1PZID

Heat-labile enterotoxin b-pentamer complexed with nitrophenyl galactoside 2a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3,5-Substituted phenyl galactosides as leads in designing effective cholera toxin antagonists; synthesis and crystallographic studies
pubmed doi rcsb
molecule keywords Heat-labile Enterotoxin B subunit
molecule tags Toxin inhibitor
source organism Escherichia coli
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pziD00
3EFXD 2IPKD 1EU4A 4UDUC 1FD7D 1AW7A 1FNWA 3DWAA 1CHPD 1XXGA 1LT3D 1SBBB 1F77A 1V1PB 3BYYB 1MD2D 3OWEB 1KLGD 3BVZA 2WV6D 3O13A 1GOZA 1LTRD 1JQYD 1UUPA 5D3DA 1D5MC 1HTLD 5ELDA 1LT6D 2G9HD 1EEFD 1SEBD 4C56C 1HQRD 1LTID 4L63B 2NTSA 4RGOS 3CHBD 1S5DD 2AQ2B 2XRQD 1RF2D 1QILA 1SXTA 1PTOC 1TS5A 1T5XD 1ESFA 1SE3A 1SJHD 5FKAC 3R8BA 1EU3A 1JWSD 1TY2A 4RH6A 2NTTA 1BCPC 1RDPD 4DXFA 2O2LD 3MFGA 4RGTA 4TSSA 1JCKB 5TSSA 1KTKA 4OHJA 4RCOA 1L0XB 1TS2A 3BVMA 5D3IB 1ET9A 1I4XA 1I4PA 3EA6A 1V1PA 1EWCA 3URYA 1S5ED 1DYQA 3DWPA 2ICIA 2RDHA 3R2IA 1B1ZA 5ELFA 2CHBD 1ENFA 1PTOH 2SEBD 3BYTB 3SEBA 2Z8LA 3R2TA 1PRTC 1LT4D 1LTTD 1PTOD 1XTCD 1S5FD 2XN9C 1FNUA 1G8ZD 1JWUD 2AQ3B 1SE2A 1D5ZC 1BCPD 1I4HA 1LTBD 1AN8A 3GP7A 1UNSA 1LT5D 2J4XA 1FNVA 1CK1A 1HXYD 4ZYSA 1JWMD 2XNAC 1RD9D 1I4GA 1I4QA 1CQVA 1PRTF 1S5CD 1CT1D 1EFID 1LTAD 1PTOF 2IJ0A 4BWGB 1I4RA 1TS3A 4K6LA 1B44D 1HA5A 1BCPF 1PRTD 1L0YB 1PRTB 1SJED 3V05A 5ELBA 1PZJD 4O1NA 1S5BD 1TY0A 1DJRD 1EEID 2TSSA 1BXTA 1PTOB 5I4DA 3MC0B 4RGMA 4RFBA 1PZID 1LLRD 1TS4A 4L6TB 1LTGD 2XRSD 1LO5D 5ELCA 1SE4A 1BCPB 4Z9CB 4RHRA 3BZDB 2QILA 1PYWD 1D5XC 4RGNA 1KLUD 4DXGA 2QEJC 1D6EC 2RDGA 3BVGA 1V1OA 1PZKD 1STEA 3KLSX 1FGBD 1LTSD 5ELEA 3W2DA 4RHSA 1CHQD 2R61A 2AQ1B 5FK9C 3TSSA 1RCVD 1ET6A 3DWQA 1M4VA 1JR0D
chains in the Genus database with same CATH superfamily
3EFXD 2IPKD 1HR0Q 1CM9A 1HCZA 1N34L 4JI3Q 2NZHA 2CQOA 4KHPL 3OWEB 1EIFA 4KMUC 4V190 4X62L 1YNNC 3NUCA 5C44G 2DUDA 5EKLA 3N6RA 5JOBA 1HZ9A 3CCUA 2NVXH 1A63A 3BZCA 3GTKH 2VB2X 4GS3A 3RNUA 1VCIA 4JBWA 2FMCA 4CBVA 2RBMA 2BE5D 2A69D 3FPUB 1SN8A 4FF2A 1S5DD 2D2CC 5M3MG 1QNKA 1KHIA 2F52A 4K0KQ 4HCSA 2FJ2A 2OQKA 1PMRA 1B7YB 4DR3L 3GTMB 4K8JA 5TSSA 1JCKB 1YNND 3MVVA 4IFDG 1JJGA 4KN7C 3CCJA 4DV5Q 1C9OA 4JK1C 1NMFA 2F0WA 4F7XA 4O0AA 1HA6A 4G7OC 3RD4A 4AQYL 4JOIC 1HRJA 1SNMA 2SEBD 4DNTB 3ZYYX 1PRTC 1OXXK 1S3OA 1AZQA 5IT9c 4OWTB 2WB1G 4OL7A 1SE2A 5ELNA 5AJ3L 3JAML 3ZJYC 1HHVA 2VQEQ 1J6QA 1AFPA 4B3RQ 3HOZH 4IURA 3PUVA 5BN4A 1GHKA 3ND9A 2M2LA 4A3LG 2QKIC 3D6WA 1GUWA 1TWHH 3QR8A 4DK3C 3D6CA 3PO2H 4B3TL 4DV3Q 4FF4A 2C35B 3P75A 4KHVA 1N32L 1PRTD 4DV1L 4OGQC 4LF8Q 1KDCA 3F8TA 1SYGA 4EQOA 4LFCQ 2Y0SE 2F0MA 1K0RA 1BOSA 1WD1A 5HURA 1PYWD 3QB3A 2ASBA 4HEDA 3SK4A 2I5LX 2R7ZH 3MEFA 4A3GB 4IUVA 3MXPA 3CMEA 2VUMH 4V0BA 2R61A 4C3HG 4HJ5A 5HGQA 2EJMA 2MPMA 4NXML 1E24A 5K36G 3B6YA 2B39A 1D7QA 4BY1B 4X64L 1PFBA 1H95A 5HGTA 5C4ZA 3CCVA 1FVIA 5IYCG 5AFWA 1N34Q 3P20A 5LL6X 3EBEA 3KLRA 4KHPQ 2L1BA 1XPRA 2JP1A 2K28A 5KGUA 4NW2A 1F9RA 2K5DA 3AFPA 4X62Q 1BBWA 3NQTA 4M8AA 2KOLA 3CCQA 4A3JG 3AYHB 3EIVA 2KVMA 4RAUC 4OWWB 3AEVA 4XT3B 1K3RA 4BY7H 3CHBD 4I65A 2VY3A 4G4KA 4AYBE 1ASZA 4ZRZA 1PTOC 4A3EB 5M9OA 1YHBA 2JA6H 3TZUA 3MXNA 3PIOA 1Q3LA 2D0OA 1HZBA 2EY2A 1RTOA 1YVCA 1CFMA 1XWEA 3S17H 4EQNA 4LFBL 3M3YB 2D0PA 4DR3Q 1SMYC 4HCEA 2MHVA 1SNCA 4QY7A 3MFYA 3H15A 1PTOD 4AQYQ 1FNUA 4A3BB 3JAME 3R3OA 3M4OB 1NE3A 1BBUA 5LMNW 4OX9L 3H6MA 2F0OA 4IUNA 1QVFA 1CZWA 4ZYSA 3OIPA 5I9PA 1SRUA 5IT9L 4KY7A 4POGA 3PV0A 5AJ3Q 4O42A 2Q2UA 1SMYD 3T16A 2E2DC 2R7DA 1U9RA 3NWTA 1TS3A 4H02A 4N9PA 3AFQA 5LMNL 4DV0L 2YU9H 3TRZA 4A76A 2E5LL 3A54A 5KNCA 2PNRC 1YNJC 5EQ0A 5C3EB 4B3TQ 3GTOH 1N32Q 4DV1Q 5LL6S 1PH2A 4P73A 1L0WA 4CGYB 4J15A 1Y8OB 2QILA 1HQMC 3KJOA 2LXKA 3RLOA 4HIMA 2NZOA 4OELB 1N9WA 3NWSA 3KF6A 5CBEE 5IYBG 3C2PA 2A68C 3K5NA 3K7UC 5FO7B 1YNJD 4ZUJA 3G4SA 2Q8RE 5FK9C 4ULLA 5F2DA 3CRKC 4K5WA 1YBYA 2YTVA 3DWQA 2NVQH 1GUOA 1TXYA 3I7FA 3LGJA 5IP9G 4ABNA 3Q24A 4NXMQ 2MP1A 1KABA 1GUTA 4GLVB 3DM1A 1RJTA 3MA2B 3VR3A 3TMEA 3M7NA 3BDLA 4YCUA 3CF5A 3A7AB 4X64Q 2KA7A 2A68D 1VF5C 1E3PA 5E4XA 5ELDA 3L3OC 1E2ZA 1HQRD 1IZ6A 3TN2A 3F1ZA 3A5ZB 2EYFA 3SGIA 1B2TA 2E2JB 4N9TA 5FLMG 1ILQA 2N78A 3M9BA 5JVG3 2IY5B 1RHPA 4APVA 3RZOH 1TY2A 1K73C 1RDPD 1UEBA 2EE1A 2LFNA 4AYBB 4HIKA 1W2BA 5E7NA 1STAA 1TR5A 1I4XA 1VQ4A 1Z9FA 4A3KH 3UI2A 1XMOL 1A6XA 2EIFA 4LFBQ 1CZGA 3R2IA 3KYHC 2AUKA 1RL2A 2KENA 3E9HA 2F0TA 3I4LA 3K6OA 2Z4IA 3Q0AA 4OWXB 5IT9E 1M90C 5JJKA 1Y1WH 3PMFA 5IYDG 1IBLL 1CQVA 3T1HL 3KF6B 5KNBA 4OX9Q 2BH8A 3LWUA 1TIID 1CTMA 3HP3A 1I50B 3CC7A 3Q8DA 4JI2L 5M3MB 3P1HA 4R8IA 1A3VA 2SDFA 2NN6G 2IHEA 3I2ZA 4A3CH 4H7BA 5C4XG 3V05A 4JI5L 1S5BD 5LMNQ 4DV0Q 2ZTDA 4JI1L 3PF5A 2DNCA 2E5LQ 4RKLA 1JJ2A 1LV9A 2B2YA 1R9TH 1EWIA 1VMPA 2KCNA 1SYFA 4LUVA 1OXSC 5GAHC 4FF3A 3A0JA 1I6HH 5EAYA 2Z6BA 1NJIC 3OHXC 5DLQE 1X3QA 1VQDA 4DR5L 2IX1A 3HOWB 1STBA 4PV1C 2EOTA 2R93G 3X3NA 1SYCA 1EY0A 1MI2A 3I4OA 2F3WA 2BA1A 3CD6A 1E1TA 4QMGA 2PQAA 1SFOB 1M4VA 4GKJL 2NVYH 4N8X1 1N36L 4BXXH 4A3FH 4XYQA 5ISRA 5CV4A 3BYYB 4PMCA 1F2MA 5IE8A 3NTIA 1MBYA 5JJIA 3PO3G 1EYCA 2VW9A 3S15H 1IL8A 1B8AA 1HTLD 4QQBX 3VR6A 3S1NB 2G9HD 3S1MB 1LTID 5DEHA 1UE1A 5GROA 2AQ2B 1RTNA 1EZ8A 3KK7A 3DXJC 5GAEC 1Y8NB 1NAPA 1SJHD 2GA4B 3MAQA 1IL2A 1JWSD 3OWFA 4RH6A 4L5RC 4EGVA 2M00A 5M5XH 2K33A 3QO2A 4A3DG 5IODA 4C3HB 4RCOA 1J8IA 4PQXA 1ML0D 1HH2P 4X3TA 4DNRB 4NDXA 1STNA 1A3TA 4C2MH 4FF1A 2Z8LA 3I72A 5CV9A 1XMOQ 2F3IA 1PH1A 1SNOA 4DNIA 3CMAA 3KDFA 2XTIA 1K0SA 2HIXA 2Z6KC 4WORA 3J80i 3PUXA 4A3JB 1QZGA 4HIOA 4M1UB 1CT1D 2P5ZX 3LWEA 1LTAD 3T53B 1K28A 1IBLQ 1NMGA 1H9SA 3H94A 3T1HQ 1GD7A 4NKLA 2A73B 4HR7B 4PZ7A 4UY8C 1A62A 2R92G 4JI2Q 2JA5H 2PQAB 3FHWA 4KHZA 1A8VA 1VQNA 3GV6A 1TWGB 1PZJD 4YHHL 1IBKL 4BBSG 3HOXH 2K5WA 5CBAE 2JEBI 3S1RH 4JI5Q 4IPGA 4JI1Q 1I6VC 3S2HB 3UE0A 5EGTA 3A74A 4A75A 1PH9A 1KAWA 2RCNA 3J7AV 5FO9B 4F8MA 1BBXC 1WYDA 2PZTA 4B08A 3C1FA 5I2XA 1P16A 2K75A 1YIJA 1VQ6A 1C7YA 1PZKD 1LTLA 4DR5Q 2G9DA 3NE5B 1VQPA 5CORA 1LTSD 4RHSA 1MSHA 1Q1EA 2CQAA 1K3BC 3M7GA 4LF9L 1PYBA 1WCMG 1JR0D 3W1BA 4POFA 3DHQA 2Z1CA 3H0GH 4ZUIA 2DGYA 1CHPD 4GKJQ 4LF7L 4GOPA 3PF4A 1F77A 3WWVA 1GKHA 4NB3A 1N36Q 4IQZA 3J80c 3I56A 5C6AA 2AUJD 4OXPA 4K5XA 2XGTA 1PA6A 1WOCA 3HOZG 1SEBD 2HQEA 3OW2A 5T1IA 3I4MG 3MWYW 3A5UA 4L8JA 1HUNA 4WRDA 3I55A 1VQ7A 1SNQA 3VA7A 1WTHA 1SE3A 1CKMA 2B8GA 1EYAA 3PO2G 2Q2IA 5J3BA 1NCVA 1H9SB 2UXBL 2RVLA 3TREA 4DV6L 5A2QL 4QGUA 3GTQB 2EZVA 1UE6A 2RDHA 5D65A 1PTOH 2PMZE 2E75C 2YV5A 4LAAA 2Z4HA 3R2TA 1LT4D 2ZJPA 4P71A 1UE5A 4JBMA 3K81C 3X3MA 5GQOA 1SE8A 2LXJA 3FKIB 5EPJA 1D5ZC 1XJVA 1SDFA 2LS01 1VQHA 3I4NH 4G7HC 4TKOB 1STGA 1TWFB 4FXKC 4DKAC 3GV3A 1SSOA 1F9PA 2B29A 5EPKA 4DK1A 2N55A 4JI0L 5JJLA 4FO2A 4IPCA 2F3VA 1M8AA 1TY0A 3FEWX 1DJRD 2TSSA 4C3IB 4YHHQ 2NZ1D 1NR2A 4QL5A 5BN3A 4RHRA 1IBKQ 5T1GA 4CJ2C 3S9WA 3S16B 4EX5A 4DXGA 3F2BA 4GZYC 5KYIA 1S72A 2C9OA 5FJ8H 2JA6G 4JBKA 1FGUA 1LYLA 4ME3A 4IN3A 1RCVD 2WINB 3L0OA 2B2YC 2K1BA 4BBRG 1B4OA 2IJ0A 1MGSA 2E76C 1WTPA 1SAPA 4LF9Q 3GTMH 2VNUD 5M3FB 3ITPA 2B63G 1SYBA 1STYA 1LUZA 2K50A 3DWAA 5M5WB 2PW5A 1EY7A 2JSOA 5C4XB 4XQNA 3CRLC 1XX8A 1KLGD 1WI5A 5EBCA 1WD0A 5D14A 4LF7Q 4QUFA 4IUQA 4YWLA 3CAMA 1Z6HA 2IT1A 1VQOA 1STHA 5CYUA 1DONA 4OO1I 1Q7YC 4OIKA 3J80L 1CSPA 4X3UA 2IX3A 4DR6L 1K9MC 4UP9A 4HTHA 1YJ9A 3QOLA 1E7ZA 4PMWA 2MO0A 3PIO3 2BH2A 1Q12A 4YWKA 1NBWA 4K8IA 1HZCA 1EQVA 1TKWB 4UP7A 4A3IH 1WTOA 3MZ5A 3S2DB 1ET9A 1HZAA 1EWCA 4UPAA 1NTGA 2ICIA 3BDCA 3BZKA 5JPNC 2UXBQ 1B1ZA 5ELFA 2CHBD 4DV6Q 4KKUA 3SEBA 3K5LA 4ID6A 3IL8A 4K5VA 1B3QA 3S1QB 4A4IA 4HJ9A 1K8MA 5JVH3 2KJXA 3GP7A 2KEEA 2F4VL 2PMZB 3LX0A 3OOCA 3K58A 5IGEA 3SDZA 4A3GH 1EY5A 2BDNA 1IBML 2F0EA 4CHTB 1Q90A 3K5MA 2KCMA 3SE0A 1ENCA 3VYUA 4NMZA 2B2WA 3KF8A 4JI0Q 4A3DB 1TWAB 1AE2A 5E3FA 4BY1H 5IOCA 4DV7L 5I4DA 1SYEA 5I6YA 1PZID 3F2DA 2RA4A 3CCLA 2SNSA 1V43A 1KRTA 3IKJA 5DM63 3ULJA 2B3GA 1KAAA 3DUZA 3RLFA 3GTPB 3EROA 2K14A 3CPFA 4A3EH 4KLKA 3OPOA 3NEMA 2ZJRA 1OTCA 2RHQB 3HKZG 2Q8TA 4R4TA 4A3KG 1PDQA 3KJPA 1R4PB 3HOVG 2R92B 1XXGA 3M3YH 1HNXL 5JEAJ 1RIPA 3W5OA 2EYJA 1WJJA 4MTKA 4GLXA 3TP7A 2FFKB 2LSSA 1PVOA 1C0AA 2L55A 4BBSB 4MIUA 1O7IA 3HOUB 3J80E 1J9OA 1IKMA 3UDXA 1KRSA 2JQOA 4A3BH 3M4OH 4UAIA 3I70A 4EVOA 3I8ZA 3VDYA 3VYRA 4DK0A 3K5OA 1TS5A 3RUZA 1T5XD 4JYAL 5CV7A 3I90A 1JB3A 1ESFA 4OIJA 4GOPC 4KY6A 1MIUA 2JYOA 5JEAH 4DR6Q 4JBJA 2L0CA 1GM5A 1K83B 1K8GA 4A3CG 3PUYA 4F87A 4CKEA 1GHJA 1I4PA 1WCMB 3URYA 4CJ1B 2ALYB 1D1IA 2K5NA 1BKBA 3P7JA 3KF8B 5C3EH 4TRDA 1TQOA 4G7ZC 4DF7A 1Q82C 3NK9A 3W1GA 1ZKOA 2B2TA 2I0QA 2SNMA 4HMIA 1VQAA 2BCOA 1B3AA 1IYUA 3IFDA 1I4HA 4ZQ3A 3HRZC 2WKCA 1JB7A 2ZJQA 1JWMD 4BS9A 2B2UC 1Z47A 3HOZB 2F4VQ 3I4MB 2AMCB 2F0JA 4YCVA 3U9SA 1X9NA 1H9RA 5C4JB 1JICA 4BXXG 2DY8A 2AWOA 4RA8A 3OIQA 3VYSA 4A3FG 1SJED 3T13A 3TQYA 1IBMQ 2I07B 4DAYA 2DNEA 2TMPA 2OCEA 3HS0C 1WFQA 4LJZC 4IPHA 4XQQA 2Z0SA 3OTOL 5FO8B 1KC8C 4DV7Q 1YJWA 2I5HA 4MHEA 1DZ1A 4GNXB 4LFAL 3D3RA 1JOKA 4K2LA 1QB5D 2QDBA 2A6EC 1PFNA 4LUZA 5ELEA 4KKTA 3W2DA 3IAYA 4TQUS 1X56A 2AQ1B 2E2JH 1ET6A 4A3MH 3G48A 1U5KA 4X65L 3PQIA 4K14A 5KRUA 3OMGA 2WB1E 1FD7D 2CVRA 4B3SL 3BG3A 2XWJB 3FP9A 4DUYL 4R9WA 3RN2A 1HNXQ 1E1OA 2A6ED 1YHQA 3J81i 3DEOA 1I3QB 1GUNA 2WAQG 4DR7L 3FVQA 2BDOA 4DV4L 1PH6A 1U4PA 1VQKA 1VQ5A 4LNQA 4WFN3 1XMQL 3ND8A 3TDQA 3QG1A 1I50H 2JA5G 4JYAQ 4RG1A 5M3MH 2OQ0A 5FLXc 2K05A 4BBRB 3A56A 4JW0A 3PCOB 1EQQA 3HOXG 4DAYB 1KL9A 4FYDA 4HJ8A 4R1JA 5IWAL 2B63B 3WOEA 3ER0A 5I2YA 3T51B 1D1KA 1Y1VB 3S14B 2O4XA 2A74C 4GN4B 3TP6A 2JA8G 5DNFA 4HIDA 5IGGA 2IL8A 4X6AH 4U68A 1J5EL 1A2UA 2PYKA 1NR4A 4G57A 3CQZB 5LHY1 3HOWH 2XNAC 5EBDA 3PIPA 2OTLA 1CI3M 1IKLA 3RZDB 4BWGB 2JA7G 3GQBA 1Z7TA 5IP7G 1GO3E 3HKSA 1B44D 2R7FA 1HA5A 2K01A 3H0GG 3C46A 1SFOH 3R93A 4CDDC 1I94L 3J81c 3FMCA 4A3LH 1OXTA 3MC0B 5C44B 1SE4A 5GAGC 4OO1H 3OTOQ 1D6EC 2RDGA 2OWOA 2QDLA 3DLLA 1K8AC 1Q8IA 4PNYA 4DFAA 3KLSX 3S1NH 4LFAQ 3NBHA 3S1MH 2B2WC 1X54A 1VQ8A 4H44C 3TSSA 3SXHA 4AIMA 1JJCB 3Q6SA 2NYZD 1EQTA 4C3HH 2IX0A 4X65Q 1B53A 1PH4A 2F0LA 4XIGS 4EQ5A 1QOHA 3CCRA 5GADC 4B3SQ 1KDBA 2WB1B 4DUYQ 2JK8A 1ILPA 1ZYRC 4LW1A 1DOLA 4DR1L 1EEFD 2BA0A 2UUAL 1XNQL 2ES2A 4OEMB 1U0LA 2F0SA 4AH6A 4I7AA 3ONAB 4A3JH 1RKNA 3C3LA 4DR7Q 1EU3A 2JA9A 1EOTA 2ZM6L 4DV4Q 2WP8J 2NVTB 2N88A 3NQIA 3MFGA 4IZ8A 3V2TA 4DPGA 5CGKA 1TS2A 2XSCA 3BVMA 1XMQQ 1ZYRD 3HKZB 2K5HA 1TWGH 1KDAA 1AEXA 4A3KB 1OXVA 2DJGC 3HOVB 5FLXL 3J81j 2UU9L 2XN9C 1X6OA 3I3CA 1S40A 5IWAQ 3BU2A 3S2HH 2A19A 4I7ZC 1EIHA 1AN8A 2G5DA 1RD9D 5IY0A 1I4QA 1W3SA 5HY6A 4C3JG 3SVMA 4KD3A 2GVBA 1J5EQ 3UDGA 3NBHB 3GO5A 2UXCL 4K6DA 5IGDA 3KOJA 3SHLA 1HFGA 3SK5A 1BCPF 1IHZA 2B2TC 5C0XI 5BR8L 1EY4A 1YNXA 2N3SA 1BXTA 1OXUA 1XPUA 5EKKA 4L6TB 4DV2L 2AKWB 1I94Q 1GJXA 1ZXTA 1BCPB 5IIFA 1L1OA 3CCMA 3J81L 3RLNA 3UE1A 3J7AF 1BUVT 2QEJC 3E0JA 1LABA 4R8NA 2R3ZA 2AHOB 2WACA 4DK6C 2HQLA 1STEA 2A1AA 1FGBD 3BJUA 3NBIA 5JJZA 1XNRL 2L12A 4ILWA 3PGZA 3K0XA 2GVAA 2K5QA 4QJFA 3UDIA 2KHIA 4A3IG 1UE7A 1CKNA 2F0QA 1PV4A 3NHHA 4J1MA 1AH9A 5J39A 3HEJA 4JCVE 4JI7L 4A3FB 4XT1B 1VQFA 1B50A 3GTQH 2UUCL 3K0YA 1A2TA 1T9HA 1GOZA 2EXZA 2PI2A 1JQYD 4IUUA 4EQPA 2E2HH 4HSPA 2KCCA 1LT6D 3S15B 4C56C 3FKIH 4RGOS 3HFZB 3E6ZX 2XRQD 1T5EA 3I73A 3M85A 1DOMA 4DR1Q 4R4QA 3LNNA 1TWFH 2UUAQ 1XNQQ 2V1CC 3KBXA 5EJWA 3GDEA 3RMHA 2LMCB 1KTKA 5FLMH 4OHJA 4BA2I 2CWAA 2ZM6Q 3CCEA 1L2FA 3HOYH 4QF4A 1DYQA 4KI0A 2BOSA 2KBNA 5FLXE 1QZHA 3VA5A 3TP5A 5BN5A 1YEZA 3NSWA 3BYTB 4C3IH 2E2IH 1Q8KA 1X3GA 3NTHA 1EZ6A 1S5FD 1KNEA 1JWUD 3U4VA 2C5CA 4B9XA 1L1OB 2UU9Q 4TVAB 2MO1A 4C1NK 2PCFB 1D8LA 1UEAB 1P8LA 1PRTF 1S5CD 3NELA 1EFWA 1VQIA 3UDFA 2WAQB 2F0HA 4KN4C 3QOJA 4K6LA 4LUOA 5IYDH 2UXCQ 1PRTB 2DJFC 1CKNB 1F9QA 3IFTA 4O1NA 5IGBA 2EY6A 3DM3A 3K7AB 3AQQA 5M3FH 5BR8Q 4JVZA 3J81E 2R7ZG 3PUWA 2NN6H 3HOXB 5ELCA 5C4XH 2PO4A 3S1RB 3DMUA 3CXCA 3F2UA 4ODGA 4PZ6A 2VUMG 4DV2Q 3CP0A 2F0KA 3D8GA 2K6AA 4XDXA 4HJ7A 2JA8B 3C1EA 1EIGA 1H9MA 4JG2A 3D0FA 5JEAG 3E9IA 2EQSA 3VYTA 3A8KE 1XNRQ 1HTPA 3RR5A 4R4IA 1A15A 1R4QB 2RF4A 1KXLA 2JA7B 2F1MA 1AW7A 5C3EG 3H0GB 3S2DH 4IFDI 4DA2A 1DD2A 1XTDA 1FL0A 1PFMA 1M1KC 4IUTA 4C1NI 5C4HA 4BY7G 1D2BA 4JI7Q 2IHFA 1KQSA 1U4RA 3O13A 3A55A 1CUKA 4L5QA 4IUPA 2HDLA 5D3DA 2UUCQ 2EYLA 2Y0SG 1VQEA 4L63B 3S1QH 1MJCA 1A3UA 3T1YL 2EPBA 4FXGC 3GTLB 1MKHA 3EQLC 4P75A 4H0LC 2JEAI 1BCPC 4DXFA 2A8VA 1Y8PB 4MN3A 1PH7A 4Q5VA 1V9PA 4DUZL 4JI4L 5CR3A 3MEHA 3NENA 4L5TA 3DWPA 1FJGL 1TWAH 1O7LA 3L7ZC 3GTGB 4GN3B 1TWCB 3HGBA 4QIWB 2OF1A 2HDMA 4DAMA 1QJOA 1C4QA 2FMMA 2HD3A 2R93B 4F88A 1BCPD 4JI8L 4PMBA 1I5FA 3HG9A 1UNSA 1HXYD 3GTJB 1SR3A 5A2QE 4A3MG 1EY9A 2X6LA 5M5YB 4KV6A 4CJ0B 1HNWL 1AZPA 1X3PA 4X3SA 3NPPA 2QF7A 4Y7NB 2EYOA 4AYBG 1F2YA 4YIJA 3QIAA 3J7ZC 2R92H 2HIVA 5G3LF 2HCIA 1HPCA 1VF7A 2RCFA 4WJWA 3PO3B 1NY4A 4BBSH 1EOVA 1KIXA 1A0IA 2WFWA 3HOUH 3BVGA 4P2CB 4DAPA 2E8GA 3SK8A 1SYDA 2N49A 2EVBA 1C8CA 2OT2A 2L9HA 4C3JB 3TEHB 3MTSA 5CC4A 3H3VI 4XYOA 2FINB 5C3XA 5ELOA 4S3SA 2KEDA 2LKVA 2CWPA 1K83H 1L1OC 3OW7A 1YHAA 2H5XA 2M9VA 5C0XJ 4CDCC 4P72A 5M5WH 4A93H 1BQQT 1MD2D 1WCMH 1BDOA 2HCCA 2JJQA 1CA6A 4DGZA 4LF6L 3Q23A 3FRPB 1B9NA 2F0PA 2A6HC 1RODA 1UUPA 1E0BA 4HJAA 3FDTA 3HOWG 1JE4A 2EY5A 5H1SE 4X66L 4QCLA 1EY8A 2N8NA 1RF2D 5KEEA 1EYGA 1QILA 1PYSB 2O5IC 3T56B 4KK7A 2EYHA 1AE3A 2Q2HA 1SNDA 3T1YQ 4DU9A 2ZXOA 5C0XH 2ZTCA 1EY6A 3I4MH 4YY3L 1L0XB 2KUMA 4ZKCB 5C4JH 1N8RC 2A6HD 4A3IB 3OMCA 1HUMA 4IPDA 4DUZQ 4GNXA 5CV8A 4JI4Q 2ATWA 1Y1WG 2NVXB 3D4WA 1PLFA 3GTKB 1FJGQ 3L9AX 1B70B 4OO1G 2J0TD 2CH4W 2QCPX 1X3EA 1EL0A 1FNVA 4HMJA 1VS0A 2K7VA 1E2WA 1SNPA 1VMCA 3WOFA 1BO0A 4JI8Q 2QA4A 3ERQA 5L37A 4LMQD 3PIP3 1PH3A 1YITA 4J6HA 3FPPA 3CCSA 4L5SA 1WVLA 1G2TA 1Q46A 1VQMA 4JI6L 2WKDA 2MUYA 3L2PA 1HNWQ 4HAEA 3OSOA 1QG7A 4FP5D 3EVQA 4B3ML 3E3XA 4B9WA 1O7YA 5CV6A 3U9OA 2DY7A 1UAPA 3U58A 4JV5L 5JAVA 1W6JA 2D5DA 1KLUD 2F0UA 1PHJA 1W6KA 3H91A 4KJOA 3BDOA 3KUPA 1X65A 3MXUA 1KNAA 1V1QA 1VQJA 4LWCA 5JPMC 1U4LA 3QJYA 3KLWA 3M4YA 1E22A 1I3QH 1XYIA 1TWHB 3PO2B 1SLJA 3G6EA 2NBFA 3Q22A 3A8IE 1DGSA 4R4OA 2PW7A 2EYMA 4ME5A 1ONLA 1G51A 3K59A 5LMUL 1PXUA 3NP8A 4YWMA 3MXGA 4BBRH 2Z6KA 1VQBA 3BVZA 1GVPA 2K4KA 3K57A 1PH5A 1AP0A 4RWSC 1X55A 2B63H 1Y1VH 2QW7A 4LF6Q 3S14H 2R7ZB 2L11A 4LF4L 2ID0A 1QCBD 2VUMB 1BF4A 4WJ3M 3CQZH 4J8QA 1GUSA 4X66Q 5IGFA 3OYYA 1EWHA 2NTTA 4CDEC 2O2LD 2OTJA 3RZDH 4RMFA 2V4DA 3CKIB 1V1PA 1WTXA 1S5ED 4YY3Q 4R4CA 2NUCA 2NN6I 1QUQA 2CFMA 4HSVA 3D31A 4IFDJ 2K03A 5C44H 2AQ3B 2X6GA 4BY7B 3I91A 1LT5D 3HKZE 2JA6B 2O5JC 1VDZA 2L15A 1FR3A 5EPLA 2EDGA 1EFID 1YI2A 1Q81C 2Y0SB 1G291 2RSOA 5G3LD 3S17B 3ICEA 1Q1BA 3VR4A 1MHWC 1DM0B 4BA1I 1C48A 1L0YB 4IFDH 4ALPA 1E2VA 3MXNB 4JI6Q 2HUGA 4PZ8A 3QWNA 4GN5A 4RFBA 2MJ8A 2EY1A 2JXMB 4B3MQ 3U4ZA 1D5XC 1EUJA 2YTXA 2HHHL 3N52A 1O7ZA 1BVSA 1HNZL 3FKIG 3K80C 4JV5Q 1F2ZA 4JC0A 4NXNL 3E5SA 1QE6A 1X3FA 4RCNA 3CC2A 4O2DA 2A5HA 2YU9B 4XQJA 4E6IA 4CKCA 3E0EA 2CH4A 4A3MB 2L5TA 1EU4A 2NVTH 3HOYG 3GTOB 4UHVA 3G6JB 3VR2A 2D9UA 1V1PB 4C3IG 4CKBA 5LMUQ 5J22A 1IW7C 2K5VA 3T4AC 4X3KA 1QUQB 3HOVH 1LTRD 2R6GA 3D4DA 1LACA 2CCZA 2RSNA 1D5MC 5DM73 3MHBA 2VZAA 1PH8A 2VQFL 4KTAA 2L4NA 1WTQA 2NTSA 2ENBA 1IYJB 2MQHA 3TS2A 2ZT9C 1SXTA 4LF4Q 2H1EA 2PZUA 4DAVA 1JORA 4IO9A 2NVQB 1HFNA 1XPOA 3NTKA 2RHSB 1BNZA 1IW7D 2EYPA 2YYZA 5K36H 4IOCA 1DXMA 2UUBL 2F0FA 3EJIA 5M3FG 3EA6A 2B2VA 3PSIA 4WJ4A 4GLAC 4FXDA 3I4NG 3TBIB 5IYCH 5E1FA 2EJFC 5E4WC 2NWGA 1Q86C 2KQ3A 2QGQA 3J7A5 4ZK9B 2FHTA 1HJPA 3RZOB 3M4PA 3H3VH 2SOBA 4H13C 4GNXC 1UWVA 5FOBB 1ASYA 1EIYB 1GXDC 4FNFA 1LM0A 4DN4M 3ERSX 2ZXRA 2ICEC 3DEPA 1EEID 1IXRA 2KHSA 4RGMA 2WAQE 2XRSD 5FJ8G 3AB9A 1YJNA 2VXWA 2XVSA 1Y1WB 1JT8A 2XWBB 2UXDL 1ICWA 2HHHQ 5IGCA 3H09A 1HNZQ 1CHQD 4NXNQ 2IWHA 5COYA 4QB4A 2OEOA 2KECA 2PZWA 4PG3A 1N33L 4OONA 2PI2E 4JPBW 3CW2C 4Y52H 1Y69U 3W3AA 2GN5A 1R9TB 2E74C 4A93B 1I6HB 3KFUA 3PUZA 4LF5L 2EXDA 1ENAA 3WDNA 2VB3X 3SK6A 4U673 5C5MA 3S24A 1SROA 2HT1A 4ZCKA 1CQFA 3HZXA 4LK1C 5CMDA 4JOIA 4DR2L 2RKSA 4XXEA 3ULPA 2F0VA 4N8FA 3TZDA 3IRBA 2VQFQ 5IYBH 2FXQA 3R8BA 3D4RA 4IOAA 2NVYB 2I46A 4NPSA 1QNUA 4TSSA 2I5MX 4NP5A 5D3IB 2KCTA 3JC66 5IP9H 2D62A 3BS1A 1CKOA 4KJNA 2UUBQ 3V96A 2EJGC 3KLSA 1NNXA 4KY5A 4MTNA 1ENFA 3K7AH 2X69A 1LTTD 1XTCD 2F0NA 1G8ZD 3HOUG 1VQ9A 4A3GG 4K2KA 3AU7A 1FYCA 4MNOA 3VR5A 3CC4A 1LTBD 2J4XA 2IW3A 1TVXA 5EKIA 5KYLA 1I4GA 2JA8H 1II3A 1G6ZA 5M5XB 4BY1G 1NSNS 4QIWE 3AMUA 2MGSA 1O80A 1YZ6A 2PQEA 2WIIB 2MFIA 2CW0C 5ELBA 3TS0A 4A93G 2JA7H 4C2MB 2NB0A 5IP7H 1TS4A 5KIXA 1DOKA 1JOQA 3A7LA 3M4QA 4HN7A 4Z9CB 1JMCA 3BZDB 4ZAIA 2Q8IB 3S16H 4GKKL 4MZ9A 1HR0W 4XTCS 3U50C 1WTRA 4A3EG 5K5PA 3JAMi 1ZEQX 2YTYA 4DR4L 1V1OA 2VL6A 3CU7A 3STBC 1KD1C 2CW0D 1MSGA 2UXDQ 5C0XG 3F2CA 5C5LA 1HR0L 4ZKBB 3G71A 3KDFB 1JE5A 2JA5B 1ESRA 2RQXA 5I9OA 1VQCA 4JI3L 3GTLH 2J7ZA 1TU2B 2AWNA 1BR9A 4UDUC 2F4IA 1N33Q 3ULLA 2K32A 2DN8A 1FNWA 1LT3D 1SBBB 1F2LA 4A3BG 2B2UA 1K8OA 4IJHA 3RN5A 3STBD 2WV6D 2PNHA 2JN4A 1WTVA 4LF5Q 2H4OA 5CV5A 3GTGH 2PPBC 1O78A 3K8AA 1TWCH 4K0KL 2E2HB 1JC7A 3GD7A 1OO9B 2R93H 3CPWA 3TP8A 3GTJH 5FKAC 4DR2Q 5KNDA 4DV5L 1H9KA 4QUCA 3SR1A 4RGTA 1G2SA 3J7YW 5M5YH 1ICFB 1EQRA 1TT2A 2JE6I 3A8JE 4Y7NH 1U4MA 4ZLTF 3HOYB 2KHJA 1CA5A 2F0GA 3JAMc 4P74A 4RKBA 5A35A 2K52A 4IALA 2E2IB 1F9SA 3KBGA 2VQEL 4B3RL 2VS1A 4GOPB 2Q2TA 2K04A 1IYVA 1S4ZA 3PO3H 3EN2A 2XIWA 4FVMA 1GUGA 1G6PA 1QWYA 1CK1A 1X32A 4KD4A 2CKZB 5J1ZA 1JOOA 1B9MA 1VQGA 2B2VC 4FDBA 4DV3L 1QVGA 1PTOF 1I4RA 4LF8L 1EYDA 2ZTEA 1PFSA 5NUCA 3H3VC 1V8QA 4Q0FA 4LFCL 4C3JH 4A3DH 1Y14B 2ZXPA 2MNAA 2OXPA 2Z9HA 1MJEA 1SMXA 1PTOB 4UP8A 2QEXA 1LLRD 1LTGD 4YCWA 3G7LA 1LO5D 1Y1VG 5DAUA 4IJLA 4CDFC 4RGNA 4KKSA 3I4NB 1DCZA 4GKKQ 3GTPH 2B8FA 2F03A 1QVCA 2LY7A 1H9JA 2F0DA 1WTWA 2F0IA 3NXWA 1NUCA 4DR4Q 5I6WA 2RDFA 1CSQA 1G91A 5C3WA 1VQLA 2BE5C 2A69C
chains in the Genus database with same CATH topology
3EFXD 2IPKD 1CM9A 1HCZA 3OWEB 4V190 4KMUC 1YNNC 3NUCA 5EKLA 3N6RA 5JOBA 2VB2X 1VCIA 4JBWA 2FMCA 4CBVA 2RBMA 2BE5D 2A69D 3FPUB 4FF2A 1S5DD 2D2CC 1QNKA 4HCSA 2FJ2A 1PMRA 3GTMB 4K8JA 5TSSA 1JCKB 1YNND 3MVVA 4IFDG 4KN7C 4JK1C 2F0WA 4F7XA 1HA6A 4G7OC 3RD4A 1HRJA 1SNMA 2SEBD 4DNTB 3ZYYX 1PRTC 1OXXK 1AZQA 4OL7A 1SE2A 3JAML 1HHVA 1AFPA 4IURA 3PUVA 5BN4A 1GHKA 3ND9A 2M2LA 2QKIC 3D6WA 1GUWA 3D6CA 4FF4A 3P75A 4KHVA 1PRTD 4OGQC 1KDCA 1SYGA 4EQOA 2F0MA 1BOSA 1WD1A 5HURA 1PYWD 3QB3A 4HEDA 3SK4A 4A3GB 4IUVA 3MXPA 4V0BA 2R61A 4C3HG 2EJMA 2MPMA 5K36G 2B39A 4BY1B 1PFBA 5HGTA 5C4ZA 5AFWA 3P20A 5LL6X 3KLRA 2L1BA 2JP1A 2K28A 5KGUA 4NW2A 1F9RA 2K5DA 3NQTA 4M8AA 2KOLA 2KVMA 4RAUC 4XT3B 3CHBD 4I65A 4G4KA 4ZRZA 1PTOC 4A3EB 5M9OA 3TZUA 3MXNA 1Q3LA 2EY2A 1RTOA 1CFMA 1XWEA 4EQNA 3M3YB 1SMYC 4HCEA 2MHVA 1SNCA 3MFYA 1PTOD 1FNUA 4A3BB 3JAME 3R3OA 3M4OB 3H6MA 2F0OA 4IUNA 1CZWA 4ZYSA 3OIPA 5I9PA 5IT9L 4KY7A 3PV0A 4O42A 1SMYD 3T16A 2E2DC 1U9RA 3NWTA 1TS3A 4N9PA 3A54A 5KNCA 2PNRC 1YNJC 5EQ0A 5C3EB 5LL6S 4CGYB 1Y8OB 2QILA 1HQMC 3NWSA 5CBEE 3C2PA 2A68C 3K5NA 5FO7B 1YNJD 4ZUJA 2Q8RE 5FK9C 4ULLA 5F2DA 3CRKC 4K5WA 3DWQA 1GUOA 4ABNA 3Q24A 2MP1A 1KABA 1GUTA 3DM1A 1RJTA 3MA2B 3VR3A 3TMEA 3M7NA 3BDLA 3A7AB 2KA7A 2A68D 1VF5C 5E4XA 5ELDA 3L3OC 1E2ZA 1HQRD 3TN2A 2EYFA 1B2TA 2E2JB 4N9TA 1ILQA 5JVG3 1RHPA 1TY2A 1RDPD 2EE1A 2LFNA 4AYBB 1STAA 1TR5A 1I4XA 3UI2A 1A6XA 1CZGA 3R2IA 2AUKA 2F0TA 3I4LA 3K6OA 2Z4IA 3Q0AA 5IT9E 3PMFA 1CQVA 5KNBA 3LWUA 1TIID 1CTMA 3HP3A 1I50B 5M3MB 3P1HA 4R8IA 1A3VA 2SDFA 2NN6G 4H7BA 3V05A 1S5BD 2DNCA 4RKLA 1LV9A 2B2YA 2KCNA 1VMPA 1SYFA 4FF3A 1OXSC 3OHXC 1X3QA 2IX1A 3HOWB 1STBA 4PV1C 2EOTA 3X3NA 1SYCA 1EY0A 1MI2A 2F3WA 2BA1A 4QMGA 1SFOB 1M4VA 4XYQA 5ISRA 5CV4A 3BYYB 4PMCA 1F2MA 3NTIA 1MBYA 1EYCA 1IL8A 1HTLD 3VR6A 3S1NB 2G9HD 3S1MB 1LTID 5DEHA 2AQ2B 1RTNA 1EZ8A 3KK7A 3DXJC 1Y8NB 1NAPA 1SJHD 2GA4B 3MAQA 1JWSD 3OWFA 4RH6A 4EGVA 2M00A 2K33A 3QO2A 5IODA 4C3HB 4RCOA 1J8IA 4PQXA 1ML0D 4X3TA 4DNRB 4NDXA 1STNA 1A3TA 4FF1A 2Z8LA 3I72A 5CV9A 1SNOA 4WORA 4A3JB 3PUXA 4M1UB 1CT1D 3LWEA 1LTAD 3T53B 1H9SA 3H94A 4NKLA 2A73B 4HR7B 4KHZA 3GV6A 1TWGB 1PZJD 2K5WA 5CBAE 2JEBI 1I6VC 3S2HB 5EGTA 3J7AV 5FO9B 4F8MA 1BBXC 2PZTA 4B08A 3C1FA 5I2XA 1PZKD 2G9DA 3NE5B 5CORA 1LTSD 4RHSA 1MSHA 1Q1EA 2CQAA 3M7GA 1JR0D 3DHQA 2Z1CA 4ZUIA 1CHPD 1F77A 4IQZA 5C6AA 2AUJD 4K5XA 1SEBD 2HQEA 5T1IA 3MWYW 4L8JA 1HUNA 4WRDA 1SNQA 3VA7A 1SE3A 2B8GA 1EYAA 1NCVA 1H9SB 2RVLA 5A2QL 3GTQB 2EZVA 2RDHA 5D65A 1PTOH 2E75C 4LAAA 2Z4HA 3R2TA 1LT4D 3X3MA 5EPJA 3FKIB 1D5ZC 1SDFA 2LS01 4G7HC 4TKOB 1STGA 1TWFB 4FXKC 3GV3A 1SSOA 1F9PA 5EPKA 4DK1A 2N55A 4FO2A 2F3VA 1M8AA 1TY0A 3FEWX 1DJRD 2TSSA 4C3IB 2NZ1D 1NR2A 5BN3A 4RHRA 5T1GA 4CJ2C 3S9WA 3S16B 4DXGA 4GZYC 5KYIA 2C9OA 4IN3A 1RCVD 2WINB 2B2YC 2K1BA 1B4OA 2IJ0A 1MGSA 2E76C 1WTPA 1SAPA 2VNUD 5M3FB 3ITPA 1SYBA 1STYA 3DWAA 2PW5A 1EY7A 2JSOA 5C4XB 4XQNA 3CRLC 1XX8A 1KLGD 5EBCA 1WD0A 5D14A 4QUFA 4IUQA 1Z6HA 2IT1A 1STHA 5CYUA 1DONA 4OO1I 4OIKA 3J80L 4X3UA 2IX3A 4HTHA 3QOLA 4PMWA 3PIO3 1Q12A 4K8IA 1EQVA 1TKWB 1WTOA 3MZ5A 3S2DB 1ET9A 1EWCA 2ICIA 3BDCA 5JPNC 1B1ZA 5ELFA 2CHBD 4KKUA 3SEBA 3K5LA 4ID6A 3IL8A 4K5VA 3S1QB 1K8MA 5JVH3 2KJXA 3GP7A 2KEEA 2PMZB 3LX0A 3OOCA 3K58A 5IGEA 3SDZA 1EY5A 2BDNA 2F0EA 4CHTB 1Q90A 3K5MA 3SE0A 1ENCA 3VYUA 4NMZA 2B2WA 3KF8A 4A3DB 1TWAB 5E3FA 5IOCA 5I4DA 1SYEA 5I6YA 1PZID 2RA4A 2SNSA 1V43A 3IKJA 5DM63 1KAAA 3DUZA 3RLFA 3GTPB 3EROA 3OPOA 2Q8TA 1PDQA 1R4PB 2R92B 1XXGA 5JEAJ 2EYJA 3TP7A 2FFKB 2L55A 4BBSB 4MIUA 3HOUB 3J80E 1J9OA 1IKMA 4UAIA 3I70A 4EVOA 3I8ZA 3VYRA 4DK0A 3K5OA 1TS5A 3RUZA 1T5XD 5CV7A 3I90A 1JB3A 1ESFA 4OIJA 4KY6A 2JYOA 5JEAH 2L0CA 1K83B 3PUYA 4F87A 4CKEA 1GHJA 1I4PA 1WCMB 3URYA 4CJ1B 5M5WB 1D1IA 4A93B 3P7JA 4TRDA 1TQOA 4G7ZC 4DF7A 3NK9A 1ZKOA 2B2TA 2SNMA 4HMIA 2BCOA 1B3AA 1IYUA 3IFDA 1I4HA 4ZQ3A 3HRZC 2WKCA 1JWMD 4BS9A 2B2UC 1Z47A 3HOZB 3I4MB 2F0JA 3U9SA 1H9RA 5C4JB 1JICA 2DY8A 2AWOA 4RA8A 3OIQA 3VYSA 1SJED 3T13A 2I07B 4DAYA 2DNEA 2TMPA 3HS0C 4LJZC 4XQQA 5FO8B 4MHEA 1DZ1A 3D3RA 1JOKA 4K2LA 1QB5D 2QDBA 2A6EC 1PFNA 5ELEA 3W2DA 4KKTA 3IAYA 4TQUS 2AQ1B 1ET6A 4K14A 5KRUA 3OMGA 1FD7D 2CVRA 3BG3A 2XWJB 4R9WA 2A6ED 3DEOA 1I3QB 1GUNA 3FVQA 2BDOA 1U4PA 4WFN3 3ND8A 3TDQA 3QG1A 2K05A 4BBRB 3A56A 4FYDA 2B63B 3WOEA 5I2YA 3T51B 1D1KA 1Y1VB 3S14B 2O4XA 2A74C 3TP6A 5DNFA 5IGGA 2IL8A 4U68A 1A2UA 2PYKA 1NR4A 4G57A 3CQZB 5LHY1 2XNAC 5EBDA 1CI3M 1IKLA 3RZDB 4BWGB 3GQBA 1Z7TA 1B44D 1HA5A 2K01A 3C46A 3R93A 3FMCA 1OXTA 3MC0B 5C44B 1SE4A 4OO1H 1D6EC 2RDGA 1Q8IA 4PNYA 4DFAA 3KLSX 3NBHA 2B2WC 4H44C 3TSSA 3SXHA 3Q6SA 2NYZD 1EQTA 2IX0A 1B53A 2F0LA 4XIGS 1QOHA 1KDBA 2WB1B 1ILPA 1ZYRC 1DOLA 1EEFD 2BA0A 2F0SA 3ONAB 3C3LA 1RKNA 1EU3A 1EOTA 2WP8J 2NVTB 2N88A 3NQIA 3MFGA 4IZ8A 3V2TA 5CGKA 1TS2A 2XSCA 3BVMA 1ZYRD 3HKZB 1KDAA 1AEXA 4A3KB 1OXVA 3HOVB 5FLXL 2XN9C 3I3CA 4I7ZC 1EIHA 1AN8A 1RD9D 1I4QA 4C3JG 3SVMA 4KD3A 3GO5A 4K6DA 5IGDA 3SHLA 1HFGA 3SK5A 1BCPF 1IHZA 2B2TC 5C0XI 1EY4A 1BXTA 1OXUA 5EKKA 4L6TB 1GJXA 1ZXTA 1BCPB 5IIFA 3J81L 3J7AF 1BUVT 2QEJC 3E0JA 1LABA 4R8NA 2R3ZA 2WACA 1STEA 1FGBD 3NBIA 5JJZA 2L12A 4ILWA 2K5QA 2F0QA 3NHHA 4J1MA 5J39A 3HEJA 4A3FB 4XT1B 1B50A 3K0YA 1A2TA 1GOZA 2EXZA 1JQYD 4IUUA 4EQPA 4HSPA 2KCCA 1LT6D 3S15B 4C56C 4RGOS 3E6ZX 2XRQD 1T5EA 3I73A 3M85A 1DOMA 3LNNA 3KBXA 5EJWA 3RMHA 2LMCB 1KTKA 4BA2I 4OHJA 4QF4A 1DYQA 4KI0A 2BOSA 5FLXE 3VA5A 3TP5A 5BN5A 3NSWA 3BYTB 3NTHA 1EZ6A 1S5FD 1KNEA 1JWUD 2C5CA 4B9XA 4C1NK 2PCFB 1UEAB 1PRTF 1S5CD 2WAQB 2F0HA 4KN4C 3QOJA 4K6LA 1PRTB 1F9QA 3IFTA 4O1NA 5IGBA 2EY6A 3K7AB 3J81E 3PUWA 2NN6H 3HOXB 5ELCA 2PO4A 3S1RB 3DMUA 3F2UA 4ODGA 2F0KA 3D8GA 2K6AA 4XDXA 2JA8B 3C1EA 1EIGA 1H9MA 5JEAG 3VYTA 3A8KE 1HTPA 1A15A 1R4QB 2JA7B 2F1MA 1AW7A 3H0GB 4IFDI 4DA2A 1DD2A 1PFMA 4IUTA 4C1NI 5C4HA 1D2BA 1U4RA 3O13A 3A55A 4IUPA 2HDLA 5D3DA 2EYLA 4L63B 1A3UA 2EPBA 4FXGC 3GTLB 3EQLC 4H0LC 2JEAI 1BCPC 4DXFA 1Y8PB 4MN3A 4Q5VA 5CR3A 3MEHA 3DWPA 1O7LA 3L7ZC 3GTGB 1TWCB 3HGBA 4QIWB 2OF1A 2HDMA 1QJOA 1C4QA 2FMMA 2R93B 4F88A 1BCPD 4PMBA 3HG9A 1UNSA 1HXYD 3GTJB 5A2QE 1EY9A 2X6LA 5M5YB 4KV6A 4CJ0B 1AZPA 1X3PA 4X3SA 2QF7A 3NPPA 4Y7NB 2EYOA 1F2YA 4YIJA 3QIAA 5G3LF 2HCIA 1HPCA 1VF7A 4WJWA 3PO3B 3BVGA 4P2CB 4DAPA 3SK8A 1SYDA 2EVBA 1C8CA 2OT2A 2L9HA 4C3JB 3MTSA 5CC4A 4XYOA 2FINB 5C3XA 4S3SA 2KEDA 2LKVA 3OW7A 2M9VA 5C0XJ 1BQQT 1MD2D 1BDOA 2HCCA 1CA6A 4DGZA 3Q23A 3FRPB 1B9NA 2F0PA 2A6HC 1RODA 1UUPA 1E0BA 3FDTA 1JE4A 2EY5A 4QCLA 1EY8A 1RF2D 5KEEA 2O5IC 1QILA 3T56B 4KK7A 2EYHA 1SNDA 4DU9A 2ZXOA 5C0XH 1EY6A 1L0XB 2KUMA 4ZKCB 2A6HD 4A3IB 3OMCA 1HUMA 5CV8A 2NVXB 3D4WA 1PLFA 3GTKB 3L9AX 4OO1G 2J0TD 2QCPX 1EL0A 1FNVA 4HMJA 2K7VA 1E2WA 1SNPA 1VMCA 3WOFA 1BO0A 3ERQA 4LMQD 3PIP3 4J6HA 3FPPA 1WVLA 1G2TA 2WKDA 2MUYA 4HAEA 3OSOA 1QG7A 4FP5D 3EVQA 4B9WA 1O7YA 5CV6A 3U9OA 2DY7A 1UAPA 5JAVA 1W6JA 2D5DA 1KLUD 2F0UA 1W6KA 3H91A 4KJOA 3BDOA 3KUPA 3MXUA 1KNAA 5JPMC 1U4LA 3QJYA 3M4YA 1XYIA 1TWHB 3PO2B 2NBFA 3Q22A 3A8IE 2PW7A 2EYMA 4ME5A 1ONLA 3K59A 1PXUA 3NP8A 3MXGA 3BVZA 3K57A 1AP0A 4RWSC 2R7ZB 2L11A 2ID0A 1QCBD 2VUMB 1BF4A 4J8QA 1GUSA 5IGFA 1EWHA 2NTTA 2O2LD 2V4DA 3CKIB 1V1PA 1WTXA 1S5ED 2NUCA 2NN6I 4HSVA 3D31A 4IFDJ 2K03A 2AQ3B 2X6GA 4BY7B 3I91A 1LT5D 2JA6B 2O5JC 1VDZA 1FR3A 5EPLA 2EDGA 1EFID 2Y0SB 1G291 2RSOA 5G3LD 3S17B 1Q1BA 3VR4A 1DM0B 4BA1I 1C48A 1L0YB 4IFDH 1E2VA 2HUGA 3QWNA 4RFBA 2MJ8A 2EY1A 2JXMB 1D5XC 3N52A 1O7ZA 1F2ZA 3E5SA 1QE6A 4RCNA 2A5HA 2YU9B 4XQJA 4E6IA 4CKCA 4A3MB 2L5TA 1EU4A 3GTOB 3G6JB 3VR2A 2D9UA 1V1PB 4C3IG 4CKBA 5J22A 1IW7C 3T4AC 4X3KA 1LTRD 2R6GA 3D4DA 1LACA 2RSNA 1D5MC 5DM73 3MHBA 4KTAA 2L4NA 1WTQA 2NTSA 2ENBA 2ZT9C 1SXTA 2H1EA 2PZUA 4DAVA 1JORA 2NVQB 1HFNA 3NTKA 1BNZA 1IW7D 2EYPA 2YYZA 5K36H 1DXMA 2F0FA 3EJIA 3EA6A 2B2VA 4FXDA 3TBIB 5E1FA 2EJFC 5E4WC 2NWGA 2KQ3A 4ZK9B 2FHTA 3RZOB 2SOBA 4H13C 5FOBB 1GXDC 4FNFA 4DN4M 2ZXRA 2ICEC 3DEPA 1EEID 2KHSA 4RGMA 2XRSD 3AB9A 2VXWA 2XVSA 1Y1WB 2XWBB 1ICWA 5IGCA 3H09A 1CHQD 2IWHA 5COYA 4QB4A 2OEOA 2KECA 2PZWA 1Y69U 3W3AA 1R9TB 2E74C 1I6HB 3PUZA 1ENAA 3WDNA 2VB3X 3SK6A 4U673 5C5MA 1CQFA 3HZXA 4LK1C 5CMDA 2RKSA 4XXEA 2F0VA 3TZDA 3R8BA 3D4RA 2NVYB 2I46A 1QNUA 4TSSA 4NP5A 5D3IB 2D62A 3BS1A 4KJNA 3V96A 2EJGC 3KLSA 4KY5A 1ENFA 2X69A 1LTTD 1XTCD 2F0NA 1G8ZD 4K2KA 3AU7A 1FYCA 3VR5A 1LTBD 2J4XA 2IW3A 1TVXA 5EKIA 5KYLA 1I4GA 1II3A 1G6ZA 5M5XB 1NSNS 3AMUA 2MGSA 1O80A 2PQEA 2WIIB 2CW0C 5ELBA 4C2MB 2NB0A 1TS4A 5KIXA 1DOKA 1JOQA 3A7LA 4HN7A 4Z9CB 3BZDB 4ZAIA 2Q8IB 4XTCS 1WTRA 5K5PA 1ZEQX 1V1OA 3CU7A 2CW0D 1MSGA 5C0XG 5C5LA 4ZKBB 2JA5B 1ESRA 2RQXA 5I9OA 2J7ZA 1TU2B 2AWNA 1BR9A 4UDUC 2F4IA 2K32A 2DN8A 1FNWA 1LT3D 1SBBB 1F2LA 2B2UA 1K8OA 2WV6D 1WTVA 2H4OA 5CV5A 2PPBC 1O78A 2E2HB 1JC7A 3GD7A 1OO9B 3TP8A 5FKAC 5KNDA 1H9KA 4QUCA 3SR1A 4RGTA 1G2SA 3J7YW 1TT2A 2JE6I 3A8JE 1U4MA 4ZLTF 3HOYB 1CA5A 2F0GA 4RKBA 5A35A 4IALA 2E2IB 1F9SA 3KBGA 2K04A 1IYVA 1S4ZA 2XIWA 4FVMA 1GUGA 1QWYA 1CK1A 1X32A 4KD4A 5J1ZA 1JOOA 1B9MA 2B2VC 1PTOF 1I4RA 1EYDA 5NUCA 3H3VC 1V8QA 4Q0FA 2ZXPA 2OXPA 1PTOB 1LLRD 1LTGD 3G7LA 1LO5D 5DAUA 4RGNA 4KKSA 3I4NB 1DCZA 2B8FA 2F03A 2LY7A 1H9JA 2F0DA 1WTWA 2F0IA 3NXWA 1NUCA 5I6WA 2RDFA 1G91A 5C3WA 2BE5C 2A69C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EFX D;  2IPK D;  1EU4 A;  4UDU C;  1FD7 D;  1AW7 A;  1FNW A;  3DWA A;  1CHP D;  1XXG A;  1LT3 D;  1SBB B;  1F77 A;  1V1P B;  3BYY B;  1MD2 D;  3OWE B;  1KLG D;  3BVZ A;  2WV6 D;  3O13 A;  1GOZ A;  1LTR D;  1JQY D;  1UUP A;  5D3D A;  1D5M C;  1HTL D;  5ELD A;  1LT6 D;  2G9H D;  1EEF D;  1SEB D;  4C56 C;  1HQR D;  1LTI D;  4L63 B;  2NTS A;  4RGO S;  3CHB D;  1S5D D;  2AQ2 B;  2XRQ D;  1RF2 D;  1QIL A;  1SXT A;  1PTO C;  1TS5 A;  1T5X D;  1ESF A;  1SE3 A;  1SJH D;  5FKA C;  3R8B A;  1EU3 A;  1JWS D;  1TY2 A;  4RH6 A;  2NTT A;  1BCP C;  1RDP D;  4DXF A;  2O2L D;  3MFG A;  4RGT A;  4TSS A;  1JCK B;  5TSS A;  1KTK A;  4OHJ A;  4RCO A;  1L0X B;  1TS2 A;  3BVM A;  5D3I B;  1ET9 A;  1I4X A;  1I4P A;  3EA6 A;  1V1P A;  1EWC A;  3URY A;  1S5E D;  1DYQ A;  3DWP A;  2ICI A;  2RDH A;  3R2I A;  1B1Z A;  5ELF A;  2CHB D;  1ENF A;  1PTO H;  2SEB D;  3BYT B;  3SEB A;  2Z8L A;  3R2T A;  1PRT C;  1LT4 D;  1LTT D;  1PTO D;  1XTC D;  1S5F D;  2XN9 C;  1FNU A;  1G8Z D;  1JWU D;  2AQ3 B;  1SE2 A;  1D5Z C;  1BCP D;  1I4H A;  1LTB D;  1AN8 A;  3GP7 A;  1UNS A;  1LT5 D;  2J4X A;  1FNV A;  1CK1 A;  1HXY D;  4ZYS A;  1JWM D;  2XNA C;  1RD9 D;  1I4G A;  1I4Q A;  1CQV A;  1PRT F;  1S5C D;  1CT1 D;  1EFI D;  1LTA D;  1PTO F;  2IJ0 A;  4BWG B;  1I4R A;  1TS3 A;  4K6L A;  1B44 D;  1HA5 A;  1BCP F;  1PRT D;  1L0Y B;  1PRT B;  1SJE D;  3V05 A;  5ELB A;  1PZJ D;  4O1N A;  1S5B D;  1TY0 A;  1DJR D;  1EEI D;  2TSS A;  1BXT A;  1PTO B;  5I4D A;  3MC0 B;  4RGM A;  4RFB A;  1PZI D;  1LLR D;  1TS4 A;  4L6T B;  1LTG D;  2XRS D;  1LO5 D;  5ELC A;  1SE4 A;  1BCP B;  4Z9C B;  4RHR A;  3BZD B;  2QIL A;  1PYW D;  1D5X C;  4RGN A;  1KLU D;  4DXG A;  2QEJ C;  1D6E C;  2RDG A;  3BVG A;  1V1O A;  1PZK D;  1STE A;  3KLS X;  1FGB D;  1LTS D;  5ELE A;  3W2D A;  4RHS A;  1CHQ D;  2R61 A;  2AQ1 B;  5FK9 C;  3TSS A;  1RCV D;  1ET6 A;  3DWQ A;  1M4V A;  1JR0 D; 
#chains in the Genus database with same CATH topology
 3EFX D;  2IPK D;  1HR0 Q;  1CM9 A;  1HCZ A;  1N34 L;  4JI3 Q;  2NZH A;  2CQO A;  4KHP L;  3OWE B;  1EIF A;  4KMU C;  4V19 0;  4X62 L;  1YNN C;  3NUC A;  5C44 G;  2DUD A;  5EKL A;  3N6R A;  5JOB A;  1HZ9 A;  3CCU A;  2NVX H;  1A63 A;  3BZC A;  3GTK H;  2VB2 X;  4GS3 A;  3RNU A;  1VCI A;  4JBW A;  2FMC A;  4CBV A;  2RBM A;  2BE5 D;  2A69 D;  3FPU B;  1SN8 A;  4FF2 A;  1S5D D;  2D2C C;  5M3M G;  1QNK A;  1KHI A;  2F52 A;  4K0K Q;  4HCS A;  2FJ2 A;  2OQK A;  1PMR A;  1B7Y B;  4DR3 L;  3GTM B;  4K8J A;  5TSS A;  1JCK B;  1YNN D;  3MVV A;  4IFD G;  1JJG A;  4KN7 C;  3CCJ A;  4DV5 Q;  1C9O A;  4JK1 C;  1NMF A;  2F0W A;  4F7X A;  4O0A A;  1HA6 A;  4G7O C;  3RD4 A;  4AQY L;  4JOI C;  1HRJ A;  1SNM A;  2SEB D;  4DNT B;  3ZYY X;  1PRT C;  1OXX K;  1S3O A;  1AZQ A;  5IT9 c;  4OWT B;  2WB1 G;  4OL7 A;  1SE2 A;  5ELN A;  5AJ3 L;  3JAM L;  3ZJY C;  1HHV A;  2VQE Q;  1J6Q A;  1AFP A;  4B3R Q;  3HOZ H;  4IUR A;  3PUV A;  5BN4 A;  1GHK A;  3ND9 A;  2M2L A;  4A3L G;  2QKI C;  3D6W A;  1GUW A;  1TWH H;  3QR8 A;  4DK3 C;  3D6C A;  3PO2 H;  4B3T L;  4DV3 Q;  4FF4 A;  2C35 B;  3P75 A;  4KHV A;  1N32 L;  1PRT D;  4DV1 L;  4OGQ C;  4LF8 Q;  1KDC A;  3F8T A;  1SYG A;  4EQO A;  4LFC Q;  2Y0S E;  2F0M A;  1K0R A;  1BOS A;  1WD1 A;  5HUR A;  1PYW D;  3QB3 A;  2ASB A;  4HED A;  3SK4 A;  2I5L X;  2R7Z H;  3MEF A;  4A3G B;  4IUV A;  3MXP A;  3CME A;  2VUM H;  4V0B A;  2R61 A;  4C3H G;  4HJ5 A;  5HGQ A;  2EJM A;  2MPM A;  4NXM L;  1E24 A;  5K36 G;  3B6Y A;  2B39 A;  1D7Q A;  4BY1 B;  4X64 L;  1PFB A;  1H95 A;  5HGT A;  5C4Z A;  3CCV A;  1FVI A;  5IYC G;  5AFW A;  1N34 Q;  3P20 A;  5LL6 X;  3EBE A;  3KLR A;  4KHP Q;  2L1B A;  1XPR A;  2JP1 A;  2K28 A;  5KGU A;  4NW2 A;  1F9R A;  2K5D A;  3AFP A;  4X62 Q;  1BBW A;  3NQT A;  4M8A A;  2KOL A;  3CCQ A;  4A3J G;  3AYH B;  3EIV A;  2KVM A;  4RAU C;  4OWW B;  3AEV A;  4XT3 B;  1K3R A;  4BY7 H;  3CHB D;  4I65 A;  2VY3 A;  4G4K A;  4AYB E;  1ASZ A;  4ZRZ A;  1PTO C;  4A3E B;  5M9O A;  1YHB A;  2JA6 H;  3TZU A;  3MXN A;  3PIO A;  1Q3L A;  2D0O A;  1HZB A;  2EY2 A;  1RTO A;  1YVC A;  1CFM A;  1XWE A;  3S17 H;  4EQN A;  4LFB L;  3M3Y B;  2D0P A;  4DR3 Q;  1SMY C;  4HCE A;  2MHV A;  1SNC A;  4QY7 A;  3MFY A;  3H15 A;  1PTO D;  4AQY Q;  1FNU A;  4A3B B;  3JAM E;  3R3O A;  3M4O B;  1NE3 A;  1BBU A;  5LMN W;  4OX9 L;  3H6M A;  2F0O A;  4IUN A;  1QVF A;  1CZW A;  4ZYS A;  3OIP A;  5I9P A;  1SRU A;  5IT9 L;  4KY7 A;  4POG A;  3PV0 A;  5AJ3 Q;  4O42 A;  2Q2U A;  1SMY D;  3T16 A;  2E2D C;  2R7D A;  1U9R A;  3NWT A;  1TS3 A;  4H02 A;  4N9P A;  3AFQ A;  5LMN L;  4DV0 L;  2YU9 H;  3TRZ A;  4A76 A;  2E5L L;  3A54 A;  5KNC A;  2PNR C;  1YNJ C;  5EQ0 A;  5C3E B;  4B3T Q;  3GTO H;  1N32 Q;  4DV1 Q;  5LL6 S;  1PH2 A;  4P73 A;  1L0W A;  4CGY B;  4J15 A;  1Y8O B;  2QIL A;  1HQM C;  3KJO A;  2LXK A;  3RLO A;  4HIM A;  2NZO A;  4OEL B;  1N9W A;  3NWS A;  3KF6 A;  5CBE E;  5IYB G;  3C2P A;  2A68 C;  3K5N A;  3K7U C;  5FO7 B;  1YNJ D;  4ZUJ A;  3G4S A;  2Q8R E;  5FK9 C;  4ULL A;  5F2D A;  3CRK C;  4K5W A;  1YBY A;  2YTV A;  3DWQ A;  2NVQ H;  1GUO A;  1TXY A;  3I7F A;  3LGJ A;  5IP9 G;  4ABN A;  3Q24 A;  4NXM Q;  2MP1 A;  1KAB A;  1GUT A;  4GLV B;  3DM1 A;  1RJT A;  3MA2 B;  3VR3 A;  3TME A;  3M7N A;  3BDL A;  4YCU A;  3CF5 A;  3A7A B;  4X64 Q;  2KA7 A;  2A68 D;  1VF5 C;  1E3P A;  5E4X A;  5ELD A;  3L3O C;  1E2Z A;  1HQR D;  1IZ6 A;  3TN2 A;  3F1Z A;  3A5Z B;  2EYF A;  3SGI A;  1B2T A;  2E2J B;  4N9T A;  5FLM G;  1ILQ A;  2N78 A;  3M9B A;  5JVG 3;  2IY5 B;  1RHP A;  4APV A;  3RZO H;  1TY2 A;  1K73 C;  1RDP D;  1UEB A;  2EE1 A;  2LFN A;  4AYB B;  4HIK A;  1W2B A;  5E7N A;  1STA A;  1TR5 A;  1I4X A;  1VQ4 A;  1Z9F A;  4A3K H;  3UI2 A;  1XMO L;  1A6X A;  2EIF A;  4LFB Q;  1CZG A;  3R2I A;  3KYH C;  2AUK A;  1RL2 A;  2KEN A;  3E9H A;  2F0T A;  3I4L A;  3K6O A;  2Z4I A;  3Q0A A;  4OWX B;  5IT9 E;  1M90 C;  5JJK A;  1Y1W H;  3PMF A;  5IYD G;  1IBL L;  1CQV A;  3T1H L;  3KF6 B;  5KNB A;  4OX9 Q;  2BH8 A;  3LWU A;  1TII D;  1CTM A;  3HP3 A;  1I50 B;  3CC7 A;  3Q8D A;  4JI2 L;  5M3M B;  3P1H A;  4R8I A;  1A3V A;  2SDF A;  2NN6 G;  2IHE A;  3I2Z A;  4A3C H;  4H7B A;  5C4X G;  3V05 A;  4JI5 L;  1S5B D;  5LMN Q;  4DV0 Q;  2ZTD A;  4JI1 L;  3PF5 A;  2DNC A;  2E5L Q;  4RKL A;  1JJ2 A;  1LV9 A;  2B2Y A;  1R9T H;  1EWI A;  1VMP A;  2KCN A;  1SYF A;  4LUV A;  1OXS C;  5GAH C;  4FF3 A;  3A0J A;  1I6H H;  5EAY A;  2Z6B A;  1NJI C;  3OHX C;  5DLQ E;  1X3Q A;  1VQD A;  4DR5 L;  2IX1 A;  3HOW B;  1STB A;  4PV1 C;  2EOT A;  2R93 G;  3X3N A;  1SYC A;  1EY0 A;  1MI2 A;  3I4O A;  2F3W A;  2BA1 A;  3CD6 A;  1E1T A;  4QMG A;  2PQA A;  1SFO B;  1M4V A;  4GKJ L;  2NVY H;  4N8X 1;  1N36 L;  4BXX H;  4A3F H;  4XYQ A;  5ISR A;  5CV4 A;  3BYY B;  4PMC A;  1F2M A;  5IE8 A;  3NTI A;  1MBY A;  5JJI A;  3PO3 G;  1EYC A;  2VW9 A;  3S15 H;  1IL8 A;  1B8A A;  1HTL D;  4QQB X;  3VR6 A;  3S1N B;  2G9H D;  3S1M B;  1LTI D;  5DEH A;  1UE1 A;  5GRO A;  2AQ2 B;  1RTN A;  1EZ8 A;  3KK7 A;  3DXJ C;  5GAE C;  1Y8N B;  1NAP A;  1SJH D;  2GA4 B;  3MAQ A;  1IL2 A;  1JWS D;  3OWF A;  4RH6 A;  4L5R C;  4EGV A;  2M00 A;  5M5X H;  2K33 A;  3QO2 A;  4A3D G;  5IOD A;  4C3H B;  4RCO A;  1J8I A;  4PQX A;  1ML0 D;  1HH2 P;  4X3T A;  4DNR B;  4NDX A;  1STN A;  1A3T A;  4C2M H;  4FF1 A;  2Z8L A;  3I72 A;  5CV9 A;  1XMO Q;  2F3I A;  1PH1 A;  1SNO A;  4DNI A;  3CMA A;  3KDF A;  2XTI A;  1K0S A;  2HIX A;  2Z6K C;  4WOR A;  3J80 i;  3PUX A;  4A3J B;  1QZG A;  4HIO A;  4M1U B;  1CT1 D;  2P5Z X;  3LWE A;  1LTA D;  3T53 B;  1K28 A;  1IBL Q;  1NMG A;  1H9S A;  3H94 A;  3T1H Q;  1GD7 A;  4NKL A;  2A73 B;  4HR7 B;  4PZ7 A;  4UY8 C;  1A62 A;  2R92 G;  4JI2 Q;  2JA5 H;  2PQA B;  3FHW A;  4KHZ A;  1A8V A;  1VQN A;  3GV6 A;  1TWG B;  1PZJ D;  4YHH L;  1IBK L;  4BBS G;  3HOX H;  2K5W A;  5CBA E;  2JEB I;  3S1R H;  4JI5 Q;  4IPG A;  4JI1 Q;  1I6V C;  3S2H B;  3UE0 A;  5EGT A;  3A74 A;  4A75 A;  1PH9 A;  1KAW A;  2RCN A;  3J7A V;  5FO9 B;  4F8M A;  1BBX C;  1WYD A;  2PZT A;  4B08 A;  3C1F A;  5I2X A;  1P16 A;  2K75 A;  1YIJ A;  1VQ6 A;  1C7Y A;  1PZK D;  1LTL A;  4DR5 Q;  2G9D A;  3NE5 B;  1VQP A;  5COR A;  1LTS D;  4RHS A;  1MSH A;  1Q1E A;  2CQA A;  1K3B C;  3M7G A;  4LF9 L;  1PYB A;  1WCM G;  1JR0 D;  3W1B A;  4POF A;  3DHQ A;  2Z1C A;  3H0G H;  4ZUI A;  2DGY A;  1CHP D;  4GKJ Q;  4LF7 L;  4GOP A;  3PF4 A;  1F77 A;  3WWV A;  1GKH A;  4NB3 A;  1N36 Q;  4IQZ A;  3J80 c;  3I56 A;  5C6A A;  2AUJ D;  4OXP A;  4K5X A;  2XGT A;  1PA6 A;  1WOC A;  3HOZ G;  1SEB D;  2HQE A;  3OW2 A;  5T1I A;  3I4M G;  3MWY W;  3A5U A;  4L8J A;  1HUN A;  4WRD A;  3I55 A;  1VQ7 A;  1SNQ A;  3VA7 A;  1WTH A;  1SE3 A;  1CKM A;  2B8G A;  1EYA A;  3PO2 G;  2Q2I A;  5J3B A;  1NCV A;  1H9S B;  2UXB L;  2RVL A;  3TRE A;  4DV6 L;  5A2Q L;  4QGU A;  3GTQ B;  2EZV A;  1UE6 A;  2RDH A;  5D65 A;  1PTO H;  2PMZ E;  2E75 C;  2YV5 A;  4LAA A;  2Z4H A;  3R2T A;  1LT4 D;  2ZJP A;  4P71 A;  1UE5 A;  4JBM A;  3K81 C;  3X3M A;  5GQO A;  1SE8 A;  2LXJ A;  3FKI B;  5EPJ A;  1D5Z C;  1XJV A;  1SDF A;  2LS0 1;  1VQH A;  3I4N H;  4G7H C;  4TKO B;  1STG A;  1TWF B;  4FXK C;  4DKA C;  3GV3 A;  1SSO A;  1F9P A;  2B29 A;  5EPK A;  4DK1 A;  2N55 A;  4JI0 L;  5JJL A;  4FO2 A;  4IPC A;  2F3V A;  1M8A A;  1TY0 A;  3FEW X;  1DJR D;  2TSS A;  4C3I B;  4YHH Q;  2NZ1 D;  1NR2 A;  4QL5 A;  5BN3 A;  4RHR A;  1IBK Q;  5T1G A;  4CJ2 C;  3S9W A;  3S16 B;  4EX5 A;  4DXG A;  3F2B A;  4GZY C;  5KYI A;  1S72 A;  2C9O A;  5FJ8 H;  2JA6 G;  4JBK A;  1FGU A;  1LYL A;  4ME3 A;  4IN3 A;  1RCV D;  2WIN B;  3L0O A;  2B2Y C;  2K1B A;  4BBR G;  1B4O A;  2IJ0 A;  1MGS A;  2E76 C;  1WTP A;  1SAP A;  4LF9 Q;  3GTM H;  2VNU D;  5M3F B;  3ITP A;  2B63 G;  1SYB A;  1STY A;  1LUZ A;  2K50 A;  3DWA A;  5M5W B;  2PW5 A;  1EY7 A;  2JSO A;  5C4X B;  4XQN A;  3CRL C;  1XX8 A;  1KLG D;  1WI5 A;  5EBC A;  1WD0 A;  5D14 A;  4LF7 Q;  4QUF A;  4IUQ A;  4YWL A;  3CAM A;  1Z6H A;  2IT1 A;  1VQO A;  1STH A;  5CYU A;  1DON A;  4OO1 I;  1Q7Y C;  4OIK A;  3J80 L;  1CSP A;  4X3U A;  2IX3 A;  4DR6 L;  1K9M C;  4UP9 A;  4HTH A;  1YJ9 A;  3QOL A;  1E7Z A;  4PMW A;  2MO0 A;  3PIO 3;  2BH2 A;  1Q12 A;  4YWK A;  1NBW A;  4K8I A;  1HZC A;  1EQV A;  1TKW B;  4UP7 A;  4A3I H;  1WTO A;  3MZ5 A;  3S2D B;  1ET9 A;  1HZA A;  1EWC A;  4UPA A;  1NTG A;  2ICI A;  3BDC A;  3BZK A;  5JPN C;  2UXB Q;  1B1Z A;  5ELF A;  2CHB D;  4DV6 Q;  4KKU A;  3SEB A;  3K5L A;  4ID6 A;  3IL8 A;  4K5V A;  1B3Q A;  3S1Q B;  4A4I A;  4HJ9 A;  1K8M A;  5JVH 3;  2KJX A;  3GP7 A;  2KEE A;  2F4V L;  2PMZ B;  3LX0 A;  3OOC A;  3K58 A;  5IGE A;  3SDZ A;  4A3G H;  1EY5 A;  2BDN A;  1IBM L;  2F0E A;  4CHT B;  1Q90 A;  3K5M A;  2KCM A;  3SE0 A;  1ENC A;  3VYU A;  4NMZ A;  2B2W A;  3KF8 A;  4JI0 Q;  4A3D B;  1TWA B;  1AE2 A;  5E3F A;  4BY1 H;  5IOC A;  4DV7 L;  5I4D A;  1SYE A;  5I6Y A;  1PZI D;  3F2D A;  2RA4 A;  3CCL A;  2SNS A;  1V43 A;  1KRT A;  3IKJ A;  5DM6 3;  3ULJ A;  2B3G A;  1KAA A;  3DUZ A;  3RLF A;  3GTP B;  3ERO A;  2K14 A;  3CPF A;  4A3E H;  4KLK A;  3OPO A;  3NEM A;  2ZJR A;  1OTC A;  2RHQ B;  3HKZ G;  2Q8T A;  4R4T A;  4A3K G;  1PDQ A;  3KJP A;  1R4P B;  3HOV G;  2R92 B;  1XXG A;  3M3Y H;  1HNX L;  5JEA J;  1RIP A;  3W5O A;  2EYJ A;  1WJJ A;  4MTK A;  4GLX A;  3TP7 A;  2FFK B;  2LSS A;  1PVO A;  1C0A A;  2L55 A;  4BBS B;  4MIU A;  1O7I A;  3HOU B;  3J80 E;  1J9O A;  1IKM A;  3UDX A;  1KRS A;  2JQO A;  4A3B H;  3M4O H;  4UAI A;  3I70 A;  4EVO A;  3I8Z A;  3VDY A;  3VYR A;  4DK0 A;  3K5O A;  1TS5 A;  3RUZ A;  1T5X D;  4JYA L;  5CV7 A;  3I90 A;  1JB3 A;  1ESF A;  4OIJ A;  4GOP C;  4KY6 A;  1MIU A;  2JYO A;  5JEA H;  4DR6 Q;  4JBJ A;  2L0C A;  1GM5 A;  1K83 B;  1K8G A;  4A3C G;  3PUY A;  4F87 A;  4CKE A;  1GHJ A;  1I4P A;  1WCM B;  3URY A;  4CJ1 B;  2ALY B;  1D1I A;  2K5N A;  1BKB A;  3P7J A;  3KF8 B;  5C3E H;  4TRD A;  1TQO A;  4G7Z C;  4DF7 A;  1Q82 C;  3NK9 A;  3W1G A;  1ZKO A;  2B2T A;  2I0Q A;  2SNM A;  4HMI A;  1VQA A;  2BCO A;  1B3A A;  1IYU A;  3IFD A;  1I4H A;  4ZQ3 A;  3HRZ C;  2WKC A;  1JB7 A;  2ZJQ A;  1JWM D;  4BS9 A;  2B2U C;  1Z47 A;  3HOZ B;  2F4V Q;  3I4M B;  2AMC B;  2F0J A;  4YCV A;  3U9S A;  1X9N A;  1H9R A;  5C4J B;  1JIC A;  4BXX G;  2DY8 A;  2AWO A;  4RA8 A;  3OIQ A;  3VYS A;  4A3F G;  1SJE D;  3T13 A;  3TQY A;  1IBM Q;  2I07 B;  4DAY A;  2DNE A;  2TMP A;  2OCE A;  3HS0 C;  1WFQ A;  4LJZ C;  4IPH A;  4XQQ A;  2Z0S A;  3OTO L;  5FO8 B;  1KC8 C;  4DV7 Q;  1YJW A;  2I5H A;  4MHE A;  1DZ1 A;  4GNX B;  4LFA L;  3D3R A;  1JOK A;  4K2L A;  1QB5 D;  2QDB A;  2A6E C;  1PFN A;  4LUZ A;  5ELE A;  4KKT A;  3W2D A;  3IAY A;  4TQU S;  1X56 A;  2AQ1 B;  2E2J H;  1ET6 A;  4A3M H;  3G48 A;  1U5K A;  4X65 L;  3PQI A;  4K14 A;  5KRU A;  3OMG A;  2WB1 E;  1FD7 D;  2CVR A;  4B3S L;  3BG3 A;  2XWJ B;  3FP9 A;  4DUY L;  4R9W A;  3RN2 A;  1HNX Q;  1E1O A;  2A6E D;  1YHQ A;  3J81 i;  3DEO A;  1I3Q B;  1GUN A;  2WAQ G;  4DR7 L;  3FVQ A;  2BDO A;  4DV4 L;  1PH6 A;  1U4P A;  1VQK A;  1VQ5 A;  4LNQ A;  4WFN 3;  1XMQ L;  3ND8 A;  3TDQ A;  3QG1 A;  1I50 H;  2JA5 G;  4JYA Q;  4RG1 A;  5M3M H;  2OQ0 A;  5FLX c;  2K05 A;  4BBR B;  3A56 A;  4JW0 A;  3PCO B;  1EQQ A;  3HOX G;  4DAY B;  1KL9 A;  4FYD A;  4HJ8 A;  4R1J A;  5IWA L;  2B63 B;  3WOE A;  3ER0 A;  5I2Y A;  3T51 B;  1D1K A;  1Y1V B;  3S14 B;  2O4X A;  2A74 C;  4GN4 B;  3TP6 A;  2JA8 G;  5DNF A;  4HID A;  5IGG A;  2IL8 A;  4X6A H;  4U68 A;  1J5E L;  1A2U A;  2PYK A;  1NR4 A;  4G57 A;  3CQZ B;  5LHY 1;  3HOW H;  2XNA C;  5EBD A;  3PIP A;  2OTL A;  1CI3 M;  1IKL A;  3RZD B;  4BWG B;  2JA7 G;  3GQB A;  1Z7T A;  5IP7 G;  1GO3 E;  3HKS A;  1B44 D;  2R7F A;  1HA5 A;  2K01 A;  3H0G G;  3C46 A;  1SFO H;  3R93 A;  4CDD C;  1I94 L;  3J81 c;  3FMC A;  4A3L H;  1OXT A;  3MC0 B;  5C44 B;  1SE4 A;  5GAG C;  4OO1 H;  3OTO Q;  1D6E C;  2RDG A;  2OWO A;  2QDL A;  3DLL A;  1K8A C;  1Q8I A;  4PNY A;  4DFA A;  3KLS X;  3S1N H;  4LFA Q;  3NBH A;  3S1M H;  2B2W C;  1X54 A;  1VQ8 A;  4H44 C;  3TSS A;  3SXH A;  4AIM A;  1JJC B;  3Q6S A;  2NYZ D;  1EQT A;  4C3H H;  2IX0 A;  4X65 Q;  1B53 A;  1PH4 A;  2F0L A;  4XIG S;  4EQ5 A;  1QOH A;  3CCR A;  5GAD C;  4B3S Q;  1KDB A;  2WB1 B;  4DUY Q;  2JK8 A;  1ILP A;  1ZYR C;  4LW1 A;  1DOL A;  4DR1 L;  1EEF D;  2BA0 A;  2UUA L;  1XNQ L;  2ES2 A;  4OEM B;  1U0L A;  2F0S A;  4AH6 A;  4I7A A;  3ONA B;  4A3J H;  1RKN A;  3C3L A;  4DR7 Q;  1EU3 A;  2JA9 A;  1EOT A;  2ZM6 L;  4DV4 Q;  2WP8 J;  2NVT B;  2N88 A;  3NQI A;  3MFG A;  4IZ8 A;  3V2T A;  4DPG A;  5CGK A;  1TS2 A;  2XSC A;  3BVM A;  1XMQ Q;  1ZYR D;  3HKZ B;  2K5H A;  1TWG H;  1KDA A;  1AEX A;  4A3K B;  1OXV A;  2DJG C;  3HOV B;  5FLX L;  3J81 j;  2UU9 L;  2XN9 C;  1X6O A;  3I3C A;  1S40 A;  5IWA Q;  3BU2 A;  3S2H H;  2A19 A;  4I7Z C;  1EIH A;  1AN8 A;  2G5D A;  1RD9 D;  5IY0 A;  1I4Q A;  1W3S A;  5HY6 A;  4C3J G;  3SVM A;  4KD3 A;  2GVB A;  1J5E Q;  3UDG A;  3NBH B;  3GO5 A;  2UXC L;  4K6D A;  5IGD A;  3KOJ A;  3SHL A;  1HFG A;  3SK5 A;  1BCP F;  1IHZ A;  2B2T C;  5C0X I;  5BR8 L;  1EY4 A;  1YNX A;  2N3S A;  1BXT A;  1OXU A;  1XPU A;  5EKK A;  4L6T B;  4DV2 L;  2AKW B;  1I94 Q;  1GJX A;  1ZXT A;  1BCP B;  5IIF A;  1L1O A;  3CCM A;  3J81 L;  3RLN A;  3UE1 A;  3J7A F;  1BUV T;  2QEJ C;  3E0J A;  1LAB A;  4R8N A;  2R3Z A;  2AHO B;  2WAC A;  4DK6 C;  2HQL A;  1STE A;  2A1A A;  1FGB D;  3BJU A;  3NBI A;  5JJZ A;  1XNR L;  2L12 A;  4ILW A;  3PGZ A;  3K0X A;  2GVA A;  2K5Q A;  4QJF A;  3UDI A;  2KHI A;  4A3I G;  1UE7 A;  1CKN A;  2F0Q A;  1PV4 A;  3NHH A;  4J1M A;  1AH9 A;  5J39 A;  3HEJ A;  4JCV E;  4JI7 L;  4A3F B;  4XT1 B;  1VQF A;  1B50 A;  3GTQ H;  2UUC L;  3K0Y A;  1A2T A;  1T9H A;  1GOZ A;  2EXZ A;  2PI2 A;  1JQY D;  4IUU A;  4EQP A;  2E2H H;  4HSP A;  2KCC A;  1LT6 D;  3S15 B;  4C56 C;  3FKI H;  4RGO S;  3HFZ B;  3E6Z X;  2XRQ D;  1T5E A;  3I73 A;  3M85 A;  1DOM A;  4DR1 Q;  4R4Q A;  3LNN A;  1TWF H;  2UUA Q;  1XNQ Q;  2V1C C;  3KBX A;  5EJW A;  3GDE A;  3RMH A;  2LMC B;  1KTK A;  5FLM H;  4OHJ A;  4BA2 I;  2CWA A;  2ZM6 Q;  3CCE A;  1L2F A;  3HOY H;  4QF4 A;  1DYQ A;  4KI0 A;  2BOS A;  2KBN A;  5FLX E;  1QZH A;  3VA5 A;  3TP5 A;  5BN5 A;  1YEZ A;  3NSW A;  3BYT B;  4C3I H;  2E2I H;  1Q8K A;  1X3G A;  3NTH A;  1EZ6 A;  1S5F D;  1KNE A;  1JWU D;  3U4V A;  2C5C A;  4B9X A;  1L1O B;  2UU9 Q;  4TVA B;  2MO1 A;  4C1N K;  2PCF B;  1D8L A;  1UEA B;  1P8L A;  1PRT F;  1S5C D;  3NEL A;  1EFW A;  1VQI A;  3UDF A;  2WAQ B;  2F0H A;  4KN4 C;  3QOJ A;  4K6L A;  4LUO A;  5IYD H;  2UXC Q;  1PRT B;  2DJF C;  1CKN B;  1F9Q A;  3IFT A;  4O1N A;  5IGB A;  2EY6 A;  3DM3 A;  3K7A B;  3AQQ A;  5M3F H;  5BR8 Q;  4JVZ A;  3J81 E;  2R7Z G;  3PUW A;  2NN6 H;  3HOX B;  5ELC A;  5C4X H;  2PO4 A;  3S1R B;  3DMU A;  3CXC A;  3F2U A;  4ODG A;  4PZ6 A;  2VUM G;  4DV2 Q;  3CP0 A;  2F0K A;  3D8G A;  2K6A A;  4XDX A;  4HJ7 A;  2JA8 B;  3C1E A;  1EIG A;  1H9M A;  4JG2 A;  3D0F A;  5JEA G;  3E9I A;  2EQS A;  3VYT A;  3A8K E;  1XNR Q;  1HTP A;  3RR5 A;  4R4I A;  1A15 A;  1R4Q B;  2RF4 A;  1KXL A;  2JA7 B;  2F1M A;  1AW7 A;  5C3E G;  3H0G B;  3S2D H;  4IFD I;  4DA2 A;  1DD2 A;  1XTD A;  1FL0 A;  1PFM A;  1M1K C;  4IUT A;  4C1N I;  5C4H A;  4BY7 G;  1D2B A;  4JI7 Q;  2IHF A;  1KQS A;  1U4R A;  3O13 A;  3A55 A;  1CUK A;  4L5Q A;  4IUP A;  2HDL A;  5D3D A;  2UUC Q;  2EYL A;  2Y0S G;  1VQE A;  4L63 B;  3S1Q H;  1MJC A;  1A3U A;  3T1Y L;  2EPB A;  4FXG C;  3GTL B;  1MKH A;  3EQL C;  4P75 A;  4H0L C;  2JEA I;  1BCP C;  4DXF A;  2A8V A;  1Y8P B;  4MN3 A;  1PH7 A;  4Q5V A;  1V9P A;  4DUZ L;  4JI4 L;  5CR3 A;  3MEH A;  3NEN A;  4L5T A;  3DWP A;  1FJG L;  1TWA H;  1O7L A;  3L7Z C;  3GTG B;  4GN3 B;  1TWC B;  3HGB A;  4QIW B;  2OF1 A;  2HDM A;  4DAM A;  1QJO A;  1C4Q A;  2FMM A;  2HD3 A;  2R93 B;  4F88 A;  1BCP D;  4JI8 L;  4PMB A;  1I5F A;  3HG9 A;  1UNS A;  1HXY D;  3GTJ B;  1SR3 A;  5A2Q E;  4A3M G;  1EY9 A;  2X6L A;  5M5Y B;  4KV6 A;  4CJ0 B;  1HNW L;  1AZP A;  1X3P A;  4X3S A;  3NPP A;  2QF7 A;  4Y7N B;  2EYO A;  4AYB G;  1F2Y A;  4YIJ A;  3QIA A;  3J7Z C;  2R92 H;  2HIV A;  5G3L F;  2HCI A;  1HPC A;  1VF7 A;  2RCF A;  4WJW A;  3PO3 B;  1NY4 A;  4BBS H;  1EOV A;  1KIX A;  1A0I A;  2WFW A;  3HOU H;  3BVG A;  4P2C B;  4DAP A;  2E8G A;  3SK8 A;  1SYD A;  2N49 A;  2EVB A;  1C8C A;  2OT2 A;  2L9H A;  4C3J B;  3TEH B;  3MTS A;  5CC4 A;  3H3V I;  4XYO A;  2FIN B;  5C3X A;  5ELO A;  4S3S A;  2KED A;  2LKV A;  2CWP A;  1K83 H;  1L1O C;  3OW7 A;  1YHA A;  2H5X A;  2M9V A;  5C0X J;  4CDC C;  4P72 A;  5M5W H;  4A93 H;  1BQQ T;  1MD2 D;  1WCM H;  1BDO A;  2HCC A;  2JJQ A;  1CA6 A;  4DGZ A;  4LF6 L;  3Q23 A;  3FRP B;  1B9N A;  2F0P A;  2A6H C;  1ROD A;  1UUP A;  1E0B A;  4HJA A;  3FDT A;  3HOW G;  1JE4 A;  2EY5 A;  5H1S E;  4X66 L;  4QCL A;  1EY8 A;  2N8N A;  1RF2 D;  5KEE A;  1EYG A;  1QIL A;  1PYS B;  2O5I C;  3T56 B;  4KK7 A;  2EYH A;  1AE3 A;  2Q2H A;  1SND A;  3T1Y Q;  4DU9 A;  2ZXO A;  5C0X H;  2ZTC A;  1EY6 A;  3I4M H;  4YY3 L;  1L0X B;  2KUM A;  4ZKC B;  5C4J H;  1N8R C;  2A6H D;  4A3I B;  3OMC A;  1HUM A;  4IPD A;  4DUZ Q;  4GNX A;  5CV8 A;  4JI4 Q;  2ATW A;  1Y1W G;  2NVX B;  3D4W A;  1PLF A;  3GTK B;  1FJG Q;  3L9A X;  1B70 B;  4OO1 G;  2J0T D;  2CH4 W;  2QCP X;  1X3E A;  1EL0 A;  1FNV A;  4HMJ A;  1VS0 A;  2K7V A;  1E2W A;  1SNP A;  1VMC A;  3WOF A;  1BO0 A;  4JI8 Q;  2QA4 A;  3ERQ A;  5L37 A;  4LMQ D;  3PIP 3;  1PH3 A;  1YIT A;  4J6H A;  3FPP A;  3CCS A;  4L5S A;  1WVL A;  1G2T A;  1Q46 A;  1VQM A;  4JI6 L;  2WKD A;  2MUY A;  3L2P A;  1HNW Q;  4HAE A;  3OSO A;  1QG7 A;  4FP5 D;  3EVQ A;  4B3M L;  3E3X A;  4B9W A;  1O7Y A;  5CV6 A;  3U9O A;  2DY7 A;  1UAP A;  3U58 A;  4JV5 L;  5JAV A;  1W6J A;  2D5D A;  1KLU D;  2F0U A;  1PHJ A;  1W6K A;  3H91 A;  4KJO A;  3BDO A;  3KUP A;  1X65 A;  3MXU A;  1KNA A;  1V1Q A;  1VQJ A;  4LWC A;  5JPM C;  1U4L A;  3QJY A;  3KLW A;  3M4Y A;  1E22 A;  1I3Q H;  1XYI A;  1TWH B;  3PO2 B;  1SLJ A;  3G6E A;  2NBF A;  3Q22 A;  3A8I E;  1DGS A;  4R4O A;  2PW7 A;  2EYM A;  4ME5 A;  1ONL A;  1G51 A;  3K59 A;  5LMU L;  1PXU A;  3NP8 A;  4YWM A;  3MXG A;  4BBR H;  2Z6K A;  1VQB A;  3BVZ A;  1GVP A;  2K4K A;  3K57 A;  1PH5 A;  1AP0 A;  4RWS C;  1X55 A;  2B63 H;  1Y1V H;  2QW7 A;  4LF6 Q;  3S14 H;  2R7Z B;  2L11 A;  4LF4 L;  2ID0 A;  1QCB D;  2VUM B;  1BF4 A;  4WJ3 M;  3CQZ H;  4J8Q A;  1GUS A;  4X66 Q;  5IGF A;  3OYY A;  1EWH A;  2NTT A;  4CDE C;  2O2L D;  2OTJ A;  3RZD H;  4RMF A;  2V4D A;  3CKI B;  1V1P A;  1WTX A;  1S5E D;  4YY3 Q;  4R4C A;  2NUC A;  2NN6 I;  1QUQ A;  2CFM A;  4HSV A;  3D31 A;  4IFD J;  2K03 A;  5C44 H;  2AQ3 B;  2X6G A;  4BY7 B;  3I91 A;  1LT5 D;  3HKZ E;  2JA6 B;  2O5J C;  1VDZ A;  2L15 A;  1FR3 A;  5EPL A;  2EDG A;  1EFI D;  1YI2 A;  1Q81 C;  2Y0S B;  1G29 1;  2RSO A;  5G3L D;  3S17 B;  3ICE A;  1Q1B A;  3VR4 A;  1MHW C;  1DM0 B;  4BA1 I;  1C48 A;  1L0Y B;  4IFD H;  4ALP A;  1E2V A;  3MXN B;  4JI6 Q;  2HUG A;  4PZ8 A;  3QWN A;  4GN5 A;  4RFB A;  2MJ8 A;  2EY1 A;  2JXM B;  4B3M Q;  3U4Z A;  1D5X C;  1EUJ A;  2YTX A;  2HHH L;  3N52 A;  1O7Z A;  1BVS A;  1HNZ L;  3FKI G;  3K80 C;  4JV5 Q;  1F2Z A;  4JC0 A;  4NXN L;  3E5S A;  1QE6 A;  1X3F A;  4RCN A;  3CC2 A;  4O2D A;  2A5H A;  2YU9 B;  4XQJ A;  4E6I A;  4CKC A;  3E0E A;  2CH4 A;  4A3M B;  2L5T A;  1EU4 A;  2NVT H;  3HOY G;  3GTO B;  4UHV A;  3G6J B;  3VR2 A;  2D9U A;  1V1P B;  4C3I G;  4CKB A;  5LMU Q;  5J22 A;  1IW7 C;  2K5V A;  3T4A C;  4X3K A;  1QUQ B;  3HOV H;  1LTR D;  2R6G A;  3D4D A;  1LAC A;  2CCZ A;  2RSN A;  1D5M C;  5DM7 3;  3MHB A;  2VZA A;  1PH8 A;  2VQF L;  4KTA A;  2L4N A;  1WTQ A;  2NTS A;  2ENB A;  1IYJ B;  2MQH A;  3TS2 A;  2ZT9 C;  1SXT A;  4LF4 Q;  2H1E A;  2PZU A;  4DAV A;  1JOR A;  4IO9 A;  2NVQ B;  1HFN A;  1XPO A;  3NTK A;  2RHS B;  1BNZ A;  1IW7 D;  2EYP A;  2YYZ A;  5K36 H;  4IOC A;  1DXM A;  2UUB L;  2F0F A;  3EJI A;  5M3F G;  3EA6 A;  2B2V A;  3PSI A;  4WJ4 A;  4GLA C;  4FXD A;  3I4N G;  3TBI B;  5IYC H;  5E1F A;  2EJF C;  5E4W C;  2NWG A;  1Q86 C;  2KQ3 A;  2QGQ A;  3J7A 5;  4ZK9 B;  2FHT A;  1HJP A;  3RZO B;  3M4P A;  3H3V H;  2SOB A;  4H13 C;  4GNX C;  1UWV A;  5FOB B;  1ASY A;  1EIY B;  1GXD C;  4FNF A;  1LM0 A;  4DN4 M;  3ERS X;  2ZXR A;  2ICE C;  3DEP A;  1EEI D;  1IXR A;  2KHS A;  4RGM A;  2WAQ E;  2XRS D;  5FJ8 G;  3AB9 A;  1YJN A;  2VXW A;  2XVS A;  1Y1W B;  1JT8 A;  2XWB B;  2UXD L;  1ICW A;  2HHH Q;  5IGC A;  3H09 A;  1HNZ Q;  1CHQ D;  4NXN Q;  2IWH A;  5COY A;  4QB4 A;  2OEO A;  2KEC A;  2PZW A;  4PG3 A;  1N33 L;  4OON A;  2PI2 E;  4JPB W;  3CW2 C;  4Y52 H;  1Y69 U;  3W3A A;  2GN5 A;  1R9T B;  2E74 C;  4A93 B;  1I6H B;  3KFU A;  3PUZ A;  4LF5 L;  2EXD A;  1ENA A;  3WDN A;  2VB3 X;  3SK6 A;  4U67 3;  5C5M A;  3S24 A;  1SRO A;  2HT1 A;  4ZCK A;  1CQF A;  3HZX A;  4LK1 C;  5CMD A;  4JOI A;  4DR2 L;  2RKS A;  4XXE A;  3ULP A;  2F0V A;  4N8F A;  3TZD A;  3IRB A;  2VQF Q;  5IYB H;  2FXQ A;  3R8B A;  3D4R A;  4IOA A;  2NVY B;  2I46 A;  4NPS A;  1QNU A;  4TSS A;  2I5M X;  4NP5 A;  5D3I B;  2KCT A;  3JC6 6;  5IP9 H;  2D62 A;  3BS1 A;  1CKO A;  4KJN A;  2UUB Q;  3V96 A;  2EJG C;  3KLS A;  1NNX A;  4KY5 A;  4MTN A;  1ENF A;  3K7A H;  2X69 A;  1LTT D;  1XTC D;  2F0N A;  1G8Z D;  3HOU G;  1VQ9 A;  4A3G G;  4K2K A;  3AU7 A;  1FYC A;  4MNO A;  3VR5 A;  3CC4 A;  1LTB D;  2J4X A;  2IW3 A;  1TVX A;  5EKI A;  5KYL A;  1I4G A;  2JA8 H;  1II3 A;  1G6Z A;  5M5X B;  4BY1 G;  1NSN S;  4QIW E;  3AMU A;  2MGS A;  1O80 A;  1YZ6 A;  2PQE A;  2WII B;  2MFI A;  2CW0 C;  5ELB A;  3TS0 A;  4A93 G;  2JA7 H;  4C2M B;  2NB0 A;  5IP7 H;  1TS4 A;  5KIX A;  1DOK A;  1JOQ A;  3A7L A;  3M4Q A;  4HN7 A;  4Z9C B;  1JMC A;  3BZD B;  4ZAI A;  2Q8I B;  3S16 H;  4GKK L;  4MZ9 A;  1HR0 W;  4XTC S;  3U50 C;  1WTR A;  4A3E G;  5K5P A;  3JAM i;  1ZEQ X;  2YTY A;  4DR4 L;  1V1O A;  2VL6 A;  3CU7 A;  3STB C;  1KD1 C;  2CW0 D;  1MSG A;  2UXD Q;  5C0X G;  3F2C A;  5C5L A;  1HR0 L;  4ZKB B;  3G71 A;  3KDF B;  1JE5 A;  2JA5 B;  1ESR A;  2RQX A;  5I9O A;  1VQC A;  4JI3 L;  3GTL H;  2J7Z A;  1TU2 B;  2AWN A;  1BR9 A;  4UDU C;  2F4I A;  1N33 Q;  3ULL A;  2K32 A;  2DN8 A;  1FNW A;  1LT3 D;  1SBB B;  1F2L A;  4A3B G;  2B2U A;  1K8O A;  4IJH A;  3RN5 A;  3STB D;  2WV6 D;  2PNH A;  2JN4 A;  1WTV A;  4LF5 Q;  2H4O A;  5CV5 A;  3GTG H;  2PPB C;  1O78 A;  3K8A A;  1TWC H;  4K0K L;  2E2H B;  1JC7 A;  3GD7 A;  1OO9 B;  2R93 H;  3CPW A;  3TP8 A;  3GTJ H;  5FKA C;  4DR2 Q;  5KND A;  4DV5 L;  1H9K A;  4QUC A;  3SR1 A;  4RGT A;  1G2S A;  3J7Y W;  5M5Y H;  1ICF B;  1EQR A;  1TT2 A;  2JE6 I;  3A8J E;  4Y7N H;  1U4M A;  4ZLT F;  3HOY B;  2KHJ A;  1CA5 A;  2F0G A;  3JAM c;  4P74 A;  4RKB A;  5A35 A;  2K52 A;  4IAL A;  2E2I B;  1F9S A;  3KBG A;  2VQE L;  4B3R L;  2VS1 A;  4GOP B;  2Q2T A;  2K04 A;  1IYV A;  1S4Z A;  3PO3 H;  3EN2 A;  2XIW A;  4FVM A;  1GUG A;  1G6P A;  1QWY A;  1CK1 A;  1X32 A;  4KD4 A;  2CKZ B;  5J1Z A;  1JOO A;  1B9M A;  1VQG A;  2B2V C;  4FDB A;  4DV3 L;  1QVG A;  1PTO F;  1I4R A;  4LF8 L;  1EYD A;  2ZTE A;  1PFS A;  5NUC A;  3H3V C;  1V8Q A;  4Q0F A;  4LFC L;  4C3J H;  4A3D H;  1Y14 B;  2ZXP A;  2MNA A;  2OXP A;  2Z9H A;  1MJE A;  1SMX A;  1PTO B;  4UP8 A;  2QEX A;  1LLR D;  1LTG D;  4YCW A;  3G7L A;  1LO5 D;  1Y1V G;  5DAU A;  4IJL A;  4CDF C;  4RGN A;  4KKS A;  3I4N B;  1DCZ A;  4GKK Q;  3GTP H;  2B8F A;  2F03 A;  1QVC A;  2LY7 A;  1H9J A;  2F0D A;  1WTW A;  2F0I A;  3NXW A;  1NUC A;  4DR4 Q;  5I6W A;  2RDF A;  1CSQ A;  1G91 A;  5C3W A;  1VQL A;  2BE5 C;  2A69 C; 
#chains in the Genus database with same CATH homology
 3EFX D;  2IPK D;  1CM9 A;  1HCZ A;  3OWE B;  4V19 0;  4KMU C;  1YNN C;  3NUC A;  5EKL A;  3N6R A;  5JOB A;  2VB2 X;  1VCI A;  4JBW A;  2FMC A;  4CBV A;  2RBM A;  2BE5 D;  2A69 D;  3FPU B;  4FF2 A;  1S5D D;  2D2C C;  1QNK A;  4HCS A;  2FJ2 A;  1PMR A;  3GTM B;  4K8J A;  5TSS A;  1JCK B;  1YNN D;  3MVV A;  4IFD G;  4KN7 C;  4JK1 C;  2F0W A;  4F7X A;  1HA6 A;  4G7O C;  3RD4 A;  1HRJ A;  1SNM A;  2SEB D;  4DNT B;  3ZYY X;  1PRT C;  1OXX K;  1AZQ A;  4OL7 A;  1SE2 A;  3JAM L;  1HHV A;  1AFP A;  4IUR A;  3PUV A;  5BN4 A;  1GHK A;  3ND9 A;  2M2L A;  2QKI C;  3D6W A;  1GUW A;  3D6C A;  4FF4 A;  3P75 A;  4KHV A;  1PRT D;  4OGQ C;  1KDC A;  1SYG A;  4EQO A;  2F0M A;  1BOS A;  1WD1 A;  5HUR A;  1PYW D;  3QB3 A;  4HED A;  3SK4 A;  4A3G B;  4IUV A;  3MXP A;  4V0B A;  2R61 A;  4C3H G;  2EJM A;  2MPM A;  5K36 G;  2B39 A;  4BY1 B;  1PFB A;  5HGT A;  5C4Z A;  5AFW A;  3P20 A;  5LL6 X;  3KLR A;  2L1B A;  2JP1 A;  2K28 A;  5KGU A;  4NW2 A;  1F9R A;  2K5D A;  3NQT A;  4M8A A;  2KOL A;  2KVM A;  4RAU C;  4XT3 B;  3CHB D;  4I65 A;  4G4K A;  4ZRZ A;  1PTO C;  4A3E B;  5M9O A;  3TZU A;  3MXN A;  1Q3L A;  2EY2 A;  1RTO A;  1CFM A;  1XWE A;  4EQN A;  3M3Y B;  1SMY C;  4HCE A;  2MHV A;  1SNC A;  3MFY A;  1PTO D;  1FNU A;  4A3B B;  3JAM E;  3R3O A;  3M4O B;  3H6M A;  2F0O A;  4IUN A;  1CZW A;  4ZYS A;  3OIP A;  5I9P A;  5IT9 L;  4KY7 A;  3PV0 A;  4O42 A;  1SMY D;  3T16 A;  2E2D C;  1U9R A;  3NWT A;  1TS3 A;  4N9P A;  3A54 A;  5KNC A;  2PNR C;  1YNJ C;  5EQ0 A;  5C3E B;  5LL6 S;  4CGY B;  1Y8O B;  2QIL A;  1HQM C;  3NWS A;  5CBE E;  3C2P A;  2A68 C;  3K5N A;  5FO7 B;  1YNJ D;  4ZUJ A;  2Q8R E;  5FK9 C;  4ULL A;  5F2D A;  3CRK C;  4K5W A;  3DWQ A;  1GUO A;  4ABN A;  3Q24 A;  2MP1 A;  1KAB A;  1GUT A;  3DM1 A;  1RJT A;  3MA2 B;  3VR3 A;  3TME A;  3M7N A;  3BDL A;  3A7A B;  2KA7 A;  2A68 D;  1VF5 C;  5E4X A;  5ELD A;  3L3O C;  1E2Z A;  1HQR D;  3TN2 A;  2EYF A;  1B2T A;  2E2J B;  4N9T A;  1ILQ A;  5JVG 3;  1RHP A;  1TY2 A;  1RDP D;  2EE1 A;  2LFN A;  4AYB B;  1STA A;  1TR5 A;  1I4X A;  3UI2 A;  1A6X A;  1CZG A;  3R2I A;  2AUK A;  2F0T A;  3I4L A;  3K6O A;  2Z4I A;  3Q0A A;  5IT9 E;  3PMF A;  1CQV A;  5KNB A;  3LWU A;  1TII D;  1CTM A;  3HP3 A;  1I50 B;  5M3M B;  3P1H A;  4R8I A;  1A3V A;  2SDF A;  2NN6 G;  4H7B A;  3V05 A;  1S5B D;  2DNC A;  4RKL A;  1LV9 A;  2B2Y A;  2KCN A;  1VMP A;  1SYF A;  4FF3 A;  1OXS C;  3OHX C;  1X3Q A;  2IX1 A;  3HOW B;  1STB A;  4PV1 C;  2EOT A;  3X3N A;  1SYC A;  1EY0 A;  1MI2 A;  2F3W A;  2BA1 A;  4QMG A;  1SFO B;  1M4V A;  4XYQ A;  5ISR A;  5CV4 A;  3BYY B;  4PMC A;  1F2M A;  3NTI A;  1MBY A;  1EYC A;  1IL8 A;  1HTL D;  3VR6 A;  3S1N B;  2G9H D;  3S1M B;  1LTI D;  5DEH A;  2AQ2 B;  1RTN A;  1EZ8 A;  3KK7 A;  3DXJ C;  1Y8N B;  1NAP A;  1SJH D;  2GA4 B;  3MAQ A;  1JWS D;  3OWF A;  4RH6 A;  4EGV A;  2M00 A;  2K33 A;  3QO2 A;  5IOD A;  4C3H B;  4RCO A;  1J8I A;  4PQX A;  1ML0 D;  4X3T A;  4DNR B;  4NDX A;  1STN A;  1A3T A;  4FF1 A;  2Z8L A;  3I72 A;  5CV9 A;  1SNO A;  4WOR A;  4A3J B;  3PUX A;  4M1U B;  1CT1 D;  3LWE A;  1LTA D;  3T53 B;  1H9S A;  3H94 A;  4NKL A;  2A73 B;  4HR7 B;  4KHZ A;  3GV6 A;  1TWG B;  1PZJ D;  2K5W A;  5CBA E;  2JEB I;  1I6V C;  3S2H B;  5EGT A;  3J7A V;  5FO9 B;  4F8M A;  1BBX C;  2PZT A;  4B08 A;  3C1F A;  5I2X A;  1PZK D;  2G9D A;  3NE5 B;  5COR A;  1LTS D;  4RHS A;  1MSH A;  1Q1E A;  2CQA A;  3M7G A;  1JR0 D;  3DHQ A;  2Z1C A;  4ZUI A;  1CHP D;  1F77 A;  4IQZ A;  5C6A A;  2AUJ D;  4K5X A;  1SEB D;  2HQE A;  5T1I A;  3MWY W;  4L8J A;  1HUN A;  4WRD A;  1SNQ A;  3VA7 A;  1SE3 A;  2B8G A;  1EYA A;  1NCV A;  1H9S B;  2RVL A;  5A2Q L;  3GTQ B;  2EZV A;  2RDH A;  5D65 A;  1PTO H;  2E75 C;  4LAA A;  2Z4H A;  3R2T A;  1LT4 D;  3X3M A;  5EPJ A;  3FKI B;  1D5Z C;  1SDF A;  2LS0 1;  4G7H C;  4TKO B;  1STG A;  1TWF B;  4FXK C;  3GV3 A;  1SSO A;  1F9P A;  5EPK A;  4DK1 A;  2N55 A;  4FO2 A;  2F3V A;  1M8A A;  1TY0 A;  3FEW X;  1DJR D;  2TSS A;  4C3I B;  2NZ1 D;  1NR2 A;  5BN3 A;  4RHR A;  5T1G A;  4CJ2 C;  3S9W A;  3S16 B;  4DXG A;  4GZY C;  5KYI A;  2C9O A;  4IN3 A;  1RCV D;  2WIN B;  2B2Y C;  2K1B A;  1B4O A;  2IJ0 A;  1MGS A;  2E76 C;  1WTP A;  1SAP A;  2VNU D;  5M3F B;  3ITP A;  1SYB A;  1STY A;  3DWA A;  2PW5 A;  1EY7 A;  2JSO A;  5C4X B;  4XQN A;  3CRL C;  1XX8 A;  1KLG D;  5EBC A;  1WD0 A;  5D14 A;  4QUF A;  4IUQ A;  1Z6H A;  2IT1 A;  1STH A;  5CYU A;  1DON A;  4OO1 I;  4OIK A;  3J80 L;  4X3U A;  2IX3 A;  4HTH A;  3QOL A;  4PMW A;  3PIO 3;  1Q12 A;  4K8I A;  1EQV A;  1TKW B;  1WTO A;  3MZ5 A;  3S2D B;  1ET9 A;  1EWC A;  2ICI A;  3BDC A;  5JPN C;  1B1Z A;  5ELF A;  2CHB D;  4KKU A;  3SEB A;  3K5L A;  4ID6 A;  3IL8 A;  4K5V A;  3S1Q B;  1K8M A;  5JVH 3;  2KJX A;  3GP7 A;  2KEE A;  2PMZ B;  3LX0 A;  3OOC A;  3K58 A;  5IGE A;  3SDZ A;  1EY5 A;  2BDN A;  2F0E A;  4CHT B;  1Q90 A;  3K5M A;  3SE0 A;  1ENC A;  3VYU A;  4NMZ A;  2B2W A;  3KF8 A;  4A3D B;  1TWA B;  5E3F A;  5IOC A;  5I4D A;  1SYE A;  5I6Y A;  1PZI D;  2RA4 A;  2SNS A;  1V43 A;  3IKJ A;  5DM6 3;  1KAA A;  3DUZ A;  3RLF A;  3GTP B;  3ERO A;  3OPO A;  2Q8T A;  1PDQ A;  1R4P B;  2R92 B;  1XXG A;  5JEA J;  2EYJ A;  3TP7 A;  2FFK B;  2L55 A;  4BBS B;  4MIU A;  3HOU B;  3J80 E;  1J9O A;  1IKM A;  4UAI A;  3I70 A;  4EVO A;  3I8Z A;  3VYR A;  4DK0 A;  3K5O A;  1TS5 A;  3RUZ A;  1T5X D;  5CV7 A;  3I90 A;  1JB3 A;  1ESF A;  4OIJ A;  4KY6 A;  2JYO A;  5JEA H;  2L0C A;  1K83 B;  3PUY A;  4F87 A;  4CKE A;  1GHJ A;  1I4P A;  1WCM B;  3URY A;  4CJ1 B;  5M5W B;  1D1I A;  4A93 B;  3P7J A;  4TRD A;  1TQO A;  4G7Z C;  4DF7 A;  3NK9 A;  1ZKO A;  2B2T A;  2SNM A;  4HMI A;  2BCO A;  1B3A A;  1IYU A;  3IFD A;  1I4H A;  4ZQ3 A;  3HRZ C;  2WKC A;  1JWM D;  4BS9 A;  2B2U C;  1Z47 A;  3HOZ B;  3I4M B;  2F0J A;  3U9S A;  1H9R A;  5C4J B;  1JIC A;  2DY8 A;  2AWO A;  4RA8 A;  3OIQ A;  3VYS A;  1SJE D;  3T13 A;  2I07 B;  4DAY A;  2DNE A;  2TMP A;  3HS0 C;  4LJZ C;  4XQQ A;  5FO8 B;  4MHE A;  1DZ1 A;  3D3R A;  1JOK A;  4K2L A;  1QB5 D;  2QDB A;  2A6E C;  1PFN A;  5ELE A;  3W2D A;  4KKT A;  3IAY A;  4TQU S;  2AQ1 B;  1ET6 A;  4K14 A;  5KRU A;  3OMG A;  1FD7 D;  2CVR A;  3BG3 A;  2XWJ B;  4R9W A;  2A6E D;  3DEO A;  1I3Q B;  1GUN A;  3FVQ A;  2BDO A;  1U4P A;  4WFN 3;  3ND8 A;  3TDQ A;  3QG1 A;  2K05 A;  4BBR B;  3A56 A;  4FYD A;  2B63 B;  3WOE A;  5I2Y A;  3T51 B;  1D1K A;  1Y1V B;  3S14 B;  2O4X A;  2A74 C;  3TP6 A;  5DNF A;  5IGG A;  2IL8 A;  4U68 A;  1A2U A;  2PYK A;  1NR4 A;  4G57 A;  3CQZ B;  5LHY 1;  2XNA C;  5EBD A;  1CI3 M;  1IKL A;  3RZD B;  4BWG B;  3GQB A;  1Z7T A;  1B44 D;  1HA5 A;  2K01 A;  3C46 A;  3R93 A;  3FMC A;  1OXT A;  3MC0 B;  5C44 B;  1SE4 A;  4OO1 H;  1D6E C;  2RDG A;  1Q8I A;  4PNY A;  4DFA A;  3KLS X;  3NBH A;  2B2W C;  4H44 C;  3TSS A;  3SXH A;  3Q6S A;  2NYZ D;  1EQT A;  2IX0 A;  1B53 A;  2F0L A;  4XIG S;  1QOH A;  1KDB A;  2WB1 B;  1ILP A;  1ZYR C;  1DOL A;  1EEF D;  2BA0 A;  2F0S A;  3ONA B;  3C3L A;  1RKN A;  1EU3 A;  1EOT A;  2WP8 J;  2NVT B;  2N88 A;  3NQI A;  3MFG A;  4IZ8 A;  3V2T A;  5CGK A;  1TS2 A;  2XSC A;  3BVM A;  1ZYR D;  3HKZ B;  1KDA A;  1AEX A;  4A3K B;  1OXV A;  3HOV B;  5FLX L;  2XN9 C;  3I3C A;  4I7Z C;  1EIH A;  1AN8 A;  1RD9 D;  1I4Q A;  4C3J G;  3SVM A;  4KD3 A;  3GO5 A;  4K6D A;  5IGD A;  3SHL A;  1HFG A;  3SK5 A;  1BCP F;  1IHZ A;  2B2T C;  5C0X I;  1EY4 A;  1BXT A;  1OXU A;  5EKK A;  4L6T B;  1GJX A;  1ZXT A;  1BCP B;  5IIF A;  3J81 L;  3J7A F;  1BUV T;  2QEJ C;  3E0J A;  1LAB A;  4R8N A;  2R3Z A;  2WAC A;  1STE A;  1FGB D;  3NBI A;  5JJZ A;  2L12 A;  4ILW A;  2K5Q A;  2F0Q A;  3NHH A;  4J1M A;  5J39 A;  3HEJ A;  4A3F B;  4XT1 B;  1B50 A;  3K0Y A;  1A2T A;  1GOZ A;  2EXZ A;  1JQY D;  4IUU A;  4EQP A;  4HSP A;  2KCC A;  1LT6 D;  3S15 B;  4C56 C;  4RGO S;  3E6Z X;  2XRQ D;  1T5E A;  3I73 A;  3M85 A;  1DOM A;  3LNN A;  3KBX A;  5EJW A;  3RMH A;  2LMC B;  1KTK A;  4BA2 I;  4OHJ A;  4QF4 A;  1DYQ A;  4KI0 A;  2BOS A;  5FLX E;  3VA5 A;  3TP5 A;  5BN5 A;  3NSW A;  3BYT B;  3NTH A;  1EZ6 A;  1S5F D;  1KNE A;  1JWU D;  2C5C A;  4B9X A;  4C1N K;  2PCF B;  1UEA B;  1PRT F;  1S5C D;  2WAQ B;  2F0H A;  4KN4 C;  3QOJ A;  4K6L A;  1PRT B;  1F9Q A;  3IFT A;  4O1N A;  5IGB A;  2EY6 A;  3K7A B;  3J81 E;  3PUW A;  2NN6 H;  3HOX B;  5ELC A;  2PO4 A;  3S1R B;  3DMU A;  3F2U A;  4ODG A;  2F0K A;  3D8G A;  2K6A A;  4XDX A;  2JA8 B;  3C1E A;  1EIG A;  1H9M A;  5JEA G;  3VYT A;  3A8K E;  1HTP A;  1A15 A;  1R4Q B;  2JA7 B;  2F1M A;  1AW7 A;  3H0G B;  4IFD I;  4DA2 A;  1DD2 A;  1PFM A;  4IUT A;  4C1N I;  5C4H A;  1D2B A;  1U4R A;  3O13 A;  3A55 A;  4IUP A;  2HDL A;  5D3D A;  2EYL A;  4L63 B;  1A3U A;  2EPB A;  4FXG C;  3GTL B;  3EQL C;  4H0L C;  2JEA I;  1BCP C;  4DXF A;  1Y8P B;  4MN3 A;  4Q5V A;  5CR3 A;  3MEH A;  3DWP A;  1O7L A;  3L7Z C;  3GTG B;  1TWC B;  3HGB A;  4QIW B;  2OF1 A;  2HDM A;  1QJO A;  1C4Q A;  2FMM A;  2R93 B;  4F88 A;  1BCP D;  4PMB A;  3HG9 A;  1UNS A;  1HXY D;  3GTJ B;  5A2Q E;  1EY9 A;  2X6L A;  5M5Y B;  4KV6 A;  4CJ0 B;  1AZP A;  1X3P A;  4X3S A;  2QF7 A;  3NPP A;  4Y7N B;  2EYO A;  1F2Y A;  4YIJ A;  3QIA A;  5G3L F;  2HCI A;  1HPC A;  1VF7 A;  4WJW A;  3PO3 B;  3BVG A;  4P2C B;  4DAP A;  3SK8 A;  1SYD A;  2EVB A;  1C8C A;  2OT2 A;  2L9H A;  4C3J B;  3MTS A;  5CC4 A;  4XYO A;  2FIN B;  5C3X A;  4S3S A;  2KED A;  2LKV A;  3OW7 A;  2M9V A;  5C0X J;  1BQQ T;  1MD2 D;  1BDO A;  2HCC A;  1CA6 A;  4DGZ A;  3Q23 A;  3FRP B;  1B9N A;  2F0P A;  2A6H C;  1ROD A;  1UUP A;  1E0B A;  3FDT A;  1JE4 A;  2EY5 A;  4QCL A;  1EY8 A;  1RF2 D;  5KEE A;  2O5I C;  1QIL A;  3T56 B;  4KK7 A;  2EYH A;  1SND A;  4DU9 A;  2ZXO A;  5C0X H;  1EY6 A;  1L0X B;  2KUM A;  4ZKC B;  2A6H D;  4A3I B;  3OMC A;  1HUM A;  5CV8 A;  2NVX B;  3D4W A;  1PLF A;  3GTK B;  3L9A X;  4OO1 G;  2J0T D;  2QCP X;  1EL0 A;  1FNV A;  4HMJ A;  2K7V A;  1E2W A;  1SNP A;  1VMC A;  3WOF A;  1BO0 A;  3ERQ A;  4LMQ D;  3PIP 3;  4J6H A;  3FPP A;  1WVL A;  1G2T A;  2WKD A;  2MUY A;  4HAE A;  3OSO A;  1QG7 A;  4FP5 D;  3EVQ A;  4B9W A;  1O7Y A;  5CV6 A;  3U9O A;  2DY7 A;  1UAP A;  5JAV A;  1W6J A;  2D5D A;  1KLU D;  2F0U A;  1W6K A;  3H91 A;  4KJO A;  3BDO A;  3KUP A;  3MXU A;  1KNA A;  5JPM C;  1U4L A;  3QJY A;  3M4Y A;  1XYI A;  1TWH B;  3PO2 B;  2NBF A;  3Q22 A;  3A8I E;  2PW7 A;  2EYM A;  4ME5 A;  1ONL A;  3K59 A;  1PXU A;  3NP8 A;  3MXG A;  3BVZ A;  3K57 A;  1AP0 A;  4RWS C;  2R7Z B;  2L11 A;  2ID0 A;  1QCB D;  2VUM B;  1BF4 A;  4J8Q A;  1GUS A;  5IGF A;  1EWH A;  2NTT A;  2O2L D;  2V4D A;  3CKI B;  1V1P A;  1WTX A;  1S5E D;  2NUC A;  2NN6 I;  4HSV A;  3D31 A;  4IFD J;  2K03 A;  2AQ3 B;  2X6G A;  4BY7 B;  3I91 A;  1LT5 D;  2JA6 B;  2O5J C;  1VDZ A;  1FR3 A;  5EPL A;  2EDG A;  1EFI D;  2Y0S B;  1G29 1;  2RSO A;  5G3L D;  3S17 B;  1Q1B A;  3VR4 A;  1DM0 B;  4BA1 I;  1C48 A;  1L0Y B;  4IFD H;  1E2V A;  2HUG A;  3QWN A;  4RFB A;  2MJ8 A;  2EY1 A;  2JXM B;  1D5X C;  3N52 A;  1O7Z A;  1F2Z A;  3E5S A;  1QE6 A;  4RCN A;  2A5H A;  2YU9 B;  4XQJ A;  4E6I A;  4CKC A;  4A3M B;  2L5T A;  1EU4 A;  3GTO B;  3G6J B;  3VR2 A;  2D9U A;  1V1P B;  4C3I G;  4CKB A;  5J22 A;  1IW7 C;  3T4A C;  4X3K A;  1LTR D;  2R6G A;  3D4D A;  1LAC A;  2RSN A;  1D5M C;  5DM7 3;  3MHB A;  4KTA A;  2L4N A;  1WTQ A;  2NTS A;  2ENB A;  2ZT9 C;  1SXT A;  2H1E A;  2PZU A;  4DAV A;  1JOR A;  2NVQ B;  1HFN A;  3NTK A;  1BNZ A;  1IW7 D;  2EYP A;  2YYZ A;  5K36 H;  1DXM A;  2F0F A;  3EJI A;  3EA6 A;  2B2V A;  4FXD A;  3TBI B;  5E1F A;  2EJF C;  5E4W C;  2NWG A;  2KQ3 A;  4ZK9 B;  2FHT A;  3RZO B;  2SOB A;  4H13 C;  5FOB B;  1GXD C;  4FNF A;  4DN4 M;  2ZXR A;  2ICE C;  3DEP A;  1EEI D;  2KHS A;  4RGM A;  2XRS D;  3AB9 A;  2VXW A;  2XVS A;  1Y1W B;  2XWB B;  1ICW A;  5IGC A;  3H09 A;  1CHQ D;  2IWH A;  5COY A;  4QB4 A;  2OEO A;  2KEC A;  2PZW A;  1Y69 U;  3W3A A;  1R9T B;  2E74 C;  1I6H B;  3PUZ A;  1ENA A;  3WDN A;  2VB3 X;  3SK6 A;  4U67 3;  5C5M A;  1CQF A;  3HZX A;  4LK1 C;  5CMD A;  2RKS A;  4XXE A;  2F0V A;  3TZD A;  3R8B A;  3D4R A;  2NVY B;  2I46 A;  1QNU A;  4TSS A;  4NP5 A;  5D3I B;  2D62 A;  3BS1 A;  4KJN A;  3V96 A;  2EJG C;  3KLS A;  4KY5 A;  1ENF A;  2X69 A;  1LTT D;  1XTC D;  2F0N A;  1G8Z D;  4K2K A;  3AU7 A;  1FYC A;  3VR5 A;  1LTB D;  2J4X A;  2IW3 A;  1TVX A;  5EKI A;  5KYL A;  1I4G A;  1II3 A;  1G6Z A;  5M5X B;  1NSN S;  3AMU A;  2MGS A;  1O80 A;  2PQE A;  2WII B;  2CW0 C;  5ELB A;  4C2M B;  2NB0 A;  1TS4 A;  5KIX A;  1DOK A;  1JOQ A;  3A7L A;  4HN7 A;  4Z9C B;  3BZD B;  4ZAI A;  2Q8I B;  4XTC S;  1WTR A;  5K5P A;  1ZEQ X;  1V1O A;  3CU7 A;  2CW0 D;  1MSG A;  5C0X G;  5C5L A;  4ZKB B;  2JA5 B;  1ESR A;  2RQX A;  5I9O A;  2J7Z A;  1TU2 B;  2AWN A;  1BR9 A;  4UDU C;  2F4I A;  2K32 A;  2DN8 A;  1FNW A;  1LT3 D;  1SBB B;  1F2L A;  2B2U A;  1K8O A;  2WV6 D;  1WTV A;  2H4O A;  5CV5 A;  2PPB C;  1O78 A;  2E2H B;  1JC7 A;  3GD7 A;  1OO9 B;  3TP8 A;  5FKA C;  5KND A;  1H9K A;  4QUC A;  3SR1 A;  4RGT A;  1G2S A;  3J7Y W;  1TT2 A;  2JE6 I;  3A8J E;  1U4M A;  4ZLT F;  3HOY B;  1CA5 A;  2F0G A;  4RKB A;  5A35 A;  4IAL A;  2E2I B;  1F9S A;  3KBG A;  2K04 A;  1IYV A;  1S4Z A;  2XIW A;  4FVM A;  1GUG A;  1QWY A;  1CK1 A;  1X32 A;  4KD4 A;  5J1Z A;  1JOO A;  1B9M A;  2B2V C;  1PTO F;  1I4R A;  1EYD A;  5NUC A;  3H3V C;  1V8Q A;  4Q0F A;  2ZXP A;  2OXP A;  1PTO B;  1LLR D;  1LTG D;  3G7L A;  1LO5 D;  5DAU A;  4RGN A;  4KKS A;  3I4N B;  1DCZ A;  2B8F A;  2F03 A;  2LY7 A;  1H9J A;  2F0D A;  1WTW A;  2F0I A;  3NXW A;  1NUC A;  5I6W A;  2RDF A;  1G91 A;  5C3W A;  2BE5 C;  2A69 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...