1PZID

Heat-labile enterotoxin b-pentamer complexed with nitrophenyl galactoside 2a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat-labile Enterotoxin B subunit
publication title 3,5-Substituted phenyl galactosides as leads in designing effective cholera toxin antagonists; synthesis and crystallographic studies
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin inhibitor
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pziD00
1UUPA 1PTOH 1HQRD 1TS2A 1EU4A 1PRTB 1S5DD 1EEFD 1BCPF 2IJ0A 2RDGA 4BWGB 1FNVA 1PRTD 1JCKB 4RFBA 1LT6D 1QILA 4UDUC 1CK1A 1LTAD 5ELBA 1I4XA 1JWSD 3V05A 3EA6A 1JWUD 1I4HA 3KLSX 1GOZA 1V1PB 3O13A 4RGNA 4Z9CB 1ET9A 1PTOF 1HA5A 2NTSA 1S5FD 1LTGD 3BZDB 4RGOS 4DXGA 1V1PA 1S5BD 4RH6A 4ZYSA 1LTID 1ENFA 1D5MC 1I4PA 1LT4D 2AQ1B 2J4XA 4RGTA 1DYQA 1V1OA 1ESFA 1TS4A 1SXTA 1AW7A 1BXTA 1PTOB 4OHJA 4K6LA 3BVMA 1PTOD 1RF2D 3R8BA 2O2LD 1EEID 1JR0D 1SJED 1D6EC 1PYWD 2SEBD 3SEBA 1AN8A 4L6TB 2QEJC 5ELFA 1SE4A 3OWEB 3DWAA 1PRTC 1TY0A 2TSSA 1KTKA 1F77A 1L0XB 2IPKD 1PZJD 1S5CD 2XNAC 1BCPB 1KLUD 1FGBD 5FK9C 1SEBD 1TS3A 3TSSA 1BCPD 1LT3D 1STEA 1L0YB 2XRSD 1CQVA 2AQ2B 3R2TA 1LTSD 1LO5D 2CHBD 5D3DA 1SJHD 1XTCD 1CHQD 4C56C 1S5ED 2RDHA 2QILA 4RHSA 5TSSA 1SE2A 1UNSA 5D3IB 1TY2A 1LT5D 2ICIA 1LTRD 4TSSA 3EFXD 1T5XD 5FKAC 1G8ZD 3DWQA 1PTOC 3R2IA 1FNUA 1TS5A 2AQ3B 2XN9C 1FNWA 1PZID 4RCOA 1D5ZC 1LTTD 5ELDA 1RD9D 1HTLD 1B1ZA 1FD7D 1CHPD 1LLRD 3DWPA 1M4VA 2NTTA 1DJRD 1JQYD 2G9HD 4O1NA 1BCPC 1JWMD 1EU3A 1I4QA 1KLGD 3W2DA 3MFGA 3BVZA 3BYYB 2Z8LA 1SE3A 4L63B 4RHRA 1RCVD 1I4GA 1SBBB 3URYA 1CT1D 1MD2D 1PZKD 3BYTB 1EWCA 1HXYD 2R61A 5ELEA 3GP7A 3BVGA 1XXGA 1RDPD 1PRTF 4DXFA 5I4DA 1EFID 1D5XC 1LTBD 2WV6D 3MC0B 5ELCA 3CHBD 2XRQD 1ET6A 1B44D 1I4RA 4RGMA
chains in the Genus database with same CATH superfamily
1B50A 1X3FA 5JEAG 2QGQA 1SMYD 4UPAA 3S17B 2IJ0A 1PRTD 4FXDA 1EYAA 3A54A 1F2LA 1M8AA 4ZUIA 1VQDA 3EN2A 5J1ZA 4I7ZC 2QCPX 3A56A 4C3IB 4RGNA 5A35A 4ILWA 3K5MA 2Z4HA 1ENFA 4KJOA 2WKCA 1L1OB 3RLNA 3K58A 3CC2A 5CV4A 4C3IG 4HIDA 5EKKA 2IHFA 3NSWA 5LMNL 5CMDA 4DUYL 3V96A 2Z9HA 5KYLA 4OHJA 1LYLA 1VQ9A 4C1NK 4IOCA 4K5VA 3ND9A 2NWGA 3GTGB 2I0QA 2GVBA 1F77A 2DUDA 2RHQB 1II3A 1TS3A 3TSSA 5LMNQ 3G6JB 1SYCA 3P7JA 4OEMB 4DUYQ 1SNQA 2KOLA 2HD3A 4G7OC 1KRSA 2ID0A 3G6EA 1B2TA 4LF5L 1E2VA 3CCEA 3M4OH 5FO9B 5IYCG 2ICIA 3SHLA 1B53A 3ZYYX 1SFOB 2B39A 2RBMA 3R2IA 4XQQA 4O0AA 1AP0A 3N6RA 5C44B 1PFNA 4IPCA 3MEHA 3UDFA 5JAVA 4LAAA 5CV8A 1RD9D 2XWBB 1HTLD 1FD7D 4EQ5A 3ULJA 5C44G 4A3MG 4LF5Q 2UXDL 3GTPH 3M7NA 2G9HD 4IURA 2I5HA 4HCSA 1O7YA 1MHWC 5IGGA 1MJCA 1SE3A 2Z8LA 4XXEA 2NZ1D 3KJOA 1IYVA 1RCVD 2IY5B 2VQEL 1SBBB 5K36G 1IKMA 3C46A 5KRUA 2WB1B 2NZOA 3CRKC 2NB0A 2F0QA 2N78A 1F2ZA 3BVGA 1ZXTA 4DR4L 2UXDQ 1EFID 2EJFC 3SE0A 2ZTEA 2F1MA 2IX3A 3U58A 1HNZL 2EJGC 1XPOA 4KLKA 3I4OA 2R93B 2VS1A 1TS2A 4DAVA 1JORA 1EU4A 5CV6A 2VQEQ 1TIID 4JOIC 3H3VI 4HSPA 4IALA 2E2JH 2PNRC 1QILA 1I5FA 4A3MH 2QA4A 3CRLC 2B8GA 2YTVA 3CCSA 1EY4A 1RTNA 2FMCA 4BXXG 2WB1E 3VR3A 1HNZQ 3KFUA 2DY7A 1V1PA 1P16A 3A5UA 3CC4A 3K8AA 1FGUA 1A2UA 3HP3A 1S40A 1F2YA 4XQJA 2DJFC 2BCOA 5LL6X 3UE0A 2B2YA 1PTOB 4NKLA 4XT3B 2A73B 1KABA 5HY6A 3S14B 2SEBD 1F9SA 2QEJC 5IP9G 4Y7NH 3J7ZC 2QEXA 2OQ0A 1CI3M 2VB3X 3D4WA 5FK9C 1SEBD 4IFDJ 1L0YB 2V4DA 1F2MA 1CFMA 1OXXK 2CHBD 1EY9A 4DNRB 1DOLA 2HCIA 1U9RA 1WYDA 1VQ7A 1PYSB 3FDTA 4BXXH 2XIWA 4DV5L 1TY2A 1R4PB 3DM1A 4DAYA 4C2MH 4JI5L 5KGUA 1EQVA 2LXJA 3TRZA 1UAPA 4HR7B 3TP6A 4H02A 2HCCA 3ONAB 2PMZE 3OTOL 3HOXH 4P71A 2KCCA 2Q2TA 1JJCB 1KDAA 4KKUA 1ESRA 4A3IH 1OO9B 5IP9H 4ZAIA 4DV5Q 4GN5A 3W2DA 4JI5Q 4LUVA 1Y1VB 1Q90A 2B2UA 1N36Q 3MXGA 2K50A 1DM0B 1Y1VG 1JOKA 4ZCKA 2R61A 4B9XA 5KNDA 4A3CH 4A93B 3OTOQ 4HIMA 4A75A 3PMFA 3CCUA 1VMCA 5I4DA 5M5WB 3LX0A 3MC0B 4LF9L 3GV6A 1UE5A 3S1QH 4A93G 1EOTA 4KHVA 1J8IA 1I4RA 3AU7A 4KKTA 1M1KC 1SNDA 3I70A 3NBHB 3S1RB 1EEFD 4K5XA 1C0AA 2HT1A 2AKWB 2XVSA 1W3SA 2FINB 2NN6G 4LF9Q 5C0XI 1S5BD 4LNQA 4B9WA 3TMEA 2MPMA 2QW7A 1SROA 4RGTA 1HUNA 2K5QA 4KD3A 1L1OA 3QB3A 1U4MA 3I73A 2MO1A 1E2WA 2Z6KA 4RMFA 5H1SE 3DLLA 1PH3A 1JR0D 3N52A 4U673 1HNWL 2PQAB 4DV0Q 2NVTB 5CV5A 1G6ZA 3VYSA 1TWGB 1F9PA 1L0XB 1WOCA 2JYOA 4GN3B 1X6OA 4QF4A 1SAPA 3X3NA 4DV2L 3H91A 1GVPA 1F9QA 3A55A 5F2DA 4KY6A 4KI0A 1XMQL 1VQ6A 1LTSD 4DK6C 2NN6I 4IPHA 4LJZC 1T5EA 5IIFA 1OXTA 2WAQG 3F2CA 3TS2A 4BBRH 3GQBA 3BDCA 2D0PA 4RHSA 4JI3L 2NVQB 3PUZA 4P72A 3K59A 3TP8A 4KY7A 2R92H 1Z6HA 1PYBA 1RL2A 3ERQA 5EPKA 2F4VL 2DGYA 1GUOA 4JI1L 5HGTA 4DV1L 1WTPA 4LMQD 1TS5A 1FVIA 4PMBA 4DV2Q 1XMQQ 1S72A 1D5ZC 2NVYB 1V8QA 3IL8A 4N9PA 2WIIB 1E1OA 3RMHA 3OSOA 3S1NB 4JI3Q 3EBEA 3S9WA 1W6JA 4LWCA 3NTIA 4JI1Q 3T56B 1J6QA 1Z47A 4V190 1KAAA 5C4HA 2E2DC 3PF5A 3BG3A 3AFQA 1JICA 5E4WC 4TVAB 5C4XB 3CHBD 1Y8NB 4WJ3M 2ZM6L 4X62L 4IJLA 4JI8L 2PQEA 3I72A 5IYBH 1BDOA 1O7ZA 2OF1A 2GVAA 3EVQA 1PRTB 1KRTA 5C4XG 2EYHA 4POFA 1K73C 1YHAA 2PZUA 2ASBA 1BVSA 1HFGA 1TWFB 4B3RL 2HDLA 2FXQA 1GOZA 1ASZA 4A3LH 1Q8IA 3BZDB 4X62Q 3VYUA 5C3EH 4JI8Q 3GTKB 4GKJL 3K5OA 4FXKC 4B08A 5FLXE 1W2BA 1X3EA 1VQFA 1O78A 4KV6A 4L5SA 3GTOH 1KC8C 1KL9A 1B4OA 2A69C 2FFKB 1EEID 4K2KA 4B3RQ 1WCMH 3HOZH 1NCVA 3OIPA 3A8KE 2AMCB 1ZEQX 2PI2A 4GKJQ 2IPKD 4GLVB 3CMEA 2A19A 4EVOA 1JOOA 1VQPA 2AQ2B 2IHEA 4IFDG 1EOVA 4L5TA 4NMZA 3HOWB 5GAGC 4HTHA 3HOVB 1Z7TA 2F0MA 4EX5A 3LGJA 3T53B 1GUWA 1QVGA 4R4QA 3HOWG 3EFXD 2DJGC 3DWQA 3HOVG 1XNRQ 1R9TB 2CW0C 3GTLH 4OO1I 1HR0W 2AQ3B 2PZTA 3OW2A 2MO0A 2A6HC 4HJ9A 4A3DB 2NTTA 4H13C 2EVBA 1ICWA 3B6YA 3PCOB 3VA5A 4C3HB 4IFDI 1TWAH 3JAMc 1PFBA 1SRUA 1I4GA 2JE6I 3F8TA 3I8ZA 1CT1D 1BR9A 2K5VA 2N49A 4C3HG 3PO2H 3W1BA 1A3VA 3CQZB 3OWFA 2ZJPA 5KIXA 5FLMH 4IUVA 1K83H 2A69D 2N3SA 2TMPA 3F2UA 3GTMH 4GZYC 2RDGA 4LUZA 2BDNA 1K9MC 1STGA 3NBHA 1LT6D 1X9NA 5M3MB 1QZHA 5FJ8H 1JWSD 3JAML 2M2LA 1EL0A 3DUZA 3RN2A 2IL8A 5M3FB 1VQCA 1ESFA 2JEAI 1TS4A 4FF1A 4CBVA 3NP8A 2H1EA 1NR4A 3HOYB 2CW0D 1R4QB 4RG1A 2EXDA 3VR6A 1SYDA 2A6HD 3HOYG 2AUJD 3L7ZC 2PQAA 3TEHB 3KLWA 4R4OA 2JA6H 4DV6L 4P2CB 1PDQA 3GTQB 3HZXA 1SYBA 2HIVA 5CV9A 1SDFA 3RUZA 4DN4M 2K4KA 3E6ZX 1SJHD 1UE1A 2PNHA 3GD7A 4ZKCB 4DR3Q 2R6GA 4NW2A 4PZ6A 1WTRA 1A62A 2JP1A 3FRPB 1EIYB 4QGUA 3T1HL 4QL5A 3CKIB 4AYBB 5FOBB 3UDGA 2N88A 2LFNA 2VUMH 1Q7YC 4DV6Q 3TP7A 1EY6A 1AZPA 3E5SA 4AYBG 4PZ8A 2RVLA 2XGTA 5LHY1 2B2TC 3J81c 4JV5L 2JA7H 4MN3A 3HOYH 5J22A 1N33Q 3T1HQ 3JC66 1HPCA 3CF5A 5IE8A 5BN4A 2K04A 2YV5A 3VR2A 4JI6L 3GTJB 1QVCA 2PCFB 2E2IH 1GM5A 1E24A 1FR3A 1CKMA 1VQAA 2Q2HA 2Q8RE 4IUQA 1PH1A 4IN3A 1OXSC 3PGZA 1Y8PB 2A5HA 5M5YH 3GTQH 1HQMC 4OGQC 4PMWA 2Y0SB 4Q5VA 1LTBD 1T9HA 5CR3A 2J0TD 2WV6D 3SGIA 4JV5Q 5IT9E 4IO9A 1EWHA 3IFTA 5E3FA 1KXLA 3QOLA 4RGMA 1S4ZA 2Y0SG 4A3BB 4GN4B 4NXML 2BA0A 1AFPA 1FNVA 5DAUA 1BBUA 4EGVA 3J81L 1I6VC 5C0XJ 2KJXA 1X65A 3V05A 1BF4A 4CJ0B 1WJJA 3TS0A 1PTOF 4RGOS 3SVMA 1JJ2A 1B8AA 1GKHA 3PUYA 3HFZB 4NXMQ 5JJLA 4ULLA 4OX9L 4KKSA 5CBAE 1H9KA 2XSCA 2E2HB 1RF2D 4DR6L 1Q86C 3J80i 1U4RA 2L4NA 1WI5A 2KENA 4A3FB 1KTKA 2K28A 4KD4A 2E8GA 3Q8DA 1PMRA 4ME5A 2G9DA 2XRSD 2M9VA 1STBA 4UHVA 4OX9Q 3OOCA 3CXCA 2Z1CA 2KECA 1LO5D 5LMUL 3RZOB 4DR6Q 3FP9A 3S15B 3NPPA 3NE5B 1JT8A 3NQTA 4WORA 2Z4IA 1DCZA 2KQ3A 2B2WC 1STNA 1V9PA 3H09A 4R9WA 1YNXA 4OIKA 5FKAC 5IP7H 3PIPA 3BJUA 2OT2A 1KQSA 3HOUB 1CZGA 3M3YB 4DK3C 3I4NH 2EQSA 1WFQA 1PZID 1K3RA 2LXKA 3SK6A 3K0YA 5JEAH 3HOUG 5LMUQ 4YIJA 4CKEA 1G51A 1LLRD 3CAMA 3ULPA 1WVLA 3DHQA 1GJXA 5EGTA 4L8JA 3L3OC 4IOAA 1SYFA 3U9OA 3S17H 3MFGA 4O2DA 1AH9A 3ITPA 1BBXC 4ID6A 4DV4L 5M9OA 3D31A 3CP0A 3OMCA 3TZDA 1AEXA 3TN2A 3VDYA 1ZYRC 4C3IH 3W1GA 4L5QA 3CCQA 2F3IA 1K8MA 3MAQA 4KJNA 4HAEA 5IOCA 2JSOA 5IT9c 4R8NA 1CTMA 4HN7A 3P1HA 4ZQ3A 4QMGA 1HQRD 1PFMA 3CCVA 3OHXC 4DK1A 4F87A 4FVMA 5C4JB 4DUZL 4DV4Q 1CSQA 3MA2B 1MI2A 4R8IA 3GTGH 2R7ZB 1I4XA 3D0FA 5COYA 1JWUD 1ASYA 3KLSX 5L37A 2OWOA 1KHIA 3RZDB 1ET9A 4H0LC 5EKIA 5JVH3 4ZYSA 2I5LX 3H15A 2H5XA 2WB1G 4BBSB 1SYGA 5IYCH 4LK1C 4QIWB 3A5ZB 4DUZQ 2CCZA 2O4XA 2EYOA 1MSGA 5C5LA 3TZUA 1LM0A 2RSOA 3PSIA 4J6HA 2M00A 4BBSG 2RQXA 4ME3A 5IT9L 1YNNC 2E75C 4G4KA 3P20A 3RN5A 1C4QA 4JBJA 1SFOH 2D62A 1YI2A 2R93G 1WTOA 1Y8OB 2L0CA 5C44H 1EZ6A 4BY7B 1UEBA 1Y1WB 2HHHL 5DM73 3H3VH 4DR4Q 1NTGA 3LNNA 3G7LA 1TT2A 2CFMA 2YYZA 1M90C 5I6YA 4BY7G 1U0LA 2KHIA 4K14A 1Y1WG 5K36H 2HDMA 3I2ZA 1XTCD 1I50B 2A1AA 3ZJYC 4QIWE 2L1BA 4K5WA 3HKSA 2QILA 1EY5A 1SE2A 1ZYRD 2QKIC 4CKCA 3F2DA 1LTRD 2BDOA 2HHHQ 2CQAA 2JA5B 5CORA 1G8ZD 3D4RA 3S2HB 1WTWA 1TWHB 2L12A 2PMZB 3KYHC 5ELDA 5M5XB 2JA5G 1QJOA 1QE6A 1EQQA 1NNXA 1KD1C 3A74A 4OWTB 1A15A 2R93H 3KJPA 4CJ1B 1D1IA 4JOIA 4PQXA 4MTNA 1AE2A 2VZAA 2NVXB 3VR4A 3BVZA 1GUNA 4R4IA 3K6OA 3W5OA 3CD6A 4MZ9A 3QJYA 1VQOA 4FF4A 5CYUA 3BYTB 5ELEA 1YJ9A 1JB3A 3Q6SA 3KOJA 1PRTF 1MSHA 5EPLA 4DA2A 4POGA 4RAUC 3K57A 1YNND 1OXUA 3BZKA 1PTOH 1QB5D 2FHTA 2IT1A 1XJVA 1S5DD 4HMJA 3NEMA 2GA4B 4NP5A 3S14H 4RFBA 1SR3A 3GV3A 1UE6A 2K1BA 2IX0A 1LTAD 1A6XA 5ELBA 1TQOA 5C0XG 1NY4A 1I4HA 2EY1A 2PPBC 2F4IA 2R7FA 2K5HA 3K5LA 5DLQE 1S5FD 1RTOA 4P74A 4RKLA 4YHHL 2WP8J 1LT4D 2MGSA 2MFIA 4M1UB 3V2TA 4DV7L 1BXTA 3VR5A 2N8NA 4DPGA 1Q1EA 3J7AF 1O80A 2SNSA 4RA8A 1GUGA 4DR1L 2RA4A 1CA5A 2F0UA 2C9OA 3KLRA 1SNCA 4EQOA 1SE4A 2EYMA 2TSSA 3FPPA 1SNPA 4GNXC 4A3EB 1D1KA 1A3TA 5GROA 1KLUD 2F0LA 1U4PA 2XTIA 2A8VA 3U4ZA 4CDFC 4DV7Q 2C5CA 2JXMB 5C0XH 1CHQD 2EOTA 1CZWA 3KF6B 4DR1Q 3RR5A 5DEHA 1Y1VH 3NWSA 4XQNA 2OCEA 5D3IB 4H44C 3PO3B 1G291 1AE3A 4YCUA 2P5ZX 3S2DB 3D4DA 4UAIA 4UP7A 2LY7A 3SK5A 4A93H 2OXPA 1Z9FA 2XN9C 1FNWA 4GOPC 3PO3G 4X64L 2NYZD 3PUVA 4RCOA 1X3GA 5M5WH 4ALPA 1DD2A 5CGKA 2OTLA 3CCMA 2ZJRA 4A3GB 3HKZE 5FO8B 5KYIA 3AQQA 1EQTA 4A3KB 4EQNA 2JA8B 3S1RH 2VB2X 4DR2L 4G7HC 1I4QA 3PUXA 3SK8A 4A3GG 3OW7A 1HR0L 2NN6H 1HNWQ 3KK7A 4A3KG 2AUKA 4IZ8A 3NQIA 1JE4A 4DAPA 1MD2D 3D8GA 1EWIA 2ES2A 4X64Q 3U50C 1B9NA 3C1FA 3RLFA 4KN4C 4IUUA 5EBCA 1N34L 1IW7C 2EDGA 2ZT9C 4JYAL 3H6MA 2VW9A 4DR2Q 1B44D 3T13A 2NUCA 3KF8B 3TBIB 1HR0Q 4NPSA 3RLOA 2F4VQ 3JAME 1H9RA 4L5RC 4DV1Q 1A2TA 2NVTH 2DNCA 3PV0A 1Q12A 5EKLA 1TWGH 1N34Q 1VCIA 5JVG3 1JMCA 1IHZA 1I6HB 4JYAQ 4K0KL 1LTGD 2KHSA 1IBML 3FKIB 1K0RA 1HNXL 2NZHA 1V1OA 5JPMC 1RIPA 2NVQH 3FKIG 4B3ML 4JVZA 1X56A 4FXGC 1IYJB 1SJED 2AWOA 5C4ZA 3KBGA 3Q24A 5BN5A 1Y69U 4HIKA 4K0KQ 4AIMA 3IRBA 2UUBL 1PH2A 5K5PA 1IBMQ 1D8LA 2NVYH 1DOMA 2Z0SA 1ML0D 3PIP3 2ZM6Q 1HNXQ 4GKKL 1TXYA 1H9MA 3S1NH 1SLJA 1ILPA 1HHVA 4ZUJA 2B2VA 1VQ4A 4CJ2C 4DR5L 1HJPA 5NUCA 3TQYA 3SK4A 2EYFA 2BH2A 4OO1G 1LTLA 1K8AC 2UUBQ 1IW7D 5JJKA 3H94A 1IYUA 4QJFA 2K32A 3G71A 2KUMA 3A8JE 3FPUB 3C2PA 3K81C 5C4XH 3T51B 2EY5A 1OXVA 5JJIA 1EYGA 4X3KA 1M4VA 4DR5Q 1DJRD 3C3LA 2HIXA 5GQOA 1PH8A 5DM63 4I7AA 3EROA 4DGZA 1VQKA 2Z6BA 1N32L 2WFWA 3FHWA 2HQEA 3HEJA 1TWFH 3CMAA 1A8VA 3QWNA 2K7VA 4XIGS 4UY8C 2VQFL 3BU2A 4WJ4A 1XXGA 4DXFA 1MBYA 1I3QB 3GTKH 1GO3E 5ISRA 2EE1A 3S16B 4OO1H 3I4MB 1CA6A 3J81E 2EYJA 4J15A 1QNKA 2H4OA 1N32Q 3I4MG 4KTAA 2SDFA 1BUVT 4A3DG 3A0JA 2D2CC 1NUCA 3KDFB 2VQFQ 3M4YA 2RSNA 1SSOA 2F0EA 4IUPA 4IFDH 3O13A 2K5WA 4Z9CB 5LL6S 2R7DA 3D3RA 4DXGA 3PF4A 3HGBA 4IQZA 3I90A 1X3QA 1HTPA 1X3PA 2B8FA 3BDOA 3MZ5A 3CCRA 3HOWH 3MWYW 2F0OA 2AWNA 2X69A 3HOVH 1A0IA 4OXPA 1NSNS 1WTVA 4Y52H 5T1GA 3K5NA 2UXCL 2LMCB 2F52A 4C3JB 4QY7A 2A68C 1EYDA 3BS1A 1R9TH 3OWEB 3DWAA 3S24A 3W3AA 3H0GB 3FMCA 3R93A 4C3JG 5M3MG 4XYOA 2ZJQA 3BDLA 2CH4A 4A3DH 1IL2A 3KLSA 1N8RC 4JPBW 4V0BA 3CPWA 3DM3A 1EQRA 4IUTA 4C3HH 4C56C 3K7AB 1TWCB 5M3FG 3J81j 4HJAA 1VQ5A 3DEPA 1UNSA 4F88A 2UXBL 1VS0A 3KF6A 1RHPA 3WOFA 4J8QA 3HRZC 4YWMA 1BNZA 3CQZH 2BA1A 3JAMi 2L15A 1LTTD 4JCVE 3MXUA 3OIQA 3S1MB 2V1CC 1CHPD 4IPGA 1HCZA 3G48A 4MHEA 1XYIA 4JK1C 1PFSA 5GAHC 4HSVA 2ZXPA 3C1EA 2RHSB 1ONLA 1PHJA 2JJQA 2UXBQ 2I07B 1FL0A 5BN3A 1WTQA 4LF4L 5M3MH 2CWAA 3FVQA 4K6DA 2MNAA 1DONA 2IW3A 4K8JA 5M3FH 3GO5A 4KHPL 1MIUA 2EXZA 2N55A 1S3OA 3OMGA 4LF4Q 3K80C 4YWLA 1V43A 1GHJA 2A68D 3KF8A 2RDFA 2D0OA 3LWEA 4F8MA 1EY7A 2F0JA 3E9HA 1QOHA 3NUCA 1DXMA 4BS9A 4KHPQ 3M4QA 1B3AA 4UP9A 1HZBA 1HA5A 2IX1A 3MHBA 5T1IA 1EIHA 2YU9B 1P8LA 3J80c 1X32A 2LKVA 1XMOL 4JI6Q 4K6LA 1ZKOA 2EZVA 3NWTA 2K33A 4JG2A 4MIUA 4OL7A 1PYWD 2PO4A 3SEBA 5IGBA 4A3BG 4X3UA 1XWEA 1TY0A 4JI0L 3M7GA 5IODA 1VQ8A 2XNAC 1MGSA 2YTXA 1WTXA 3EIVA 2B2TA 1AZQA 1KDCA 4CKBA 2K5DA 2CQOA 2K14A 3TP5A 1VQJA 5AFWA 3J80L 3E0JA 5KNBA 3GTJH 1BBWA 1DOKA 1O7LA 3PIO3 1T5XD 3WWVA 3AEVA 4OELB 5FO7B 4JBWA 4DK0A 4JI0Q 1MJEA 1QWYA 4GLAC 1TKWB 1CKNB 2O5JC 1SNMA 1RJTA 1QCBD 3M4PA 3J7YW 2QDLA 2ALYB 1GXDC 4A3FG 3L0OA 3DWPA 4OIJA 3NELA 3G4SA 4A3BH 1KLGD 4K2LA 3BYYB 3M4OB 3MXNB 1LABA 2PZWA 2J7ZA 3UE1A 4A76A 1KNEA 1YHQA 2I5MX 1WTHA 3U4VA 2EIFA 1Q3LA 3GP7A 2RF4A 5BR8L 2ZTDA 3Q0AA 1G6PA 1GUSA 1JE5A 2F0DA 5IWAL 3GTPB 2F0PA 2E2HH 3DMUA 1BQQT 4GNXB 4BWGB 3P75A 1NMGA 4UDUC 4DNTB 3EJIA 4A3FH 4APVA 3UI2A 2LSSA 3KDFA 4YCWA 5EAYA 4JC0A 5IY0A 5BR8Q 1NAPA 2K05A 2NTSA 3QOJA 1FJGL 1XTDA 5IWAQ 4XDXA 1V1QA 2HQLA 1D5MC 2I46A 3RZOH 2CWPA 1C8CA 1SXTA 4B3TL 3S15H 1KNAA 1ILQA 4CDCC 1STHA 2B2WA 1EY0A 1VQIA 4E6IA 1VQMA 1CSPA 4GOPB 2F0NA 1WD0A 1D7QA 2K75A 1QVFA 2E2JB 3HOUH 1C48A 2MQHA 4J1MA 1EIGA 3M3YH 4A3MB 5KNCA 4NXNL 4DU9A 1G2TA 4PV1C 1ENCA 4JI7L 3L2PA 1FJGQ 2YTYA 1VQGA 2D5DA 2R7ZG 4FDBA 4B3TQ 3J7AV 3MFYA 1H95A 1O7IA 3SDZA 2RDHA 4G7ZC 4S3SA 1EUJA 5IYDG 4MTKA 1KIXA 1YEZA 2B2YC 2F03A 5G3LD 4NXNQ 4JI7Q 2WKDA 1PH9A 1FNUA 2EYPA 4Y7NB 4RCNA 1K8GA 1VQNA 1L2FA 1VQLA 1IBLL 3D6CA 3UDIA 4LF8L 1BCPC 5C4JH 4WFN3 2JA9A 1QUQB 3A7LA 1EFWA 3URYA 1UE7A 2R7ZH 4C2MB 4XT1B 4QQBX 2OQKA 4BY1B 1HXYD 3RZDH 1HZAA 2EY6A 4HJ8A 4ODGA 3IKJA 3DXJC 5IYDH 4BBSH 4KK7A 1IBLQ 2XRQD 4BY1G 3OPOA 4LF8Q 1YITA 1N9WA 3HOXB 1H9JA 2ZTCA 1UUPA 2VXWA 1CQFA 4A3IB 3HOXG 4P75A 1JCKB 4DF7A 1GD7A 1STYA 4FP5D 5LMNW 4X6AH 1Q81C 4U68A 5E7NA 4F7XA 3ICEA 5CC4A 4BY7H 4A3IG 1Y1WH 2B2UC 4G57A 1RKNA 2ZXRA 1IBKL 1EY8A 2F0VA 1K0SA 4RH6A 3CW2C 5IGCA 4A3CG 2AQ1B 1RODA 3S1QB 4K8IA 1I50H 4IPDA 4YCVA 3I56A 4FF3A 1GHKA 4JBKA 2ICEC 3AB9A 2Q2UA 3R8BA 1ENAA 2JA5H 5GAEC 1SMXA 1TU2B 4X3TA 2OEOA 1A3UA 2VL6A 4BY1H 1K28A 3S2HH 1N36L 2EYLA 2MP1A 2PI2E 1TWHH 1IBKQ 4BA2I 2ZXOA 5I6WA 2QDBA 2PYKA 5M5XH 1YJWA 4HMIA 1FGBD 1SE8A 1CUKA 1HUMA 1BCPD 4YY3L 1STEA 3R3OA 3A8IE 2B29A 1YZ6A 4BA1I 2VY3A 4RWSC 2NVXH 2XWJB 1K8OA 2F3WA 3QG1A 3AMUA 2RCFA 1E22A 1L1OC 4AQYL 1E2ZA 1KDBA 1H9SB 3A7AB 2D9UA 3IAYA 5IGDA 2Z6KC 1PH5A 2EY2A 2PW5A 4QUFA 2K03A 4YY3Q 3HKZB 4YHHQ 1CKNA 5EQ0A 4HJ5A 5C3XA 2QF7A 4A3EG 4KN7C 1JQYD 1PXUA 3HKZG 2LS01 4AQYQ 1B7YB 4BBRB 4EQPA 2KVMA 1JOQA 4N8FA 4RHRA 2KA7A 2R92B 1MKHA 1FYCA 1PH7A 3MXNA 4ABNA 1PZKD 2KCTA 1TR5A 4BBRG 3NXWA 1EWCA 4DV0L 4H7BA 1X55A 3X3MA 1QG7A 1RDPD 2R92G 3D6WA 1D5XC 1NJIC 4NB3A 5ELCA 3I4LA 5D14A 4TKOB 3H3VC 3PIOA 5JOBA 4DR7L 3MEFA 2KBNA 3I3CA 3NENA 3ULLA 4A4IA 1YIJA 1G91A 1PH6A 4JBMA 1DZ1A 4C1NI 2L55A 2KCNA 4XYQA 4GNXA 2JA8G 5A2QE 2F3VA 4A3EH 4JW0A 5I2XA 3K0XA 1K3BC 4IUNA 4X66L 3CC7A 2WAQB 4ZRZA 1NE3A 2E5LL 4GS3A 4QUCA 5G3LF 2B3GA 1E1TA 4DR7Q 3LWUA 1YNJC 2JEBI 1YVCA 1PLFA 2E76C 4FO2A 1VQHA 4LW1A 1IXRA 3E9IA 3PO3H 5DNFA 2BOSA 1KAWA 2O2LD 4WRDA 5IYBG 1AN8A 5ELFA 3S2DH 4DNIA 4X66Q 1HZCA 2NBFA 4GOPA 4R4CA 4LUOA 2E5LQ 1QZGA 1L0WA 4O42A 3K7UC 3M9BA 1VMPA 4A3GH 1LT3D 5C3EB 5C3WA 3R2TA 2WAQE 2KCMA 2WINB 3I91A 4A3KH 3PQIA 4HCEA 1W6KA 1XNQL 2JA8H 4A3LG 1Y14B 1Q46A 5D3DA 3T16A 5C3EG 3GTOB 4PNYA 4X65L 5GADC 2B2VC 3FEWX 3F1ZA 3NBIA 5D65A 1LT5D 2K01A 1WCMB 3HOZB 1PTOC 3CU7A 1A63A 2L5TA 4PZ7A 1I94L 2ATWA 2KEDA 1WCMG 3HOZG 5CBEE 3M85A 2MUYA 1E3PA 1XNQQ 3TDQA 5IGEA 2CKZB 5CV7A 3I55A 3SR1A 2CVRA 4X65Q 1ICFB 3T4AC 1B3QA 4B3MQ 2Q8IB 2B63B 4L63B 3QIAA 1UEAB 1SN8A 1QUQA 2A74C 4JI4L 2SOBA 3SXHA 1STAA 1I94Q 1F9RA 4ZLTF 1SNOA 5ELOA 1BOSA 4KY5A 3CCJA 2B63G 3GTLB 5JJZA 2UUAL 1I6HH 3DEOA 4A3JB 1YNJD 4GKKQ 1B70B 1VF5C 4OWWB 2F0GA 3FKIH 4NDXA 2UU9L 2C35B 3STBC 3NHHA 1U5KA 4LFCL 4A3JG 4QB4A 5JEAJ 4CDDC 4DKAC 4JI4Q 1BCPF 5E1FA 3EQLC 1TWAB 3Q23A 2UUAQ 1CK1A 2F0IA 1BO0A 5KEEA 3EA6A 3PO2B 4OONA 2Q2IA 1XNRL 2UU9Q 1LACA 4LFCQ 3PO2G 1I4PA 1JC7A 2BH8A 1VDZA 3IFDA 1DYQA 4KHZA 3VYTA 2EJMA 3ND8A 1HRJA 1K83B 1OTCA 5EPJA 3CPFA 4JI2L 2B63H 1CM9A 3GTMB 1HH2P 4QCLA 2K6AA 1PTOD 2MJ8A 3U9SA 5FLMG 4FNFA 4PMCA 1D6EC 1B9MA 1VQEA 4KMUC 2Q8TA 2G5DA 3TREA 5I2YA 4A3JH 2DN8A 1S5CD 1NMFA 3PUWA 2F0SA 3CCLA 2KHJA 4WJWA 3VYRA 5FJ8G 4UP8A 5A2QL 2F0HA 1CQVA 3NK9A 1XX8A 2MHVA 4JI2Q 4LFBL 3J80E 2A6EC 3RNUA 5HURA 1X54A 1VF7A 3ER0A 3KBXA 2R3ZA 4TSSA 1WD1A 2DNEA 4RKBA 2K52A 4LFAL 2RKSA 1H9SA 3GDEA 2GN5A 4CHTB 3STBD 3AFPA 4N9TA 1I3QH 1SYEA 4XTCS 2IWHA 3WDNA 2JA6B 1C9OA 4I65A 4LFBQ 2JQOA 3S16H 5I9OA 1J9OA 1CKOA 3I4MH 3HS0C 3NTHA 1DGSA 5I9PA 3MXPA 3H0GG 4O1NA 2JA6G 2O5IC 1NBWA 3NTKA 3I7FA 2UXCQ 2UUCL 4LF7L 4LFAQ 3VA7A 1EYCA 3QO2A 2VNUD 1EIFA 1HFNA 2HUGA 3RD4A 1J5EL 2VUMB 3KUPA 2ENBA 1JJGA 2DY8A 1JB7A 1VQBA 1PH4A 4DAMA 4R1JA 1NR2A 4HEDA 4OWXB 2VUMG 1C7YA 1ET6A 1LUZA 5FLXc 2UUCQ 1YJNA 4PG3A 1TVXA 4LF7Q 3J7A5 4LF6L 2JA7B 5J39A 3OYYA 4DR3L 2F0TA 2F0KA 3BZCA 2KEEA 4TRDA 3E0EA 4C3JH 1J5EQ 4IJHA 4M8AA 2JA7G 2E2IB 2EPBA 1G2SA 3H0GH 1V1PB 2K5NA 2AHOB 4Q0FA 2JN4A 5IGFA 2A6ED 1PA6A 5M5YB 4FF2A 2BE5C 1LTID 3E3XA 3F2BA 4LF6Q 3HG9A 4GLXA 2J4XA 3K7AH 1AW7A 1TWCH 1PVOA 4B3SL 4ZK9B 4HIOA 1IL8A 1GUTA 1YHBA 3BVMA 4CGYB 1YBYA 3AYHB 1N33L 1D2BA 5FLXL 3L9AX 3ERSX 2F0WA 4L6TB 1SMYC 4P73A 2L9HA 2E74C 1PRTC 4DFAA 4MNOA 1BKBA 3T1YL 1PZJD 3S1MH 1BCPB 1IZ6A 4HJ7A 4R4TA 1HA6A 4AH6A 4B3SQ 2FMMA 2FJ2A 2PW7A 1QNUA 1S5ED 4DAYB 2L11A 5TSSA 1HZ9A 2WACA 3WOEA 2RCNA 5JPNC 4YWKA 3MVVA 2X6GA 4X3SA 5C6AA 3T1YQ 2OTJA 2CH4W 1IKLA 5ELNA 4AYBE 2SNMA 5AJ3L 4DV3L 1LV9A 1B1ZA 2X6LA 4TQUS 1E7ZA 5C5MA 1Q82C 5EBDA 4N8X1 4CDEC 3Q22A 1PV4A 1Q8KA 2F0FA 3MTSA 1XMOQ 1Q1BA 1JWMD 5HGQA 1EU3A 4FYDA 4ZKBB 1E0BA 1XPUA 3J81i 5AJ3Q 4DV3Q 2BE5D 1U4LA 3UDXA 3I4NB 1UWVA 2JK8A 1XPRA 5J3BA 5IP7G 2YU9H 5E4XA 3I4NG 2Y0SE 1EZ8A 3QR8A 5EJWA
chains in the Genus database with same CATH topology
1B50A 5JEAG 1SMYD 3S17B 2IJ0A 1PRTD 4FXDA 1EYAA 3A54A 1F2LA 1M8AA 4ZUIA 5J1ZA 4I7ZC 2QCPX 3A56A 4C3IB 4RGNA 5A35A 4ILWA 3K5MA 2Z4HA 1ENFA 4KJOA 2WKCA 3K58A 5CV4A 4C3IG 5EKKA 3NSWA 5CMDA 3V96A 5KYLA 4OHJA 4C1NK 4K5VA 3ND9A 2NWGA 3GTGB 1F77A 1II3A 1TS3A 3TSSA 3G6JB 1SYCA 3P7JA 1SNQA 2KOLA 4G7OC 2ID0A 1B2TA 1E2VA 5FO9B 2ICIA 3SHLA 1B53A 3ZYYX 1SFOB 2B39A 2RBMA 3R2IA 4XQQA 1AP0A 3N6RA 5C44B 1PFNA 3MEHA 5JAVA 4LAAA 5CV8A 1RD9D 2XWBB 1HTLD 1FD7D 3M7NA 2G9HD 4IURA 4HCSA 1O7YA 5IGGA 2Z8LA 1SE3A 4XXEA 2NZ1D 1IYVA 1RCVD 1SBBB 5K36G 1IKMA 3C46A 5KRUA 2WB1B 3CRKC 2NB0A 2F0QA 1F2ZA 3BVGA 1ZXTA 1EFID 2EJFC 3SE0A 2F1MA 2IX3A 2EJGC 2R93B 1TS2A 4DAVA 1JORA 1EU4A 5CV6A 1TIID 4HSPA 4IALA 2PNRC 1QILA 3CRLC 2B8GA 1EY4A 1RTNA 2FMCA 3VR3A 2DY7A 1V1PA 1A2UA 3HP3A 1F2YA 4XQJA 2BCOA 5LL6X 2B2YA 1PTOB 4NKLA 4XT3B 2A73B 1KABA 3S14B 2SEBD 1F9SA 2QEJC 1CI3M 2VB3X 3D4WA 5FK9C 1SEBD 4IFDJ 1L0YB 2V4DA 1F2MA 1CFMA 1OXXK 2CHBD 1EY9A 4DNRB 1DOLA 2HCIA 1U9RA 3FDTA 2XIWA 1TY2A 1R4PB 3DM1A 4DAYA 5KGUA 1EQVA 1UAPA 4HR7B 3TP6A 2HCCA 3ONAB 2KCCA 1KDAA 4KKUA 1ESRA 1OO9B 4ZAIA 3W2DA 1Y1VB 1Q90A 2B2UA 3MXGA 1DM0B 4B9XA 1JOKA 5KNDA 2R61A 4A93B 3PMFA 1VMCA 5I4DA 5M5WB 3LX0A 3MC0B 1J8IA 1EOTA 4KHVA 1I4RA 3AU7A 4KKTA 1SNDA 3I70A 3S1RB 1EEFD 4K5XA 2XVSA 2FINB 2NN6G 5C0XI 1S5BD 4B9WA 3TMEA 2MPMA 4RGTA 1HUNA 2K5QA 4KD3A 3QB3A 1U4MA 3I73A 1E2WA 1JR0D 3N52A 4U673 2NVTB 5CV5A 1G6ZA 3VYSA 1TWGB 1F9PA 1L0XB 2JYOA 4QF4A 3X3NA 1SAPA 3H91A 3A55A 1F9QA 5F2DA 4KY6A 4KI0A 1LTSD 2NN6I 4LJZC 1T5EA 5IIFA 1OXTA 3GQBA 3BDCA 4RHSA 2NVQB 3PUZA 3K59A 3TP8A 4KY7A 1Z6HA 5EPKA 3ERQA 1GUOA 5HGTA 1WTPA 4LMQD 1TS5A 4PMBA 1D5ZC 2NVYB 1V8QA 3IL8A 4N9PA 2WIIB 3RMHA 3OSOA 3S1NB 3S9WA 1W6JA 3NTIA 3T56B 1Z47A 4V190 1KAAA 5C4HA 2E2DC 3BG3A 1JICA 5E4WC 5C4XB 3CHBD 1Y8NB 2PQEA 3I72A 1BDOA 1O7ZA 2OF1A 3EVQA 1PRTB 2EYHA 2PZUA 1HFGA 1TWFB 2HDLA 1GOZA 1Q8IA 3BZDB 3VYUA 3GTKB 3K5OA 4FXKC 4B08A 5FLXE 1O78A 4KV6A 1B4OA 2A69C 2FFKB 1EEID 4K2KA 1NCVA 3OIPA 3A8KE 1ZEQX 2IPKD 4EVOA 1JOOA 2AQ2B 4IFDG 4NMZA 3HOWB 4HTHA 3HOVB 1Z7TA 2F0MA 3T53B 1GUWA 3EFXD 3DWQA 1R9TB 2CW0C 4OO1I 2AQ3B 2PZTA 2A6HC 4A3DB 2NTTA 4H13C 2EVBA 1ICWA 3VA5A 4C3HB 4IFDI 1PFBA 1I4GA 2JE6I 3I8ZA 1CT1D 1BR9A 4C3HG 1A3VA 3CQZB 3OWFA 5KIXA 4IUVA 2A69D 2TMPA 3F2UA 4GZYC 2RDGA 2BDNA 1STGA 3NBHA 1LT6D 5M3MB 1JWSD 3JAML 2M2LA 1EL0A 3DUZA 2IL8A 5M3FB 1ESFA 2JEAI 1TS4A 4FF1A 4CBVA 3NP8A 2H1EA 1NR4A 3HOYB 2CW0D 1R4QB 3VR6A 1SYDA 2A6HD 2AUJD 3L7ZC 4P2CB 1PDQA 3GTQB 3HZXA 1SYBA 5CV9A 1SDFA 3RUZA 4DN4M 3E6ZX 1SJHD 3GD7A 4ZKCB 2R6GA 4NW2A 1WTRA 2JP1A 3FRPB 3CKIB 4AYBB 5FOBB 2N88A 2LFNA 3TP7A 1EY6A 1AZPA 3E5SA 2RVLA 5LHY1 2B2TC 4MN3A 5J22A 1HPCA 5BN4A 2K04A 3VR2A 3GTJB 2PCFB 1FR3A 2Q8RE 4IUQA 4IN3A 1OXSC 1Y8PB 2A5HA 1HQMC 4OGQC 4PMWA 2Y0SB 4Q5VA 1LTBD 5CR3A 2J0TD 2WV6D 5IT9E 1EWHA 3IFTA 5E3FA 3QOLA 4RGMA 1S4ZA 4A3BB 2BA0A 1AFPA 1FNVA 5DAUA 4EGVA 3J81L 1I6VC 5C0XJ 2KJXA 3V05A 1BF4A 4CJ0B 1PTOF 4RGOS 3SVMA 3PUYA 4ULLA 4KKSA 5CBAE 1H9KA 2XSCA 2E2HB 1RF2D 1U4RA 2L4NA 4A3FB 1KTKA 2K28A 4KD4A 1PMRA 4ME5A 2G9DA 2XRSD 2M9VA 1STBA 3OOCA 2Z1CA 2KECA 1LO5D 3RZOB 3S15B 3NPPA 3NE5B 3NQTA 4WORA 2Z4IA 1DCZA 2KQ3A 2B2WC 1STNA 3H09A 4R9WA 4OIKA 5FKAC 3HOUB 2OT2A 1CZGA 3M3YB 1PZID 3SK6A 3K0YA 5JEAH 4YIJA 4CKEA 1LLRD 1WVLA 3DHQA 1GJXA 5EGTA 4L8JA 3L3OC 1SYFA 3U9OA 3MFGA 3ITPA 1BBXC 4ID6A 5M9OA 3D31A 3OMCA 3TZDA 1AEXA 3TN2A 1ZYRC 1K8MA 3MAQA 4KJNA 4HAEA 5IOCA 2JSOA 4R8NA 1CTMA 4HN7A 3P1HA 4ZQ3A 4QMGA 1HQRD 1PFMA 3OHXC 4DK1A 4F87A 4FVMA 5C4JB 3MA2B 1MI2A 4R8IA 2R7ZB 1I4XA 5COYA 1JWUD 3KLSX 3RZDB 1ET9A 4H0LC 5EKIA 5JVH3 4ZYSA 4BBSB 1SYGA 4LK1C 4QIWB 2O4XA 2EYOA 1MSGA 5C5LA 3TZUA 2RSOA 4J6HA 2M00A 2RQXA 5IT9L 1YNNC 2E75C 4G4KA 3P20A 1C4QA 2D62A 1WTOA 1Y8OB 2L0CA 1EZ6A 4BY7B 1Y1WB 5DM73 3LNNA 3G7LA 1TT2A 2YYZA 5I6YA 4K14A 5K36H 2HDMA 1XTCD 1I50B 2L1BA 4K5WA 2QILA 1EY5A 1SE2A 1ZYRD 2QKIC 4CKCA 1LTRD 2BDOA 2CQAA 2JA5B 5CORA 1G8ZD 3D4RA 3S2HB 1WTWA 1TWHB 2L12A 2PMZB 5ELDA 5M5XB 1QJOA 1QE6A 1A15A 4CJ1B 1D1IA 4PQXA 2NVXB 3VR4A 3BVZA 1GUNA 3K6OA 3QJYA 4FF4A 5CYUA 3BYTB 5ELEA 1JB3A 3Q6SA 1PRTF 1MSHA 5EPLA 4DA2A 4RAUC 3K57A 1YNND 1OXUA 1PTOH 1QB5D 2FHTA 2IT1A 1S5DD 4HMJA 2GA4B 4NP5A 4RFBA 3GV3A 2K1BA 2IX0A 1LTAD 1A6XA 5ELBA 1TQOA 5C0XG 1I4HA 2EY1A 2PPBC 2F4IA 3K5LA 1S5FD 1RTOA 4RKLA 2WP8J 1LT4D 2MGSA 4M1UB 3V2TA 1BXTA 3VR5A 1Q1EA 3J7AF 1O80A 2SNSA 4RA8A 1GUGA 2RA4A 1CA5A 2F0UA 2C9OA 3KLRA 1SNCA 4EQOA 1SE4A 2EYMA 2TSSA 3FPPA 1SNPA 4A3EB 1D1KA 1A3TA 1KLUD 2F0LA 1U4PA 2C5CA 2JXMB 5C0XH 1CHQD 2EOTA 1CZWA 5DEHA 3NWSA 4XQNA 5D3IB 4H44C 3PO3B 1G291 3S2DB 3D4DA 4UAIA 2LY7A 3SK5A 2OXPA 2XN9C 1FNWA 2NYZD 3PUVA 4RCOA 1DD2A 5CGKA 4A3GB 5FO8B 5KYIA 4A3KB 1EQTA 4EQNA 2JA8B 2VB2X 4G7HC 1I4QA 3PUXA 3SK8A 3OW7A 2NN6H 3KK7A 2AUKA 4IZ8A 3NQIA 1JE4A 4DAPA 1MD2D 3D8GA 1B9NA 3C1FA 3RLFA 4KN4C 4IUUA 5EBCA 1IW7C 2EDGA 2ZT9C 3H6MA 1B44D 3T13A 2NUCA 3TBIB 3JAME 1H9RA 1A2TA 2DNCA 3PV0A 1Q12A 5EKLA 1VCIA 5JVG3 1IHZA 1I6HB 1LTGD 2KHSA 3FKIB 1V1OA 5JPMC 4FXGC 1SJED 2AWOA 5C4ZA 3KBGA 3Q24A 5BN5A 1Y69U 5K5PA 1DOMA 1ML0D 3PIP3 1H9MA 1ILPA 1HHVA 4ZUJA 2B2VA 4CJ2C 5NUCA 3SK4A 2EYFA 4OO1G 1IW7D 3H94A 1IYUA 2K32A 2KUMA 3A8JE 3FPUB 3C2PA 3T51B 2EY5A 1OXVA 4X3KA 1M4VA 1DJRD 3C3LA 5DM63 3EROA 4DGZA 2HQEA 3HEJA 3QWNA 2K7VA 4XIGS 1XXGA 4DXFA 1MBYA 1I3QB 5ISRA 2EE1A 3S16B 4OO1H 3I4MB 1CA6A 3J81E 2EYJA 1QNKA 2H4OA 4KTAA 2SDFA 1BUVT 2D2CC 1NUCA 3M4YA 2RSNA 1SSOA 2F0EA 4IUPA 4IFDH 3O13A 2K5WA 4Z9CB 5LL6S 3D3RA 4DXGA 3HGBA 4IQZA 3I90A 1X3QA 1HTPA 1X3PA 2B8FA 3BDOA 3MZ5A 3MWYW 2F0OA 2AWNA 2X69A 1NSNS 1WTVA 5T1GA 3K5NA 2LMCB 4C3JB 2A68C 1EYDA 3BS1A 3OWEB 3DWAA 3W3AA 3H0GB 3FMCA 3R93A 4C3JG 4XYOA 3BDLA 3KLSA 4V0BA 4IUTA 4C56C 3K7AB 1TWCB 3DEPA 1UNSA 4F88A 1RHPA 3WOFA 4J8QA 3HRZC 1BNZA 2BA1A 1LTTD 3MXUA 3OIQA 3S1MB 1CHPD 1HCZA 4MHEA 1XYIA 4JK1C 4HSVA 2ZXPA 3C1EA 1ONLA 2I07B 5BN3A 1WTQA 3FVQA 4K6DA 1DONA 2IW3A 4K8JA 3GO5A 2EXZA 2N55A 3OMGA 1V43A 1GHJA 2A68D 3KF8A 2RDFA 3LWEA 4F8MA 1EY7A 2F0JA 1QOHA 3NUCA 1DXMA 4BS9A 1B3AA 1HA5A 2IX1A 3MHBA 5T1IA 1EIHA 2YU9B 1X32A 2LKVA 4K6LA 1ZKOA 2EZVA 3NWTA 2K33A 4MIUA 4OL7A 1PYWD 2PO4A 3SEBA 5IGBA 4X3UA 1XWEA 1TY0A 3M7GA 5IODA 2XNAC 1MGSA 1WTXA 2B2TA 1AZQA 1KDCA 4CKBA 2K5DA 3TP5A 5AFWA 3J80L 3E0JA 5KNBA 1DOKA 1O7LA 3PIO3 1T5XD 5FO7B 4JBWA 4DK0A 1QWYA 1TKWB 2O5JC 1SNMA 1RJTA 1QCBD 3J7YW 1GXDC 3DWPA 4OIJA 1KLGD 4K2LA 3BYYB 3M4OB 1LABA 2PZWA 2J7ZA 1KNEA 1Q3LA 3GP7A 3Q0AA 1GUSA 2F0DA 3GTPB 2F0PA 3DMUA 1BQQT 4BWGB 3P75A 4UDUC 4DNTB 3EJIA 3UI2A 1NAPA 2K05A 2NTSA 3QOJA 4XDXA 1D5MC 2I46A 1C8CA 1SXTA 1KNAA 1ILQA 1STHA 2B2WA 1EY0A 4E6IA 1WD0A 2F0NA 2E2JB 1C48A 4J1MA 1EIGA 4A3MB 5KNCA 4DU9A 1G2TA 4PV1C 1ENCA 2D5DA 3J7AV 3MFYA 3SDZA 2RDHA 4G7ZC 4S3SA 2B2YC 2F03A 5G3LD 2WKDA 1FNUA 2EYPA 4Y7NB 4RCNA 3D6CA 1BCPC 4WFN3 3A7LA 3URYA 4C2MB 4XT1B 4BY1B 1HXYD 2EY6A 4ODGA 3IKJA 3DXJC 4KK7A 2XRQD 3OPOA 3HOXB 1H9JA 1UUPA 2VXWA 1CQFA 4A3IB 1JCKB 4DF7A 1STYA 4FP5D 4U68A 4F7XA 5CC4A 2B2UC 4G57A 1RKNA 2ZXRA 1EY8A 2F0VA 4RH6A 5IGCA 2AQ1B 1RODA 3S1QB 4K8IA 4FF3A 1GHKA 2ICEC 3AB9A 3R8BA 1ENAA 1TU2B 4X3TA 2OEOA 1A3UA 2EYLA 2MP1A 4BA2I 2ZXOA 5I6WA 2QDBA 2PYKA 4HMIA 1FGBD 1HUMA 1BCPD 1STEA 3R3OA 3A8IE 4BA1I 4RWSC 2XWJB 1K8OA 2F3WA 3QG1A 3AMUA 1E2ZA 1KDBA 1H9SB 3A7AB 2D9UA 3IAYA 5IGDA 2EY2A 2PW5A 4QUFA 2K03A 3HKZB 5EQ0A 5C3XA 2QF7A 4KN7C 1JQYD 1PXUA 2LS01 4BBRB 4EQPA 2KVMA 1JOQA 4RHRA 2KA7A 2R92B 1FYCA 3MXNA 4ABNA 1PZKD 1TR5A 3NXWA 1EWCA 4H7BA 3X3MA 1QG7A 1RDPD 3D6WA 1D5XC 5ELCA 3I4LA 5D14A 4TKOB 3H3VC 5JOBA 3I3CA 1G91A 1DZ1A 4C1NI 2L55A 2KCNA 4XYQA 5A2QE 2F3VA 5I2XA 4IUNA 2WAQB 4ZRZA 5G3LF 4QUCA 3LWUA 1YNJC 2JEBI 1PLFA 2E76C 4FO2A 5DNFA 2BOSA 2O2LD 4WRDA 1AN8A 5ELFA 2NBFA 4O42A 1VMPA 1LT3D 5C3EB 5C3WA 3R2TA 2WINB 3I91A 4HCEA 1W6KA 5D3DA 3T16A 3GTOB 4PNYA 2B2VC 3FEWX 3NBIA 5D65A 1LT5D 2K01A 1WCMB 3HOZB 1PTOC 3CU7A 2L5TA 2KEDA 5CBEE 3M85A 2MUYA 3TDQA 5IGEA 5CV7A 3SR1A 2CVRA 3T4AC 2Q8IB 2B63B 4L63B 3QIAA 1UEAB 2A74C 2SOBA 3SXHA 1STAA 1F9RA 4ZLTF 1SNOA 1BOSA 4KY5A 3GTLB 5JJZA 3DEOA 4A3JB 1YNJD 1VF5C 2F0GA 4NDXA 3NHHA 4QB4A 5JEAJ 1BCPF 5E1FA 3EQLC 1TWAB 3Q23A 1CK1A 2F0IA 1BO0A 5KEEA 3EA6A 3PO2B 1LACA 1I4PA 1JC7A 4KHZA 1VDZA 3IFDA 1DYQA 3VYTA 2EJMA 3ND8A 1HRJA 1K83B 5EPJA 1CM9A 3GTMB 4QCLA 2K6AA 1PTOD 2MJ8A 3U9SA 4FNFA 4PMCA 1D6EC 1B9MA 4KMUC 2Q8TA 5I2YA 2DN8A 1S5CD 3PUWA 2F0SA 4WJWA 3VYRA 5A2QL 2F0HA 1CQVA 3NK9A 1XX8A 2MHVA 3J80E 2A6EC 5HURA 1VF7A 3KBXA 2R3ZA 4TSSA 1WD1A 2DNEA 4RKBA 2RKSA 1H9SA 4CHTB 4N9TA 1SYEA 4XTCS 2IWHA 3WDNA 2JA6B 4I65A 5I9OA 1J9OA 3HS0C 3NTHA 5I9PA 3MXPA 4O1NA 2O5IC 3NTKA 3VA7A 1EYCA 3QO2A 2VNUD 1HFNA 2HUGA 3RD4A 2VUMB 3KUPA 2ENBA 2DY8A 1NR2A 4HEDA 1ET6A 1TVXA 2JA7B 5J39A 2F0TA 2F0KA 2KEEA 4TRDA 4M8AA 2E2IB 2EPBA 1G2SA 1V1PB 4Q0FA 5IGFA 2A6ED 5M5YB 4FF2A 2BE5C 1LTID 3HG9A 2J4XA 1AW7A 4ZK9B 1IL8A 1GUTA 3BVMA 4CGYB 1D2BA 5FLXL 3L9AX 2F0WA 4L6TB 1SMYC 2L9HA 2E74C 1PRTC 4DFAA 1PZJD 1BCPB 1HA6A 2FMMA 2FJ2A 2PW7A 1QNUA 1S5ED 2L11A 5TSSA 2WACA 3WOEA 5JPNC 3MVVA 2X6GA 4X3SA 5C6AA 1IKLA 2SNMA 1LV9A 1B1ZA 2X6LA 4TQUS 5C5MA 5EBDA 3Q22A 2F0FA 3MTSA 1Q1BA 1JWMD 1EU3A 4FYDA 4ZKBB 1E0BA 2BE5D 1U4LA 3I4NB 5E4XA 1EZ8A 3GV6A 5EJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUP A;  1PTO H;  1HQR D;  1TS2 A;  1EU4 A;  1PRT B;  1S5D D;  1EEF D;  1BCP F;  2IJ0 A;  2RDG A;  4BWG B;  1FNV A;  1PRT D;  1JCK B;  4RFB A;  1LT6 D;  1QIL A;  4UDU C;  1CK1 A;  1LTA D;  5ELB A;  1I4X A;  1JWS D;  3V05 A;  3EA6 A;  1JWU D;  1I4H A;  3KLS X;  1GOZ A;  1V1P B;  3O13 A;  4RGN A;  4Z9C B;  1ET9 A;  1PTO F;  1HA5 A;  2NTS A;  1S5F D;  1LTG D;  3BZD B;  4RGO S;  4DXG A;  1V1P A;  1S5B D;  4RH6 A;  4ZYS A;  1LTI D;  1ENF A;  1D5M C;  1I4P A;  1LT4 D;  2AQ1 B;  2J4X A;  4RGT A;  1DYQ A;  1V1O A;  1ESF A;  1TS4 A;  1SXT A;  1AW7 A;  1BXT A;  1PTO B;  4OHJ A;  4K6L A;  3BVM A;  1PTO D;  1RF2 D;  3R8B A;  2O2L D;  1EEI D;  1JR0 D;  1SJE D;  1D6E C;  1PYW D;  2SEB D;  3SEB A;  1AN8 A;  4L6T B;  2QEJ C;  5ELF A;  1SE4 A;  3OWE B;  3DWA A;  1PRT C;  1TY0 A;  2TSS A;  1KTK A;  1F77 A;  1L0X B;  2IPK D;  1PZJ D;  1S5C D;  2XNA C;  1BCP B;  1KLU D;  1FGB D;  5FK9 C;  1SEB D;  1TS3 A;  3TSS A;  1BCP D;  1LT3 D;  1STE A;  1L0Y B;  2XRS D;  1CQV A;  2AQ2 B;  3R2T A;  1LTS D;  1LO5 D;  2CHB D;  5D3D A;  1SJH D;  1XTC D;  1CHQ D;  4C56 C;  1S5E D;  2RDH A;  2QIL A;  4RHS A;  5TSS A;  1SE2 A;  1UNS A;  5D3I B;  1TY2 A;  1LT5 D;  2ICI A;  1LTR D;  4TSS A;  3EFX D;  1T5X D;  5FKA C;  1G8Z D;  3DWQ A;  1PTO C;  3R2I A;  1FNU A;  1TS5 A;  2AQ3 B;  2XN9 C;  1FNW A;  1PZI D;  4RCO A;  1D5Z C;  1LTT D;  5ELD A;  1RD9 D;  1HTL D;  1B1Z A;  1FD7 D;  1CHP D;  1LLR D;  3DWP A;  1M4V A;  2NTT A;  1DJR D;  1JQY D;  2G9H D;  4O1N A;  1BCP C;  1JWM D;  1EU3 A;  1I4Q A;  1KLG D;  3W2D A;  3MFG A;  3BVZ A;  3BYY B;  2Z8L A;  1SE3 A;  4L63 B;  4RHR A;  1RCV D;  1I4G A;  1SBB B;  3URY A;  1CT1 D;  1MD2 D;  1PZK D;  3BYT B;  1EWC A;  1HXY D;  2R61 A;  5ELE A;  3GP7 A;  3BVG A;  1XXG A;  1RDP D;  1PRT F;  4DXF A;  5I4D A;  1EFI D;  1D5X C;  1LTB D;  2WV6 D;  3MC0 B;  5ELC A;  3CHB D;  2XRQ D;  1ET6 A;  1B44 D;  1I4R A;  4RGM A; 
#chains in the Genus database with same CATH topology
 1B50 A;  1X3F A;  5JEA G;  2QGQ A;  1SMY D;  4UPA A;  3S17 B;  2IJ0 A;  1PRT D;  4FXD A;  1EYA A;  3A54 A;  1F2L A;  1M8A A;  4ZUI A;  1VQD A;  3EN2 A;  5J1Z A;  4I7Z C;  2QCP X;  3A56 A;  4C3I B;  4RGN A;  5A35 A;  4ILW A;  3K5M A;  2Z4H A;  1ENF A;  4KJO A;  2WKC A;  1L1O B;  3RLN A;  3K58 A;  3CC2 A;  5CV4 A;  4C3I G;  4HID A;  5EKK A;  2IHF A;  3NSW A;  5LMN L;  5CMD A;  4DUY L;  3V96 A;  2Z9H A;  5KYL A;  4OHJ A;  1LYL A;  1VQ9 A;  4C1N K;  4IOC A;  4K5V A;  3ND9 A;  2NWG A;  3GTG B;  2I0Q A;  2GVB A;  1F77 A;  2DUD A;  2RHQ B;  1II3 A;  1TS3 A;  3TSS A;  5LMN Q;  3G6J B;  1SYC A;  3P7J A;  4OEM B;  4DUY Q;  1SNQ A;  2KOL A;  2HD3 A;  4G7O C;  1KRS A;  2ID0 A;  3G6E A;  1B2T A;  4LF5 L;  1E2V A;  3CCE A;  3M4O H;  5FO9 B;  5IYC G;  2ICI A;  3SHL A;  1B53 A;  3ZYY X;  1SFO B;  2B39 A;  2RBM A;  3R2I A;  4XQQ A;  4O0A A;  1AP0 A;  3N6R A;  5C44 B;  1PFN A;  4IPC A;  3MEH A;  3UDF A;  5JAV A;  4LAA A;  5CV8 A;  1RD9 D;  2XWB B;  1HTL D;  1FD7 D;  4EQ5 A;  3ULJ A;  5C44 G;  4A3M G;  4LF5 Q;  2UXD L;  3GTP H;  3M7N A;  2G9H D;  4IUR A;  2I5H A;  4HCS A;  1O7Y A;  1MHW C;  5IGG A;  1MJC A;  1SE3 A;  2Z8L A;  4XXE A;  2NZ1 D;  3KJO A;  1IYV A;  1RCV D;  2IY5 B;  2VQE L;  1SBB B;  5K36 G;  1IKM A;  3C46 A;  5KRU A;  2WB1 B;  2NZO A;  3CRK C;  2NB0 A;  2F0Q A;  2N78 A;  1F2Z A;  3BVG A;  1ZXT A;  4DR4 L;  2UXD Q;  1EFI D;  2EJF C;  3SE0 A;  2ZTE A;  2F1M A;  2IX3 A;  3U58 A;  1HNZ L;  2EJG C;  1XPO A;  4KLK A;  3I4O A;  2R93 B;  2VS1 A;  1TS2 A;  4DAV A;  1JOR A;  1EU4 A;  5CV6 A;  2VQE Q;  1TII D;  4JOI C;  3H3V I;  4HSP A;  4IAL A;  2E2J H;  2PNR C;  1QIL A;  1I5F A;  4A3M H;  2QA4 A;  3CRL C;  2B8G A;  2YTV A;  3CCS A;  1EY4 A;  1RTN A;  2FMC A;  4BXX G;  2WB1 E;  3VR3 A;  1HNZ Q;  3KFU A;  2DY7 A;  1V1P A;  1P16 A;  3A5U A;  3CC4 A;  3K8A A;  1FGU A;  1A2U A;  3HP3 A;  1S40 A;  1F2Y A;  4XQJ A;  2DJF C;  2BCO A;  5LL6 X;  3UE0 A;  2B2Y A;  1PTO B;  4NKL A;  4XT3 B;  2A73 B;  1KAB A;  5HY6 A;  3S14 B;  2SEB D;  1F9S A;  2QEJ C;  5IP9 G;  4Y7N H;  3J7Z C;  2QEX A;  2OQ0 A;  1CI3 M;  2VB3 X;  3D4W A;  5FK9 C;  1SEB D;  4IFD J;  1L0Y B;  2V4D A;  1F2M A;  1CFM A;  1OXX K;  2CHB D;  1EY9 A;  4DNR B;  1DOL A;  2HCI A;  1U9R A;  1WYD A;  1VQ7 A;  1PYS B;  3FDT A;  4BXX H;  2XIW A;  4DV5 L;  1TY2 A;  1R4P B;  3DM1 A;  4DAY A;  4C2M H;  4JI5 L;  5KGU A;  1EQV A;  2LXJ A;  3TRZ A;  1UAP A;  4HR7 B;  3TP6 A;  4H02 A;  2HCC A;  3ONA B;  2PMZ E;  3OTO L;  3HOX H;  4P71 A;  2KCC A;  2Q2T A;  1JJC B;  1KDA A;  4KKU A;  1ESR A;  4A3I H;  1OO9 B;  5IP9 H;  4ZAI A;  4DV5 Q;  4GN5 A;  3W2D A;  4JI5 Q;  4LUV A;  1Y1V B;  1Q90 A;  2B2U A;  1N36 Q;  3MXG A;  2K50 A;  1DM0 B;  1Y1V G;  1JOK A;  4ZCK A;  2R61 A;  4B9X A;  5KND A;  4A3C H;  4A93 B;  3OTO Q;  4HIM A;  4A75 A;  3PMF A;  3CCU A;  1VMC A;  5I4D A;  5M5W B;  3LX0 A;  3MC0 B;  4LF9 L;  3GV6 A;  1UE5 A;  3S1Q H;  4A93 G;  1EOT A;  4KHV A;  1J8I A;  1I4R A;  3AU7 A;  4KKT A;  1M1K C;  1SND A;  3I70 A;  3NBH B;  3S1R B;  1EEF D;  4K5X A;  1C0A A;  2HT1 A;  2AKW B;  2XVS A;  1W3S A;  2FIN B;  2NN6 G;  4LF9 Q;  5C0X I;  1S5B D;  4LNQ A;  4B9W A;  3TME A;  2MPM A;  2QW7 A;  1SRO A;  4RGT A;  1HUN A;  2K5Q A;  4KD3 A;  1L1O A;  3QB3 A;  1U4M A;  3I73 A;  2MO1 A;  1E2W A;  2Z6K A;  4RMF A;  5H1S E;  3DLL A;  1PH3 A;  1JR0 D;  3N52 A;  4U67 3;  1HNW L;  2PQA B;  4DV0 Q;  2NVT B;  5CV5 A;  1G6Z A;  3VYS A;  1TWG B;  1F9P A;  1L0X B;  1WOC A;  2JYO A;  4GN3 B;  1X6O A;  4QF4 A;  1SAP A;  3X3N A;  4DV2 L;  3H91 A;  1GVP A;  1F9Q A;  3A55 A;  5F2D A;  4KY6 A;  4KI0 A;  1XMQ L;  1VQ6 A;  1LTS D;  4DK6 C;  2NN6 I;  4IPH A;  4LJZ C;  1T5E A;  5IIF A;  1OXT A;  2WAQ G;  3F2C A;  3TS2 A;  4BBR H;  3GQB A;  3BDC A;  2D0P A;  4RHS A;  4JI3 L;  2NVQ B;  3PUZ A;  4P72 A;  3K59 A;  3TP8 A;  4KY7 A;  2R92 H;  1Z6H A;  1PYB A;  1RL2 A;  3ERQ A;  5EPK A;  2F4V L;  2DGY A;  1GUO A;  4JI1 L;  5HGT A;  4DV1 L;  1WTP A;  4LMQ D;  1TS5 A;  1FVI A;  4PMB A;  4DV2 Q;  1XMQ Q;  1S72 A;  1D5Z C;  2NVY B;  1V8Q A;  3IL8 A;  4N9P A;  2WII B;  1E1O A;  3RMH A;  3OSO A;  3S1N B;  4JI3 Q;  3EBE A;  3S9W A;  1W6J A;  4LWC A;  3NTI A;  4JI1 Q;  3T56 B;  1J6Q A;  1Z47 A;  4V19 0;  1KAA A;  5C4H A;  2E2D C;  3PF5 A;  3BG3 A;  3AFQ A;  1JIC A;  5E4W C;  4TVA B;  5C4X B;  3CHB D;  1Y8N B;  4WJ3 M;  2ZM6 L;  4X62 L;  4IJL A;  4JI8 L;  2PQE A;  3I72 A;  5IYB H;  1BDO A;  1O7Z A;  2OF1 A;  2GVA A;  3EVQ A;  1PRT B;  1KRT A;  5C4X G;  2EYH A;  4POF A;  1K73 C;  1YHA A;  2PZU A;  2ASB A;  1BVS A;  1HFG A;  1TWF B;  4B3R L;  2HDL A;  2FXQ A;  1GOZ A;  1ASZ A;  4A3L H;  1Q8I A;  3BZD B;  4X62 Q;  3VYU A;  5C3E H;  4JI8 Q;  3GTK B;  4GKJ L;  3K5O A;  4FXK C;  4B08 A;  5FLX E;  1W2B A;  1X3E A;  1VQF A;  1O78 A;  4KV6 A;  4L5S A;  3GTO H;  1KC8 C;  1KL9 A;  1B4O A;  2A69 C;  2FFK B;  1EEI D;  4K2K A;  4B3R Q;  1WCM H;  3HOZ H;  1NCV A;  3OIP A;  3A8K E;  2AMC B;  1ZEQ X;  2PI2 A;  4GKJ Q;  2IPK D;  4GLV B;  3CME A;  2A19 A;  4EVO A;  1JOO A;  1VQP A;  2AQ2 B;  2IHE A;  4IFD G;  1EOV A;  4L5T A;  4NMZ A;  3HOW B;  5GAG C;  4HTH A;  3HOV B;  1Z7T A;  2F0M A;  4EX5 A;  3LGJ A;  3T53 B;  1GUW A;  1QVG A;  4R4Q A;  3HOW G;  3EFX D;  2DJG C;  3DWQ A;  3HOV G;  1XNR Q;  1R9T B;  2CW0 C;  3GTL H;  4OO1 I;  1HR0 W;  2AQ3 B;  2PZT A;  3OW2 A;  2MO0 A;  2A6H C;  4HJ9 A;  4A3D B;  2NTT A;  4H13 C;  2EVB A;  1ICW A;  3B6Y A;  3PCO B;  3VA5 A;  4C3H B;  4IFD I;  1TWA H;  3JAM c;  1PFB A;  1SRU A;  1I4G A;  2JE6 I;  3F8T A;  3I8Z A;  1CT1 D;  1BR9 A;  2K5V A;  2N49 A;  4C3H G;  3PO2 H;  3W1B A;  1A3V A;  3CQZ B;  3OWF A;  2ZJP A;  5KIX A;  5FLM H;  4IUV A;  1K83 H;  2A69 D;  2N3S A;  2TMP A;  3F2U A;  3GTM H;  4GZY C;  2RDG A;  4LUZ A;  2BDN A;  1K9M C;  1STG A;  3NBH A;  1LT6 D;  1X9N A;  5M3M B;  1QZH A;  5FJ8 H;  1JWS D;  3JAM L;  2M2L A;  1EL0 A;  3DUZ A;  3RN2 A;  2IL8 A;  5M3F B;  1VQC A;  1ESF A;  2JEA I;  1TS4 A;  4FF1 A;  4CBV A;  3NP8 A;  2H1E A;  1NR4 A;  3HOY B;  2CW0 D;  1R4Q B;  4RG1 A;  2EXD A;  3VR6 A;  1SYD A;  2A6H D;  3HOY G;  2AUJ D;  3L7Z C;  2PQA A;  3TEH B;  3KLW A;  4R4O A;  2JA6 H;  4DV6 L;  4P2C B;  1PDQ A;  3GTQ B;  3HZX A;  1SYB A;  2HIV A;  5CV9 A;  1SDF A;  3RUZ A;  4DN4 M;  2K4K A;  3E6Z X;  1SJH D;  1UE1 A;  2PNH A;  3GD7 A;  4ZKC B;  4DR3 Q;  2R6G A;  4NW2 A;  4PZ6 A;  1WTR A;  1A62 A;  2JP1 A;  3FRP B;  1EIY B;  4QGU A;  3T1H L;  4QL5 A;  3CKI B;  4AYB B;  5FOB B;  3UDG A;  2N88 A;  2LFN A;  2VUM H;  1Q7Y C;  4DV6 Q;  3TP7 A;  1EY6 A;  1AZP A;  3E5S A;  4AYB G;  4PZ8 A;  2RVL A;  2XGT A;  5LHY 1;  2B2T C;  3J81 c;  4JV5 L;  2JA7 H;  4MN3 A;  3HOY H;  5J22 A;  1N33 Q;  3T1H Q;  3JC6 6;  1HPC A;  3CF5 A;  5IE8 A;  5BN4 A;  2K04 A;  2YV5 A;  3VR2 A;  4JI6 L;  3GTJ B;  1QVC A;  2PCF B;  2E2I H;  1GM5 A;  1E24 A;  1FR3 A;  1CKM A;  1VQA A;  2Q2H A;  2Q8R E;  4IUQ A;  1PH1 A;  4IN3 A;  1OXS C;  3PGZ A;  1Y8P B;  2A5H A;  5M5Y H;  3GTQ H;  1HQM C;  4OGQ C;  4PMW A;  2Y0S B;  4Q5V A;  1LTB D;  1T9H A;  5CR3 A;  2J0T D;  2WV6 D;  3SGI A;  4JV5 Q;  5IT9 E;  4IO9 A;  1EWH A;  3IFT A;  5E3F A;  1KXL A;  3QOL A;  4RGM A;  1S4Z A;  2Y0S G;  4A3B B;  4GN4 B;  4NXM L;  2BA0 A;  1AFP A;  1FNV A;  5DAU A;  1BBU A;  4EGV A;  3J81 L;  1I6V C;  5C0X J;  2KJX A;  1X65 A;  3V05 A;  1BF4 A;  4CJ0 B;  1WJJ A;  3TS0 A;  1PTO F;  4RGO S;  3SVM A;  1JJ2 A;  1B8A A;  1GKH A;  3PUY A;  3HFZ B;  4NXM Q;  5JJL A;  4ULL A;  4OX9 L;  4KKS A;  5CBA E;  1H9K A;  2XSC A;  2E2H B;  1RF2 D;  4DR6 L;  1Q86 C;  3J80 i;  1U4R A;  2L4N A;  1WI5 A;  2KEN A;  4A3F B;  1KTK A;  2K28 A;  4KD4 A;  2E8G A;  3Q8D A;  1PMR A;  4ME5 A;  2G9D A;  2XRS D;  2M9V A;  1STB A;  4UHV A;  4OX9 Q;  3OOC A;  3CXC A;  2Z1C A;  2KEC A;  1LO5 D;  5LMU L;  3RZO B;  4DR6 Q;  3FP9 A;  3S15 B;  3NPP A;  3NE5 B;  1JT8 A;  3NQT A;  4WOR A;  2Z4I A;  1DCZ A;  2KQ3 A;  2B2W C;  1STN A;  1V9P A;  3H09 A;  4R9W A;  1YNX A;  4OIK A;  5FKA C;  5IP7 H;  3PIP A;  3BJU A;  2OT2 A;  1KQS A;  3HOU B;  1CZG A;  3M3Y B;  4DK3 C;  3I4N H;  2EQS A;  1WFQ A;  1PZI D;  1K3R A;  2LXK A;  3SK6 A;  3K0Y A;  5JEA H;  3HOU G;  5LMU Q;  4YIJ A;  4CKE A;  1G51 A;  1LLR D;  3CAM A;  3ULP A;  1WVL A;  3DHQ A;  1GJX A;  5EGT A;  4L8J A;  3L3O C;  4IOA A;  1SYF A;  3U9O A;  3S17 H;  3MFG A;  4O2D A;  1AH9 A;  3ITP A;  1BBX C;  4ID6 A;  4DV4 L;  5M9O A;  3D31 A;  3CP0 A;  3OMC A;  3TZD A;  1AEX A;  3TN2 A;  3VDY A;  1ZYR C;  4C3I H;  3W1G A;  4L5Q A;  3CCQ A;  2F3I A;  1K8M A;  3MAQ A;  4KJN A;  4HAE A;  5IOC A;  2JSO A;  5IT9 c;  4R8N A;  1CTM A;  4HN7 A;  3P1H A;  4ZQ3 A;  4QMG A;  1HQR D;  1PFM A;  3CCV A;  3OHX C;  4DK1 A;  4F87 A;  4FVM A;  5C4J B;  4DUZ L;  4DV4 Q;  1CSQ A;  3MA2 B;  1MI2 A;  4R8I A;  3GTG H;  2R7Z B;  1I4X A;  3D0F A;  5COY A;  1JWU D;  1ASY A;  3KLS X;  5L37 A;  2OWO A;  1KHI A;  3RZD B;  1ET9 A;  4H0L C;  5EKI A;  5JVH 3;  4ZYS A;  2I5L X;  3H15 A;  2H5X A;  2WB1 G;  4BBS B;  1SYG A;  5IYC H;  4LK1 C;  4QIW B;  3A5Z B;  4DUZ Q;  2CCZ A;  2O4X A;  2EYO A;  1MSG A;  5C5L A;  3TZU A;  1LM0 A;  2RSO A;  3PSI A;  4J6H A;  2M00 A;  4BBS G;  2RQX A;  4ME3 A;  5IT9 L;  1YNN C;  2E75 C;  4G4K A;  3P20 A;  3RN5 A;  1C4Q A;  4JBJ A;  1SFO H;  2D62 A;  1YI2 A;  2R93 G;  1WTO A;  1Y8O B;  2L0C A;  5C44 H;  1EZ6 A;  4BY7 B;  1UEB A;  1Y1W B;  2HHH L;  5DM7 3;  3H3V H;  4DR4 Q;  1NTG A;  3LNN A;  3G7L A;  1TT2 A;  2CFM A;  2YYZ A;  1M90 C;  5I6Y A;  4BY7 G;  1U0L A;  2KHI A;  4K14 A;  1Y1W G;  5K36 H;  2HDM A;  3I2Z A;  1XTC D;  1I50 B;  2A1A A;  3ZJY C;  4QIW E;  2L1B A;  4K5W A;  3HKS A;  2QIL A;  1EY5 A;  1SE2 A;  1ZYR D;  2QKI C;  4CKC A;  3F2D A;  1LTR D;  2BDO A;  2HHH Q;  2CQA A;  2JA5 B;  5COR A;  1G8Z D;  3D4R A;  3S2H B;  1WTW A;  1TWH B;  2L12 A;  2PMZ B;  3KYH C;  5ELD A;  5M5X B;  2JA5 G;  1QJO A;  1QE6 A;  1EQQ A;  1NNX A;  1KD1 C;  3A74 A;  4OWT B;  1A15 A;  2R93 H;  3KJP A;  4CJ1 B;  1D1I A;  4JOI A;  4PQX A;  4MTN A;  1AE2 A;  2VZA A;  2NVX B;  3VR4 A;  3BVZ A;  1GUN A;  4R4I A;  3K6O A;  3W5O A;  3CD6 A;  4MZ9 A;  3QJY A;  1VQO A;  4FF4 A;  5CYU A;  3BYT B;  5ELE A;  1YJ9 A;  1JB3 A;  3Q6S A;  3KOJ A;  1PRT F;  1MSH A;  5EPL A;  4DA2 A;  4POG A;  4RAU C;  3K57 A;  1YNN D;  1OXU A;  3BZK A;  1PTO H;  1QB5 D;  2FHT A;  2IT1 A;  1XJV A;  1S5D D;  4HMJ A;  3NEM A;  2GA4 B;  4NP5 A;  3S14 H;  4RFB A;  1SR3 A;  3GV3 A;  1UE6 A;  2K1B A;  2IX0 A;  1LTA D;  1A6X A;  5ELB A;  1TQO A;  5C0X G;  1NY4 A;  1I4H A;  2EY1 A;  2PPB C;  2F4I A;  2R7F A;  2K5H A;  3K5L A;  5DLQ E;  1S5F D;  1RTO A;  4P74 A;  4RKL A;  4YHH L;  2WP8 J;  1LT4 D;  2MGS A;  2MFI A;  4M1U B;  3V2T A;  4DV7 L;  1BXT A;  3VR5 A;  2N8N A;  4DPG A;  1Q1E A;  3J7A F;  1O80 A;  2SNS A;  4RA8 A;  1GUG A;  4DR1 L;  2RA4 A;  1CA5 A;  2F0U A;  2C9O A;  3KLR A;  1SNC A;  4EQO A;  1SE4 A;  2EYM A;  2TSS A;  3FPP A;  1SNP A;  4GNX C;  4A3E B;  1D1K A;  1A3T A;  5GRO A;  1KLU D;  2F0L A;  1U4P A;  2XTI A;  2A8V A;  3U4Z A;  4CDF C;  4DV7 Q;  2C5C A;  2JXM B;  5C0X H;  1CHQ D;  2EOT A;  1CZW A;  3KF6 B;  4DR1 Q;  3RR5 A;  5DEH A;  1Y1V H;  3NWS A;  4XQN A;  2OCE A;  5D3I B;  4H44 C;  3PO3 B;  1G29 1;  1AE3 A;  4YCU A;  2P5Z X;  3S2D B;  3D4D A;  4UAI A;  4UP7 A;  2LY7 A;  3SK5 A;  4A93 H;  2OXP A;  1Z9F A;  2XN9 C;  1FNW A;  4GOP C;  3PO3 G;  4X64 L;  2NYZ D;  3PUV A;  4RCO A;  1X3G A;  5M5W H;  4ALP A;  1DD2 A;  5CGK A;  2OTL A;  3CCM A;  2ZJR A;  4A3G B;  3HKZ E;  5FO8 B;  5KYI A;  3AQQ A;  1EQT A;  4A3K B;  4EQN A;  2JA8 B;  3S1R H;  2VB2 X;  4DR2 L;  4G7H C;  1I4Q A;  3PUX A;  3SK8 A;  4A3G G;  3OW7 A;  1HR0 L;  2NN6 H;  1HNW Q;  3KK7 A;  4A3K G;  2AUK A;  4IZ8 A;  3NQI A;  1JE4 A;  4DAP A;  1MD2 D;  3D8G A;  1EWI A;  2ES2 A;  4X64 Q;  3U50 C;  1B9N A;  3C1F A;  3RLF A;  4KN4 C;  4IUU A;  5EBC A;  1N34 L;  1IW7 C;  2EDG A;  2ZT9 C;  4JYA L;  3H6M A;  2VW9 A;  4DR2 Q;  1B44 D;  3T13 A;  2NUC A;  3KF8 B;  3TBI B;  1HR0 Q;  4NPS A;  3RLO A;  2F4V Q;  3JAM E;  1H9R A;  4L5R C;  4DV1 Q;  1A2T A;  2NVT H;  2DNC A;  3PV0 A;  1Q12 A;  5EKL A;  1TWG H;  1N34 Q;  1VCI A;  5JVG 3;  1JMC A;  1IHZ A;  1I6H B;  4JYA Q;  4K0K L;  1LTG D;  2KHS A;  1IBM L;  3FKI B;  1K0R A;  1HNX L;  2NZH A;  1V1O A;  5JPM C;  1RIP A;  2NVQ H;  3FKI G;  4B3M L;  4JVZ A;  1X56 A;  4FXG C;  1IYJ B;  1SJE D;  2AWO A;  5C4Z A;  3KBG A;  3Q24 A;  5BN5 A;  1Y69 U;  4HIK A;  4K0K Q;  4AIM A;  3IRB A;  2UUB L;  1PH2 A;  5K5P A;  1IBM Q;  1D8L A;  2NVY H;  1DOM A;  2Z0S A;  1ML0 D;  3PIP 3;  2ZM6 Q;  1HNX Q;  4GKK L;  1TXY A;  1H9M A;  3S1N H;  1SLJ A;  1ILP A;  1HHV A;  4ZUJ A;  2B2V A;  1VQ4 A;  4CJ2 C;  4DR5 L;  1HJP A;  5NUC A;  3TQY A;  3SK4 A;  2EYF A;  2BH2 A;  4OO1 G;  1LTL A;  1K8A C;  2UUB Q;  1IW7 D;  5JJK A;  3H94 A;  1IYU A;  4QJF A;  2K32 A;  3G71 A;  2KUM A;  3A8J E;  3FPU B;  3C2P A;  3K81 C;  5C4X H;  3T51 B;  2EY5 A;  1OXV A;  5JJI A;  1EYG A;  4X3K A;  1M4V A;  4DR5 Q;  1DJR D;  3C3L A;  2HIX A;  5GQO A;  1PH8 A;  5DM6 3;  4I7A A;  3ERO A;  4DGZ A;  1VQK A;  2Z6B A;  1N32 L;  2WFW A;  3FHW A;  2HQE A;  3HEJ A;  1TWF H;  3CMA A;  1A8V A;  3QWN A;  2K7V A;  4XIG S;  4UY8 C;  2VQF L;  3BU2 A;  4WJ4 A;  1XXG A;  4DXF A;  1MBY A;  1I3Q B;  3GTK H;  1GO3 E;  5ISR A;  2EE1 A;  3S16 B;  4OO1 H;  3I4M B;  1CA6 A;  3J81 E;  2EYJ A;  4J15 A;  1QNK A;  2H4O A;  1N32 Q;  3I4M G;  4KTA A;  2SDF A;  1BUV T;  4A3D G;  3A0J A;  2D2C C;  1NUC A;  3KDF B;  2VQF Q;  3M4Y A;  2RSN A;  1SSO A;  2F0E A;  4IUP A;  4IFD H;  3O13 A;  2K5W A;  4Z9C B;  5LL6 S;  2R7D A;  3D3R A;  4DXG A;  3PF4 A;  3HGB A;  4IQZ A;  3I90 A;  1X3Q A;  1HTP A;  1X3P A;  2B8F A;  3BDO A;  3MZ5 A;  3CCR A;  3HOW H;  3MWY W;  2F0O A;  2AWN A;  2X69 A;  3HOV H;  1A0I A;  4OXP A;  1NSN S;  1WTV A;  4Y52 H;  5T1G A;  3K5N A;  2UXC L;  2LMC B;  2F52 A;  4C3J B;  4QY7 A;  2A68 C;  1EYD A;  3BS1 A;  1R9T H;  3OWE B;  3DWA A;  3S24 A;  3W3A A;  3H0G B;  3FMC A;  3R93 A;  4C3J G;  5M3M G;  4XYO A;  2ZJQ A;  3BDL A;  2CH4 A;  4A3D H;  1IL2 A;  3KLS A;  1N8R C;  4JPB W;  4V0B A;  3CPW A;  3DM3 A;  1EQR A;  4IUT A;  4C3H H;  4C56 C;  3K7A B;  1TWC B;  5M3F G;  3J81 j;  4HJA A;  1VQ5 A;  3DEP A;  1UNS A;  4F88 A;  2UXB L;  1VS0 A;  3KF6 A;  1RHP A;  3WOF A;  4J8Q A;  3HRZ C;  4YWM A;  1BNZ A;  3CQZ H;  2BA1 A;  3JAM i;  2L15 A;  1LTT D;  4JCV E;  3MXU A;  3OIQ A;  3S1M B;  2V1C C;  1CHP D;  4IPG A;  1HCZ A;  3G48 A;  4MHE A;  1XYI A;  4JK1 C;  1PFS A;  5GAH C;  4HSV A;  2ZXP A;  3C1E A;  2RHS B;  1ONL A;  1PHJ A;  2JJQ A;  2UXB Q;  2I07 B;  1FL0 A;  5BN3 A;  1WTQ A;  4LF4 L;  5M3M H;  2CWA A;  3FVQ A;  4K6D A;  2MNA A;  1DON A;  2IW3 A;  4K8J A;  5M3F H;  3GO5 A;  4KHP L;  1MIU A;  2EXZ A;  2N55 A;  1S3O A;  3OMG A;  4LF4 Q;  3K80 C;  4YWL A;  1V43 A;  1GHJ A;  2A68 D;  3KF8 A;  2RDF A;  2D0O A;  3LWE A;  4F8M A;  1EY7 A;  2F0J A;  3E9H A;  1QOH A;  3NUC A;  1DXM A;  4BS9 A;  4KHP Q;  3M4Q A;  1B3A A;  4UP9 A;  1HZB A;  1HA5 A;  2IX1 A;  3MHB A;  5T1I A;  1EIH A;  2YU9 B;  1P8L A;  3J80 c;  1X32 A;  2LKV A;  1XMO L;  4JI6 Q;  4K6L A;  1ZKO A;  2EZV A;  3NWT A;  2K33 A;  4JG2 A;  4MIU A;  4OL7 A;  1PYW D;  2PO4 A;  3SEB A;  5IGB A;  4A3B G;  4X3U A;  1XWE A;  1TY0 A;  4JI0 L;  3M7G A;  5IOD A;  1VQ8 A;  2XNA C;  1MGS A;  2YTX A;  1WTX A;  3EIV A;  2B2T A;  1AZQ A;  1KDC A;  4CKB A;  2K5D A;  2CQO A;  2K14 A;  3TP5 A;  1VQJ A;  5AFW A;  3J80 L;  3E0J A;  5KNB A;  3GTJ H;  1BBW A;  1DOK A;  1O7L A;  3PIO 3;  1T5X D;  3WWV A;  3AEV A;  4OEL B;  5FO7 B;  4JBW A;  4DK0 A;  4JI0 Q;  1MJE A;  1QWY A;  4GLA C;  1TKW B;  1CKN B;  2O5J C;  1SNM A;  1RJT A;  1QCB D;  3M4P A;  3J7Y W;  2QDL A;  2ALY B;  1GXD C;  4A3F G;  3L0O A;  3DWP A;  4OIJ A;  3NEL A;  3G4S A;  4A3B H;  1KLG D;  4K2L A;  3BYY B;  3M4O B;  3MXN B;  1LAB A;  2PZW A;  2J7Z A;  3UE1 A;  4A76 A;  1KNE A;  1YHQ A;  2I5M X;  1WTH A;  3U4V A;  2EIF A;  1Q3L A;  3GP7 A;  2RF4 A;  5BR8 L;  2ZTD A;  3Q0A A;  1G6P A;  1GUS A;  1JE5 A;  2F0D A;  5IWA L;  3GTP B;  2F0P A;  2E2H H;  3DMU A;  1BQQ T;  4GNX B;  4BWG B;  3P75 A;  1NMG A;  4UDU C;  4DNT B;  3EJI A;  4A3F H;  4APV A;  3UI2 A;  2LSS A;  3KDF A;  4YCW A;  5EAY A;  4JC0 A;  5IY0 A;  5BR8 Q;  1NAP A;  2K05 A;  2NTS A;  3QOJ A;  1FJG L;  1XTD A;  5IWA Q;  4XDX A;  1V1Q A;  2HQL A;  1D5M C;  2I46 A;  3RZO H;  2CWP A;  1C8C A;  1SXT A;  4B3T L;  3S15 H;  1KNA A;  1ILQ A;  4CDC C;  1STH A;  2B2W A;  1EY0 A;  1VQI A;  4E6I A;  1VQM A;  1CSP A;  4GOP B;  2F0N A;  1WD0 A;  1D7Q A;  2K75 A;  1QVF A;  2E2J B;  3HOU H;  1C48 A;  2MQH A;  4J1M A;  1EIG A;  3M3Y H;  4A3M B;  5KNC A;  4NXN L;  4DU9 A;  1G2T A;  4PV1 C;  1ENC A;  4JI7 L;  3L2P A;  1FJG Q;  2YTY A;  1VQG A;  2D5D A;  2R7Z G;  4FDB A;  4B3T Q;  3J7A V;  3MFY A;  1H95 A;  1O7I A;  3SDZ A;  2RDH A;  4G7Z C;  4S3S A;  1EUJ A;  5IYD G;  4MTK A;  1KIX A;  1YEZ A;  2B2Y C;  2F03 A;  5G3L D;  4NXN Q;  4JI7 Q;  2WKD A;  1PH9 A;  1FNU A;  2EYP A;  4Y7N B;  4RCN A;  1K8G A;  1VQN A;  1L2F A;  1VQL A;  1IBL L;  3D6C A;  3UDI A;  4LF8 L;  1BCP C;  5C4J H;  4WFN 3;  2JA9 A;  1QUQ B;  3A7L A;  1EFW A;  3URY A;  1UE7 A;  2R7Z H;  4C2M B;  4XT1 B;  4QQB X;  2OQK A;  4BY1 B;  1HXY D;  3RZD H;  1HZA A;  2EY6 A;  4HJ8 A;  4ODG A;  3IKJ A;  3DXJ C;  5IYD H;  4BBS H;  4KK7 A;  1IBL Q;  2XRQ D;  4BY1 G;  3OPO A;  4LF8 Q;  1YIT A;  1N9W A;  3HOX B;  1H9J A;  2ZTC A;  1UUP A;  2VXW A;  1CQF A;  4A3I B;  3HOX G;  4P75 A;  1JCK B;  4DF7 A;  1GD7 A;  1STY A;  4FP5 D;  5LMN W;  4X6A H;  1Q81 C;  4U68 A;  5E7N A;  4F7X A;  3ICE A;  5CC4 A;  4BY7 H;  4A3I G;  1Y1W H;  2B2U C;  4G57 A;  1RKN A;  2ZXR A;  1IBK L;  1EY8 A;  2F0V A;  1K0S A;  4RH6 A;  3CW2 C;  5IGC A;  4A3C G;  2AQ1 B;  1ROD A;  3S1Q B;  4K8I A;  1I50 H;  4IPD A;  4YCV A;  3I56 A;  4FF3 A;  1GHK A;  4JBK A;  2ICE C;  3AB9 A;  2Q2U A;  3R8B A;  1ENA A;  2JA5 H;  5GAE C;  1SMX A;  1TU2 B;  4X3T A;  2OEO A;  1A3U A;  2VL6 A;  4BY1 H;  1K28 A;  3S2H H;  1N36 L;  2EYL A;  2MP1 A;  2PI2 E;  1TWH H;  1IBK Q;  4BA2 I;  2ZXO A;  5I6W A;  2QDB A;  2PYK A;  5M5X H;  1YJW A;  4HMI A;  1FGB D;  1SE8 A;  1CUK A;  1HUM A;  1BCP D;  4YY3 L;  1STE A;  3R3O A;  3A8I E;  2B29 A;  1YZ6 A;  4BA1 I;  2VY3 A;  4RWS C;  2NVX H;  2XWJ B;  1K8O A;  2F3W A;  3QG1 A;  3AMU A;  2RCF A;  1E22 A;  1L1O C;  4AQY L;  1E2Z A;  1KDB A;  1H9S B;  3A7A B;  2D9U A;  3IAY A;  5IGD A;  2Z6K C;  1PH5 A;  2EY2 A;  2PW5 A;  4QUF A;  2K03 A;  4YY3 Q;  3HKZ B;  4YHH Q;  1CKN A;  5EQ0 A;  4HJ5 A;  5C3X A;  2QF7 A;  4A3E G;  4KN7 C;  1JQY D;  1PXU A;  3HKZ G;  2LS0 1;  4AQY Q;  1B7Y B;  4BBR B;  4EQP A;  2KVM A;  1JOQ A;  4N8F A;  4RHR A;  2KA7 A;  2R92 B;  1MKH A;  1FYC A;  1PH7 A;  3MXN A;  4ABN A;  1PZK D;  2KCT A;  1TR5 A;  4BBR G;  3NXW A;  1EWC A;  4DV0 L;  4H7B A;  1X55 A;  3X3M A;  1QG7 A;  1RDP D;  2R92 G;  3D6W A;  1D5X C;  1NJI C;  4NB3 A;  5ELC A;  3I4L A;  5D14 A;  4TKO B;  3H3V C;  3PIO A;  5JOB A;  4DR7 L;  3MEF A;  2KBN A;  3I3C A;  3NEN A;  3ULL A;  4A4I A;  1YIJ A;  1G91 A;  1PH6 A;  4JBM A;  1DZ1 A;  4C1N I;  2L55 A;  2KCN A;  4XYQ A;  4GNX A;  2JA8 G;  5A2Q E;  2F3V A;  4A3E H;  4JW0 A;  5I2X A;  3K0X A;  1K3B C;  4IUN A;  4X66 L;  3CC7 A;  2WAQ B;  4ZRZ A;  1NE3 A;  2E5L L;  4GS3 A;  4QUC A;  5G3L F;  2B3G A;  1E1T A;  4DR7 Q;  3LWU A;  1YNJ C;  2JEB I;  1YVC A;  1PLF A;  2E76 C;  4FO2 A;  1VQH A;  4LW1 A;  1IXR A;  3E9I A;  3PO3 H;  5DNF A;  2BOS A;  1KAW A;  2O2L D;  4WRD A;  5IYB G;  1AN8 A;  5ELF A;  3S2D H;  4DNI A;  4X66 Q;  1HZC A;  2NBF A;  4GOP A;  4R4C A;  4LUO A;  2E5L Q;  1QZG A;  1L0W A;  4O42 A;  3K7U C;  3M9B A;  1VMP A;  4A3G H;  1LT3 D;  5C3E B;  5C3W A;  3R2T A;  2WAQ E;  2KCM A;  2WIN B;  3I91 A;  4A3K H;  3PQI A;  4HCE A;  1W6K A;  1XNQ L;  2JA8 H;  4A3L G;  1Y14 B;  1Q46 A;  5D3D A;  3T16 A;  5C3E G;  3GTO B;  4PNY A;  4X65 L;  5GAD C;  2B2V C;  3FEW X;  3F1Z A;  3NBI A;  5D65 A;  1LT5 D;  2K01 A;  1WCM B;  3HOZ B;  1PTO C;  3CU7 A;  1A63 A;  2L5T A;  4PZ7 A;  1I94 L;  2ATW A;  2KED A;  1WCM G;  3HOZ G;  5CBE E;  3M85 A;  2MUY A;  1E3P A;  1XNQ Q;  3TDQ A;  5IGE A;  2CKZ B;  5CV7 A;  3I55 A;  3SR1 A;  2CVR A;  4X65 Q;  1ICF B;  3T4A C;  1B3Q A;  4B3M Q;  2Q8I B;  2B63 B;  4L63 B;  3QIA A;  1UEA B;  1SN8 A;  1QUQ A;  2A74 C;  4JI4 L;  2SOB A;  3SXH A;  1STA A;  1I94 Q;  1F9R A;  4ZLT F;  1SNO A;  5ELO A;  1BOS A;  4KY5 A;  3CCJ A;  2B63 G;  3GTL B;  5JJZ A;  2UUA L;  1I6H H;  3DEO A;  4A3J B;  1YNJ D;  4GKK Q;  1B70 B;  1VF5 C;  4OWW B;  2F0G A;  3FKI H;  4NDX A;  2UU9 L;  2C35 B;  3STB C;  3NHH A;  1U5K A;  4LFC L;  4A3J G;  4QB4 A;  5JEA J;  4CDD C;  4DKA C;  4JI4 Q;  1BCP F;  5E1F A;  3EQL C;  1TWA B;  3Q23 A;  2UUA Q;  1CK1 A;  2F0I A;  1BO0 A;  5KEE A;  3EA6 A;  3PO2 B;  4OON A;  2Q2I A;  1XNR L;  2UU9 Q;  1LAC A;  4LFC Q;  3PO2 G;  1I4P A;  1JC7 A;  2BH8 A;  1VDZ A;  3IFD A;  1DYQ A;  4KHZ A;  3VYT A;  2EJM A;  3ND8 A;  1HRJ A;  1K83 B;  1OTC A;  5EPJ A;  3CPF A;  4JI2 L;  2B63 H;  1CM9 A;  3GTM B;  1HH2 P;  4QCL A;  2K6A A;  1PTO D;  2MJ8 A;  3U9S A;  5FLM G;  4FNF A;  4PMC A;  1D6E C;  1B9M A;  1VQE A;  4KMU C;  2Q8T A;  2G5D A;  3TRE A;  5I2Y A;  4A3J H;  2DN8 A;  1S5C D;  1NMF A;  3PUW A;  2F0S A;  3CCL A;  2KHJ A;  4WJW A;  3VYR A;  5FJ8 G;  4UP8 A;  5A2Q L;  2F0H A;  1CQV A;  3NK9 A;  1XX8 A;  2MHV A;  4JI2 Q;  4LFB L;  3J80 E;  2A6E C;  3RNU A;  5HUR A;  1X54 A;  1VF7 A;  3ER0 A;  3KBX A;  2R3Z A;  4TSS A;  1WD1 A;  2DNE A;  4RKB A;  2K52 A;  4LFA L;  2RKS A;  1H9S A;  3GDE A;  2GN5 A;  4CHT B;  3STB D;  3AFP A;  4N9T A;  1I3Q H;  1SYE A;  4XTC S;  2IWH A;  3WDN A;  2JA6 B;  1C9O A;  4I65 A;  4LFB Q;  2JQO A;  3S16 H;  5I9O A;  1J9O A;  1CKO A;  3I4M H;  3HS0 C;  3NTH A;  1DGS A;  5I9P A;  3MXP A;  3H0G G;  4O1N A;  2JA6 G;  2O5I C;  1NBW A;  3NTK A;  3I7F A;  2UXC Q;  2UUC L;  4LF7 L;  4LFA Q;  3VA7 A;  1EYC A;  3QO2 A;  2VNU D;  1EIF A;  1HFN A;  2HUG A;  3RD4 A;  1J5E L;  2VUM B;  3KUP A;  2ENB A;  1JJG A;  2DY8 A;  1JB7 A;  1VQB A;  1PH4 A;  4DAM A;  4R1J A;  1NR2 A;  4HED A;  4OWX B;  2VUM G;  1C7Y A;  1ET6 A;  1LUZ A;  5FLX c;  2UUC Q;  1YJN A;  4PG3 A;  1TVX A;  4LF7 Q;  3J7A 5;  4LF6 L;  2JA7 B;  5J39 A;  3OYY A;  4DR3 L;  2F0T A;  2F0K A;  3BZC A;  2KEE A;  4TRD A;  3E0E A;  4C3J H;  1J5E Q;  4IJH A;  4M8A A;  2JA7 G;  2E2I B;  2EPB A;  1G2S A;  3H0G H;  1V1P B;  2K5N A;  2AHO B;  4Q0F A;  2JN4 A;  5IGF A;  2A6E D;  1PA6 A;  5M5Y B;  4FF2 A;  2BE5 C;  1LTI D;  3E3X A;  3F2B A;  4LF6 Q;  3HG9 A;  4GLX A;  2J4X A;  3K7A H;  1AW7 A;  1TWC H;  1PVO A;  4B3S L;  4ZK9 B;  4HIO A;  1IL8 A;  1GUT A;  1YHB A;  3BVM A;  4CGY B;  1YBY A;  3AYH B;  1N33 L;  1D2B A;  5FLX L;  3L9A X;  3ERS X;  2F0W A;  4L6T B;  1SMY C;  4P73 A;  2L9H A;  2E74 C;  1PRT C;  4DFA A;  4MNO A;  1BKB A;  3T1Y L;  1PZJ D;  3S1M H;  1BCP B;  1IZ6 A;  4HJ7 A;  4R4T A;  1HA6 A;  4AH6 A;  4B3S Q;  2FMM A;  2FJ2 A;  2PW7 A;  1QNU A;  1S5E D;  4DAY B;  2L11 A;  5TSS A;  1HZ9 A;  2WAC A;  3WOE A;  2RCN A;  5JPN C;  4YWK A;  3MVV A;  2X6G A;  4X3S A;  5C6A A;  3T1Y Q;  2OTJ A;  2CH4 W;  1IKL A;  5ELN A;  4AYB E;  2SNM A;  5AJ3 L;  4DV3 L;  1LV9 A;  1B1Z A;  2X6L A;  4TQU S;  1E7Z A;  5C5M A;  1Q82 C;  5EBD A;  4N8X 1;  4CDE C;  3Q22 A;  1PV4 A;  1Q8K A;  2F0F A;  3MTS A;  1XMO Q;  1Q1B A;  1JWM D;  5HGQ A;  1EU3 A;  4FYD A;  4ZKB B;  1E0B A;  1XPU A;  3J81 i;  5AJ3 Q;  4DV3 Q;  2BE5 D;  1U4L A;  3UDX A;  3I4N B;  1UWV A;  2JK8 A;  1XPR A;  5J3B A;  5IP7 G;  2YU9 H;  5E4X A;  3I4N G;  2Y0S E;  1EZ8 A;  3QR8 A;  5EJW A; 
#chains in the Genus database with same CATH homology
 1B50 A;  5JEA G;  1SMY D;  3S17 B;  2IJ0 A;  1PRT D;  4FXD A;  1EYA A;  3A54 A;  1F2L A;  1M8A A;  4ZUI A;  5J1Z A;  4I7Z C;  2QCP X;  3A56 A;  4C3I B;  4RGN A;  5A35 A;  4ILW A;  3K5M A;  2Z4H A;  1ENF A;  4KJO A;  2WKC A;  3K58 A;  5CV4 A;  4C3I G;  5EKK A;  3NSW A;  5CMD A;  3V96 A;  5KYL A;  4OHJ A;  4C1N K;  4K5V A;  3ND9 A;  2NWG A;  3GTG B;  1F77 A;  1II3 A;  1TS3 A;  3TSS A;  3G6J B;  1SYC A;  3P7J A;  1SNQ A;  2KOL A;  4G7O C;  2ID0 A;  1B2T A;  1E2V A;  5FO9 B;  2ICI A;  3SHL A;  1B53 A;  3ZYY X;  1SFO B;  2B39 A;  2RBM A;  3R2I A;  4XQQ A;  1AP0 A;  3N6R A;  5C44 B;  1PFN A;  3MEH A;  5JAV A;  4LAA A;  5CV8 A;  1RD9 D;  2XWB B;  1HTL D;  1FD7 D;  3M7N A;  2G9H D;  4IUR A;  4HCS A;  1O7Y A;  5IGG A;  2Z8L A;  1SE3 A;  4XXE A;  2NZ1 D;  1IYV A;  1RCV D;  1SBB B;  5K36 G;  1IKM A;  3C46 A;  5KRU A;  2WB1 B;  3CRK C;  2NB0 A;  2F0Q A;  1F2Z A;  3BVG A;  1ZXT A;  1EFI D;  2EJF C;  3SE0 A;  2F1M A;  2IX3 A;  2EJG C;  2R93 B;  1TS2 A;  4DAV A;  1JOR A;  1EU4 A;  5CV6 A;  1TII D;  4HSP A;  4IAL A;  2PNR C;  1QIL A;  3CRL C;  2B8G A;  1EY4 A;  1RTN A;  2FMC A;  3VR3 A;  2DY7 A;  1V1P A;  1A2U A;  3HP3 A;  1F2Y A;  4XQJ A;  2BCO A;  5LL6 X;  2B2Y A;  1PTO B;  4NKL A;  4XT3 B;  2A73 B;  1KAB A;  3S14 B;  2SEB D;  1F9S A;  2QEJ C;  1CI3 M;  2VB3 X;  3D4W A;  5FK9 C;  1SEB D;  4IFD J;  1L0Y B;  2V4D A;  1F2M A;  1CFM A;  1OXX K;  2CHB D;  1EY9 A;  4DNR B;  1DOL A;  2HCI A;  1U9R A;  3FDT A;  2XIW A;  1TY2 A;  1R4P B;  3DM1 A;  4DAY A;  5KGU A;  1EQV A;  1UAP A;  4HR7 B;  3TP6 A;  2HCC A;  3ONA B;  2KCC A;  1KDA A;  4KKU A;  1ESR A;  1OO9 B;  4ZAI A;  3W2D A;  1Y1V B;  1Q90 A;  2B2U A;  3MXG A;  1DM0 B;  4B9X A;  1JOK A;  5KND A;  2R61 A;  4A93 B;  3PMF A;  1VMC A;  5I4D A;  5M5W B;  3LX0 A;  3MC0 B;  1J8I A;  1EOT A;  4KHV A;  1I4R A;  3AU7 A;  4KKT A;  1SND A;  3I70 A;  3S1R B;  1EEF D;  4K5X A;  2XVS A;  2FIN B;  2NN6 G;  5C0X I;  1S5B D;  4B9W A;  3TME A;  2MPM A;  4RGT A;  1HUN A;  2K5Q A;  4KD3 A;  3QB3 A;  1U4M A;  3I73 A;  1E2W A;  1JR0 D;  3N52 A;  4U67 3;  2NVT B;  5CV5 A;  1G6Z A;  3VYS A;  1TWG B;  1F9P A;  1L0X B;  2JYO A;  4QF4 A;  3X3N A;  1SAP A;  3H91 A;  3A55 A;  1F9Q A;  5F2D A;  4KY6 A;  4KI0 A;  1LTS D;  2NN6 I;  4LJZ C;  1T5E A;  5IIF A;  1OXT A;  3GQB A;  3BDC A;  4RHS A;  2NVQ B;  3PUZ A;  3K59 A;  3TP8 A;  4KY7 A;  1Z6H A;  5EPK A;  3ERQ A;  1GUO A;  5HGT A;  1WTP A;  4LMQ D;  1TS5 A;  4PMB A;  1D5Z C;  2NVY B;  1V8Q A;  3IL8 A;  4N9P A;  2WII B;  3RMH A;  3OSO A;  3S1N B;  3S9W A;  1W6J A;  3NTI A;  3T56 B;  1Z47 A;  4V19 0;  1KAA A;  5C4H A;  2E2D C;  3BG3 A;  1JIC A;  5E4W C;  5C4X B;  3CHB D;  1Y8N B;  2PQE A;  3I72 A;  1BDO A;  1O7Z A;  2OF1 A;  3EVQ A;  1PRT B;  2EYH A;  2PZU A;  1HFG A;  1TWF B;  2HDL A;  1GOZ A;  1Q8I A;  3BZD B;  3VYU A;  3GTK B;  3K5O A;  4FXK C;  4B08 A;  5FLX E;  1O78 A;  4KV6 A;  1B4O A;  2A69 C;  2FFK B;  1EEI D;  4K2K A;  1NCV A;  3OIP A;  3A8K E;  1ZEQ X;  2IPK D;  4EVO A;  1JOO A;  2AQ2 B;  4IFD G;  4NMZ A;  3HOW B;  4HTH A;  3HOV B;  1Z7T A;  2F0M A;  3T53 B;  1GUW A;  3EFX D;  3DWQ A;  1R9T B;  2CW0 C;  4OO1 I;  2AQ3 B;  2PZT A;  2A6H C;  4A3D B;  2NTT A;  4H13 C;  2EVB A;  1ICW A;  3VA5 A;  4C3H B;  4IFD I;  1PFB A;  1I4G A;  2JE6 I;  3I8Z A;  1CT1 D;  1BR9 A;  4C3H G;  1A3V A;  3CQZ B;  3OWF A;  5KIX A;  4IUV A;  2A69 D;  2TMP A;  3F2U A;  4GZY C;  2RDG A;  2BDN A;  1STG A;  3NBH A;  1LT6 D;  5M3M B;  1JWS D;  3JAM L;  2M2L A;  1EL0 A;  3DUZ A;  2IL8 A;  5M3F B;  1ESF A;  2JEA I;  1TS4 A;  4FF1 A;  4CBV A;  3NP8 A;  2H1E A;  1NR4 A;  3HOY B;  2CW0 D;  1R4Q B;  3VR6 A;  1SYD A;  2A6H D;  2AUJ D;  3L7Z C;  4P2C B;  1PDQ A;  3GTQ B;  3HZX A;  1SYB A;  5CV9 A;  1SDF A;  3RUZ A;  4DN4 M;  3E6Z X;  1SJH D;  3GD7 A;  4ZKC B;  2R6G A;  4NW2 A;  1WTR A;  2JP1 A;  3FRP B;  3CKI B;  4AYB B;  5FOB B;  2N88 A;  2LFN A;  3TP7 A;  1EY6 A;  1AZP A;  3E5S A;  2RVL A;  5LHY 1;  2B2T C;  4MN3 A;  5J22 A;  1HPC A;  5BN4 A;  2K04 A;  3VR2 A;  3GTJ B;  2PCF B;  1FR3 A;  2Q8R E;  4IUQ A;  4IN3 A;  1OXS C;  1Y8P B;  2A5H A;  1HQM C;  4OGQ C;  4PMW A;  2Y0S B;  4Q5V A;  1LTB D;  5CR3 A;  2J0T D;  2WV6 D;  5IT9 E;  1EWH A;  3IFT A;  5E3F A;  3QOL A;  4RGM A;  1S4Z A;  4A3B B;  2BA0 A;  1AFP A;  1FNV A;  5DAU A;  4EGV A;  3J81 L;  1I6V C;  5C0X J;  2KJX A;  3V05 A;  1BF4 A;  4CJ0 B;  1PTO F;  4RGO S;  3SVM A;  3PUY A;  4ULL A;  4KKS A;  5CBA E;  1H9K A;  2XSC A;  2E2H B;  1RF2 D;  1U4R A;  2L4N A;  4A3F B;  1KTK A;  2K28 A;  4KD4 A;  1PMR A;  4ME5 A;  2G9D A;  2XRS D;  2M9V A;  1STB A;  3OOC A;  2Z1C A;  2KEC A;  1LO5 D;  3RZO B;  3S15 B;  3NPP A;  3NE5 B;  3NQT A;  4WOR A;  2Z4I A;  1DCZ A;  2KQ3 A;  2B2W C;  1STN A;  3H09 A;  4R9W A;  4OIK A;  5FKA C;  3HOU B;  2OT2 A;  1CZG A;  3M3Y B;  1PZI D;  3SK6 A;  3K0Y A;  5JEA H;  4YIJ A;  4CKE A;  1LLR D;  1WVL A;  3DHQ A;  1GJX A;  5EGT A;  4L8J A;  3L3O C;  1SYF A;  3U9O A;  3MFG A;  3ITP A;  1BBX C;  4ID6 A;  5M9O A;  3D31 A;  3OMC A;  3TZD A;  1AEX A;  3TN2 A;  1ZYR C;  1K8M A;  3MAQ A;  4KJN A;  4HAE A;  5IOC A;  2JSO A;  4R8N A;  1CTM A;  4HN7 A;  3P1H A;  4ZQ3 A;  4QMG A;  1HQR D;  1PFM A;  3OHX C;  4DK1 A;  4F87 A;  4FVM A;  5C4J B;  3MA2 B;  1MI2 A;  4R8I A;  2R7Z B;  1I4X A;  5COY A;  1JWU D;  3KLS X;  3RZD B;  1ET9 A;  4H0L C;  5EKI A;  5JVH 3;  4ZYS A;  4BBS B;  1SYG A;  4LK1 C;  4QIW B;  2O4X A;  2EYO A;  1MSG A;  5C5L A;  3TZU A;  2RSO A;  4J6H A;  2M00 A;  2RQX A;  5IT9 L;  1YNN C;  2E75 C;  4G4K A;  3P20 A;  1C4Q A;  2D62 A;  1WTO A;  1Y8O B;  2L0C A;  1EZ6 A;  4BY7 B;  1Y1W B;  5DM7 3;  3LNN A;  3G7L A;  1TT2 A;  2YYZ A;  5I6Y A;  4K14 A;  5K36 H;  2HDM A;  1XTC D;  1I50 B;  2L1B A;  4K5W A;  2QIL A;  1EY5 A;  1SE2 A;  1ZYR D;  2QKI C;  4CKC A;  1LTR D;  2BDO A;  2CQA A;  2JA5 B;  5COR A;  1G8Z D;  3D4R A;  3S2H B;  1WTW A;  1TWH B;  2L12 A;  2PMZ B;  5ELD A;  5M5X B;  1QJO A;  1QE6 A;  1A15 A;  4CJ1 B;  1D1I A;  4PQX A;  2NVX B;  3VR4 A;  3BVZ A;  1GUN A;  3K6O A;  3QJY A;  4FF4 A;  5CYU A;  3BYT B;  5ELE A;  1JB3 A;  3Q6S A;  1PRT F;  1MSH A;  5EPL A;  4DA2 A;  4RAU C;  3K57 A;  1YNN D;  1OXU A;  1PTO H;  1QB5 D;  2FHT A;  2IT1 A;  1S5D D;  4HMJ A;  2GA4 B;  4NP5 A;  4RFB A;  3GV3 A;  2K1B A;  2IX0 A;  1LTA D;  1A6X A;  5ELB A;  1TQO A;  5C0X G;  1I4H A;  2EY1 A;  2PPB C;  2F4I A;  3K5L A;  1S5F D;  1RTO A;  4RKL A;  2WP8 J;  1LT4 D;  2MGS A;  4M1U B;  3V2T A;  1BXT A;  3VR5 A;  1Q1E A;  3J7A F;  1O80 A;  2SNS A;  4RA8 A;  1GUG A;  2RA4 A;  1CA5 A;  2F0U A;  2C9O A;  3KLR A;  1SNC A;  4EQO A;  1SE4 A;  2EYM A;  2TSS A;  3FPP A;  1SNP A;  4A3E B;  1D1K A;  1A3T A;  1KLU D;  2F0L A;  1U4P A;  2C5C A;  2JXM B;  5C0X H;  1CHQ D;  2EOT A;  1CZW A;  5DEH A;  3NWS A;  4XQN A;  5D3I B;  4H44 C;  3PO3 B;  1G29 1;  3S2D B;  3D4D A;  4UAI A;  2LY7 A;  3SK5 A;  2OXP A;  2XN9 C;  1FNW A;  2NYZ D;  3PUV A;  4RCO A;  1DD2 A;  5CGK A;  4A3G B;  5FO8 B;  5KYI A;  4A3K B;  1EQT A;  4EQN A;  2JA8 B;  2VB2 X;  4G7H C;  1I4Q A;  3PUX A;  3SK8 A;  3OW7 A;  2NN6 H;  3KK7 A;  2AUK A;  4IZ8 A;  3NQI A;  1JE4 A;  4DAP A;  1MD2 D;  3D8G A;  1B9N A;  3C1F A;  3RLF A;  4KN4 C;  4IUU A;  5EBC A;  1IW7 C;  2EDG A;  2ZT9 C;  3H6M A;  1B44 D;  3T13 A;  2NUC A;  3TBI B;  3JAM E;  1H9R A;  1A2T A;  2DNC A;  3PV0 A;  1Q12 A;  5EKL A;  1VCI A;  5JVG 3;  1IHZ A;  1I6H B;  1LTG D;  2KHS A;  3FKI B;  1V1O A;  5JPM C;  4FXG C;  1SJE D;  2AWO A;  5C4Z A;  3KBG A;  3Q24 A;  5BN5 A;  1Y69 U;  5K5P A;  1DOM A;  1ML0 D;  3PIP 3;  1H9M A;  1ILP A;  1HHV A;  4ZUJ A;  2B2V A;  4CJ2 C;  5NUC A;  3SK4 A;  2EYF A;  4OO1 G;  1IW7 D;  3H94 A;  1IYU A;  2K32 A;  2KUM A;  3A8J E;  3FPU B;  3C2P A;  3T51 B;  2EY5 A;  1OXV A;  4X3K A;  1M4V A;  1DJR D;  3C3L A;  5DM6 3;  3ERO A;  4DGZ A;  2HQE A;  3HEJ A;  3QWN A;  2K7V A;  4XIG S;  1XXG A;  4DXF A;  1MBY A;  1I3Q B;  5ISR A;  2EE1 A;  3S16 B;  4OO1 H;  3I4M B;  1CA6 A;  3J81 E;  2EYJ A;  1QNK A;  2H4O A;  4KTA A;  2SDF A;  1BUV T;  2D2C C;  1NUC A;  3M4Y A;  2RSN A;  1SSO A;  2F0E A;  4IUP A;  4IFD H;  3O13 A;  2K5W A;  4Z9C B;  5LL6 S;  3D3R A;  4DXG A;  3HGB A;  4IQZ A;  3I90 A;  1X3Q A;  1HTP A;  1X3P A;  2B8F A;  3BDO A;  3MZ5 A;  3MWY W;  2F0O A;  2AWN A;  2X69 A;  1NSN S;  1WTV A;  5T1G A;  3K5N A;  2LMC B;  4C3J B;  2A68 C;  1EYD A;  3BS1 A;  3OWE B;  3DWA A;  3W3A A;  3H0G B;  3FMC A;  3R93 A;  4C3J G;  4XYO A;  3BDL A;  3KLS A;  4V0B A;  4IUT A;  4C56 C;  3K7A B;  1TWC B;  3DEP A;  1UNS A;  4F88 A;  1RHP A;  3WOF A;  4J8Q A;  3HRZ C;  1BNZ A;  2BA1 A;  1LTT D;  3MXU A;  3OIQ A;  3S1M B;  1CHP D;  1HCZ A;  4MHE A;  1XYI A;  4JK1 C;  4HSV A;  2ZXP A;  3C1E A;  1ONL A;  2I07 B;  5BN3 A;  1WTQ A;  3FVQ A;  4K6D A;  1DON A;  2IW3 A;  4K8J A;  3GO5 A;  2EXZ A;  2N55 A;  3OMG A;  1V43 A;  1GHJ A;  2A68 D;  3KF8 A;  2RDF A;  3LWE A;  4F8M A;  1EY7 A;  2F0J A;  1QOH A;  3NUC A;  1DXM A;  4BS9 A;  1B3A A;  1HA5 A;  2IX1 A;  3MHB A;  5T1I A;  1EIH A;  2YU9 B;  1X32 A;  2LKV A;  4K6L A;  1ZKO A;  2EZV A;  3NWT A;  2K33 A;  4MIU A;  4OL7 A;  1PYW D;  2PO4 A;  3SEB A;  5IGB A;  4X3U A;  1XWE A;  1TY0 A;  3M7G A;  5IOD A;  2XNA C;  1MGS A;  1WTX A;  2B2T A;  1AZQ A;  1KDC A;  4CKB A;  2K5D A;  3TP5 A;  5AFW A;  3J80 L;  3E0J A;  5KNB A;  1DOK A;  1O7L A;  3PIO 3;  1T5X D;  5FO7 B;  4JBW A;  4DK0 A;  1QWY A;  1TKW B;  2O5J C;  1SNM A;  1RJT A;  1QCB D;  3J7Y W;  1GXD C;  3DWP A;  4OIJ A;  1KLG D;  4K2L A;  3BYY B;  3M4O B;  1LAB A;  2PZW A;  2J7Z A;  1KNE A;  1Q3L A;  3GP7 A;  3Q0A A;  1GUS A;  2F0D A;  3GTP B;  2F0P A;  3DMU A;  1BQQ T;  4BWG B;  3P75 A;  4UDU C;  4DNT B;  3EJI A;  3UI2 A;  1NAP A;  2K05 A;  2NTS A;  3QOJ A;  4XDX A;  1D5M C;  2I46 A;  1C8C A;  1SXT A;  1KNA A;  1ILQ A;  1STH A;  2B2W A;  1EY0 A;  4E6I A;  1WD0 A;  2F0N A;  2E2J B;  1C48 A;  4J1M A;  1EIG A;  4A3M B;  5KNC A;  4DU9 A;  1G2T A;  4PV1 C;  1ENC A;  2D5D A;  3J7A V;  3MFY A;  3SDZ A;  2RDH A;  4G7Z C;  4S3S A;  2B2Y C;  2F03 A;  5G3L D;  2WKD A;  1FNU A;  2EYP A;  4Y7N B;  4RCN A;  3D6C A;  1BCP C;  4WFN 3;  3A7L A;  3URY A;  4C2M B;  4XT1 B;  4BY1 B;  1HXY D;  2EY6 A;  4ODG A;  3IKJ A;  3DXJ C;  4KK7 A;  2XRQ D;  3OPO A;  3HOX B;  1H9J A;  1UUP A;  2VXW A;  1CQF A;  4A3I B;  1JCK B;  4DF7 A;  1STY A;  4FP5 D;  4U68 A;  4F7X A;  5CC4 A;  2B2U C;  4G57 A;  1RKN A;  2ZXR A;  1EY8 A;  2F0V A;  4RH6 A;  5IGC A;  2AQ1 B;  1ROD A;  3S1Q B;  4K8I A;  4FF3 A;  1GHK A;  2ICE C;  3AB9 A;  3R8B A;  1ENA A;  1TU2 B;  4X3T A;  2OEO A;  1A3U A;  2EYL A;  2MP1 A;  4BA2 I;  2ZXO A;  5I6W A;  2QDB A;  2PYK A;  4HMI A;  1FGB D;  1HUM A;  1BCP D;  1STE A;  3R3O A;  3A8I E;  4BA1 I;  4RWS C;  2XWJ B;  1K8O A;  2F3W A;  3QG1 A;  3AMU A;  1E2Z A;  1KDB A;  1H9S B;  3A7A B;  2D9U A;  3IAY A;  5IGD A;  2EY2 A;  2PW5 A;  4QUF A;  2K03 A;  3HKZ B;  5EQ0 A;  5C3X A;  2QF7 A;  4KN7 C;  1JQY D;  1PXU A;  2LS0 1;  4BBR B;  4EQP A;  2KVM A;  1JOQ A;  4RHR A;  2KA7 A;  2R92 B;  1FYC A;  3MXN A;  4ABN A;  1PZK D;  1TR5 A;  3NXW A;  1EWC A;  4H7B A;  3X3M A;  1QG7 A;  1RDP D;  3D6W A;  1D5X C;  5ELC A;  3I4L A;  5D14 A;  4TKO B;  3H3V C;  5JOB A;  3I3C A;  1G91 A;  1DZ1 A;  4C1N I;  2L55 A;  2KCN A;  4XYQ A;  5A2Q E;  2F3V A;  5I2X A;  4IUN A;  2WAQ B;  4ZRZ A;  5G3L F;  4QUC A;  3LWU A;  1YNJ C;  2JEB I;  1PLF A;  2E76 C;  4FO2 A;  5DNF A;  2BOS A;  2O2L D;  4WRD A;  1AN8 A;  5ELF A;  2NBF A;  4O42 A;  1VMP A;  1LT3 D;  5C3E B;  5C3W A;  3R2T A;  2WIN B;  3I91 A;  4HCE A;  1W6K A;  5D3D A;  3T16 A;  3GTO B;  4PNY A;  2B2V C;  3FEW X;  3NBI A;  5D65 A;  1LT5 D;  2K01 A;  1WCM B;  3HOZ B;  1PTO C;  3CU7 A;  2L5T A;  2KED A;  5CBE E;  3M85 A;  2MUY A;  3TDQ A;  5IGE A;  5CV7 A;  3SR1 A;  2CVR A;  3T4A C;  2Q8I B;  2B63 B;  4L63 B;  3QIA A;  1UEA B;  2A74 C;  2SOB A;  3SXH A;  1STA A;  1F9R A;  4ZLT F;  1SNO A;  1BOS A;  4KY5 A;  3GTL B;  5JJZ A;  3DEO A;  4A3J B;  1YNJ D;  1VF5 C;  2F0G A;  4NDX A;  3NHH A;  4QB4 A;  5JEA J;  1BCP F;  5E1F A;  3EQL C;  1TWA B;  3Q23 A;  1CK1 A;  2F0I A;  1BO0 A;  5KEE A;  3EA6 A;  3PO2 B;  1LAC A;  1I4P A;  1JC7 A;  4KHZ A;  1VDZ A;  3IFD A;  1DYQ A;  3VYT A;  2EJM A;  3ND8 A;  1HRJ A;  1K83 B;  5EPJ A;  1CM9 A;  3GTM B;  4QCL A;  2K6A A;  1PTO D;  2MJ8 A;  3U9S A;  4FNF A;  4PMC A;  1D6E C;  1B9M A;  4KMU C;  2Q8T A;  5I2Y A;  2DN8 A;  1S5C D;  3PUW A;  2F0S A;  4WJW A;  3VYR A;  5A2Q L;  2F0H A;  1CQV A;  3NK9 A;  1XX8 A;  2MHV A;  3J80 E;  2A6E C;  5HUR A;  1VF7 A;  3KBX A;  2R3Z A;  4TSS A;  1WD1 A;  2DNE A;  4RKB A;  2RKS A;  1H9S A;  4CHT B;  4N9T A;  1SYE A;  4XTC S;  2IWH A;  3WDN A;  2JA6 B;  4I65 A;  5I9O A;  1J9O A;  3HS0 C;  3NTH A;  5I9P A;  3MXP A;  4O1N A;  2O5I C;  3NTK A;  3VA7 A;  1EYC A;  3QO2 A;  2VNU D;  1HFN A;  2HUG A;  3RD4 A;  2VUM B;  3KUP A;  2ENB A;  2DY8 A;  1NR2 A;  4HED A;  1ET6 A;  1TVX A;  2JA7 B;  5J39 A;  2F0T A;  2F0K A;  2KEE A;  4TRD A;  4M8A A;  2E2I B;  2EPB A;  1G2S A;  1V1P B;  4Q0F A;  5IGF A;  2A6E D;  5M5Y B;  4FF2 A;  2BE5 C;  1LTI D;  3HG9 A;  2J4X A;  1AW7 A;  4ZK9 B;  1IL8 A;  1GUT A;  3BVM A;  4CGY B;  1D2B A;  5FLX L;  3L9A X;  2F0W A;  4L6T B;  1SMY C;  2L9H A;  2E74 C;  1PRT C;  4DFA A;  1PZJ D;  1BCP B;  1HA6 A;  2FMM A;  2FJ2 A;  2PW7 A;  1QNU A;  1S5E D;  2L11 A;  5TSS A;  2WAC A;  3WOE A;  5JPN C;  3MVV A;  2X6G A;  4X3S A;  5C6A A;  1IKL A;  2SNM A;  1LV9 A;  1B1Z A;  2X6L A;  4TQU S;  5C5M A;  5EBD A;  3Q22 A;  2F0F A;  3MTS A;  1Q1B A;  1JWM D;  1EU3 A;  4FYD A;  4ZKB B;  1E0B A;  2BE5 D;  1U4L A;  3I4N B;  5E4X A;  1EZ8 A;  3GV6 A;  5EJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...