA 3U4HA 2B5WA 3JQGA 1VSUA 5JE8A 4FN4A 2B35A 2VOEA 3NKLA 5JO0A 2HDHA 4CQMB 2EKPA 4GWKA 3BIOA 3ZNNA 4NK5A 3ZV5A 4A2CA 1ZK1A 1YQGA 2B4TO 2P9CA 1YRLA 1QV7A 2POQX 4FFOA 3ZU3A 1Y8RB 2O2SA 3HQ4O 4XJTA 3PPIA 4RF3A 3DTTA 3MJSA 1IOLA 3DBHB 2AW5A 3ASUA 1YQDA 4QT0A 3PEFA 3E82A 3O8QB 1LDMA 2DPGA 3B6ZA 4DVJA 3NT5A 1C0IA 5L9AA 1C0LA 4OSOA 3OA2A 3GUYA 3IP3A 4FR5A 1BVRA 2X9NA 2PH5A 3DDNA 4E5YA 2GN8A 4TRMA 2WM3A 3FTNA 1SMKA 2J3HA 3PWKA 1PJSA 1V6AA 1MB4A 4RF2A 1F8FA 4H15A 4PG5A 1CQIA 1ADBA 2DVMA 3H2ZA 4RVUA 4CUJA 5B37A 3HDQA 4WK6A 4CMIB 3GLQA 3ZU5A 2CD9A 4A73A 3V2GA 1ZZEA 4NPCA 3TF5A 1UXJA 2VYND 1VL0A 4D0RA 1R15A 3VPFA 2ZB7A 3H9JA 3A4VA 2X22A 2Y1OA 3WYBA 4ZHSA 2B36A 2CUKA 4J0EA 4PLZA 3NX4A 5A02A 2X23A 4N7RA 1LEHA 2HAEA 4MKZA 5JO9A 1EQ2A 2DTDA 3LZ6A 1PL8A 3KSUA 2EGHA 4DXHA 5T67A 4Z9FA 2AEMA 4IQ0A 5GMOA 1T1SA 1GQQA 3Q1LA 4IIUA 1MGOA 1D7OA 2FOIA 1Z7EA 1TVEA 3GAFA 4Y8VA 1LBEA 4DA9A 3KO8A 1GZ4A 1R4NB 1SO8A 5ENDA 3GRPA 4ZRNA 3VKVA 4O5OA 2AQKA 3KYCB 1EE9A 1E3IA 4GX2A 5CEJA 1A7AA 3WGHA 1CF2O 2OOSA 2OORA 4BO7A 2GZ3A 5CDUA 3LSYA 1RKXA 3CUKA 4UVHA 4OAQA 1XSEA 4BB6A 1GUFA 2GUGA 3GN2A 4U8GA 3PLNA 1LSOA 4NU5A 4IDBA 4IJUA 4R5HA 5FWNA 1ADFA 4IZIA 2B4QA 2VHWA 2PLAA 3DMYA 2DBQA 3FSRA 3WNVA 4LMPA 4IXTA 3TQHA 4RL6A 4GVXA 2BI8A 1EMDA 4NFSA 4UUNA 1L1FA 4OQYA 4XRGA 2NVBA 4FBGA 5EMHA 4ALKA 5A05A 2C0CA 3WGZA 4YRAA 1IY8A 4E21A 4UVGA 3V2UA 1VI2A 3B70A 5K9ZA 1YB1A 3DMTC 1JN0A 2DC1A 4CMCA 4CUKA 4HP8A 3OIDA 2CF5A 2JJYA 2GSDA 2CMDA 1TT7A 2X4GA 1F06A
chains in the Genus database with same CATH superfamily
3E9CA 4KLNA 3NEJA 1YVRA 1ISHA 3UK2A 3N75A 2G25A 3AM3A 3GJZA 3QXHA 5IJ0B 2NUTB 3COJA 1QP0A 1ZAYA 1KZHA 5BW4A 2D62A 4M8SA 1IU9A 1PT8A 1T5LA 2WPNA 1Z15A 1O97D 4FWIB 4H77A 1VYHA 4BFLA 4EQZA 1Q1EA 5CFPA 1EM8A 1GV0A 1DJMA 5HJ2A 1WZIA 4C43A 5JATA 3H75A 2XVZA 3T0FA 1GPLA 4AN0A 4KQGA 4MAFA 2AD5A 2W4IA 2Y9MB 2B1IA 4Q05A 2GX6A 4CQLB 3OCYA 5EP3A 3TLMA 3WHPA 1UDCA 1SB8A 3HCOA 5DNYB 4MA5A 2I80A 1KU6A 3THWB 4R2HA 2VYQA 5HK8A 5DLPA 5FL7D 1QTQA 1WDMA 2HQ1A 4D99A 1ZIDA 4FXPA 1KJ8A 1JWBB 2DWQA 2M98A 3FFBA 3N05A 4KQ2A 4MWBA 2MDTA 1FP1D 3B9QA 4YFVA 5BSHA 2FEAA 2B8JA 4GMDA 1FRFS 3CIOA 1NQWA 1CIJA 3TQRA 3CJRA 1LW7A 1N57A 4OYRA 1SXIA 1S2DA 3Q7RA 1CHNA 5TDHA 5E6RB 1T34A 4TGLA 1DHRA 2IEZA 3PHJA 1V43A 3BTOA 1ONPA 3QBTA 5C9ZA 1UIRA 1JAHA 2P69A 1QH9A 2ECFA 3R7AA 3BSFA 4INZA 2WAAA 2LRHA 2NYAA 1M73E 4I08A 1TO1E 1Q0PA 1WSWA 2CFOA 4KJXA 4C4YA 1ZGGA 1EJ0A 4GM4A 4RDIA 4ZOLB 2HSGA 5BRJA 4RDXA 4BAZA 2JIOA 1EWVA 2IF2A 3GWGA 5AUQA 3WAKA 3GPDG 1X92A 4DCPA 1QYCA 2AUTA 3QVUA 4M1OA 2VZ9A 2QPLA 2PA0A 4F1KA 1JR3A 4PGMA 3AEQB 4MLCA 1SQ0A 4RFVA 3GMTA 5AW6A 2R6JA 3DO6A 1ZNZA 3WRXA 1YUBA 1Z62A 3B3AA 1I24A 4AYTA 5HQTA 5LN1A 1EUDA 1XXLA 4KNYA 4UUOA 4MUYA 3ONVA 1IXKA 3EAGA 1TM7E 2OQ2A 4PEVA 1EFAA 2YZKA 2J31A 3SHFA 1QIJA 2OFWA 3CVOA 1CZRA 3L8DA 4BVLA 3R7DA 1NZFA 3QH4A 3LA8A 3RS8A 4AWBA 1ZC3A 4CHGA 4K9DA 1DBSA 2QXYA 3KKOA 5CIYA 2FVYA 1GADO 1G16A 3E61A 3QHQA 4RJJA 2MINB 3G0CA 3LO8A 4PQEA 4RL4A 4DSTA 4K6CA 3SZMA 3QEMB 5EJ4A 1Z0IA 1EVZA 4YT4A 5DM60 2GDJA 3RYHB 2CYAA 3EVTA 1PJZA 1FDSA 3H3XA 1LLUA 2G6TA 3WLHA 1JL3A 4H6WA 4KPUA 5KSWB 3VU3A 3IFSA 3WL7A 2ROQA 1PS9A 1S2GA 5KVQA 3T5CA 3TQOA 4DBLE 4S1WA 3ZIDA 2VNHA 3M5WA 2ZJ1A 2AI2A 3FYUB 1KRWA 1FTWA 3D4LA 2EJUA 5AJYA 1JEYA 3RFCA 4ZT3A 2J0VA 1A72A 2V98A 3WTCA 1ACMA 2BFEB 4GBGA 3SQLA 3T4UA 3C3JA 4F72A 2O0LA 4LZJA 2EC5A 2ZM6B 1QK3A 1QOPB 3B51X 3A28A 4H7HA 4EY7A 2GARA 1IXZA 3C87A 1G66A 3G68A 4Q3OA 1J20A 1EZZA 3OZVA 1ZMRA 3QLTA 2C8VA 3ER8A 1Y9EA 3W6NA 2ODPA 2R7AA 2E1RA 3C6BA 3ZQUA 1G55A 1ZESA 3LWNA 3N2NA 1N2XA 3F6PA 3VJMA 4WXMA 1WPXA 3ODGA 3OFJA 4G9BA 4GBED 2YHIB 2QL5A 3MMXA 2IYQA 4F6LA 2W2LA 3HDVA 2EFJA 1P4GA 4HFMA 721PA 4MVJH 2PD3A 3WRYC 4B2LA 4PXSA 4LF7B 1OR8A 1VHDA 3IT2A 4IEEA 4OK5A 5AESA 1PUXA 3H84A 4Y1EA 4U7GA 2X3YA 3DVAA 2Q4OA 3PSAA 1TU4A 1M6YA 1O96B 1ENYA 3DAGA 4XQ9A 1WY7A 8ABPA 4IQFA 2YHUA 1TLFA 3C39A 1OF1A 1Z4MA 1L7DA 4CG0A 1KI4A 4FD2A 1J0AA 4RZHA 2FN9A 1N3IA 3PGVA 2WWTA 1OAOA 3HNOA 3AESB 1WPQA 3M1IA 2JHGA 3G59A 4QQRA 4PZ0A 2ACWA 1P4RA 1Q7EA 3AL2A 5B7NA 2WSIA 1G5HA 3DFUA 1IOZA 3V8RA 3BWEA 3AFMA 4H0FA 5JMWA 1FUUA 3KHUA 3CNHA 3M6WA 3RIMA 1IATA 4AB1A 1WNFA 3ADKA 1MB3A 1ZXBA 5AD1A 2GVDC 3SF8B 4NENB 2JH3A 1ZSYA 1LD3A 1IIRA 5J43A 1CXZA 5F5XA 2BGJA 3E0QA 3OE1A 2BI7A 1I3NA 1YU6A 4HF7A 4JENA 1CU1A 3CKMA 4QUJA 4V24A 4CM6A 1A8QA 3ESAA 3HACA 1AK1A 1M1NA 2X58A 3GUCA 2NU6A 4GIBA 1O7JA 4DC0A 4EQ6A 2YXLA 3ZHSA 3PDCA 4E08A 2I4TA 3QBEA 4B2YA 3KSAC 1S1MA 2KPOA 1EFDN 4JX9A 2NTEA 4XB1A 1YA8A 4NOJA 4IV0A 1WD5A 4X1KB 2H92A 1AUPA 1Q14A 3DHWC 1LK0A 2VYCA 3PC7A 4MVWA 4U7DA 4EARA 3LH5A 4JP8A 4RSGA 5B2EA 3V4LA 3ZXUB 5JAMA 1WA5A 3EVEA 4EI8A 3PQ7A 4XAQA 2X2EA 3H86A 2ANBA 5K0BA 5K2OA 3CS3A 3Q2KA 4ZVKA 1DOZA 1MO5A 5KNDD 4YCCA 5LNK1 4K46A 4FC6A 2Q6VA 1A7UA 3L0YA 4JP2A 1ZHHA 4PO8A 1UMDB 3MXTA 4MRSA 4C0JA 2GH1A 3PXEA 3WAJA 2RAPA 1IB0A 5DULA 2WIAA 4B3JA 1NXQA 1DTSA 2IEDA 4UHKA 3BGOS 3AR5A 1ESZA 1EVYA 1FXSA 3NNDA 1YQWA 1QLHA 4RA6B 4PZZA 4MQEB 2EFEB 4BY9E 2XGMA 2AFIE 1J0EA 3GLSA 1MG5A 1TGYA 3Q7QA 2BFFB 5D86A 4AF7A 4ER5A 3UHJA 4MAAA 5A1TA 2RHOA 4REQA 2HV9A 4C06A 2C2BA 1HDEA 2F17A 2QT0A 4MUIA 4YDRA 5E7QA 1UJNA 4TQUS 4BFYA 2C7GA 1RKVA 3V80A 4Q82A 3VQTA 3ZCPA 2E1PA 6YASA 4WCFA 2W70A 4AUNA 4RFLA 4HQFA 2DQ4A 4XFJA 4URWR 1FU8A 2JCXA 3K1AB 1C0EA 7REQB 1ZOOA 3W2GA 1JHZA 4FFVA 4R83A 4G8BA 4I4CA 1EFRD 3BCSA 1VOTA 4KHZA 4LEIA 3DGEC 3EG5A 3OQ1A 1CULC 4BNKA 1AA9A 2EX0A 4LDJA 1NNSA 3D7SA 5DCLA 1XA4A 1A4XA 1G8MA 1IM8A 3OQBA 4MUMA 3K4PA 3R0QA 4GOJA 3WLQA 3QKIA 4YQYA 5LWQA 3ENQA 3F6RA 5BW6B 1IIBA 3IR7A 2VJOA 1QIGA 4TV9A 1ZL0A 4P0QB 1AHIA 3RHZA 1FQWA 2QJRA 5CFOA 1WHTA 3WDLA 4F85A 1OZHA 1SU7A 1ULZA 3C5EA 4N1AA 3BK2A 2DUJA 3PC3A 3U44A 2YWDA 4NBUA 1LQUA 4QJ5A 1A2KC 2UXDB 1RLUA 4MGYR 4HDCA 3QUSA 3VOSA 4C4RA 3DKVA 1BN6A 5DEIA 1RKBA 4DMGA 1DC5A 1FU4A 3TPZA 3O8BA 3CVYA 3TSYA 4PLHA 2JGDB 3UJ9A 1ZR2A 2REBA 4FZ3A 3WB1A 4DSUA 5CLFA 2ZYSA 4J2TA 4LDNA 1GPJA 4ZDKA 1J0XO 4BLSA 1WHTB 2PZGA 4D9CA 2G5GX 3L0IB 3U5TA 3TVYA 1HBJA 2QG9A 2O57A 2PWZA 3CSSA 3RABA 3SIPA 1DRVA 2VCHA 2WG2A 3WGOA 4CM4A 5HWSA 4F8JA 3ORQA 1CJMA 1LPOA 2PV0A 4IV5A 1KO7A 1ZVJA 1PFYA 2R7KA 5LZ9A 2V1UA 3FOCA 5A04A 1XCGB 3K9HA 5ARDA 2GQ0A 4I0WB 3U2QA 3O2SB 4Q18A 3G1UA 4N49A 3NBAA 1MG0A 3LXMA 3TDNA 3GJQA 3I1FA 2ZWIA 5IVPA 2IS6A 5MFPA 1GPKA 1W8IA 2WU8A 1GA1A 4KH1A 3STVA 5E38A 5A2QA 1W44A 1M67A 3EY4A 1OB2A 1WXIA 1YRWA 3OJXA 3EZ6A 1PZFA 1G4AE 1TJYA 1Z82A 4NECA 1Y89A 2IELA 4XR4A 2Q21A 1Y33E 3I34X 1D5WA 2PCLA 2F8LA 2R2GA 3JTEA 1QQBA 2XDQB 3H6KA 2DGDA 4LNUA 2NXWA 2V9ZA 3I9KA 2CZQA 3O92A 7GPBA 3UM9A 1W36C 4MTLA 1E3JA 2DFPA 1F2TB 1P7VA 2VUTA 4OB7A 4IZHA 3UNXA 1V16B 4JLUA 2P40A 3HXLA 3DXFA 1W5AA 3ROPA 1T3LA 2Y6VA 3L0BA 4RDCA 4R05A 2A30A 4XI9A 1DEOA 5CVVA 2QAGA 2B1JA 1CQIB 1DRKA 1K3TA 1Y0BA 2MR6A 2RHTA 1HEYA 2WKPA 4BWYA 1MFPA 4W5TA 1YCGA 3MRXA 5FULA 2CHEA 1O5IA 2YASA 2OCPA 2IYZA 4I4IA 1QHXA 1QDEA 2GM9A 4IJWA 4OKIA 2H54A 1RFLA 2WR8A 2Y1KA 3MQ2A 1C7QA 3ER6A 3SSNA 3HC7A 3L0DA 4IXNA 1GYRA 4TS4A 3TJMA 1KZ4A 3U3RA 3NHYA 3FCOA 1N7GA 4TX1A 4ZO4A 2Y93A 5I3CA 4ZVMA 1A5ZA 2YUTA 2UZIR 1KVSA 1ZGBA 3AF0A 4E1BA 1ZWLA 2G5CA 1JJAA 1OWLA 1IMJA 2YZNA 2ZYWX 5CH3A 3UGKA 3ZKWA 1NKTA 1J2EA 2JLAA 3BFKA 1KYXA 4HB4A 2PBZA 2ECOA 3R3VA 4ND6A 4U2BA 1O6ZA 4RZIA 3B60A 1FW8A 2IYVA 1E5DA 4PLWA 3BWCA 4LS3A 3UA3A 5ALSA 4IRUB 4C78A 4PNEA 3O7MA 3Q9UA 1NUSA 3AOGA 1KVUA 1MCZA 3WJAA 4EHLA 2ZJ2A 2YIVX 8LDHA 3R3UA 2ID9A 4AS2A 4R71A 5A4KA 3KUXA 4KFRA 4KYVA 2PUDA 3ONNA 3I83A 1GITA 2R1ZA 4XYGA 3WK5A 5HJ7A 3DGFC 1XDSA 4QDZA 3ISVA 2WTMA 2XXBA 3I61A 1B23P 3NRBA 4PFJA 4DG9A 2Q62A 1E3WB 2B99A 1V3UA 5IDVA 4YAGA 1L4NA 3FVVA 4BEBA 3I2IA 1S9HA 4GT1A 2EBWA 3JYPA 1JX6A 1EP9A 1P80A 3OO1A 4YXFA 5FTMA 2Y6UA 2XMDA 5I7FA 4XGQA 5JAUA 3LDGA 4K81B 5JJBA 4B6PA 1Z4KA 2M32A 2ZZMA 4YWJA 1X9GA 4PLFA 4C4OA 1JMVA 3ESQA 4WD3A 1ISFA 5FUVA 1X8XA 2YOFA 3HYTA 9ATCA 7MHTA 1P9WA 1RE1A 1ZVMA 5IM5A 1GHTA 3MS4A 3V5NA 1L3BA 3H18A 4FFNA 3MJCA 4IBOA 4QXMA 5E6UB 2EWVA 1ORWA 4DMHA 3JQ8B 3PFHA 3FYDA 4HEJA 4RVNA 3R6WA 4F2PA 1NJ2A 5H8WA 1L7BA 2NP7A 4L50A 3TBHA 5JOQA 1R9JA 3IDZA 2D2VA 4B6OA 2BCJQ 1DWPA 1H8EA 1UKYA 2P9GA 2EAUA 3HGTA 3OCCA 4H59A 4KK4A 1NYQA 3BAFA 4KLZA 4L57A 4UU8A 3U49A 3NBXX 4F4DA 5IKEA 4B5KA 4ZVUA 4YC7A 3IP1A 1V3TA 2WU1A 3GBSA 1U3DA 1XN4A 2WU3A 4P93A 4WK4B 2NUTA 5FHQA 4JJFA 5FI5A 4RZSA 3ZWBA 5I7SA 2E5WA 1NUQA 1U0HC 4EHJA 3PJFA 4XOUA 1HE4A 2O2XA 3ITKA 3JASB 3R20A 5AWFC 1Z0SA 4KN8A 3W9UA 1CJSA 3HCBA 3LLMA 5CHYA 5C0OE 1M8GA 2HWXA 1E2KA 2C54A 2Y27A 3JVDA 1JYEA 4J0JA 1TPYA 4WBSA 2ZU6A 2FJUA 2O1XA 3I1IA 5FTKA 1ORRA 4EP1A 4G0OA 1P45A 3MCWA 1NONA 4CMEA 3WZ2A 5FNVF 2WUFA 3IR5A 1GZVA 2AI3A 1B14A 1G21E 4D9IA 1FSPA 3GFSA 2VPQA 3GUUA 2QYSA 4BNHA 1I5RA 3FDIA 4L4XA 4GQBA 1M54A 2O3UA 3HCDA 1XVTA 2DWUA 2YFKA 1JHAA 4ZRMA 5A06A 4J0QA 2VF4X 3I28A 3A14A 3H2HA 4KBFA 9LDBA 3P2OA 2FZ5A 4FONA 4JP5A 1PLLA 2D54A 2TECE 5KSZA 4AY2A 2WKSA 3D8TA 5C5DA 2ZVDA 1T36B 1AKWA 1RWXA 2C20A 2YC4C 3ON5A 1L7OA 2C2HA 5DH9A 4ZYLA 1DAHA 2R60A 4DABA 3FRJA 4EITA 1JQBA 2P9EA 3VNRA 3WGMA 4WZ6A 4AN1A 5B58C 5JZ9A 1S3FA 2MSDB 2GRUA 3GFPA 3RK0A 4EG0A 4QU0A 5CLGA 1BX0A 4CLXA 2VK2A 3J81A 3ZD6A 2XMQA 1GTMA 1MRSA 3COSA 1M74A 4ZOLA 3ZY2A 4AJEA 1OWNA 2YHIA 4HFJA 2XUDA 3D6VA 3EEQA 1NTOA 2I6TA 2QZ4A 1BD3A 1MOSA 4RJ2A 3RR2A 3V6MA 4F9GA 4BS9A 1TOAA 1W52X 3FCEA 4ZZ2A 1HFKA 4NNJA 1AUXA 1U04A 2RC5A 2CLLB 2IE8A 3VDNB 4FOTA 1L5OA 2AYXA 4ZT5A 1BYIA 4MWOA 1QQTA 5CLLA 3BXFA 3OICA 4NU0A 5DZSA 4QX6A 1GZUA 4M7PA 2HA4A 3KZKA 4N01A 4LJ4A 2X0NA 3M6AA 4CN8A 4YRSA 1MQ9A 2PQ6A 4FZ5A 4BGUA 2I3DA 4F4FA 3A27A 4DXDA 3EVAA 4FSDA 1WVGA 2DECA 4B47A 2WF9A 3RTGA 5CD9A 3DMTA 4ASUD 3K1ZA 1H42A 4ENTA 4F6RA 4IKEA 4HTFA 1JEJA 1R74A 3HDYA 3PYLA 4HWOA 2Z56A 4JDUA 3RRJA 1N77A 1KI6B 5FOTA 3THWA 4BPBA 3ZOKA 3WMWA 3RYHA 4HAOA 4TWBA 3WXBA 1FA9A 1NE7A 2W0MA 1WUTA 4GDFA 2DWCA 3OZSA 4ZKEA 1U8ZA 4EEXA 2FKAA 5F4ZA 1KHTA 3O8OB 1FP2A 3U7QB 2PKRA 1Z5PA 4DR5B 1L7RA 5FL7A 3ZKWB 4ZMBA 5LMCA 4HBZA 4AJJA 2OL4A 2QS9A 2IZZA 1ITZA 3OF3A 3R8FA 3HJFA 1CJCA 1W94A 1XBTA 1F48A 2OV4A 4IIBA 2V9CA 4A1FA 4RCZA 2W6IA 3I9OA 4X60A 3SQXA 4KWIA 2B83A 2HK8A 2R25B 1JB9A 4GUAA 1ENPA 4YRJA 2O5CA 1KI6A 1ZUNB 1FYVA 3A1UA 2C9BA 3MS7A 5GY7A 3TRFA 5CW1A 1LNQA 5AVXA 2JEOA 4RE5A 3SQDA 3H0CA 5FBRB 3ZCRA 4N6OA 5DEOA 1Z0JA 4TL7A 3W4JA 3DKIA 5JSKA 5I8WA 3FI0A 3JQ9C 3ZGZA 4M1SA 4U6QA 2TYSB 4FUTA 5FKJA 3IP7A 2C5EA 1IG0A 2XTJA 4CT4B 4D3SA 4D7AA 1NOIA 2GAAA 2CVZA 1D4AA 2ZJ0A 1P75A 3W6UA 1FNSA 1Y9JA 2OCBA 3C8DA 4HWPA 4I50F 3T3HA 4BMNA 1Z7YA 1MOQA 2XWJI 3KKNA 2VJYA 4CLDA 4PHCA 3LY7A 2VNKA 5ITZB 2QYOA 1EK6A 3QVVA 4HX2A 4M60A 1SHKA 1Z7WA 3SDZA 2VZLA 3PSHA 1WBBA 3Q6MA 5KSYA 4FFDA 5K6RA 5LD2B 2QNRA 4LBVA 1E9VA 3PRHA 4RKFA 2J9XB 2RH9B 4GI2A 4IVPA 1ADJA 1MXFA 3TPFA 3HCPA 2HJ9A 3L4SO 2RI0A 4MULA 1PYDA 1ZG3A 2ATVA 3G8YA 1D03A 5IPFA 2YV2A 1ZM9A 4BX0A 4DL9A 1NOKA 1X9IA 4L02A 2GZRA 3OZTA 1QP4A 1RP7A 1W4ZA 2IXEA 3SSOA 3ZBTA 2YJZA 3DE2X 3RODA 1O3YA 3W3AH 5GV8A 5G4LA 1J1UA 4EJMA 1X8LA 1GZ6A 3ADOA 2P0EA 3HP4A 1CY8A 4B46A 4QUEA 4PSAA 4MEAA 1XP8A 3FHCB 3HSYA 4L5YA 4YJHB 5JWHA 4BP3A 4GVLA 2ATEA 1NATA 3AKCA 4F4CA 4PZEA 4DLTA 1VDZA 1KXJA 3WLFA 1MX3A 3AUKA 3KD2A 2N42A 4V02A 1OV4A 2HRQA 3HKBA 1VQ1A 1NW3A 1BOFA 5ALVA 1NSYA 1YL7A 1PBNA 3E7PA 1BMQA 4OL9A 2BLNA 4PXYA 4WY8A 5A5DA 1ZKMA 4JI1B 1VG1A 3BVPA 2FLVA 3CSUA 3PA8A 2COEA 1TYZA 2HA6A 3GNSA 5LP6C 4MWDA 3F1LA 5H81A 1QS0B 1T10A 4ADSG 5SZJA 1XZ8A 2AD1A 3QUAA 4EPYA 3ZZNA 5C1DA 3NFYA 4ENVA 4YECA 2C9ZA 2RBKA 2MSNA 3FGPA 4QVGA 3C8ZA 2FWJA 2VQDA 3B1FA 1LLDA 4Z4IA 1UOEA 5JLAA 1VHJA 3HR8A 1LSSA 4F96A 5EA2A 4CMKA 3JQ8A 3TSZA 4F9FA 2X9LA 2YIDA 4D92A 3U7JA 5LIRA 5LM3A 3F78A 1ZUWA 1ZZGA 3BZWA 3DFZA 3RWMB 1YFZA 1YO6A 2YRFA 3NG1A 1N5JA 2C3PA 3TNFA 2CNWA 2H5LA 2XMBA 3OCZA 3OJWA 4WXEA 5AVOA 1LX7A 1XDWA 2IL1A 3B6JA 3EBOA 4KPEC 3WVNA 2D06A 5DTRA 1HMPA 4DLPA 5C31A 5HKKA 3VTFA 1QU2A 3L49A 2DT8A 1K5PA 3GG9A 4ZOLF 2JI7A 2XZTA 3FYTA 3ABSB 5KSOA 1W581 1F0KA 3OHPA 2IZOA 3LLCA 5KWVA 1O58A 4U39A 2XUFA 2ZSBA 2XDAA 4Z9AA 4DYHA 4A91A 6AT1A 1V7CA 2PVSA 1LZLA 3LYHA 1JWAB 2O3SA 2I2BA 2G5TA 1P62B 5C5CA 1PO7A 4M87A 4AP6A 5HJEA 3ND6A 3G8DA 4G1CA 1TF7A 2VH1A 3L1HA 3KZOA 2XUAA 5CK4A 1XVIA 3E05A 3F7NA 2ZSUA 3DEIA 4IF4A 4LAFA 1V26A 2G83A 5EJFA 3MD9A 2VHVA 4YJDA 5K05A 1P81A 3S3TA 5I01A 1WV0A 4JEMA 1U7WA 3IULA 3ZHTA 1T2EA 3L7MA 4YBZA 1FTQA 3Q3GE 4RKQA 5EVJA 3ZZUA 4DNXA 5L3QA 3ZXIA 2WYHA 1BD4A 4B4UA 3DZGA 5IJ9A 2HFJA 3IJ5A 3BICA 5D01A 1C7RA 3HGMA 4HLUC 1R64A 4OFBA 3MCAA 1SQ5A 3U4DA 4NE2A 3BMOA 2K7FA 4PFKA 3IUPA 3WNCA 4Z0NA 2PKWA 1YOBA 2ZE8A 2FFAA 1NAIA 5KSPA 5F2KA 2R86A 3IQEA 1QPGA 1PAUA 2DFVA 3CJTA 2YH2A 3PQ2A 2LR0A 2Q2VA 1HKHA 1YZKA 2Y68A 1CFZA 1UC8A 2OLEA 2IITA 3KFXA 5ARBA 2WOOA 3LVFO 4ZAGA 3N58A 5HMLA 1L7EA 4J3FA 4BRUA 4MV7A 4HN2A 2GZSA 2WHYA 3E8XA 3T5MA 4CKWA 4FI3C 1GGFA 2O3RA 1TZMA 3ANMA 5L7TA 2GF2A 1AO0A 4W1SA 1COZA 2Q7XA 4YJ2F 5J5AA 4P33A 4NQRA 3I2GA 2ZOSA 3V4PB 1QDLB 2WMDA 3LMKA 2QRLA 3IUJA 1D2EA 2L42A 1SVMA 3MBOA 3QXXA 3LBFA 4GSKA 4A8JA 1QH0A 4AFNA 5FWYA 4LFCB 4AZ3B 5IKPA 4BTEA 3RVQA 5FI1B 2HJSA 3CZAA 4ARUA 5L40A 4D2IA 3BKWA 6GPBA 4OI1A 3FNRA 2HIHA 3EIOA 3KQMA 3NLLA 3GL9A 1G1AA 4MI3A 2ZUFA 2HT6A 2P5SA 3CLKA 4IOLA 1Y3IA 1KTIA 2Q7OE 2W2NA 1IHDA 3LRXA 1NVGA 2MT9A 4CL3A 4DWJA 2WJIA 1PR3A 1E69A 2RONA 3I2HA 4MKXA 1Q20A 3V32A 1UZUA 4LGYA 3PNOA 4UE6A 1R8JA 2Q5JA 4KQKA 2EWMA 2QRGA 1E3EA 4KVFA 3LC7O 3AU8A 1D07A 2VXOA 4UNSA 5LYJA 3O8LA 2QD5A 3WS7A 1CUBA 4KXMA 4QAQA 4C4SA 5JG7A 2QRUA 4MWCA 4V0KA 4EFLA 2JBHA 4YAJA 4BE7B 1EDEA 4DLWA 4Q03A 4CCAA 3LVRE 2CHGA 4FOPA 4LZNA 2E4YA 3DNPA 4F38A 1COWA 5C80A 4UQOA 3RAJA 3LPAA 3OSUA 2PXHA 2ZAOA 2ZJ3A 1NVWQ 2IWHA 5FPKA 3R4VA 1BE6A 1GL7A 2O0HA 2VRNA 5MGNA 1YA6A 1YVPA 4BBPA 2FRDA 5ECWA 4LYHA 2A5YB 3CONA 1AGRA 2AR0A 3QLUC 4FI3F 1LI5A 3AB8A 2GPSA 4XPIB 1VZ2A 1P0FA 4KW7A 1RJWA 4JLWA 4AAYA 2UUAB 1TMYA 3OC6A 4QHSA 4BP9A 2IODA 2QTNA 5C51B 2Y77A 2QN1A 5DT2A 4FOLA 3WBBA 3V34A 3WMEA 1F2UA 1O94D 2AMYA 1YNSA 3HEMA 2VRCD 1TFUA 2B6NA 3RVMA 1VIDA 3E35A 3IAEA 1TJ4A 2D5BA 2HHCA 3PGA1 1MQSA 2FWBA 1B0AA 5B64A 1PQUA 3Q40A 1Z88A 4Q3AA 3A1VA 3TNYA 4KIWA 3U48A 4EGQA 2P9BA 1BSVA 3AY0A 2L0XA 1E2FA 1KZ9A 1UWLA 2XSZA 2XXJA 3GAZA 4L8VA 4DYDA 4TSKA 4BAGA 1A50B 4YT5A 4MW5A 5AM5A 4XLZA 4BWGA 2B98A 4KB5A 1XTSA 5CH5A 1YK0A 5EJIA 3TLCA 5K6TA 2ZULA 4NWIA 3R0XA 4R7TA 1DO8A 4ZODA 4CM9A 1KPGA 2AJLI 4MYUA 1CNEA 4MV1A 4WUTA 3GA5A 4MA0A 3RRBA 1X19A 2ZJZA 3OFNA 5C8YB 4DIDA 1JBEA 5DBHX 1W34A 4Y7DA 4A6PA 1DRWA 2C57A 5GVRA 1BEEA 5BQ3A 2Y99A 2PL1A 3R9XA 1EWQA 2V54A 1RXVA 3L2OB 1LBTA 3U0VA 4QJ4A 3P27A 2QN6A 4YALA 3U62A 4EVQA 5FUQA 1K88A 2R6R1 2JLZA 4D0LB 1OBVA 4WEOA 3R09A 3A11A 5J1TB 5JECA 1EEXB 1F6DA 4ZTBA 4JIMA 5HSGA 4TKVA 1UKVY 1UPAA 3LCCA 1HT2E 3OEHD 5LVAA 2JHPA 3ZDRA 3AFHA 3NORA 4I6GA 4F3CA 4WKBA 4O02B 3ZV3A 1N5OX 2GWHA 3CRW1 1E92A 3DAYA 2PR7A 1SXJE 4UUBA 4NXMB 1BDBA 1W4LA 2IZ5A 3SJUA 4Q9IA 4ZCRA 1WLYA 1VL1A 1NJ5A 3COPA 2ODAA 3GD7A 3W06A 4HTFB 4I55B 3FGNA 4TRRA 2AUNA 4ARVA 3ZHVA 2R2AA 1GLNA 3BMNB 3G2MA 3P4XA 1LBQA 1QFJA 1MA3A 4L6AA 5E0OA 4HQ0A 4P7KA 5A6SB 5TJHA 3RYIA 3KWLA 2Z5FA 4D8TA 3HXTA 4FS3A 1KEVA 4K2AA 5B3AA 1FE8A 2H4ZA 1IZ7A 5EJGA 4NZPA 3UWOA 4EK9A 1GQYA 1J7JA 4RPKA 5AW2A 2BMVA 5J4KA 3E7FA 1GEGA 1E9RA 2V4UA 4MP3A 4OBEA 5CT6A 1TK9A 3BGVA 3UJDA 2FOLA 2C8JA 4LBYA 3MTBA 3PNVA 4X8OA 1PFKA 5IM4A 5F21A 4R1LA 4DLYA 4YPOA 4P81A 4UZEA 2CKMA 2QB5A 3EGWA 1A0OA 5ILGA 3LLSA 3QF4A 4LVCA 2Z4SA 3IVAA 3QEBZ 4Q7EA 1GFSA 3BC1A 3TTYA 4YRGA 1P3DA 3R7SA 3HI4A 3WTBA 1O57A 1SVLA 1CP2A 3C6QA 4PX3A 4PE5B 4QASA 3BX1A 3NAMA 2GAJA 1FRQA 1DCFA 1JXQA 2IUYA 3NM4A 4OFWA 5JZSA 1JXMA 1JYSA 1YC2A 4QHYA 4J16A 2X3UA 2IXBA 3CWCA 3N2IA 1ZUHA 4Q6BA 4C7XA 4LSGA 5JCJA 4DBZA 3FG9A 1M8PA 4LJKA 1L8LA 3O2NA 3R6LA 4QGFA 2ZRMA 5JQGB 4TWZA 3ENKA 1WKBA 4Q3DA 1OLXB 4HQRA 4RNDB 4IXWA 2OO7A 3PXGA 4RPIA 3DZCA 2QU8A 2BN4A 4RNCA 4UM5A 5ALKA 3UT6A 5EE5B 1JB1A 3NOVA 2OBNA 1GVHA 3X1ZA 5F78A 4XQ0A 2FMHA 2C5BA 3RWBA 3CLRD 3GEHA 3HJHA 4MI1A 5K7SA 1FJ2A 1PFVA 1T9ZA 4HZGA 4LZPA 1MB0A 2XKAA 3CLUD 1FVOA 4LIPD 4RKYA 4E4TA 3ZBQA 5IXSA 1IBCA 2DHRA 2J6IA 5FT9A 4D9MA 4YUZA 1S1CA 1SBYA 3A6GA 3F8SA 2GK3A 4BFCA 2XB8A 3F74A 4WXPA 1B93A 2J08A 2H31A 1PR1A 3I2KA 3KL4A 3DWFA 3PDJA 4D74A 2BSAA 1XVVA 1YZVA 2ETXA 2PMCA 1YJQA 2PO7A 3N8NA 2UVQA 3DOIA 3PFCA 5GJCA 4D9BA 4Z3OA 2QMQA 4I9HA 1OIVA 3C85A 3LIPA 4W5RA 1JU3A 3QPCA 5FAXA 1U3CA 2M6SA 2F3UA 2HKIA 3FM9A 3N74A 3G1TA 5E9WA 5EY5B 1E3QA 1Z83A 1WCV1 1JQLB 1IEQA 1TDJA 3OKCA 4DJ5X 4FW9A 5DGDA 1PSZA 1Z06A 4L0CA 4QGSA 2OC9A 2ZB4A 2R6AA 2YW2A 3A6JA 1USGA 4ZO8A 1IM2A 3RU9A 4WASA 4C76A 4MW4A 2OB2A 3FPCA 4ETIA 5GM1A 3N5CA 4ZVRA 1XZNA 1JG2A 1QYXA 1SCUB 3KKMA 4KAFA 2PRZA 4JP1A 5BSKA 4W6QA 4UMVA 2W90A 4WN9A 5T3UA 2P2CA 3PWTA 1TU3A 3H19A 2FSVA 3MRTA 4KVAA 1I5EA 3IOMA 4RVDA 4L8FA 4BLOA 5EKTA 1C7FA 2MYPA 1E7SA 5B58T 5AKIA 4QM7A 2OAP1 2QLTA 1DADA 4Y98A 1G98A 4QQNA 3BMQA 3BXOA 2FMKA 4YFYA 4CR7A 1X2EA 3IEMA 3LHIA 2QTRA 4FFMA 2FP4A 2SECE 5FPHA 3PFBA 1GFZA 1EZ4A 4JJIA 2YDYA 5K0EA 2R62A 4TN5A 4W5JA 1S7GA 2PA3A 5TF4A 5A3JA 2GBIA 3IOYA 4LHYA 1JSZA 5CG2A 2NWQA 3QPWA 1T2FA 3FTFA 5D8DA 2QRHA 1E4OA 1D6SA 1PT5A 2Z1NA 3LM8A 3EDOA 4YA6A 2IHKA 1L4LA 5J2UF 1HZZC 3G2HA 4ECEA 1L5HB 1GPBA 5BPHA 1RBMA 4P35A 3RBAA 4F3NA 3D8UA 3W78A 1RM0A 1YR2A 4GUDA 4MV5A 5FFFA 2W2KB 3NONA 3T7RA 4C04A 4CM7A 2V7VA 3EMDA 3KJFA 5TQVA 2D1FA 1THMA 1CUZA 2XNHA 5LZ5A 2VN8A 2YZGA 1E77A 2V96A 2IXGA 3Q98A 4FZVA 4H0NA 4IO0A 2R85A 1Q7GA 1UK6A 2RGNC 3IP8A 4K88A 2YVQA 2AZ4A 4OGGA 5A4AA 2AG8A 1PZNA 5IFLA 1USWA 5ALQA 3A4NA 1UXIA 2ZIUB 5PGMA 4TTQA 3Q85A 4TTJA 2ZRNA 1PIWA 1W59A 4IMPA 4OBXA 3HM2A 3JWIA 3ZV4A 4MP6A 4LF5B 3Q15C 1SIWA 4GMKA 3P0RA 4QOGA 2OYRA 4NFHA 1PV2A 3PXCX 3SJAA 1RYDA 2XKBA 3DL4A 5GP1A 3C5WP 3HBJA 3RJ9A 1QRUA 3L82B 3LA6A 5HIJA 3L84A 2GYUA 4FILA 1NFQA 4CIAA 2ZYIA 4IEIA 4AMUA 4JUDX 5HOEA 4PTLA 3UWDA 4E31A 3SZOA 4YUYA 1PQ4A 4WBNB 1E79D 2R5FA 1WHSA 2FN3A 1ZICA 2WIBA 4XM2A 4EVIA 4GPD1 1G3IA 4LPSA 1YR7A 4J9VA 4ZAXA 2ZRGA 2XYHA 3GRAA 1DKUA 1RCTE 4QDXA 3J7TA 3Q3IA 1K6JA 1PWZA 2EW8A 2OTCA 1GY8A 1KEEB 1XPJA 2SBTA 3CG4A 3IO5A 4HMQA 4LSZA 5ALZA 5G4KB 1ZH6A 2ZB3A 4KGDA 5J23A 3UXYA 2O2JA 1I3KA 3WL6A 1RZUA 5FLEX 2PWAA 3VNVA 2WKRA 3FKQA 1H05A 4I36A 4MQUA 4ZT4A 2J0UB 3QMMA 2W37A 3CNBA 1OLOA 3RAFC 1E3SA 4QEKA 5HZGA 1ZC4A 1L1QA 2GTIA 2WJAA 3DMFA 1PJBA 3TKYA 4GGMX 3U17A 3IQGX 4FHZA 4JKOA 4X6XA 3K9QO 1WX1A 4HSEA 4Q3BA 2F1IA 2OV2A 2PS3A 1S3SA 2Q3CA 3NTUA 5T8KA 3T7IA 4BPRA 2EZ4A 5COQA 4G2TA 5HKAA 1WTAA 3K70B 1NBME 3QE2A 4NCAA 1JPUA 4FCWA 1X70A 4ZQGA 4EMTA 2PZBA 2QRVA 1H9BA 2R6HA 1Q7RA 1MW8X 5EP1A 3MIZA 1CVRA 3LHSA 4MDEA 2RH8A 3CLVA 1V3VA 3A1FA 1XPUA 1C1XB 1BN7A 3E53A 5AUOB 4XW2A 1FQJA 1P7YA 4GP6A 4B75A 2WTBA 1U1DA 2ASVA 3HHEA 4QGGA 4BGDA 1B42A 1L4KA 1PDOA 1OT5A 1UC4B 1GKLA 4TOIA 3ZQKA 1USUA 2UYYA 1N5IA 4GLOA 4C2TA 4M1YA 1M0SA 1DJPA 2DUMA 2PVPA 4NE7A 4AP5A 4R1QA 5A9RA 3NU1A 2XQVA 4XGRA 4MVJP 3PRJA 1R10A 4UE2A 3SSMA 3UKOA 4MQMA 4DPMA 5JPDA 1WB5A 3RW9A 5KYNA 1MV8A 5DNCA 1HGXA 4Y6SA 3VZDA 1VKHA 4G5XA 4W5NA 4LG1A 5F64A 5SZIA 3MLEA 1BHJA 1CK4A 4PYKA 2QTZA 3T7CA 3SEAA 3WOHA 1AC5A 1YMQA 4V0ME 2R8OA 5FP0A 3I3OA 3JPWA 3ILSA 2BEVA 4TSRA 3K9GA 1PNTA 4R54A 3UW3A 3X1XA 1TT5B 1DPFA 1Q50A 4QE3A 4E30A 5HKKD 4MLDA 1CQJA 3X1DA 1IFXA 3PKZA 1XF1A 1M2VB 1VPLA 1A9QA 4KVZA 1TKCA 1K68A 4P7FA 4IQGA 3LG2A 5K1ZA 1JIVA 3IP6A 1XEFA 3VKWA 1I7QB 2LE0A 1IJEA 5IT5A 1G63A 1LF0A 4UEJA 1OYOA 4KGVA 1XR3A 4UOQA 2VH2A 4BC1A 3PIIA 4DADA 1T3GA 5NULA 1HOXA 1B2RA 1P0PA 3HP1A 1VMEA 2ZQZA 5TMDA 2HW8A 2O19A 1PN3A 3AGQA 4OJQA 4KG7A 1QZZA 3OZ7A 3TMYA 4FSHA 4IVNA 2NQ2C 4OKNA 2XWPA 1ODSA 3FDZA 4MUHA 2ILTA 3C8MA 3KVVA 2G1AA 4E2XA 5JTTA 3RD5A 1LTKA 4U7JA 1XDZA 5GV7A 1UJCA 4UUPA 4KMMA 1T4BA 1EVLA 4H31A 1CIVA 4Y1FA 5JJIA 2ZROA 2GCGA 1OPXA 3PPYA 2NPIA 2GK6A 3QUCA 3IQFA 4KPFC 2WWFA 1NG9A 1GQFA 1QE5A 1P4HA 1ZH4A 3B7PA 4MS1B 1DJQA 2C88A 3EWSA 4CN9A 2OK7A 2WSYB 2BR5A 1SG0A 2RG7A 4GPZA 2IPAB 1ZM4A 4G8JA 4R0MA 2NV2B 2FXIA 2UZ3A 1VBKA 3A1WA 4QECA 4JQCA 4K5QA 5E3JA 1CJVC 3ZVMA 4R8RA 1H9CA 4EYEA 5M7EA 2W2OA 2GXAA 1PW5A 1NXOA 1I6KA 1N7HA 4X1KA 5LKRA 3OPYB 3E9EA 1UJMA 3DDUA 1RYHA 4RO0A 5A3SA 4Q7JB 1CJTC 1FLDA 3OIFA 1E2MA 4KQ6A 1EBBA 4OQPA 1A98A 2I4IA 2Q9CA 4GMGA 1NXPA 4B33A 3Q0EA 2RBEA 1NBMD 1PR4A 4XSHA 2I4RA 1X0XA 5TR9A 4DZTA 2IX3A 4P5EA 3RIHA 3FE2A 4KRYA 3WADA 3EGVA 4EHBA 1RNLA 3HVRA 1SUIA 4KFTA 1CRWG 1JFVA 1OH5A 3I62A 2F48A 4M1TA 3AZQA 2FUNB 2WAYA 3DM5A 5H5JA 4QUGA 4DA6A 2F3PA 1KK1A 2AYYA 5BO5A 3FOEC 1DDOA 2RK6A 3BEOA 4ZYTA 1W87A 5CFNA 4O1HA 2ILVA 3H8JA 4PRZA 3QQ5A 4Y2RA 2LV8A 3OIVA 2NYRA 1GLVA 3ESYA 4O4IF 3U09A 2OG2A 3MJ4A 2YL2A 5DCYA 1GNSA 1NKVA 2MCFA 2DERA 3W8FA 4FJ1A 3GJ5A 2PAFA 3TEJA 4QIHA 1AUVA 3KIPA 3JZIA 4FS8A 2PO5A 1IN7A 1QRDA 2ZRIA 4PQYA 5DASA 3KYIB 1TJPB 3RJ5A 2XT0A 3BCRA 4AJOA 1LDBA 3LDAA 4FCTA 3FRHA 2H2HA 2BPOA 4GX1A 4FGKA 3WGYA 3PQ3A 1A5AB 1OH6A 3BXEA 5AQEA 3L05A 1WUHS