1PZID

Heat-labile enterotoxin b-pentamer complexed with nitrophenyl galactoside 2a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3,5-Substituted phenyl galactosides as leads in designing effective cholera toxin antagonists; synthesis and crystallographic studies
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin inhibitor
molecule keywords Heat-labile Enterotoxin B subunit
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pziD00
1LTTD 2CHBD 1SE2A 3BYTB 1S5DD 3DWAA 1KTKA 1BCPD 1LT3D 1SE4A 4UDUC 3MFGA 1SJHD 1BCPF 3SEBA 1PTOD 5TSSA 1SEBD 5FK9C 1EU3A 1LTGD 2XRSD 1PZJD 1FNVA 1S5FD 2AQ1B 1FNUA 3URYA 4K6LA 4DXGA 4ZYSA 5D3IB 2SEBD 1RDPD 3BVMA 4RGMA 3GP7A 1PTOH 5D3DA 1LO5D 1JQYD 2ICIA 3EA6A 1V1PA 1D5ZC 3CHBD 3R2IA 1PTOB 1KLUD 1EU4A 1PTOC 1TY0A 1PZKD 1LTSD 4RGTA 1TS2A 1XXGA 1CHQD 3O13A 4RH6A 2R61A 1I4GA 1PRTC 2AQ2B 1B1ZA 1EEFD 2QEJC 1ET6A 3W2DA 2NTSA 1I4PA 3KLSX 1BCPC 1AW7A 1G8ZD 1HA5A 1S5BD 4L63B 1TS3A 4RHRA 1JWUD 1I4QA 3R8BA 3MC0B 1MD2D 1LT6D 1S5ED 5ELBA 1I4HA 2G9HD 2RDHA 1JWMD 1STEA 4L6TB 1TS5A 1CHPD 4RFBA 2IPKD 1LT4D 4RCOA 3DWQA 4TSSA 4Z9CB 1F77A 1LTBD 5ELFA 1LTRD 2IJ0A 1RD9D 1PTOF 2J4XA 4DXFA 1B44D 1BCPB 1CT1D 1LTID 4O1NA 1FGBD 1PRTF 1PRTB 1TY2A 3EFXD 1KLGD 2QILA 2Z8LA 3BVGA 1UUPA 2NTTA 5ELEA 1S5CD 2XN9C 1L0XB 1LLRD 1HXYD 1AN8A 1DJRD 1D6EC 1I4XA 1L0YB 1V1OA 1EWCA 1GOZA 1SE3A 4RGOS 2WV6D 1DYQA 2XNAC 1T5XD 1JCKB 5ELDA 1TS4A 1EFID 3DWPA 1RF2D 1JR0D 2XRQD 1BXTA 4OHJA 1RCVD 3TSSA 4C56C 3OWEB 1QILA 1FD7D 1PRTD 1D5MC 1ET9A 1UNSA 3BYYB 1FNWA 2TSSA 3V05A 1ESFA 4RGNA 1SXTA 5ELCA 1M4VA 4BWGB 1I4RA 4RHSA 1CQVA 1LTAD 1ENFA 1D5XC 1EEID 1XTCD 3BVZA 1V1PB 3BZDB 1HQRD 2O2LD 2RDGA 2AQ3B 5I4DA 5FKAC 1SJED 1CK1A 1SBBB 3R2TA 1HTLD 1PZID 1LT5D 1PYWD 1JWSD
chains in the Genus database with same CATH superfamily
1KDAA 3F8TA 2A74C 3QR8A 1Y1WB 3KF8A 3VYTA 1BCPD 4JYAL 5AJ3Q 4Y52H 5C44H 2P5ZX 4OIJA 4LF8Q 2N49A 1B50A 4DV1Q 1MBYA 2DJFC 3RUZA 4LFCQ 2RSNA 5JJIA 5D3IB 4ZKCB 3BVMA 1XNQL 2AWNA 3PSIA 2F4VL 1B3AA 2IX1A 1JQYD 1PH4A 5EKIA 3S1NB 4C3JB 3S9WA 3I55A 3KDFA 3KF6A 3SK8A 4DPGA 5CV7A 1I4GA 4C3JH 1EEFD 4AQYQ 1MJCA 4L63B 1QNUA 2VXWA 4OO1H 4NXNL 2RSOA 3KLWA 5FO9B 1X54A 4J15A 2KUMA 4JW0A 3S24A 2CQAA 3K7AH 4LF7L 1FR3A 1WCMB 3T1HQ 2Y0SB 1I6VC 4IUTA 2Z6BA 2EY6A 1Q8IA 2J4XA 3K58A 1BCPB 5KYIA 3TP7A 2VNUD 4RA8A 4DF7A 4JI2L 1V1QA 2UUAL 1GOZA 4K5XA 1JCKB 4OONA 2JE6I 4PV1C 5C4ZA 2F0GA 2PMZB 2OQ0A 1CI3M 3TSSA 4CDEC 1KRSA 3GQBA 4JBJA 1SAPA 3IRBA 5IT9L 2ZTDA 1TWAB 1Y8OB 2TSSA 2F0EA 3HFZB 3ND9A 1YBYA 4PQXA 2UUBQ 4JK1C 3ZYYX 5M3MG 3A5UA 4OL7A 2WB1B 5C4XH 3BVZA 3VYSA 1ML0D 1Z9FA 3HOYB 1QE6A 2KHIA 1AE3A 4DR3Q 2AQ3B 1SSOA 4KD3A 4UPAA 3CQZH 3K7UC 1EQTA 2Y0SE 4P71A 1V43A 1QVGA 2MPMA 1IBKQ 2L1BA 4FF3A 5EKLA 5K36H 2WACA 2E5LQ 5C4JB 1N32Q 3MFGA 2JA5H 2EY1A 1SEBD 1JOQA 1VF7A 1EY6A 1B9NA 4GOPB 1FJGQ 4LFBL 2R7ZG 4F7XA 3I90A 4DR5Q 1QJOA 5G3LF 3S16H 3AFPA 3EA6A 1EQQA 2HQLA 1D5ZC 1RODA 5C0XI 2UXCQ 3CKIB 1GO3E 3M4PA 4R4OA 1KDCA 4IUUA 3EROA 3OWFA 2A6EC 5BR8Q 4WJWA 3AMUA 3GTJB 1HNZQ 3GTOH 4QF4A 1B3QA 4C3HG 1F2ZA 4LF6Q 1TS3A 2VB2X 2BOSA 5HY6A 3HOYG 5LMUL 4NXMQ 1STAA 3QWNA 3T16A 2UUCL 1E22A 3H94A 1H9SB 4ME3A 2PO4A 3CCEA 3HS0C 2IY5B 5M5XB 1TIID 5KNDA 1PYSB 3FPUB 3U9SA 3J80i 4JI4L 2KCMA 2B2YA 2B29A 2MHVA 4HEDA 1X3QA 2JP1A 1H9MA 2FMMA 3A8IE 1PTOF 3IFDA 3OPOA 4DV2L 5DM63 3JAME 2K5HA 2X6GA 1K73C 3J7AV 4CGYB 1WYDA 2Z1CA 1YNNC 3TP5A 5JJKA 1Q8KA 1KAAA 1CZWA 5CV6A 1XNQQ 2TMPA 1TT2A 1D6EC 1JB7A 4K0KQ 5DM73 1LV9A 4CKBA 3NTHA 5IIFA 3FEWX 2F0TA 2F0OA 1EYDA 2KOLA 3BS1A 1J9OA 1BXTA 5AFWA 4B3MQ 2OQKA 4RKLA 1SMYC 2VL6A 1CQVA 2CQOA 2HT1A 2CFMA 2LMCB 2NN6H 5KIXA 1HQRD 3FKIB 2RDGA 3UDGA 4X3TA 4A3CG 4IFDG 1KRTA 1VQLA 3P75A 1SJED 1VQIA 2H5XA 2EPBA 1BDOA 3KBGA 2B2WC 4JI5L 1ILQA 1ICFB 4DV6Q 1FGBD 1I50B 2A19A 4JOIA 3J80E 1TWCB 2Q8IB 1E0BA 1EIGA 1KTKA 1X3FA 4GLAC 1SJHD 2B39A 2WKCA 4JI1Q 3HOZH 1LYLA 2E74C 1V8QA 1PFSA 4MZ9A 3M3YH 4ID6A 3HOZB 2XWBB 1H9KA 1EUJA 1S4ZA 3B6YA 3S2HB 3K8AA 5KNBA 5C5MA 2K5DA 1STBA 2E75C 2F0QA 2HCIA 1YJWA 2HUGA 4YCUA 2YU9H 4FXDA 2K03A 3S2DB 2FFKB 1X32A 4LFBQ 2KHSA 2ZTEA 4HJ5A 2R92G 3I73A 3DHQA 4GOPC 3KLSX 1S5BD 1GUGA 3CPWA 4HJ9A 1ONLA 3LGJA 3DEOA 1KDBA 1X9NA 2B2VA 3KJOA 3TZUA 1MGSA 4DR1Q 3GTMB 4K5WA 1EL0A 4AYBB 1IL2A 2XTIA 3DEPA 4QQBX 5FLMH 3QOLA 4PZ8A 3BDLA 5I6YA 4LF9Q 1DONA 5KEEA 2LY7A 3OSOA 4DK0A 1AZQA 2F0HA 2A69D 2PNHA 3EJIA 5IP9H 4N8FA 2GVBA 4XYQA 3D4WA 1DJRD 2Y0SG 2N88A 4XDXA 3RLOA 4JI7Q 3IFTA 1I3QB 3EQLC 4JBKA 5BR8L 3QOJA 4X65Q 4OHJA 1EY8A 2EY5A 3H0GH 2JYOA 1XPOA 1ESFA 2R7FA 4U68A 1GJXA 4HAEA 3SVMA 4JI8Q 4DV1L 1PFMA 2IX3A 1EEID 5CMDA 3TS2A 4C3JG 3VR6A 4DR6Q 4EQPA 3I4LA 3GV3A 3MVVA 2RBMA 4X62L 1HUNA 2I0QA 2HDMA 3W3AA 2EYHA 4DV2Q 1MHWC 1SBBB 1G2SA 1IW7C 3R93A 2VQFL 4X66Q 4IOCA 1YHAA 4OIKA 1C0AA 1WD1A 1PH6A 3TRZA 1KNEA 4UDUC 2LS01 3KF6B 4IUNA 1BVSA 2R7DA 4DR2Q 5TSSA 3CU7A 5FK9C 5C44B 4NDXA 2F0KA 3QB3A 1IW7D 1PTOH 2JJQA 1LO5D 1PFNA 2PQAA 1J6QA 3OW7A 3R2IA 2F1MA 1X55A 1PZKD 1LTSD 4RGTA 1TS2A 4PZ7A 3Q23A 2MQHA 5CBEE 5M9OA 4FP5D 3PF5A 4A3DG 4LJZC 3M9BA 3PIP3 1XPUA 3R8BA 5M3FB 1YHBA 1I4HA 2KHJA 4S3SA 1PH9A 4KK7A 3QJYA 4RFBA 3C2PA 4MTKA 2K33A 1RTNA 4IQZA 1XYIA 2VUMH 1Q81C 2WAQG 2QA4A 3SE0A 3AYHB 1GUSA 4V0BA 2QDLA 4JYAQ 2J0TD 2HCCA 4HJAA 5CV9A 2QDBA 4POFA 4MHEA 4PZ6A 3T4AC 1PXUA 4DR3L 3ITPA 3H3VC 2PW7A 5FJ8G 1DYQA 2RCNA 1BUVT 1PH1A 4FF4A 1IBKL 1PHJA 4KY6A 1VQNA 5IYCH 3PUVA 1EY5A 1STGA 2K14A 1ILPA 1Q12A 2UU9L 4NXNQ 4E6IA 5M3MB 2RHQB 3PUYA 1GUNA 1SE8A 1XTDA 2O2LD 5C4XB 3VR5A 1XNRQ 4A3LH 3HOYH 1EIYB 2F03A 1DOKA 1ZYRD 2N8NA 1A6XA 3D31A 3MHBA 3A8JE 3W5OA 3M85A 4CKCA 4DN4M 5BN5A 3BYTB 3WWVA 2JA7H 5T1GA 3CC2A 1EYCA 3LWEA 3PV0A 1DGSA 5C4JH 2LXKA 1VQPA 3UI2A 1S5FD 4DXGA 2SEBD 3DM3A 4KV6A 1N34L 1K3BC 1R4PB 1G2TA 2R93B 1SYFA 1H9SA 4JI3L 3J7ZC 4LF5Q 3VYUA 2R93H 3NK9A 4G4KA 4NMZA 3K5NA 1W3SA 1XXGA 5JVH3 1SMXA 4C3HH 3NBHB 3EVQA 4QY7A 2ZXOA 4DR4L 1WTPA 3I4OA 4K5VA 3GTJH 3GTOB 3AFQA 5IGFA 4A3GG 3E5SA 1WTQA 2KA7A 1N36L 2Q2IA 2NVYB 3VR3A 3KLSA 1CTMA 4IUPA 1F9QA 4KKUA 3WDNA 1VQ9A 4O0AA 2AWOA 5M5XH 2R92H 2IX0A 1UE1A 2L0CA 3I91A 1YZ6A 4HSPA 3S15H 2R92B 1PH5A 1PFBA 2A68D 1O80A 1C9OA 2CVRA 2PZWA 1UUPA 1PH7A 1TXYA 2K05A 4YHHQ 4RWSC 4IFDJ 4TRDA 3CCJA 3N52A 1ASYA 2B2UA 3MXNA 4GLVB 1K3RA 5IE8A 5FLXE 1EY0A 3M7GA 1Y1WG 2I5HA 5ELOA 3A74A 5CGKA 5LMNW 1QB5D 2G9DA 3BYYB 2DNCA 1PH2A 5CV4A 1U4LA 3F2CA 4A3IG 5IT9c 1BQQT 2F3VA 3GTKH 4KY5A 3L3OC 1N33Q 3I2ZA 3E3XA 1VQ6A 4BA1I 1XMQL 2BA0A 1VQEA 3I56A 1LUZA 2VQEL 5FOBB 3MXNB 1VQFA 2RVLA 4B3TL 4C3IG 4DR5L 3J81i 1K0SA 2F0DA 1JB3A 3G4SA 4MTNA 3J80L 2JK8A 4BBSB 3SHLA 1G291 1LTTD 4A93G 4RAUC 1YHQA 4Y7NH 1I50H 1CA5A 1LT3D 4FF1A 5IYDH 3OTOQ 5GQOA 1RIPA 3HOWG 2XIWA 3HKZG 4X64Q 3M4YA 1EIFA 2CH4A 1LTGD 2BA1A 2O5JC 1PZJD 5CYUA 4KI0A 1NE3A 3KLRA 3P20A 3PUZA 4RMFA 2A6HD 3S14B 4CJ0B 1E24A 4QUFA 3KOJA 1PTOC 4ZCKA 1KQSA 5M5WH 1IBMQ 3S14H 1OXTA 4L5TA 4BY7G 4B08A 3O13A 2UXBQ 5DNFA 3M4OB 1B1ZA 3KK7A 3W2DA 1YJNA 4IFDI 4EQ5A 1W6KA 5LL6X 4BXXH 1AW7A 1BCPC 3K80C 1Y1VB 4YIJA 4A76A 2L15A 2KEEA 1TQOA 4XQQA 4A3BG 5C4XG 1D2BA 1WCMH 1S5ED 3ZJYC 2F0NA 1JWMD 5JEAJ 1STEA 1L2FA 2EZVA 1CHPD 3J81c 4WJ3M 4ZLTF 4LW1A 1RL2A 2Z0SA 4A3KB 3VDYA 2EYFA 4DXFA 4B3ML 1VQKA 4BY1H 1PVOA 2D9UA 3HKSA 2ZXRA 4KJOA 1D8LA 3BZKA 2F0VA 1N34Q 1L0XB 5J39A 3CC7A 4LFAQ 1YNJD 1HR0Q 2EYPA 3NTKA 1VQOA 4JI3Q 5L37A 4KHPQ 3I7FA 1VQHA 3DLLA 1JJGA 1E2ZA 2R7ZB 2BE5C 2B63B 2Z4IA 2VQFQ 1H9RA 3UDXA 2NZHA 4PNYA 4ZQ3A 3OWEB 4JI5Q 4DR4Q 2JA6H 1STHA 1B8AA 3G48A 4P74A 1NR2A 1P8LA 2JXMB 4CBVA 4DAMA 4A3GH 1E1OA 2F0JA 1D5XC 1IYJB 4X6AH 1NMGA 3V2TA 2DNEA 4DV7L 3CQZB 5FKAC 2I07B 2PPBC 2YYZA 3I4MH 2B8FA 5KNCA 1JE5A 3R2TA 2JA6G 2B2TA 4K6DA 1VQDA 2WB1G 2SOBA 2CWPA 1HRJA 5LMNQ 5JEAH 1KC8C 2K5WA 5C3XA 4J1MA 2JA8B 2E2JB 2VUMG 2UXDQ 2F0FA 3SEBA 5M5YH 4ME5A 1LACA 5JVG3 4IUVA 3RZDH 1SNOA 4CDCC 3A55A 2A73B 3QIAA 1FNUA 2XGTA 4YWLA 2EOTA 3HKZE 4GKJQ 3JC66 3L7ZC 4DR1L 5C4HA 2OT2A 3CHBD 1PTOB 1U5KA 4JI0Q 2EE1A 2IW3A 3T56B 5EPKA 2KECA 3OIQA 4H0LC 4YWKA 4A3EG 2D2CC 4R4QA 2ZTCA 3HP3A 3ICEA 2NZOA 3NUCA 3IAYA 2I5LX 2B63G 1ESRA 3DM1A 1SFOH 3RN2A 3K5OA 1EYGA 2ZJQA 2GVAA 4POGA 4R4TA 3S1RB 1MD2D 2JEAI 4L6TB 5C0XH 2E2IH 5IGCA 3S1RH 5M3FH 4UAIA 5HURA 4L5RC 1HPCA 4KKTA 2NYZD 2L4NA 4X66L 2E2IB 2K1BA 5GAGC 2ALYB 3U4VA 4BBRG 2VB3X 4YCVA 2KEDA 1B44D 3GTGB 4X64L 3CCVA 3EBEA 3HEJA 3AU7A 4DR2L 4F8MA 4HIKA 4APVA 1XX8A 1XWEA 3J80c 4HR7B 4IZ8A 1LLRD 4IALA 4NP5A 3CMAA 4A3BB 1VQMA 4TVAB 3U9OA 2F52A 5EPLA 1EFID 2CW0C 4JVZA 4DU9A 1KABA 2ZJRA 2QGQA 2RCFA 2HHHL 1CFMA 1QILA 3NHHA 5IYDG 2DJGC 1ET9A 4C2MB 4R8IA 1WTVA 1U4RA 4XYOA 1ZYRC 3J7A5 1W2BA 4C2MH 1GUOA 5NUCA 1RJTA 5IOCA 2QEXA 4HJ8A 1FL0A 4AYBG 4KN4C 2LKVA 3OIPA 5ISRA 3V96A 3BG3A 4IO9A 3QG1A 3J7YW 2B2YC 4K14A 1Q7YC 4H44C 4IPHA 4M8AA 1AE2A 1TWCH 3X3MA 2F0SA 4OWXB 1QOHA 1IBLQ 4B9XA 1NY4A 1OXVA 2A5HA 4ULLA 2BH8A 2VS1A 4DUZL 3M3YB 3G6JB 4ZRZA 2EVBA 4RKBA 3HOUH 3S2HH 4B9WA 3T1YQ 1BF4A 3GDEA 2VY3A 2DN8A 4OO1I 2OCEA 5C6AA 1VMPA 3A5ZB 2K52A 3F1ZA 5IWAL 1B7YB 3A8KE 3K0YA 3S2DH 2ASBA 4K2LA 3NWSA 2EYMA 3GTPB 1TWFB 2O5IC 1TKWB 1XJVA 4JC0A 3ND8A 5C3WA 1L1OC 2L9HA 4YHHL 3L2PA 2NTSA 4DK6C 4GOPA 1A8VA 3CCRA 3CRLC 5J1ZA 2HIVA 1CM9A 3MWYW 1Q3LA 3GTMH 3H3VI 3FKIG 1VQ8A 4HMIA 5ELBA 3GTQH 2RDHA 3TQYA 3H0GG 1T9HA 3IKJA 2D5DA 3GTQB 4LF4Q 1EOTA 4YCWA 1LTRD 2Q8RE 3CCUA 4PMBA 4A3FG 1M1KC 2A6HC 2KVMA 2EYOA 4DNRB 4C1NK 4X3KA 1A15A 2A69C 5C3EH 3PO2G 4WRDA 2ZM6Q 2LFNA 3D4RA 1OXXK 5C3EB 1SLJA 1YITA 3JAMi 4B3TQ 3HOWH 3T13A 4DUYQ 3PF4A 1HNWQ 2PW5A 1DM0B 2NN6G 5ELDA 4LF8L 2NB0A 2F0WA 3RMHA 3OMGA 5IGEA 4NW2A 3PUXA 2AUJD 1PH8A 1KIXA 2DY8A 3V05A 5BN3A 1VQ7A 4P73A 1FVIA 5I9PA 3F2BA 2JSOA 5ELCA 3GV6A 1VQCA 1EZ6A 4HTHA 3NPPA 4A3IH 2HD3A 2MO0A 1SNCA 2EYLA 3TP6A 1IHZA 5GAHC 4HIDA 4A3JB 3BZDB 3G71A 4TQUS 1I6HH 1YNJC 4WORA 4JI2Q 2E2HB 1E2WA 5CV5A 1Y8PB 2KCNA 3ULLA 2Z6KC 5IP7H 1DOLA 4GNXC 1QZGA 5H1SE 4G7OC 1D7QA 4KHVA 4G57A 1PTOD 4OX9Q 1G6ZA 2EDGA 5JPMC 4QJFA 3D4DA 4BA2I 3HOVB 2XRSD 2WB1E 1WI5A 2JEBI 1STYA 4IUQA 1RDPD 1YIJA 4JOIC 4BS9A 1HZBA 1EY7A 3C1FA 4LAAA 4KD4A 3P1HA 5I6WA 2KJXA 5IGBA 1VQ5A 4Q5VA 4XT1B 4CDFC 5IYCG 1WTWA 5A2QE 1HR0L 4LNQA 5J3BA 1F2YA 1I4PA 4K8JA 1EWIA 5E1FA 3I4NB 2V4DA 3Q0AA 2PYKA 1N32L 1LABA 2R6GA 1WTOA 1U0LA 1C4QA 1UEAB 1VQJA 2VUMB 1SROA 4RCOA 1HR0W 3HRZC 4ILWA 4Z9CB 4HN7A 2IJ0A 5K36G 1TWHB 1N8RC 2B3GA 4A3KH 5G3LD 1K83B 4QCLA 2QW7A 5IGGA 4O1NA 2NBFA 1TWHH 1B2TA 4A3FH 4RG1A 3TS0A 1K83H 1GHKA 2DY7A 1WD0A 2XN9C 4DAYB 1N33L 1KD1C 2HQEA 2NN6I 5M3FG 2YTVA 1M90C 2CW0D 3HOXH 4EX5A 2I46A 5FLMG 2AKWB 2D0OA 4DR7Q 2FJ2A 4AQYL 4U673 3CW2C 3U58A 4OWTB 1SYCA 1Y69U 1TWAH 1BOSA 2K50A 3OMCA 4CJ1B 4C56C 3Q22A 1EWHA 1D5MC 1E2VA 1FNWA 5LL6S 4PMWA 1SXTA 2ES2A 3S17H 3VR4A 1LTAD 4P2CB 1GVPA 1MSGA 3E0JA 2ZJPA 1TR5A 4A3MG 4GLXA 1Q86C 3S17B 1BBXC 3K6OA 1UE7A 1B53A 1JE4A 4MN3A 1MJEA 3D6CA 1C8CA 3DUZA 4L5SA 1CK1A 4O42A 3PIPA 1XMOL 1PZID 3I4MG 5LMUQ 1KNAA 3CP0A 2JA7B 1GUWA 2PZTA 3E6ZX 5I2YA 4KHZA 1WJJA 2KQ3A 4R9WA 4DV3L 1HJPA 1D1IA 4GKKL 4DK1A 5JEAG 1YNXA 3SDZA 4XIGS 3IL8A 1A62A 2FHTA 1O7ZA 4OXPA 2F0PA 3CMEA 4YY3Q 3I72A 2PQEA 2L12A 3NQIA 4JV5Q 4R4IA 1QVFA 3NELA 3HOXG 1JMCA 1MSHA 2RA4A 2EY2A 1QUQB 1HH2P 1PRTC 1Q1BA 4QGUA 4DV0L 1X3EA 2OTJA 2MUYA 3MXUA 4LWCA 3G7LA 5KYLA 2I5MX 3OW2A 5IYBH 1DXMA 4JG2A 1O78A 3UDFA 3CCMA 3RD4A 2AUKA 3M7NA 4XT3B 4WJ4A 1WTXA 2ID0A 3I3CA 2X69A 4LUOA 1PRTF 2SNMA 4BBRH 1TY2A 3BVGA 5HGTA 1JICA 5EJWA 4A75A 4HSVA 5FO7B 5HGQA 1DOMA 1NBWA 3KUPA 1H9JA 1TS4A 2ZXPA 1VQBA 4A3LG 1RF2D 3FRPB 1JR0D 4AYBE 1VF5C 1SNMA 1PH3A 2M2LA 4RGNA 2GN5A 1I5FA 1VCIA 3KDFB 5GADC 2WIIB 2KCTA 4KJNA 5JOBA 1EOVA 4FYDA 1SYEA 3PO3H 2UU9Q 5J22A 5CR3A 2PQAB 3HOZG 1VDZA 3J81j 4EQNA 4A3DH 3RZOB 4OGQC 4ZAIA 4BBSH 1X3GA 4DGZA 3RZOH 3K0XA 3PIOA 2F3WA 5BN4A 4DV4Q 3NBIA 5AJ3L 2K01A 2FXQA 1EZ8A 3DWAA 4B3RL 3HG9A 2MNAA 2UUCQ 4KMUC 2R3ZA 4IFDH 5ELNA 1PLFA 4LFCL 4XQJA 4JI8L 1A0IA 2AQ1B 3ULJA 4JI4Q 3HOUG 4ZYSA 3DMUA 1X3PA 1BBUA 1JC7A 2ICIA 4DR6L 4BY1G 3WOFA 5M5WB 5C0XJ 2WKDA 1IXRA 2XSCA 3GD7A 3W1GA 1K28A 4FVMA 3M4OH 3K59A 1F9RA 5C5LA 3N6RA 3TEHB 3CPFA 4L5QA 2QF7A 2YU9B 4DV5Q 3GTPH 1TWFH 1Y1VH 3MZ5A 4K0KL 4JV5L 1JOKA 2B2TC 1JWUD 1T5EA 1HNXQ 2JA9A 3MC0B 4DA2A 4LF7Q 3ONAB 5IGDA 3Q6SA 4DAYA 3T1HL 4DV0Q 4C1NI 2NVTB 1N36Q 4PG3A 2NZ1D 4ZUIA 3RN5A 2HDLA 3DWQA 4TSSA 4BY1B 3VA7A 1Z6HA 5D65A 1RD9D 3TDQA 1KL9A 1CT1D 2LSSA 1S3OA 2JN4A 1WOCA 1YJ9A 1NCVA 1R9TB 1PRTB 4LUZA 4CDDC 3R3OA 4IURA 4P75A 2EJFC 1MI2A 2ATWA 4YWMA 3T1YL 1JJ2A 1GUTA 4MIUA 5GAEC 2B63H 4QB4A 3S1QB 1TWGH 3PO2B 1P16A 3A7AB 3S1QH 2A8VA 2JA6B 4HIOA 2F4IA 3NE5B 2F0UA 3GTLH 3I4NG 3T51B 3NENA 1L0WA 5E4WC 1HTPA 3H0GB 1B4OA 3MFYA 4RHSA 4NKLA 1IYUA 1KHIA 3NQTA 2PZUA 4IJLA 5FLXL 1YVCA 2G5DA 1X65A 5EQ0A 3GO5A 1AP0A 4M1UB 1VQAA 2VQEQ 4DFAA 5COYA 2RF4A 4OWWB 3WOEA 3QO2A 3HOVG 1V9PA 1HUMA 5LHY1 3NBHA 1JWSD 3E9IA 2E2JH 3CCSA 2MP1A 2PMZE 2CHBD 3UE0A 5M5YB 2ZM6L 2EJMA 4R1JA 1Q90A 4I7ZC 2WINB 4JI7L 3M4QA 4O2DA 1F9PA 3RNUA 2D62A 1EU3A 1L1OA 1TU2B 3E0EA 1K8OA 1BKBA 1HA6A 1WFQA 2BCOA 4K6LA 4JI6Q 5JJLA 4RGMA 3GP7A 3HOVH 4H13C 1V1PA 4HCSA 1CSPA 3SR1A 1KAWA 1XNRL 1GXDC 4LF4L 3BDOA 1HNZL 2JA5G 2RDFA 4KKSA 1S72A 3S1NH 1CKNB 2KENA 3TMEA 3PMFA 1O7IA 1A3VA 2RQXA 2QEJC 5JPNC 4GN3B 1SFOB 5I2XA 3MAQA 3NXWA 2M9VA 4XXEA 4RHRA 4IPGA 1I4QA 3MTSA 4H02A 5EKKA 5C44G 4DR7L 4QIWB 4KY7A 3CAMA 1L1OB 4DUYL 3CD6A 4H7BA 3BJUA 1NNXA 3MXGA 4GNXB 2IPKD 3CCLA 1F77A 4IPCA 2AMCB 4R8NA 1U4PA 4LF5L 5IP9G 1J8IA 3EFXD 1KLGD 3HKZB 1WCMG 4A93H 4A3BH 2C5CA 1IL8A 4A3FB 1AN8A 1I4XA 1FGUA 3G6EA 4A93B 1SE3A 2WV6D 1VQ4A 4BBSG 4JBWA 1UEBA 1J5EL 2ICEC 2N55A 1BO0A 4X3SA 4UY8C 1IKMA 4C3IB 1H95A 2XRQD 3KBXA 1OTCA 2EJGC 2B2VC 4K2KA 3EIVA 3PUWA 5T1IA 3U4ZA 4GKKQ 5JJZA 5EBDA 4A3MB 2YTYA 3TBIB 1XTCD 3AEVA 4OX9L 3KFUA 1HQMC 2MJ8A 1K8AC 3MA2B 4A3MH 1SYGA 2L55A 2PI2A 1JJCB 1ZKOA 5M3MH 3FVQA 4NPSA 1K8GA 2BH2A 1DD2A 5E4XA 1FYCA 3F2DA 2NUCA 1C7YA 1PYWD 3T53B 1HCZA 2IWHA 1K0RA 2NVQB 3SK4A 4CKEA 4JCVE 1S5DD 1DZ1A 2XWJB 1SE4A 5LMNL 3STBD 1EIHA 5K5PA 1NMFA 2CWAA 2OF1A 1ENAA 4N9PA 4AH6A 1QVCA 2Q8TA 1PYBA 5D3DA 2ZT9C 5EBCA 1XMQQ 4NB3A 4GKJL 3I8ZA 1EYAA 3S16B 2H1EA 2AHOB 1U4MA 3ERSX 1JOOA 1SR3A 2PNRC 1ICWA 3RLFA 4DNTB 2R61A 2YV5A 4JI6L 2QKIC 3LNNA 2MFIA 1G8ZD 3A54A 1QUQA 3MEHA 2NVYH 4KLKA 2F4VQ 5JAVA 2M00A 1LT6D 3X3NA 2G9HD 1XMOQ 2CCZA 1STNA 1IKLA 1TS5A 2N78A 1HZAA 2SNSA 4LUVA 4B3SQ 3FDTA 3LX0A 4DV3Q 1SDFA 1R4QB 3S1MB 2DGYA 2NTTA 3RLNA 1IBML 3S15B 5KGUA 4BBRB 3S1MH 1VQGA 5C0XG 3OOCA 2DUDA 4DAVA 4RGOS 1G6PA 4FF2A 4X65L 2F0MA 3DWPA 2HIXA 1RCVD 1PMRA 3KJPA 2FMCA 2OEOA 4FXGC 2MO1A 4IOAA 1N9WA 1ZEQX 2Z9HA 1OXUA 4QL5A 3D0FA 4A3EB 1I4RA 1QNKA 1A3UA 5IYBG 3L0OA 2J7ZA 2K4KA 2C35B 2A6ED 1QG7A 4X62Q 4A3EH 1Y1VG 4F87A 1M8AA 4LK1C 2N3SA 4OEMB 1ASZA 3H3VH 1UWVA 4IJHA 3J81E 1B9MA 3SGIA 3C3LA 4KHPL 4EQOA 1UAPA 2PI2E 1UE6A 3H91A 4FO2A 5F2DA 1ENCA 4GNXA 1IBLL 2JA8G 5E7NA 4Y7NB 1J5EQ 1HNXL 3U50C 3PQIA 2UUAQ 2NVXB 3URYA 1II3A 1MKHA 4DNIA 2NVXH 2SDFA 1Y14B 1VMCA 3C46A 4DV7Q 1E3PA 1KLUD 3NTIA 4LFAL 1NUCA 3JAMc 1OO9B 1LTLA 1I94Q 3JAML 1NTGA 1AH9A 1WVLA 4F88A 2E5LL 3UE1A 1WTRA 4KTAA 3I4NH 4TKOB 1HHVA 4N8X1 4XQNA 1EFWA 3FP9A 1C48A 4PMCA 3K7AB 2UXDL 3ER0A 1GD7A 2GA4B 4FXKC 4ZKBB 1SNPA 1SNDA 2E8GA 2EIFA 1QZHA 1XPRA 2NVTH 3LWUA 4QMGA 2F3IA 1GM5A 2Q2TA 4B3RQ 1U9RA 3PGZA 2VW9A 3D3RA 1R9TH 1NJIC 3HOXB 1V1OA 1GKHA 1EWCA 1A63A 2K28A 2UXBL 1T5XD 4LMQD 1HNWL 4GN4B 1IZ6A 2L5TA 3PO2H 2R7ZH 2UXCL 3BZCA 1EY9A 1FD7D 1Z47A 4DV4L 4DV5L 3K5LA 5IT9E 4QUCA 3TREA 1PV4A 1MIUA 3GTLB 2B2UC 3FMCA 1M4VA 4BWGB 3OYYA 1ENFA 1K8MA 4JI0L 2JA7G 3C1EA 3HGBA 4A3GB 3H15A 3I4MB 1X56A 4NXML 1NSNS 3ERQA 3CXCA 1CSQA 2WP8J 2K5VA 3BDCA 3AQQA 3VR2A 2VZAA 4DAPA 4ABNA 1HZ9A 4A4IA 4HIMA 1AZPA 2JA8H 1SE2A 2JA5B 3MEFA 4X3UA 1Q1EA 3SK5A 1YI2A 2UUBL 1IYVA 3SK6A 5IY0A 2L11A 1SN8A 3TP8A 1TVXA 1E1TA 1AEXA 1FNVA 2E2DC 3I70A 1SRUA 3RZDB 2YTXA 5IP7G 4OO1G 1RHPA 5DAUA 3TZDA 2PCFB 5A35A 4UP7A 2K7VA 1NAPA 3VYRA 3KF8B 2V1CC 5GROA 4ZK9B 3K57A 1CHQD 2K32A 4RH6A 2BDNA 4Q0FA 3MXPA 5FLXc 3CC4A 4JI1L 4JPBW 1Q46A 2IHEA 1HA5A 1OXSC 1LM0A 1EQVA 4UHVA 4OELB 3NSWA 3STBC 3L9AX 1BBWA 1A2TA 1YEZA 1JT8A 2IT1A 2A1AA 1FJGL 4GZYC 2NWGA 1LT4D 4ZUJA 3GTGH 2K04A 3OHXC 5ELFA 3UDIA 2EXZA 2H4OA 2JQOA 2K6AA 1G91A 2IHFA 2CKZB 1A2UA 3D6WA 2EXDA 2E76C 3K5MA 1CKOA 5A2QL 2Z8LA 3D8GA 1SNQA 2WAQE 4RCNA 2BE5D 1F2MA 3A7LA 3K81C 1CA6A 1HXYD 2OXPA 5CV8A 2A68C 2Q2UA 4BXXG 1O7LA 3Q8DA 3PCOB 1A3TA 1YNND 1PA6A 3DXJC 4KN7C 1UNSA 4IN3A 4C3IH 4R4CA 1HFGA 4GN5A 5EPJA 1B70B 3PO3B 3FKIH 1WTHA 2EYJA 4A3DB 4L8JA 1GHJA 4HCEA 4GS3A 3FPPA 2K5QA 2R93G 2Z4HA 2MGSA 5DLQE 3NEMA 4UP9A 1F2LA 1LT5D 1Z7TA 4QIWE 1QWYA 4A3JG 3KYHC 3OTOL 1CUKA 1HZCA 3H09A 4HJ7A 3FHWA 4LF9L 2NVQH 4G7HC 2ENBA 1BCPF 2QCPX 5CBAE 1K9MC 3Q24A 2HHHQ 3BU2A 3HOUB 4V190 1O7YA 3EN2A 4DKAC 1G51A 2KBNA 1Y8NB 4YY3L 1RTOA 1NR4A 4A3KG 4I65A 2O4XA 1HFNA 1EU4A 4AIMA 3CCQA 5C3EG 1TY0A 5CC4A 2FINB 4DK3C 3F2UA 2RKSA 4DV6L 1DCZA 2AQ2B 5IODA 1ET6A 4FDBA 4UP8A 4C3HB 5E3FA 4EVOA 2D0PA 3VA5A 2XVSA 2X6LA 1F9SA 3HZXA 2LXJA 4J8QA 4HMJA 5KRUA 3A0JA 3NWTA 3ULPA 2C9OA 4BY7B 1RKNA 2Z6KA 2RHSB 1CZGA 5FJ8H 4I7AA 4DUZQ 4BY7H 3W1BA 1UE5A 1EQRA 1Q82C 1LTBD 2F0LA 4MNOA 3RR5A 4N9TA 1SMYD 3P7JA 1VS0A 4FNFA 1LTID 1ZXTA 2OTLA 2QILA 5FO8B 5DEHA 5I9OA 5ELEA 1S5CD 2WFWA 3HOWB 2EQSA 1AFPA 3AB9A 1SYBA 1TWGB 2Q2HA 2WAQB 1L0YB 1EY4A 5EGTA 2K75A 1D1KA 4EGVA 1I3QH 1CKMA 3PO3G 2XNAC 3A56A 4J6HA 1E7ZA 4P72A 2F0IA 2IL8A 2KCCA 4A3CH 1PRTD 4K8IA 1KXLA 4XTCS 3CRKC 3PIO3 3CF5A 2OWOA 1I6HB 2K5NA 1CQFA 2BDOA 5CORA 3GTKB 3NP8A 3E9HA 1PDQA 2E2HH 1JORA 1V1PB 5EAYA 5IWAQ 4G7ZC 4JBMA 3H6MA 4A3IB 4ODGA 1X6OA 1W6JA 4IPDA 4A3JH 1BNZA 4CHTB 5I4DA 4ALPA 4LF6L 3J81L 3J7AF 5D14A 1HTLD 1SYDA 2B8GA 1BR9A 3TN2A 1CKNA 2B2WA 1QCBD 2CH4W 1S40A 1I94L 3SXHA 1Y1WH 4CJ2C 4B3SL 4WFN3
chains in the Genus database with same CATH topology
1KDAA 2A74C 1Y1WB 3KF8A 3VYTA 1BCPD 4OIJA 1B50A 1MBYA 3RUZA 2RSNA 5D3IB 4ZKCB 3BVMA 2IX1A 2AWNA 1B3AA 1JQYD 5EKIA 3S1NB 4C3JB 3S9WA 3SK8A 5CV7A 1I4GA 1EEFD 4L63B 1QNUA 2VXWA 4OO1H 2RSOA 5FO9B 2KUMA 2CQAA 1FR3A 1WCMB 2Y0SB 1I6VC 4IUTA 2EY6A 1Q8IA 2J4XA 3K58A 1BCPB 5KYIA 3TP7A 2VNUD 4RA8A 4DF7A 1GOZA 4K5XA 1JCKB 2JE6I 4PV1C 5C4ZA 2F0GA 2PMZB 1CI3M 3TSSA 3GQBA 1SAPA 5IT9L 1TWAB 1Y8OB 2TSSA 2F0EA 4PQXA 3ND9A 4JK1C 3ZYYX 4OL7A 2WB1B 3BVZA 3VYSA 1ML0D 3HOYB 1QE6A 2AQ3B 1SSOA 4KD3A 1EQTA 1V43A 2MPMA 2L1BA 4FF3A 5EKLA 5K36H 2WACA 5C4JB 3MFGA 2EY1A 1SEBD 1JOQA 1VF7A 1EY6A 1B9NA 4F7XA 3I90A 1QJOA 5G3LF 3EA6A 1D5ZC 1RODA 5C0XI 3CKIB 1KDCA 4IUUA 3EROA 3OWFA 2A6EC 4WJWA 3AMUA 3GTJB 4QF4A 4C3HG 1F2ZA 1TS3A 2VB2X 2BOSA 1STAA 3QWNA 3T16A 3H94A 1H9SB 2PO4A 3HS0C 5M5XB 1TIID 5KNDA 3FPUB 3U9SA 2B2YA 2MHVA 4HEDA 1X3QA 2JP1A 1H9MA 2FMMA 3A8IE 1PTOF 3IFDA 3OPOA 5DM63 3JAME 2X6GA 3J7AV 4CGYB 2Z1CA 1YNNC 3TP5A 1KAAA 1CZWA 5CV6A 2TMPA 1TT2A 1D6EC 5DM73 1LV9A 4CKBA 3NTHA 5IIFA 3FEWX 2F0TA 2F0OA 1EYDA 2KOLA 3BS1A 1J9OA 1BXTA 5AFWA 4RKLA 1SMYC 1CQVA 2LMCB 2NN6H 5KIXA 1HQRD 3FKIB 2RDGA 4X3TA 4IFDG 3P75A 1SJED 2EPBA 1BDOA 3KBGA 2B2WC 1ILQA 1FGBD 1I50B 3J80E 1TWCB 2Q8IB 1E0BA 1EIGA 1KTKA 1SJHD 2B39A 2WKCA 2E74C 1V8QA 4ID6A 3HOZB 2XWBB 1H9KA 1S4ZA 3S2HB 5KNBA 5C5MA 2K5DA 1STBA 2E75C 2F0QA 2HCIA 2HUGA 4FXDA 2K03A 3S2DB 2FFKB 1X32A 2KHSA 3I73A 3DHQA 3KLSX 1S5BD 1GUGA 1ONLA 3DEOA 1KDBA 2B2VA 3TZUA 1MGSA 3GTMB 4K5WA 1EL0A 4AYBB 3DEPA 3QOLA 3BDLA 5I6YA 1DONA 5KEEA 2LY7A 3OSOA 4DK0A 1AZQA 2F0HA 2A69D 3EJIA 4XYQA 3D4WA 1DJRD 2N88A 4XDXA 3IFTA 1I3QB 3EQLC 3QOJA 4OHJA 1EY8A 2EY5A 2JYOA 1ESFA 4U68A 1GJXA 4HAEA 3SVMA 1PFMA 2IX3A 1EEID 5CMDA 4C3JG 3VR6A 4EQPA 3I4LA 3GV3A 3MVVA 2RBMA 1HUNA 2HDMA 3W3AA 2EYHA 1SBBB 1G2SA 1IW7C 3R93A 4OIKA 1WD1A 1KNEA 4UDUC 2LS01 4IUNA 5TSSA 3CU7A 5FK9C 5C44B 4NDXA 2F0KA 3QB3A 1IW7D 1PTOH 1LO5D 1PFNA 3OW7A 3R2IA 2F1MA 1PZKD 1LTSD 4RGTA 1TS2A 3Q23A 5CBEE 5M9OA 4FP5D 4LJZC 3PIP3 3R8BA 5M3FB 1I4HA 4S3SA 4KK7A 3QJYA 4RFBA 3C2PA 2K33A 1RTNA 4IQZA 1XYIA 3SE0A 1GUSA 4V0BA 2J0TD 2HCCA 5CV9A 2QDBA 4MHEA 3T4AC 1PXUA 3ITPA 3H3VC 2PW7A 1DYQA 1BUVT 4FF4A 4KY6A 3PUVA 1EY5A 1STGA 1ILPA 1Q12A 4E6IA 5M3MB 3PUYA 1GUNA 2O2LD 5C4XB 3VR5A 2F03A 1DOKA 1ZYRD 1A6XA 3D31A 3MHBA 3A8JE 3M85A 4CKCA 4DN4M 5BN5A 3BYTB 5T1GA 1EYCA 3LWEA 3PV0A 3UI2A 1S5FD 4DXGA 2SEBD 4KV6A 1R4PB 1G2TA 2R93B 1SYFA 1H9SA 3VYUA 3NK9A 4G4KA 4NMZA 3K5NA 1XXGA 5JVH3 3EVQA 2ZXOA 1WTPA 4K5VA 3GTOB 5IGFA 3E5SA 1WTQA 2KA7A 2NVYB 3VR3A 3KLSA 1CTMA 4IUPA 1F9QA 4KKUA 3WDNA 2AWOA 2IX0A 2L0CA 3I91A 4HSPA 2R92B 1PFBA 2A68D 1O80A 2CVRA 2PZWA 1UUPA 2K05A 4RWSC 4IFDJ 4TRDA 3N52A 2B2UA 3MXNA 5FLXE 1EY0A 3M7GA 5CGKA 1QB5D 2G9DA 3BYYB 2DNCA 5CV4A 1U4LA 1BQQT 2F3VA 4KY5A 3L3OC 4BA1I 2BA0A 5FOBB 2RVLA 4C3IG 2F0DA 1JB3A 3J80L 4BBSB 3SHLA 1G291 1LTTD 4RAUC 1CA5A 4FF1A 1LT3D 2XIWA 3M4YA 1LTGD 2BA1A 2O5JC 1PZJD 5CYUA 4KI0A 3KLRA 3P20A 3PUZA 2A6HD 3S14B 4CJ0B 4QUFA 1PTOC 1OXTA 4B08A 3O13A 5DNFA 3M4OB 1B1ZA 3KK7A 3W2DA 4IFDI 1W6KA 5LL6X 1AW7A 1BCPC 1Y1VB 4YIJA 2KEEA 1TQOA 4XQQA 1D2BA 1S5ED 2F0NA 1JWMD 5JEAJ 1STEA 2EZVA 1CHPD 4ZLTF 4A3KB 2EYFA 4DXFA 2D9UA 2ZXRA 4KJOA 2F0VA 1L0XB 5J39A 1YNJD 2EYPA 3NTKA 1E2ZA 2R7ZB 2BE5C 2B63B 2Z4IA 1H9RA 4PNYA 4ZQ3A 3OWEB 1STHA 1NR2A 4CBVA 2JXMB 2F0JA 1D5XC 3V2TA 2DNEA 3CQZB 5FKAC 2I07B 2PPBC 2YYZA 2B8FA 5KNCA 3R2TA 2B2TA 4K6DA 2SOBA 1HRJA 5JEAH 2K5WA 5C3XA 4J1MA 2JA8B 2E2JB 2F0FA 3SEBA 4ME5A 1LACA 5JVG3 4IUVA 1SNOA 3A55A 2A73B 3QIAA 1FNUA 2EOTA 3L7ZC 5C4HA 2OT2A 3CHBD 1PTOB 2EE1A 2IW3A 3T56B 5EPKA 2KECA 3OIQA 4H0LC 2D2CC 3HP3A 3NUCA 3IAYA 1ESRA 3DM1A 3K5OA 3S1RB 1MD2D 2JEAI 4L6TB 5C0XH 5IGCA 4UAIA 5HURA 1HPCA 4KKTA 2NYZD 2L4NA 2E2IB 2K1BA 2VB3X 2KEDA 1B44D 3GTGB 3HEJA 3AU7A 4F8MA 1XX8A 1XWEA 4HR7B 4IZ8A 1LLRD 4IALA 4NP5A 4A3BB 3U9OA 5EPLA 1EFID 2CW0C 4DU9A 1KABA 1CFMA 1QILA 3NHHA 4C2MB 1ET9A 4R8IA 1WTVA 1U4RA 4XYOA 1ZYRC 1GUOA 5NUCA 1RJTA 5IOCA 4KN4C 2LKVA 3OIPA 5ISRA 3V96A 3BG3A 3QG1A 3J7YW 2B2YC 4K14A 4H44C 4M8AA 3X3MA 2F0SA 1QOHA 4B9XA 1OXVA 2A5HA 4ULLA 3M3YB 3G6JB 4ZRZA 2EVBA 4RKBA 4B9WA 1BF4A 2DN8A 4OO1I 5C6AA 1VMPA 3A8KE 3K0YA 4K2LA 3NWSA 2EYMA 3GTPB 1TWFB 2O5IC 1TKWB 3ND8A 5C3WA 2L9HA 2NTSA 3CRLC 5J1ZA 1CM9A 3MWYW 1Q3LA 4HMIA 5ELBA 2RDHA 3IKJA 2D5DA 3GTQB 1EOTA 1LTRD 2Q8RE 4PMBA 2A6HC 2KVMA 2EYOA 4DNRB 4C1NK 4X3KA 1A15A 2A69C 4WRDA 2LFNA 3D4RA 1OXXK 5C3EB 3T13A 2PW5A 1DM0B 2NN6G 5ELDA 2NB0A 2F0WA 3RMHA 3OMGA 5IGEA 4NW2A 3PUXA 2AUJD 2DY8A 3V05A 5BN3A 5I9PA 2JSOA 5ELCA 3GV6A 1EZ6A 4HTHA 3NPPA 4A3JB 1SNCA 2EYLA 1IHZA 3TP6A 3BZDB 4TQUS 1YNJC 4WORA 2E2HB 1E2WA 5CV5A 1Y8PB 2KCNA 1DOLA 4G7OC 4KHVA 4G57A 1PTOD 1G6ZA 2EDGA 5JPMC 3D4DA 4BA2I 3HOVB 2XRSD 2JEBI 1STYA 4IUQA 1RDPD 4BS9A 1EY7A 3C1FA 4LAAA 4KD4A 3P1HA 5I6WA 2KJXA 5IGBA 4Q5VA 4XT1B 1WTWA 5A2QE 1F2YA 1I4PA 4K8JA 5E1FA 3I4NB 2V4DA 3Q0AA 2PYKA 1LABA 2R6GA 1WTOA 1C4QA 1UEAB 2VUMB 4RCOA 3HRZC 4ILWA 4Z9CB 4HN7A 2IJ0A 5K36G 1TWHB 5G3LD 1K83B 4QCLA 5IGGA 4O1NA 2NBFA 1B2TA 1GHKA 2DY7A 1WD0A 2XN9C 2HQEA 2NN6I 2CW0D 2I46A 2FJ2A 4U673 1Y69U 1SYCA 1BOSA 3OMCA 4CJ1B 4C56C 3Q22A 1EWHA 1D5MC 1E2VA 1FNWA 5LL6S 4PMWA 1SXTA 3VR4A 1LTAD 4P2CB 1MSGA 3E0JA 1TR5A 3S17B 1BBXC 3K6OA 1B53A 1JE4A 4MN3A 3D6CA 1C8CA 3DUZA 1CK1A 4O42A 1PZID 1KNAA 2JA7B 1GUWA 2PZTA 3E6ZX 5I2YA 4KHZA 2KQ3A 4R9WA 1D1IA 4DK1A 5JEAG 3SDZA 4XIGS 3IL8A 2FHTA 1O7ZA 2F0PA 3I72A 2PQEA 2L12A 3NQIA 1MSHA 2RA4A 2EY2A 1PRTC 1Q1BA 2MUYA 3MXUA 3G7LA 5KYLA 1DXMA 1O78A 3RD4A 2AUKA 3M7NA 4XT3B 1WTXA 2ID0A 3I3CA 2X69A 1PRTF 2SNMA 1TY2A 3BVGA 5HGTA 1JICA 5EJWA 4HSVA 5FO7B 1DOMA 3KUPA 1H9JA 1TS4A 2ZXPA 1RF2D 3FRPB 1JR0D 1VF5C 1SNMA 2M2LA 4RGNA 1VCIA 2WIIB 4KJNA 5JOBA 4FYDA 1SYEA 5J22A 5CR3A 1VDZA 4EQNA 3RZOB 4OGQC 4ZAIA 4DGZA 2F3WA 5BN4A 3NBIA 2K01A 1EZ8A 3DWAA 3HG9A 4KMUC 2R3ZA 4IFDH 1PLFA 4XQJA 2AQ1B 4ZYSA 3DMUA 1X3PA 1JC7A 2ICIA 3WOFA 5M5WB 5C0XJ 2WKDA 2XSCA 3GD7A 4FVMA 3K59A 1F9RA 5C5LA 3N6RA 2QF7A 2YU9B 3MZ5A 1JOKA 2B2TC 1JWUD 1T5EA 3MC0B 4DA2A 3ONAB 5IGDA 3Q6SA 4DAYA 4C1NI 2NVTB 2NZ1D 4ZUIA 2HDLA 3DWQA 4BY1B 4TSSA 3VA7A 1Z6HA 5D65A 1RD9D 3TDQA 1CT1D 1R9TB 1NCVA 1PRTB 3R3OA 4IURA 2EJFC 1MI2A 1GUTA 4MIUA 4QB4A 3S1QB 3PO2B 3A7AB 2JA6B 2F4IA 3NE5B 2F0UA 3T51B 5E4WC 1HTPA 3H0GB 1B4OA 3MFYA 4RHSA 4NKLA 1IYUA 3NQTA 2PZUA 5FLXL 5EQ0A 3GO5A 1AP0A 4M1UB 4DFAA 5COYA 3WOEA 3QO2A 1HUMA 5LHY1 3NBHA 1JWSD 2MP1A 2CHBD 5M5YB 2EJMA 1Q90A 4I7ZC 2WINB 1F9PA 2D62A 1EU3A 1TU2B 1K8OA 1HA6A 2BCOA 4K6LA 4RGMA 3GP7A 4H13C 1V1PA 4HCSA 3SR1A 1GXDC 3BDOA 2RDFA 4KKSA 5JPNC 3TMEA 3PMFA 1A3VA 2RQXA 2QEJC 1SFOB 5I2XA 3MAQA 3NXWA 2M9VA 4XXEA 4RHRA 1I4QA 3MTSA 5EKKA 4QIWB 4KY7A 4H7BA 3MXGA 2IPKD 1F77A 4R8NA 1U4PA 1J8IA 3EFXD 1KLGD 3HKZB 2C5CA 1IL8A 4A3FB 1AN8A 1I4XA 4A93B 1SE3A 2WV6D 4JBWA 2ICEC 2N55A 1BO0A 4X3SA 1IKMA 4C3IB 2XRQD 3KBXA 2EJGC 2B2VC 4K2KA 3PUWA 5T1IA 5JJZA 5EBDA 4A3MB 3TBIB 1XTCD 1HQMC 2MJ8A 3MA2B 1SYGA 2L55A 1ZKOA 3FVQA 1DD2A 5E4XA 1FYCA 2NUCA 1PYWD 3T53B 1HCZA 2IWHA 2NVQB 3SK4A 4CKEA 1S5DD 1DZ1A 2XWJB 1SE4A 1EIHA 5K5PA 2OF1A 1ENAA 4N9PA 2Q8TA 5D3DA 2ZT9C 5EBCA 3I8ZA 1EYAA 3S16B 2H1EA 1U4MA 1JOOA 2PNRC 1ICWA 3RLFA 4DNTB 2R61A 2QKIC 3LNNA 1G8ZD 3A54A 3MEHA 5JAVA 2M00A 1LT6D 3X3NA 2G9HD 1STNA 1IKLA 1TS5A 2SNSA 3FDTA 3LX0A 1SDFA 1R4QB 3S1MB 2NTTA 3S15B 5KGUA 4BBRB 5C0XG 3OOCA 4DAVA 4RGOS 4FF2A 2F0MA 3DWPA 1RCVD 1PMRA 2FMCA 2OEOA 4FXGC 1ZEQX 1OXUA 4A3EB 1I4RA 1QNKA 1A3UA 2J7ZA 2A6ED 1QG7A 4F87A 1M8AA 4LK1C 3J81E 1B9MA 3C3LA 4EQOA 1UAPA 3H91A 4FO2A 5F2DA 1ENCA 4Y7NB 2NVXB 3URYA 1II3A 2SDFA 1VMCA 3C46A 1KLUD 3NTIA 1NUCA 1OO9B 3JAML 1WVLA 4F88A 1WTRA 4KTAA 4TKOB 1HHVA 4XQNA 1C48A 4PMCA 3K7AB 4ZKBB 2GA4B 4FXKC 1SNPA 1SNDA 3LWUA 4QMGA 1U9RA 3D3RA 3HOXB 1V1OA 1EWCA 2K28A 1T5XD 4LMQD 2L5TA 1EY9A 1FD7D 1Z47A 3K5LA 5IT9E 4QUCA 3GTLB 2B2UC 3FMCA 1M4VA 4BWGB 1ENFA 1K8MA 3C1EA 3HGBA 4A3GB 3I4MB 1NSNS 3ERQA 2WP8J 3BDCA 3VR2A 4DAPA 4ABNA 1AZPA 1SE2A 2JA5B 4X3UA 1Q1EA 3SK5A 1IYVA 3SK6A 2L11A 3TP8A 1TVXA 1AEXA 1FNVA 2E2DC 3I70A 3RZDB 4OO1G 1RHPA 5DAUA 3TZDA 2PCFB 5A35A 2K7VA 1NAPA 3VYRA 4ZK9B 3K57A 1CHQD 2K32A 4RH6A 2BDNA 4Q0FA 3MXPA 1HA5A 1OXSC 1EQVA 3NSWA 3L9AX 1A2TA 2IT1A 4GZYC 2NWGA 1LT4D 4ZUJA 5ELFA 2K04A 3OHXC 2EXZA 2H4OA 2K6AA 1G91A 1A2UA 3D6WA 2E76C 3K5MA 5A2QL 2Z8LA 3D8GA 1SNQA 4RCNA 2BE5D 1F2MA 3A7LA 1CA6A 1HXYD 2OXPA 5CV8A 2A68C 1O7LA 1A3TA 1YNND 3DXJC 4KN7C 1UNSA 4IN3A 1HFGA 5EPJA 3PO3B 2EYJA 4A3DB 4L8JA 1GHJA 4HCEA 3FPPA 2K5QA 2Z4HA 2MGSA 1F2LA 1LT5D 1Z7TA 1QWYA 3H09A 4G7HC 2ENBA 1BCPF 2QCPX 5CBAE 3Q24A 3HOUB 4V190 1O7YA 1Y8NB 1RTOA 1NR4A 4I65A 2O4XA 1HFNA 1EU4A 1TY0A 5CC4A 2FINB 3F2UA 2RKSA 1DCZA 2AQ2B 5IODA 1ET6A 4C3HB 5E3FA 4EVOA 3VA5A 2XVSA 2X6LA 1F9SA 3HZXA 4J8QA 4HMJA 5KRUA 3NWTA 2C9OA 4BY7B 1RKNA 1CZGA 1LTBD 2F0LA 4N9TA 1SMYD 3P7JA 4FNFA 1LTID 1ZXTA 2QILA 5FO8B 5DEHA 5I9OA 5ELEA 1S5CD 3HOWB 1AFPA 3AB9A 1SYBA 1TWGB 2WAQB 1L0YB 1EY4A 5EGTA 1D1KA 4EGVA 2XNAC 3A56A 4J6HA 2F0IA 2IL8A 2KCCA 1PRTD 4K8IA 4XTCS 3CRKC 3PIO3 1I6HB 1CQFA 2BDOA 3GTKB 5CORA 3NP8A 1JORA 1PDQA 1V1PB 4G7ZC 3H6MA 4A3IB 4ODGA 1W6JA 1BNZA 4CHTB 5I4DA 3J81L 3J7AF 5D14A 1HTLD 1SYDA 2B8GA 1BR9A 3TN2A 2B2WA 1QCBD 3SXHA 4CJ2C 4WFN3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTT D;  2CHB D;  1SE2 A;  3BYT B;  1S5D D;  3DWA A;  1KTK A;  1BCP D;  1LT3 D;  1SE4 A;  4UDU C;  3MFG A;  1SJH D;  1BCP F;  3SEB A;  1PTO D;  5TSS A;  1SEB D;  5FK9 C;  1EU3 A;  1LTG D;  2XRS D;  1PZJ D;  1FNV A;  1S5F D;  2AQ1 B;  1FNU A;  3URY A;  4K6L A;  4DXG A;  4ZYS A;  5D3I B;  2SEB D;  1RDP D;  3BVM A;  4RGM A;  3GP7 A;  1PTO H;  5D3D A;  1LO5 D;  1JQY D;  2ICI A;  3EA6 A;  1V1P A;  1D5Z C;  3CHB D;  3R2I A;  1PTO B;  1KLU D;  1EU4 A;  1PTO C;  1TY0 A;  1PZK D;  1LTS D;  4RGT A;  1TS2 A;  1XXG A;  1CHQ D;  3O13 A;  4RH6 A;  2R61 A;  1I4G A;  1PRT C;  2AQ2 B;  1B1Z A;  1EEF D;  2QEJ C;  1ET6 A;  3W2D A;  2NTS A;  1I4P A;  3KLS X;  1BCP C;  1AW7 A;  1G8Z D;  1HA5 A;  1S5B D;  4L63 B;  1TS3 A;  4RHR A;  1JWU D;  1I4Q A;  3R8B A;  3MC0 B;  1MD2 D;  1LT6 D;  1S5E D;  5ELB A;  1I4H A;  2G9H D;  2RDH A;  1JWM D;  1STE A;  4L6T B;  1TS5 A;  1CHP D;  4RFB A;  2IPK D;  1LT4 D;  4RCO A;  3DWQ A;  4TSS A;  4Z9C B;  1F77 A;  1LTB D;  5ELF A;  1LTR D;  2IJ0 A;  1RD9 D;  1PTO F;  2J4X A;  4DXF A;  1B44 D;  1BCP B;  1CT1 D;  1LTI D;  4O1N A;  1FGB D;  1PRT F;  1PRT B;  1TY2 A;  3EFX D;  1KLG D;  2QIL A;  2Z8L A;  3BVG A;  1UUP A;  2NTT A;  5ELE A;  1S5C D;  2XN9 C;  1L0X B;  1LLR D;  1HXY D;  1AN8 A;  1DJR D;  1D6E C;  1I4X A;  1L0Y B;  1V1O A;  1EWC A;  1GOZ A;  1SE3 A;  4RGO S;  2WV6 D;  1DYQ A;  2XNA C;  1T5X D;  1JCK B;  5ELD A;  1TS4 A;  1EFI D;  3DWP A;  1RF2 D;  1JR0 D;  2XRQ D;  1BXT A;  4OHJ A;  1RCV D;  3TSS A;  4C56 C;  3OWE B;  1QIL A;  1FD7 D;  1PRT D;  1D5M C;  1ET9 A;  1UNS A;  3BYY B;  1FNW A;  2TSS A;  3V05 A;  1ESF A;  4RGN A;  1SXT A;  5ELC A;  1M4V A;  4BWG B;  1I4R A;  4RHS A;  1CQV A;  1LTA D;  1ENF A;  1D5X C;  1EEI D;  1XTC D;  3BVZ A;  1V1P B;  3BZD B;  1HQR D;  2O2L D;  2RDG A;  2AQ3 B;  5I4D A;  5FKA C;  1SJE D;  1CK1 A;  1SBB B;  3R2T A;  1HTL D;  1PZI D;  1LT5 D;  1PYW D;  1JWS D; 
#chains in the Genus database with same CATH topology
 1KDA A;  3F8T A;  2A74 C;  3QR8 A;  1Y1W B;  3KF8 A;  3VYT A;  1BCP D;  4JYA L;  5AJ3 Q;  4Y52 H;  5C44 H;  2P5Z X;  4OIJ A;  4LF8 Q;  2N49 A;  1B50 A;  4DV1 Q;  1MBY A;  2DJF C;  3RUZ A;  4LFC Q;  2RSN A;  5JJI A;  5D3I B;  4ZKC B;  3BVM A;  1XNQ L;  2AWN A;  3PSI A;  2F4V L;  1B3A A;  2IX1 A;  1JQY D;  1PH4 A;  5EKI A;  3S1N B;  4C3J B;  3S9W A;  3I55 A;  3KDF A;  3KF6 A;  3SK8 A;  4DPG A;  5CV7 A;  1I4G A;  4C3J H;  1EEF D;  4AQY Q;  1MJC A;  4L63 B;  1QNU A;  2VXW A;  4OO1 H;  4NXN L;  2RSO A;  3KLW A;  5FO9 B;  1X54 A;  4J15 A;  2KUM A;  4JW0 A;  3S24 A;  2CQA A;  3K7A H;  4LF7 L;  1FR3 A;  1WCM B;  3T1H Q;  2Y0S B;  1I6V C;  4IUT A;  2Z6B A;  2EY6 A;  1Q8I A;  2J4X A;  3K58 A;  1BCP B;  5KYI A;  3TP7 A;  2VNU D;  4RA8 A;  4DF7 A;  4JI2 L;  1V1Q A;  2UUA L;  1GOZ A;  4K5X A;  1JCK B;  4OON A;  2JE6 I;  4PV1 C;  5C4Z A;  2F0G A;  2PMZ B;  2OQ0 A;  1CI3 M;  3TSS A;  4CDE C;  1KRS A;  3GQB A;  4JBJ A;  1SAP A;  3IRB A;  5IT9 L;  2ZTD A;  1TWA B;  1Y8O B;  2TSS A;  2F0E A;  3HFZ B;  3ND9 A;  1YBY A;  4PQX A;  2UUB Q;  4JK1 C;  3ZYY X;  5M3M G;  3A5U A;  4OL7 A;  2WB1 B;  5C4X H;  3BVZ A;  3VYS A;  1ML0 D;  1Z9F A;  3HOY B;  1QE6 A;  2KHI A;  1AE3 A;  4DR3 Q;  2AQ3 B;  1SSO A;  4KD3 A;  4UPA A;  3CQZ H;  3K7U C;  1EQT A;  2Y0S E;  4P71 A;  1V43 A;  1QVG A;  2MPM A;  1IBK Q;  2L1B A;  4FF3 A;  5EKL A;  5K36 H;  2WAC A;  2E5L Q;  5C4J B;  1N32 Q;  3MFG A;  2JA5 H;  2EY1 A;  1SEB D;  1JOQ A;  1VF7 A;  1EY6 A;  1B9N A;  4GOP B;  1FJG Q;  4LFB L;  2R7Z G;  4F7X A;  3I90 A;  4DR5 Q;  1QJO A;  5G3L F;  3S16 H;  3AFP A;  3EA6 A;  1EQQ A;  2HQL A;  1D5Z C;  1ROD A;  5C0X I;  2UXC Q;  3CKI B;  1GO3 E;  3M4P A;  4R4O A;  1KDC A;  4IUU A;  3ERO A;  3OWF A;  2A6E C;  5BR8 Q;  4WJW A;  3AMU A;  3GTJ B;  1HNZ Q;  3GTO H;  4QF4 A;  1B3Q A;  4C3H G;  1F2Z A;  4LF6 Q;  1TS3 A;  2VB2 X;  2BOS A;  5HY6 A;  3HOY G;  5LMU L;  4NXM Q;  1STA A;  3QWN A;  3T16 A;  2UUC L;  1E22 A;  3H94 A;  1H9S B;  4ME3 A;  2PO4 A;  3CCE A;  3HS0 C;  2IY5 B;  5M5X B;  1TII D;  5KND A;  1PYS B;  3FPU B;  3U9S A;  3J80 i;  4JI4 L;  2KCM A;  2B2Y A;  2B29 A;  2MHV A;  4HED A;  1X3Q A;  2JP1 A;  1H9M A;  2FMM A;  3A8I E;  1PTO F;  3IFD A;  3OPO A;  4DV2 L;  5DM6 3;  3JAM E;  2K5H A;  2X6G A;  1K73 C;  3J7A V;  4CGY B;  1WYD A;  2Z1C A;  1YNN C;  3TP5 A;  5JJK A;  1Q8K A;  1KAA A;  1CZW A;  5CV6 A;  1XNQ Q;  2TMP A;  1TT2 A;  1D6E C;  1JB7 A;  4K0K Q;  5DM7 3;  1LV9 A;  4CKB A;  3NTH A;  5IIF A;  3FEW X;  2F0T A;  2F0O A;  1EYD A;  2KOL A;  3BS1 A;  1J9O A;  1BXT A;  5AFW A;  4B3M Q;  2OQK A;  4RKL A;  1SMY C;  2VL6 A;  1CQV A;  2CQO A;  2HT1 A;  2CFM A;  2LMC B;  2NN6 H;  5KIX A;  1HQR D;  3FKI B;  2RDG A;  3UDG A;  4X3T A;  4A3C G;  4IFD G;  1KRT A;  1VQL A;  3P75 A;  1SJE D;  1VQI A;  2H5X A;  2EPB A;  1BDO A;  3KBG A;  2B2W C;  4JI5 L;  1ILQ A;  1ICF B;  4DV6 Q;  1FGB D;  1I50 B;  2A19 A;  4JOI A;  3J80 E;  1TWC B;  2Q8I B;  1E0B A;  1EIG A;  1KTK A;  1X3F A;  4GLA C;  1SJH D;  2B39 A;  2WKC A;  4JI1 Q;  3HOZ H;  1LYL A;  2E74 C;  1V8Q A;  1PFS A;  4MZ9 A;  3M3Y H;  4ID6 A;  3HOZ B;  2XWB B;  1H9K A;  1EUJ A;  1S4Z A;  3B6Y A;  3S2H B;  3K8A A;  5KNB A;  5C5M A;  2K5D A;  1STB A;  2E75 C;  2F0Q A;  2HCI A;  1YJW A;  2HUG A;  4YCU A;  2YU9 H;  4FXD A;  2K03 A;  3S2D B;  2FFK B;  1X32 A;  4LFB Q;  2KHS A;  2ZTE A;  4HJ5 A;  2R92 G;  3I73 A;  3DHQ A;  4GOP C;  3KLS X;  1S5B D;  1GUG A;  3CPW A;  4HJ9 A;  1ONL A;  3LGJ A;  3DEO A;  1KDB A;  1X9N A;  2B2V A;  3KJO A;  3TZU A;  1MGS A;  4DR1 Q;  3GTM B;  4K5W A;  1EL0 A;  4AYB B;  1IL2 A;  2XTI A;  3DEP A;  4QQB X;  5FLM H;  3QOL A;  4PZ8 A;  3BDL A;  5I6Y A;  4LF9 Q;  1DON A;  5KEE A;  2LY7 A;  3OSO A;  4DK0 A;  1AZQ A;  2F0H A;  2A69 D;  2PNH A;  3EJI A;  5IP9 H;  4N8F A;  2GVB A;  4XYQ A;  3D4W A;  1DJR D;  2Y0S G;  2N88 A;  4XDX A;  3RLO A;  4JI7 Q;  3IFT A;  1I3Q B;  3EQL C;  4JBK A;  5BR8 L;  3QOJ A;  4X65 Q;  4OHJ A;  1EY8 A;  2EY5 A;  3H0G H;  2JYO A;  1XPO A;  1ESF A;  2R7F A;  4U68 A;  1GJX A;  4HAE A;  3SVM A;  4JI8 Q;  4DV1 L;  1PFM A;  2IX3 A;  1EEI D;  5CMD A;  3TS2 A;  4C3J G;  3VR6 A;  4DR6 Q;  4EQP A;  3I4L A;  3GV3 A;  3MVV A;  2RBM A;  4X62 L;  1HUN A;  2I0Q A;  2HDM A;  3W3A A;  2EYH A;  4DV2 Q;  1MHW C;  1SBB B;  1G2S A;  1IW7 C;  3R93 A;  2VQF L;  4X66 Q;  4IOC A;  1YHA A;  4OIK A;  1C0A A;  1WD1 A;  1PH6 A;  3TRZ A;  1KNE A;  4UDU C;  2LS0 1;  3KF6 B;  4IUN A;  1BVS A;  2R7D A;  4DR2 Q;  5TSS A;  3CU7 A;  5FK9 C;  5C44 B;  4NDX A;  2F0K A;  3QB3 A;  1IW7 D;  1PTO H;  2JJQ A;  1LO5 D;  1PFN A;  2PQA A;  1J6Q A;  3OW7 A;  3R2I A;  2F1M A;  1X55 A;  1PZK D;  1LTS D;  4RGT A;  1TS2 A;  4PZ7 A;  3Q23 A;  2MQH A;  5CBE E;  5M9O A;  4FP5 D;  3PF5 A;  4A3D G;  4LJZ C;  3M9B A;  3PIP 3;  1XPU A;  3R8B A;  5M3F B;  1YHB A;  1I4H A;  2KHJ A;  4S3S A;  1PH9 A;  4KK7 A;  3QJY A;  4RFB A;  3C2P A;  4MTK A;  2K33 A;  1RTN A;  4IQZ A;  1XYI A;  2VUM H;  1Q81 C;  2WAQ G;  2QA4 A;  3SE0 A;  3AYH B;  1GUS A;  4V0B A;  2QDL A;  4JYA Q;  2J0T D;  2HCC A;  4HJA A;  5CV9 A;  2QDB A;  4POF A;  4MHE A;  4PZ6 A;  3T4A C;  1PXU A;  4DR3 L;  3ITP A;  3H3V C;  2PW7 A;  5FJ8 G;  1DYQ A;  2RCN A;  1BUV T;  1PH1 A;  4FF4 A;  1IBK L;  1PHJ A;  4KY6 A;  1VQN A;  5IYC H;  3PUV A;  1EY5 A;  1STG A;  2K14 A;  1ILP A;  1Q12 A;  2UU9 L;  4NXN Q;  4E6I A;  5M3M B;  2RHQ B;  3PUY A;  1GUN A;  1SE8 A;  1XTD A;  2O2L D;  5C4X B;  3VR5 A;  1XNR Q;  4A3L H;  3HOY H;  1EIY B;  2F03 A;  1DOK A;  1ZYR D;  2N8N A;  1A6X A;  3D31 A;  3MHB A;  3A8J E;  3W5O A;  3M85 A;  4CKC A;  4DN4 M;  5BN5 A;  3BYT B;  3WWV A;  2JA7 H;  5T1G A;  3CC2 A;  1EYC A;  3LWE A;  3PV0 A;  1DGS A;  5C4J H;  2LXK A;  1VQP A;  3UI2 A;  1S5F D;  4DXG A;  2SEB D;  3DM3 A;  4KV6 A;  1N34 L;  1K3B C;  1R4P B;  1G2T A;  2R93 B;  1SYF A;  1H9S A;  4JI3 L;  3J7Z C;  4LF5 Q;  3VYU A;  2R93 H;  3NK9 A;  4G4K A;  4NMZ A;  3K5N A;  1W3S A;  1XXG A;  5JVH 3;  1SMX A;  4C3H H;  3NBH B;  3EVQ A;  4QY7 A;  2ZXO A;  4DR4 L;  1WTP A;  3I4O A;  4K5V A;  3GTJ H;  3GTO B;  3AFQ A;  5IGF A;  4A3G G;  3E5S A;  1WTQ A;  2KA7 A;  1N36 L;  2Q2I A;  2NVY B;  3VR3 A;  3KLS A;  1CTM A;  4IUP A;  1F9Q A;  4KKU A;  3WDN A;  1VQ9 A;  4O0A A;  2AWO A;  5M5X H;  2R92 H;  2IX0 A;  1UE1 A;  2L0C A;  3I91 A;  1YZ6 A;  4HSP A;  3S15 H;  2R92 B;  1PH5 A;  1PFB A;  2A68 D;  1O80 A;  1C9O A;  2CVR A;  2PZW A;  1UUP A;  1PH7 A;  1TXY A;  2K05 A;  4YHH Q;  4RWS C;  4IFD J;  4TRD A;  3CCJ A;  3N52 A;  1ASY A;  2B2U A;  3MXN A;  4GLV B;  1K3R A;  5IE8 A;  5FLX E;  1EY0 A;  3M7G A;  1Y1W G;  2I5H A;  5ELO A;  3A74 A;  5CGK A;  5LMN W;  1QB5 D;  2G9D A;  3BYY B;  2DNC A;  1PH2 A;  5CV4 A;  1U4L A;  3F2C A;  4A3I G;  5IT9 c;  1BQQ T;  2F3V A;  3GTK H;  4KY5 A;  3L3O C;  1N33 Q;  3I2Z A;  3E3X A;  1VQ6 A;  4BA1 I;  1XMQ L;  2BA0 A;  1VQE A;  3I56 A;  1LUZ A;  2VQE L;  5FOB B;  3MXN B;  1VQF A;  2RVL A;  4B3T L;  4C3I G;  4DR5 L;  3J81 i;  1K0S A;  2F0D A;  1JB3 A;  3G4S A;  4MTN A;  3J80 L;  2JK8 A;  4BBS B;  3SHL A;  1G29 1;  1LTT D;  4A93 G;  4RAU C;  1YHQ A;  4Y7N H;  1I50 H;  1CA5 A;  1LT3 D;  4FF1 A;  5IYD H;  3OTO Q;  5GQO A;  1RIP A;  3HOW G;  2XIW A;  3HKZ G;  4X64 Q;  3M4Y A;  1EIF A;  2CH4 A;  1LTG D;  2BA1 A;  2O5J C;  1PZJ D;  5CYU A;  4KI0 A;  1NE3 A;  3KLR A;  3P20 A;  3PUZ A;  4RMF A;  2A6H D;  3S14 B;  4CJ0 B;  1E24 A;  4QUF A;  3KOJ A;  1PTO C;  4ZCK A;  1KQS A;  5M5W H;  1IBM Q;  3S14 H;  1OXT A;  4L5T A;  4BY7 G;  4B08 A;  3O13 A;  2UXB Q;  5DNF A;  3M4O B;  1B1Z A;  3KK7 A;  3W2D A;  1YJN A;  4IFD I;  4EQ5 A;  1W6K A;  5LL6 X;  4BXX H;  1AW7 A;  1BCP C;  3K80 C;  1Y1V B;  4YIJ A;  4A76 A;  2L15 A;  2KEE A;  1TQO A;  4XQQ A;  4A3B G;  5C4X G;  1D2B A;  1WCM H;  1S5E D;  3ZJY C;  2F0N A;  1JWM D;  5JEA J;  1STE A;  1L2F A;  2EZV A;  1CHP D;  3J81 c;  4WJ3 M;  4ZLT F;  4LW1 A;  1RL2 A;  2Z0S A;  4A3K B;  3VDY A;  2EYF A;  4DXF A;  4B3M L;  1VQK A;  4BY1 H;  1PVO A;  2D9U A;  3HKS A;  2ZXR A;  4KJO A;  1D8L A;  3BZK A;  2F0V A;  1N34 Q;  1L0X B;  5J39 A;  3CC7 A;  4LFA Q;  1YNJ D;  1HR0 Q;  2EYP A;  3NTK A;  1VQO A;  4JI3 Q;  5L37 A;  4KHP Q;  3I7F A;  1VQH A;  3DLL A;  1JJG A;  1E2Z A;  2R7Z B;  2BE5 C;  2B63 B;  2Z4I A;  2VQF Q;  1H9R A;  3UDX A;  2NZH A;  4PNY A;  4ZQ3 A;  3OWE B;  4JI5 Q;  4DR4 Q;  2JA6 H;  1STH A;  1B8A A;  3G48 A;  4P74 A;  1NR2 A;  1P8L A;  2JXM B;  4CBV A;  4DAM A;  4A3G H;  1E1O A;  2F0J A;  1D5X C;  1IYJ B;  4X6A H;  1NMG A;  3V2T A;  2DNE A;  4DV7 L;  3CQZ B;  5FKA C;  2I07 B;  2PPB C;  2YYZ A;  3I4M H;  2B8F A;  5KNC A;  1JE5 A;  3R2T A;  2JA6 G;  2B2T A;  4K6D A;  1VQD A;  2WB1 G;  2SOB A;  2CWP A;  1HRJ A;  5LMN Q;  5JEA H;  1KC8 C;  2K5W A;  5C3X A;  4J1M A;  2JA8 B;  2E2J B;  2VUM G;  2UXD Q;  2F0F A;  3SEB A;  5M5Y H;  4ME5 A;  1LAC A;  5JVG 3;  4IUV A;  3RZD H;  1SNO A;  4CDC C;  3A55 A;  2A73 B;  3QIA A;  1FNU A;  2XGT A;  4YWL A;  2EOT A;  3HKZ E;  4GKJ Q;  3JC6 6;  3L7Z C;  4DR1 L;  5C4H A;  2OT2 A;  3CHB D;  1PTO B;  1U5K A;  4JI0 Q;  2EE1 A;  2IW3 A;  3T56 B;  5EPK A;  2KEC A;  3OIQ A;  4H0L C;  4YWK A;  4A3E G;  2D2C C;  4R4Q A;  2ZTC A;  3HP3 A;  3ICE A;  2NZO A;  3NUC A;  3IAY A;  2I5L X;  2B63 G;  1ESR A;  3DM1 A;  1SFO H;  3RN2 A;  3K5O A;  1EYG A;  2ZJQ A;  2GVA A;  4POG A;  4R4T A;  3S1R B;  1MD2 D;  2JEA I;  4L6T B;  5C0X H;  2E2I H;  5IGC A;  3S1R H;  5M3F H;  4UAI A;  5HUR A;  4L5R C;  1HPC A;  4KKT A;  2NYZ D;  2L4N A;  4X66 L;  2E2I B;  2K1B A;  5GAG C;  2ALY B;  3U4V A;  4BBR G;  2VB3 X;  4YCV A;  2KED A;  1B44 D;  3GTG B;  4X64 L;  3CCV A;  3EBE A;  3HEJ A;  3AU7 A;  4DR2 L;  4F8M A;  4HIK A;  4APV A;  1XX8 A;  1XWE A;  3J80 c;  4HR7 B;  4IZ8 A;  1LLR D;  4IAL A;  4NP5 A;  3CMA A;  4A3B B;  1VQM A;  4TVA B;  3U9O A;  2F52 A;  5EPL A;  1EFI D;  2CW0 C;  4JVZ A;  4DU9 A;  1KAB A;  2ZJR A;  2QGQ A;  2RCF A;  2HHH L;  1CFM A;  1QIL A;  3NHH A;  5IYD G;  2DJG C;  1ET9 A;  4C2M B;  4R8I A;  1WTV A;  1U4R A;  4XYO A;  1ZYR C;  3J7A 5;  1W2B A;  4C2M H;  1GUO A;  5NUC A;  1RJT A;  5IOC A;  2QEX A;  4HJ8 A;  1FL0 A;  4AYB G;  4KN4 C;  2LKV A;  3OIP A;  5ISR A;  3V96 A;  3BG3 A;  4IO9 A;  3QG1 A;  3J7Y W;  2B2Y C;  4K14 A;  1Q7Y C;  4H44 C;  4IPH A;  4M8A A;  1AE2 A;  1TWC H;  3X3M A;  2F0S A;  4OWX B;  1QOH A;  1IBL Q;  4B9X A;  1NY4 A;  1OXV A;  2A5H A;  4ULL A;  2BH8 A;  2VS1 A;  4DUZ L;  3M3Y B;  3G6J B;  4ZRZ A;  2EVB A;  4RKB A;  3HOU H;  3S2H H;  4B9W A;  3T1Y Q;  1BF4 A;  3GDE A;  2VY3 A;  2DN8 A;  4OO1 I;  2OCE A;  5C6A A;  1VMP A;  3A5Z B;  2K52 A;  3F1Z A;  5IWA L;  1B7Y B;  3A8K E;  3K0Y A;  3S2D H;  2ASB A;  4K2L A;  3NWS A;  2EYM A;  3GTP B;  1TWF B;  2O5I C;  1TKW B;  1XJV A;  4JC0 A;  3ND8 A;  5C3W A;  1L1O C;  2L9H A;  4YHH L;  3L2P A;  2NTS A;  4DK6 C;  4GOP A;  1A8V A;  3CCR A;  3CRL C;  5J1Z A;  2HIV A;  1CM9 A;  3MWY W;  1Q3L A;  3GTM H;  3H3V I;  3FKI G;  1VQ8 A;  4HMI A;  5ELB A;  3GTQ H;  2RDH A;  3TQY A;  3H0G G;  1T9H A;  3IKJ A;  2D5D A;  3GTQ B;  4LF4 Q;  1EOT A;  4YCW A;  1LTR D;  2Q8R E;  3CCU A;  4PMB A;  4A3F G;  1M1K C;  2A6H C;  2KVM A;  2EYO A;  4DNR B;  4C1N K;  4X3K A;  1A15 A;  2A69 C;  5C3E H;  3PO2 G;  4WRD A;  2ZM6 Q;  2LFN A;  3D4R A;  1OXX K;  5C3E B;  1SLJ A;  1YIT A;  3JAM i;  4B3T Q;  3HOW H;  3T13 A;  4DUY Q;  3PF4 A;  1HNW Q;  2PW5 A;  1DM0 B;  2NN6 G;  5ELD A;  4LF8 L;  2NB0 A;  2F0W A;  3RMH A;  3OMG A;  5IGE A;  4NW2 A;  3PUX A;  2AUJ D;  1PH8 A;  1KIX A;  2DY8 A;  3V05 A;  5BN3 A;  1VQ7 A;  4P73 A;  1FVI A;  5I9P A;  3F2B A;  2JSO A;  5ELC A;  3GV6 A;  1VQC A;  1EZ6 A;  4HTH A;  3NPP A;  4A3I H;  2HD3 A;  2MO0 A;  1SNC A;  2EYL A;  3TP6 A;  1IHZ A;  5GAH C;  4HID A;  4A3J B;  3BZD B;  3G71 A;  4TQU S;  1I6H H;  1YNJ C;  4WOR A;  4JI2 Q;  2E2H B;  1E2W A;  5CV5 A;  1Y8P B;  2KCN A;  3ULL A;  2Z6K C;  5IP7 H;  1DOL A;  4GNX C;  1QZG A;  5H1S E;  4G7O C;  1D7Q A;  4KHV A;  4G57 A;  1PTO D;  4OX9 Q;  1G6Z A;  2EDG A;  5JPM C;  4QJF A;  3D4D A;  4BA2 I;  3HOV B;  2XRS D;  2WB1 E;  1WI5 A;  2JEB I;  1STY A;  4IUQ A;  1RDP D;  1YIJ A;  4JOI C;  4BS9 A;  1HZB A;  1EY7 A;  3C1F A;  4LAA A;  4KD4 A;  3P1H A;  5I6W A;  2KJX A;  5IGB A;  1VQ5 A;  4Q5V A;  4XT1 B;  4CDF C;  5IYC G;  1WTW A;  5A2Q E;  1HR0 L;  4LNQ A;  5J3B A;  1F2Y A;  1I4P A;  4K8J A;  1EWI A;  5E1F A;  3I4N B;  2V4D A;  3Q0A A;  2PYK A;  1N32 L;  1LAB A;  2R6G A;  1WTO A;  1U0L A;  1C4Q A;  1UEA B;  1VQJ A;  2VUM B;  1SRO A;  4RCO A;  1HR0 W;  3HRZ C;  4ILW A;  4Z9C B;  4HN7 A;  2IJ0 A;  5K36 G;  1TWH B;  1N8R C;  2B3G A;  4A3K H;  5G3L D;  1K83 B;  4QCL A;  2QW7 A;  5IGG A;  4O1N A;  2NBF A;  1TWH H;  1B2T A;  4A3F H;  4RG1 A;  3TS0 A;  1K83 H;  1GHK A;  2DY7 A;  1WD0 A;  2XN9 C;  4DAY B;  1N33 L;  1KD1 C;  2HQE A;  2NN6 I;  5M3F G;  2YTV A;  1M90 C;  2CW0 D;  3HOX H;  4EX5 A;  2I46 A;  5FLM G;  2AKW B;  2D0O A;  4DR7 Q;  2FJ2 A;  4AQY L;  4U67 3;  3CW2 C;  3U58 A;  4OWT B;  1SYC A;  1Y69 U;  1TWA H;  1BOS A;  2K50 A;  3OMC A;  4CJ1 B;  4C56 C;  3Q22 A;  1EWH A;  1D5M C;  1E2V A;  1FNW A;  5LL6 S;  4PMW A;  1SXT A;  2ES2 A;  3S17 H;  3VR4 A;  1LTA D;  4P2C B;  1GVP A;  1MSG A;  3E0J A;  2ZJP A;  1TR5 A;  4A3M G;  4GLX A;  1Q86 C;  3S17 B;  1BBX C;  3K6O A;  1UE7 A;  1B53 A;  1JE4 A;  4MN3 A;  1MJE A;  3D6C A;  1C8C A;  3DUZ A;  4L5S A;  1CK1 A;  4O42 A;  3PIP A;  1XMO L;  1PZI D;  3I4M G;  5LMU Q;  1KNA A;  3CP0 A;  2JA7 B;  1GUW A;  2PZT A;  3E6Z X;  5I2Y A;  4KHZ A;  1WJJ A;  2KQ3 A;  4R9W A;  4DV3 L;  1HJP A;  1D1I A;  4GKK L;  4DK1 A;  5JEA G;  1YNX A;  3SDZ A;  4XIG S;  3IL8 A;  1A62 A;  2FHT A;  1O7Z A;  4OXP A;  2F0P A;  3CME A;  4YY3 Q;  3I72 A;  2PQE A;  2L12 A;  3NQI A;  4JV5 Q;  4R4I A;  1QVF A;  3NEL A;  3HOX G;  1JMC A;  1MSH A;  2RA4 A;  2EY2 A;  1QUQ B;  1HH2 P;  1PRT C;  1Q1B A;  4QGU A;  4DV0 L;  1X3E A;  2OTJ A;  2MUY A;  3MXU A;  4LWC A;  3G7L A;  5KYL A;  2I5M X;  3OW2 A;  5IYB H;  1DXM A;  4JG2 A;  1O78 A;  3UDF A;  3CCM A;  3RD4 A;  2AUK A;  3M7N A;  4XT3 B;  4WJ4 A;  1WTX A;  2ID0 A;  3I3C A;  2X69 A;  4LUO A;  1PRT F;  2SNM A;  4BBR H;  1TY2 A;  3BVG A;  5HGT A;  1JIC A;  5EJW A;  4A75 A;  4HSV A;  5FO7 B;  5HGQ A;  1DOM A;  1NBW A;  3KUP A;  1H9J A;  1TS4 A;  2ZXP A;  1VQB A;  4A3L G;  1RF2 D;  3FRP B;  1JR0 D;  4AYB E;  1VF5 C;  1SNM A;  1PH3 A;  2M2L A;  4RGN A;  2GN5 A;  1I5F A;  1VCI A;  3KDF B;  5GAD C;  2WII B;  2KCT A;  4KJN A;  5JOB A;  1EOV A;  4FYD A;  1SYE A;  3PO3 H;  2UU9 Q;  5J22 A;  5CR3 A;  2PQA B;  3HOZ G;  1VDZ A;  3J81 j;  4EQN A;  4A3D H;  3RZO B;  4OGQ C;  4ZAI A;  4BBS H;  1X3G A;  4DGZ A;  3RZO H;  3K0X A;  3PIO A;  2F3W A;  5BN4 A;  4DV4 Q;  3NBI A;  5AJ3 L;  2K01 A;  2FXQ A;  1EZ8 A;  3DWA A;  4B3R L;  3HG9 A;  2MNA A;  2UUC Q;  4KMU C;  2R3Z A;  4IFD H;  5ELN A;  1PLF A;  4LFC L;  4XQJ A;  4JI8 L;  1A0I A;  2AQ1 B;  3ULJ A;  4JI4 Q;  3HOU G;  4ZYS A;  3DMU A;  1X3P A;  1BBU A;  1JC7 A;  2ICI A;  4DR6 L;  4BY1 G;  3WOF A;  5M5W B;  5C0X J;  2WKD A;  1IXR A;  2XSC A;  3GD7 A;  3W1G A;  1K28 A;  4FVM A;  3M4O H;  3K59 A;  1F9R A;  5C5L A;  3N6R A;  3TEH B;  3CPF A;  4L5Q A;  2QF7 A;  2YU9 B;  4DV5 Q;  3GTP H;  1TWF H;  1Y1V H;  3MZ5 A;  4K0K L;  4JV5 L;  1JOK A;  2B2T C;  1JWU D;  1T5E A;  1HNX Q;  2JA9 A;  3MC0 B;  4DA2 A;  4LF7 Q;  3ONA B;  5IGD A;  3Q6S A;  4DAY A;  3T1H L;  4DV0 Q;  4C1N I;  2NVT B;  1N36 Q;  4PG3 A;  2NZ1 D;  4ZUI A;  3RN5 A;  2HDL A;  3DWQ A;  4TSS A;  4BY1 B;  3VA7 A;  1Z6H A;  5D65 A;  1RD9 D;  3TDQ A;  1KL9 A;  1CT1 D;  2LSS A;  1S3O A;  2JN4 A;  1WOC A;  1YJ9 A;  1NCV A;  1R9T B;  1PRT B;  4LUZ A;  4CDD C;  3R3O A;  4IUR A;  4P75 A;  2EJF C;  1MI2 A;  2ATW A;  4YWM A;  3T1Y L;  1JJ2 A;  1GUT A;  4MIU A;  5GAE C;  2B63 H;  4QB4 A;  3S1Q B;  1TWG H;  3PO2 B;  1P16 A;  3A7A B;  3S1Q H;  2A8V A;  2JA6 B;  4HIO A;  2F4I A;  3NE5 B;  2F0U A;  3GTL H;  3I4N G;  3T51 B;  3NEN A;  1L0W A;  5E4W C;  1HTP A;  3H0G B;  1B4O A;  3MFY A;  4RHS A;  4NKL A;  1IYU A;  1KHI A;  3NQT A;  2PZU A;  4IJL A;  5FLX L;  1YVC A;  2G5D A;  1X65 A;  5EQ0 A;  3GO5 A;  1AP0 A;  4M1U B;  1VQA A;  2VQE Q;  4DFA A;  5COY A;  2RF4 A;  4OWW B;  3WOE A;  3QO2 A;  3HOV G;  1V9P A;  1HUM A;  5LHY 1;  3NBH A;  1JWS D;  3E9I A;  2E2J H;  3CCS A;  2MP1 A;  2PMZ E;  2CHB D;  3UE0 A;  5M5Y B;  2ZM6 L;  2EJM A;  4R1J A;  1Q90 A;  4I7Z C;  2WIN B;  4JI7 L;  3M4Q A;  4O2D A;  1F9P A;  3RNU A;  2D62 A;  1EU3 A;  1L1O A;  1TU2 B;  3E0E A;  1K8O A;  1BKB A;  1HA6 A;  1WFQ A;  2BCO A;  4K6L A;  4JI6 Q;  5JJL A;  4RGM A;  3GP7 A;  3HOV H;  4H13 C;  1V1P A;  4HCS A;  1CSP A;  3SR1 A;  1KAW A;  1XNR L;  1GXD C;  4LF4 L;  3BDO A;  1HNZ L;  2JA5 G;  2RDF A;  4KKS A;  1S72 A;  3S1N H;  1CKN B;  2KEN A;  3TME A;  3PMF A;  1O7I A;  1A3V A;  2RQX A;  2QEJ C;  5JPN C;  4GN3 B;  1SFO B;  5I2X A;  3MAQ A;  3NXW A;  2M9V A;  4XXE A;  4RHR A;  4IPG A;  1I4Q A;  3MTS A;  4H02 A;  5EKK A;  5C44 G;  4DR7 L;  4QIW B;  4KY7 A;  3CAM A;  1L1O B;  4DUY L;  3CD6 A;  4H7B A;  3BJU A;  1NNX A;  3MXG A;  4GNX B;  2IPK D;  3CCL A;  1F77 A;  4IPC A;  2AMC B;  4R8N A;  1U4P A;  4LF5 L;  5IP9 G;  1J8I A;  3EFX D;  1KLG D;  3HKZ B;  1WCM G;  4A93 H;  4A3B H;  2C5C A;  1IL8 A;  4A3F B;  1AN8 A;  1I4X A;  1FGU A;  3G6E A;  4A93 B;  1SE3 A;  2WV6 D;  1VQ4 A;  4BBS G;  4JBW A;  1UEB A;  1J5E L;  2ICE C;  2N55 A;  1BO0 A;  4X3S A;  4UY8 C;  1IKM A;  4C3I B;  1H95 A;  2XRQ D;  3KBX A;  1OTC A;  2EJG C;  2B2V C;  4K2K A;  3EIV A;  3PUW A;  5T1I A;  3U4Z A;  4GKK Q;  5JJZ A;  5EBD A;  4A3M B;  2YTY A;  3TBI B;  1XTC D;  3AEV A;  4OX9 L;  3KFU A;  1HQM C;  2MJ8 A;  1K8A C;  3MA2 B;  4A3M H;  1SYG A;  2L55 A;  2PI2 A;  1JJC B;  1ZKO A;  5M3M H;  3FVQ A;  4NPS A;  1K8G A;  2BH2 A;  1DD2 A;  5E4X A;  1FYC A;  3F2D A;  2NUC A;  1C7Y A;  1PYW D;  3T53 B;  1HCZ A;  2IWH A;  1K0R A;  2NVQ B;  3SK4 A;  4CKE A;  4JCV E;  1S5D D;  1DZ1 A;  2XWJ B;  1SE4 A;  5LMN L;  3STB D;  1EIH A;  5K5P A;  1NMF A;  2CWA A;  2OF1 A;  1ENA A;  4N9P A;  4AH6 A;  1QVC A;  2Q8T A;  1PYB A;  5D3D A;  2ZT9 C;  5EBC A;  1XMQ Q;  4NB3 A;  4GKJ L;  3I8Z A;  1EYA A;  3S16 B;  2H1E A;  2AHO B;  1U4M A;  3ERS X;  1JOO A;  1SR3 A;  2PNR C;  1ICW A;  3RLF A;  4DNT B;  2R61 A;  2YV5 A;  4JI6 L;  2QKI C;  3LNN A;  2MFI A;  1G8Z D;  3A54 A;  1QUQ A;  3MEH A;  2NVY H;  4KLK A;  2F4V Q;  5JAV A;  2M00 A;  1LT6 D;  3X3N A;  2G9H D;  1XMO Q;  2CCZ A;  1STN A;  1IKL A;  1TS5 A;  2N78 A;  1HZA A;  2SNS A;  4LUV A;  4B3S Q;  3FDT A;  3LX0 A;  4DV3 Q;  1SDF A;  1R4Q B;  3S1M B;  2DGY A;  2NTT A;  3RLN A;  1IBM L;  3S15 B;  5KGU A;  4BBR B;  3S1M H;  1VQG A;  5C0X G;  3OOC A;  2DUD A;  4DAV A;  4RGO S;  1G6P A;  4FF2 A;  4X65 L;  2F0M A;  3DWP A;  2HIX A;  1RCV D;  1PMR A;  3KJP A;  2FMC A;  2OEO A;  4FXG C;  2MO1 A;  4IOA A;  1N9W A;  1ZEQ X;  2Z9H A;  1OXU A;  4QL5 A;  3D0F A;  4A3E B;  1I4R A;  1QNK A;  1A3U A;  5IYB G;  3L0O A;  2J7Z A;  2K4K A;  2C35 B;  2A6E D;  1QG7 A;  4X62 Q;  4A3E H;  1Y1V G;  4F87 A;  1M8A A;  4LK1 C;  2N3S A;  4OEM B;  1ASZ A;  3H3V H;  1UWV A;  4IJH A;  3J81 E;  1B9M A;  3SGI A;  3C3L A;  4KHP L;  4EQO A;  1UAP A;  2PI2 E;  1UE6 A;  3H91 A;  4FO2 A;  5F2D A;  1ENC A;  4GNX A;  1IBL L;  2JA8 G;  5E7N A;  4Y7N B;  1J5E Q;  1HNX L;  3U50 C;  3PQI A;  2UUA Q;  2NVX B;  3URY A;  1II3 A;  1MKH A;  4DNI A;  2NVX H;  2SDF A;  1Y14 B;  1VMC A;  3C46 A;  4DV7 Q;  1E3P A;  1KLU D;  3NTI A;  4LFA L;  1NUC A;  3JAM c;  1OO9 B;  1LTL A;  1I94 Q;  3JAM L;  1NTG A;  1AH9 A;  1WVL A;  4F88 A;  2E5L L;  3UE1 A;  1WTR A;  4KTA A;  3I4N H;  4TKO B;  1HHV A;  4N8X 1;  4XQN A;  1EFW A;  3FP9 A;  1C48 A;  4PMC A;  3K7A B;  2UXD L;  3ER0 A;  1GD7 A;  2GA4 B;  4FXK C;  4ZKB B;  1SNP A;  1SND A;  2E8G A;  2EIF A;  1QZH A;  1XPR A;  2NVT H;  3LWU A;  4QMG A;  2F3I A;  1GM5 A;  2Q2T A;  4B3R Q;  1U9R A;  3PGZ A;  2VW9 A;  3D3R A;  1R9T H;  1NJI C;  3HOX B;  1V1O A;  1GKH A;  1EWC A;  1A63 A;  2K28 A;  2UXB L;  1T5X D;  4LMQ D;  1HNW L;  4GN4 B;  1IZ6 A;  2L5T A;  3PO2 H;  2R7Z H;  2UXC L;  3BZC A;  1EY9 A;  1FD7 D;  1Z47 A;  4DV4 L;  4DV5 L;  3K5L A;  5IT9 E;  4QUC A;  3TRE A;  1PV4 A;  1MIU A;  3GTL B;  2B2U C;  3FMC A;  1M4V A;  4BWG B;  3OYY A;  1ENF A;  1K8M A;  4JI0 L;  2JA7 G;  3C1E A;  3HGB A;  4A3G B;  3H15 A;  3I4M B;  1X56 A;  4NXM L;  1NSN S;  3ERQ A;  3CXC A;  1CSQ A;  2WP8 J;  2K5V A;  3BDC A;  3AQQ A;  3VR2 A;  2VZA A;  4DAP A;  4ABN A;  1HZ9 A;  4A4I A;  4HIM A;  1AZP A;  2JA8 H;  1SE2 A;  2JA5 B;  3MEF A;  4X3U A;  1Q1E A;  3SK5 A;  1YI2 A;  2UUB L;  1IYV A;  3SK6 A;  5IY0 A;  2L11 A;  1SN8 A;  3TP8 A;  1TVX A;  1E1T A;  1AEX A;  1FNV A;  2E2D C;  3I70 A;  1SRU A;  3RZD B;  2YTX A;  5IP7 G;  4OO1 G;  1RHP A;  5DAU A;  3TZD A;  2PCF B;  5A35 A;  4UP7 A;  2K7V A;  1NAP A;  3VYR A;  3KF8 B;  2V1C C;  5GRO A;  4ZK9 B;  3K57 A;  1CHQ D;  2K32 A;  4RH6 A;  2BDN A;  4Q0F A;  3MXP A;  5FLX c;  3CC4 A;  4JI1 L;  4JPB W;  1Q46 A;  2IHE A;  1HA5 A;  1OXS C;  1LM0 A;  1EQV A;  4UHV A;  4OEL B;  3NSW A;  3STB C;  3L9A X;  1BBW A;  1A2T A;  1YEZ A;  1JT8 A;  2IT1 A;  2A1A A;  1FJG L;  4GZY C;  2NWG A;  1LT4 D;  4ZUJ A;  3GTG H;  2K04 A;  3OHX C;  5ELF A;  3UDI A;  2EXZ A;  2H4O A;  2JQO A;  2K6A A;  1G91 A;  2IHF A;  2CKZ B;  1A2U A;  3D6W A;  2EXD A;  2E76 C;  3K5M A;  1CKO A;  5A2Q L;  2Z8L A;  3D8G A;  1SNQ A;  2WAQ E;  4RCN A;  2BE5 D;  1F2M A;  3A7L A;  3K81 C;  1CA6 A;  1HXY D;  2OXP A;  5CV8 A;  2A68 C;  2Q2U A;  4BXX G;  1O7L A;  3Q8D A;  3PCO B;  1A3T A;  1YNN D;  1PA6 A;  3DXJ C;  4KN7 C;  1UNS A;  4IN3 A;  4C3I H;  4R4C A;  1HFG A;  4GN5 A;  5EPJ A;  1B70 B;  3PO3 B;  3FKI H;  1WTH A;  2EYJ A;  4A3D B;  4L8J A;  1GHJ A;  4HCE A;  4GS3 A;  3FPP A;  2K5Q A;  2R93 G;  2Z4H A;  2MGS A;  5DLQ E;  3NEM A;  4UP9 A;  1F2L A;  1LT5 D;  1Z7T A;  4QIW E;  1QWY A;  4A3J G;  3KYH C;  3OTO L;  1CUK A;  1HZC A;  3H09 A;  4HJ7 A;  3FHW A;  4LF9 L;  2NVQ H;  4G7H C;  2ENB A;  1BCP F;  2QCP X;  5CBA E;  1K9M C;  3Q24 A;  2HHH Q;  3BU2 A;  3HOU B;  4V19 0;  1O7Y A;  3EN2 A;  4DKA C;  1G51 A;  2KBN A;  1Y8N B;  4YY3 L;  1RTO A;  1NR4 A;  4A3K G;  4I65 A;  2O4X A;  1HFN A;  1EU4 A;  4AIM A;  3CCQ A;  5C3E G;  1TY0 A;  5CC4 A;  2FIN B;  4DK3 C;  3F2U A;  2RKS A;  4DV6 L;  1DCZ A;  2AQ2 B;  5IOD A;  1ET6 A;  4FDB A;  4UP8 A;  4C3H B;  5E3F A;  4EVO A;  2D0P A;  3VA5 A;  2XVS A;  2X6L A;  1F9S A;  3HZX A;  2LXJ A;  4J8Q A;  4HMJ A;  5KRU A;  3A0J A;  3NWT A;  3ULP A;  2C9O A;  4BY7 B;  1RKN A;  2Z6K A;  2RHS B;  1CZG A;  5FJ8 H;  4I7A A;  4DUZ Q;  4BY7 H;  3W1B A;  1UE5 A;  1EQR A;  1Q82 C;  1LTB D;  2F0L A;  4MNO A;  3RR5 A;  4N9T A;  1SMY D;  3P7J A;  1VS0 A;  4FNF A;  1LTI D;  1ZXT A;  2OTL A;  2QIL A;  5FO8 B;  5DEH A;  5I9O A;  5ELE A;  1S5C D;  2WFW A;  3HOW B;  2EQS A;  1AFP A;  3AB9 A;  1SYB A;  1TWG B;  2Q2H A;  2WAQ B;  1L0Y B;  1EY4 A;  5EGT A;  2K75 A;  1D1K A;  4EGV A;  1I3Q H;  1CKM A;  3PO3 G;  2XNA C;  3A56 A;  4J6H A;  1E7Z A;  4P72 A;  2F0I A;  2IL8 A;  2KCC A;  4A3C H;  1PRT D;  4K8I A;  1KXL A;  4XTC S;  3CRK C;  3PIO 3;  3CF5 A;  2OWO A;  1I6H B;  2K5N A;  1CQF A;  2BDO A;  5COR A;  3GTK B;  3NP8 A;  3E9H A;  1PDQ A;  2E2H H;  1JOR A;  1V1P B;  5EAY A;  5IWA Q;  4G7Z C;  4JBM A;  3H6M A;  4A3I B;  4ODG A;  1X6O A;  1W6J A;  4IPD A;  4A3J H;  1BNZ A;  4CHT B;  5I4D A;  4ALP A;  4LF6 L;  3J81 L;  3J7A F;  5D14 A;  1HTL D;  1SYD A;  2B8G A;  1BR9 A;  3TN2 A;  1CKN A;  2B2W A;  1QCB D;  2CH4 W;  1S40 A;  1I94 L;  3SXH A;  1Y1W H;  4CJ2 C;  4B3S L;  4WFN 3; 
#chains in the Genus database with same CATH homology
 1KDA A;  2A74 C;  1Y1W B;  3KF8 A;  3VYT A;  1BCP D;  4OIJ A;  1B50 A;  1MBY A;  3RUZ A;  2RSN A;  5D3I B;  4ZKC B;  3BVM A;  2IX1 A;  2AWN A;  1B3A A;  1JQY D;  5EKI A;  3S1N B;  4C3J B;  3S9W A;  3SK8 A;  5CV7 A;  1I4G A;  1EEF D;  4L63 B;  1QNU A;  2VXW A;  4OO1 H;  2RSO A;  5FO9 B;  2KUM A;  2CQA A;  1FR3 A;  1WCM B;  2Y0S B;  1I6V C;  4IUT A;  2EY6 A;  1Q8I A;  2J4X A;  3K58 A;  1BCP B;  5KYI A;  3TP7 A;  2VNU D;  4RA8 A;  4DF7 A;  1GOZ A;  4K5X A;  1JCK B;  2JE6 I;  4PV1 C;  5C4Z A;  2F0G A;  2PMZ B;  1CI3 M;  3TSS A;  3GQB A;  1SAP A;  5IT9 L;  1TWA B;  1Y8O B;  2TSS A;  2F0E A;  4PQX A;  3ND9 A;  4JK1 C;  3ZYY X;  4OL7 A;  2WB1 B;  3BVZ A;  3VYS A;  1ML0 D;  3HOY B;  1QE6 A;  2AQ3 B;  1SSO A;  4KD3 A;  1EQT A;  1V43 A;  2MPM A;  2L1B A;  4FF3 A;  5EKL A;  5K36 H;  2WAC A;  5C4J B;  3MFG A;  2EY1 A;  1SEB D;  1JOQ A;  1VF7 A;  1EY6 A;  1B9N A;  4F7X A;  3I90 A;  1QJO A;  5G3L F;  3EA6 A;  1D5Z C;  1ROD A;  5C0X I;  3CKI B;  1KDC A;  4IUU A;  3ERO A;  3OWF A;  2A6E C;  4WJW A;  3AMU A;  3GTJ B;  4QF4 A;  4C3H G;  1F2Z A;  1TS3 A;  2VB2 X;  2BOS A;  1STA A;  3QWN A;  3T16 A;  3H94 A;  1H9S B;  2PO4 A;  3HS0 C;  5M5X B;  1TII D;  5KND A;  3FPU B;  3U9S A;  2B2Y A;  2MHV A;  4HED A;  1X3Q A;  2JP1 A;  1H9M A;  2FMM A;  3A8I E;  1PTO F;  3IFD A;  3OPO A;  5DM6 3;  3JAM E;  2X6G A;  3J7A V;  4CGY B;  2Z1C A;  1YNN C;  3TP5 A;  1KAA A;  1CZW A;  5CV6 A;  2TMP A;  1TT2 A;  1D6E C;  5DM7 3;  1LV9 A;  4CKB A;  3NTH A;  5IIF A;  3FEW X;  2F0T A;  2F0O A;  1EYD A;  2KOL A;  3BS1 A;  1J9O A;  1BXT A;  5AFW A;  4RKL A;  1SMY C;  1CQV A;  2LMC B;  2NN6 H;  5KIX A;  1HQR D;  3FKI B;  2RDG A;  4X3T A;  4IFD G;  3P75 A;  1SJE D;  2EPB A;  1BDO A;  3KBG A;  2B2W C;  1ILQ A;  1FGB D;  1I50 B;  3J80 E;  1TWC B;  2Q8I B;  1E0B A;  1EIG A;  1KTK A;  1SJH D;  2B39 A;  2WKC A;  2E74 C;  1V8Q A;  4ID6 A;  3HOZ B;  2XWB B;  1H9K A;  1S4Z A;  3S2H B;  5KNB A;  5C5M A;  2K5D A;  1STB A;  2E75 C;  2F0Q A;  2HCI A;  2HUG A;  4FXD A;  2K03 A;  3S2D B;  2FFK B;  1X32 A;  2KHS A;  3I73 A;  3DHQ A;  3KLS X;  1S5B D;  1GUG A;  1ONL A;  3DEO A;  1KDB A;  2B2V A;  3TZU A;  1MGS A;  3GTM B;  4K5W A;  1EL0 A;  4AYB B;  3DEP A;  3QOL A;  3BDL A;  5I6Y A;  1DON A;  5KEE A;  2LY7 A;  3OSO A;  4DK0 A;  1AZQ A;  2F0H A;  2A69 D;  3EJI A;  4XYQ A;  3D4W A;  1DJR D;  2N88 A;  4XDX A;  3IFT A;  1I3Q B;  3EQL C;  3QOJ A;  4OHJ A;  1EY8 A;  2EY5 A;  2JYO A;  1ESF A;  4U68 A;  1GJX A;  4HAE A;  3SVM A;  1PFM A;  2IX3 A;  1EEI D;  5CMD A;  4C3J G;  3VR6 A;  4EQP A;  3I4L A;  3GV3 A;  3MVV A;  2RBM A;  1HUN A;  2HDM A;  3W3A A;  2EYH A;  1SBB B;  1G2S A;  1IW7 C;  3R93 A;  4OIK A;  1WD1 A;  1KNE A;  4UDU C;  2LS0 1;  4IUN A;  5TSS A;  3CU7 A;  5FK9 C;  5C44 B;  4NDX A;  2F0K A;  3QB3 A;  1IW7 D;  1PTO H;  1LO5 D;  1PFN A;  3OW7 A;  3R2I A;  2F1M A;  1PZK D;  1LTS D;  4RGT A;  1TS2 A;  3Q23 A;  5CBE E;  5M9O A;  4FP5 D;  4LJZ C;  3PIP 3;  3R8B A;  5M3F B;  1I4H A;  4S3S A;  4KK7 A;  3QJY A;  4RFB A;  3C2P A;  2K33 A;  1RTN A;  4IQZ A;  1XYI A;  3SE0 A;  1GUS A;  4V0B A;  2J0T D;  2HCC A;  5CV9 A;  2QDB A;  4MHE A;  3T4A C;  1PXU A;  3ITP A;  3H3V C;  2PW7 A;  1DYQ A;  1BUV T;  4FF4 A;  4KY6 A;  3PUV A;  1EY5 A;  1STG A;  1ILP A;  1Q12 A;  4E6I A;  5M3M B;  3PUY A;  1GUN A;  2O2L D;  5C4X B;  3VR5 A;  2F03 A;  1DOK A;  1ZYR D;  1A6X A;  3D31 A;  3MHB A;  3A8J E;  3M85 A;  4CKC A;  4DN4 M;  5BN5 A;  3BYT B;  5T1G A;  1EYC A;  3LWE A;  3PV0 A;  3UI2 A;  1S5F D;  4DXG A;  2SEB D;  4KV6 A;  1R4P B;  1G2T A;  2R93 B;  1SYF A;  1H9S A;  3VYU A;  3NK9 A;  4G4K A;  4NMZ A;  3K5N A;  1XXG A;  5JVH 3;  3EVQ A;  2ZXO A;  1WTP A;  4K5V A;  3GTO B;  5IGF A;  3E5S A;  1WTQ A;  2KA7 A;  2NVY B;  3VR3 A;  3KLS A;  1CTM A;  4IUP A;  1F9Q A;  4KKU A;  3WDN A;  2AWO A;  2IX0 A;  2L0C A;  3I91 A;  4HSP A;  2R92 B;  1PFB A;  2A68 D;  1O80 A;  2CVR A;  2PZW A;  1UUP A;  2K05 A;  4RWS C;  4IFD J;  4TRD A;  3N52 A;  2B2U A;  3MXN A;  5FLX E;  1EY0 A;  3M7G A;  5CGK A;  1QB5 D;  2G9D A;  3BYY B;  2DNC A;  5CV4 A;  1U4L A;  1BQQ T;  2F3V A;  4KY5 A;  3L3O C;  4BA1 I;  2BA0 A;  5FOB B;  2RVL A;  4C3I G;  2F0D A;  1JB3 A;  3J80 L;  4BBS B;  3SHL A;  1G29 1;  1LTT D;  4RAU C;  1CA5 A;  4FF1 A;  1LT3 D;  2XIW A;  3M4Y A;  1LTG D;  2BA1 A;  2O5J C;  1PZJ D;  5CYU A;  4KI0 A;  3KLR A;  3P20 A;  3PUZ A;  2A6H D;  3S14 B;  4CJ0 B;  4QUF A;  1PTO C;  1OXT A;  4B08 A;  3O13 A;  5DNF A;  3M4O B;  1B1Z A;  3KK7 A;  3W2D A;  4IFD I;  1W6K A;  5LL6 X;  1AW7 A;  1BCP C;  1Y1V B;  4YIJ A;  2KEE A;  1TQO A;  4XQQ A;  1D2B A;  1S5E D;  2F0N A;  1JWM D;  5JEA J;  1STE A;  2EZV A;  1CHP D;  4ZLT F;  4A3K B;  2EYF A;  4DXF A;  2D9U A;  2ZXR A;  4KJO A;  2F0V A;  1L0X B;  5J39 A;  1YNJ D;  2EYP A;  3NTK A;  1E2Z A;  2R7Z B;  2BE5 C;  2B63 B;  2Z4I A;  1H9R A;  4PNY A;  4ZQ3 A;  3OWE B;  1STH A;  1NR2 A;  4CBV A;  2JXM B;  2F0J A;  1D5X C;  3V2T A;  2DNE A;  3CQZ B;  5FKA C;  2I07 B;  2PPB C;  2YYZ A;  2B8F A;  5KNC A;  3R2T A;  2B2T A;  4K6D A;  2SOB A;  1HRJ A;  5JEA H;  2K5W A;  5C3X A;  4J1M A;  2JA8 B;  2E2J B;  2F0F A;  3SEB A;  4ME5 A;  1LAC A;  5JVG 3;  4IUV A;  1SNO A;  3A55 A;  2A73 B;  3QIA A;  1FNU A;  2EOT A;  3L7Z C;  5C4H A;  2OT2 A;  3CHB D;  1PTO B;  2EE1 A;  2IW3 A;  3T56 B;  5EPK A;  2KEC A;  3OIQ A;  4H0L C;  2D2C C;  3HP3 A;  3NUC A;  3IAY A;  1ESR A;  3DM1 A;  3K5O A;  3S1R B;  1MD2 D;  2JEA I;  4L6T B;  5C0X H;  5IGC A;  4UAI A;  5HUR A;  1HPC A;  4KKT A;  2NYZ D;  2L4N A;  2E2I B;  2K1B A;  2VB3 X;  2KED A;  1B44 D;  3GTG B;  3HEJ A;  3AU7 A;  4F8M A;  1XX8 A;  1XWE A;  4HR7 B;  4IZ8 A;  1LLR D;  4IAL A;  4NP5 A;  4A3B B;  3U9O A;  5EPL A;  1EFI D;  2CW0 C;  4DU9 A;  1KAB A;  1CFM A;  1QIL A;  3NHH A;  4C2M B;  1ET9 A;  4R8I A;  1WTV A;  1U4R A;  4XYO A;  1ZYR C;  1GUO A;  5NUC A;  1RJT A;  5IOC A;  4KN4 C;  2LKV A;  3OIP A;  5ISR A;  3V96 A;  3BG3 A;  3QG1 A;  3J7Y W;  2B2Y C;  4K14 A;  4H44 C;  4M8A A;  3X3M A;  2F0S A;  1QOH A;  4B9X A;  1OXV A;  2A5H A;  4ULL A;  3M3Y B;  3G6J B;  4ZRZ A;  2EVB A;  4RKB A;  4B9W A;  1BF4 A;  2DN8 A;  4OO1 I;  5C6A A;  1VMP A;  3A8K E;  3K0Y A;  4K2L A;  3NWS A;  2EYM A;  3GTP B;  1TWF B;  2O5I C;  1TKW B;  3ND8 A;  5C3W A;  2L9H A;  2NTS A;  3CRL C;  5J1Z A;  1CM9 A;  3MWY W;  1Q3L A;  4HMI A;  5ELB A;  2RDH A;  3IKJ A;  2D5D A;  3GTQ B;  1EOT A;  1LTR D;  2Q8R E;  4PMB A;  2A6H C;  2KVM A;  2EYO A;  4DNR B;  4C1N K;  4X3K A;  1A15 A;  2A69 C;  4WRD A;  2LFN A;  3D4R A;  1OXX K;  5C3E B;  3T13 A;  2PW5 A;  1DM0 B;  2NN6 G;  5ELD A;  2NB0 A;  2F0W A;  3RMH A;  3OMG A;  5IGE A;  4NW2 A;  3PUX A;  2AUJ D;  2DY8 A;  3V05 A;  5BN3 A;  5I9P A;  2JSO A;  5ELC A;  3GV6 A;  1EZ6 A;  4HTH A;  3NPP A;  4A3J B;  1SNC A;  2EYL A;  1IHZ A;  3TP6 A;  3BZD B;  4TQU S;  1YNJ C;  4WOR A;  2E2H B;  1E2W A;  5CV5 A;  1Y8P B;  2KCN A;  1DOL A;  4G7O C;  4KHV A;  4G57 A;  1PTO D;  1G6Z A;  2EDG A;  5JPM C;  3D4D A;  4BA2 I;  3HOV B;  2XRS D;  2JEB I;  1STY A;  4IUQ A;  1RDP D;  4BS9 A;  1EY7 A;  3C1F A;  4LAA A;  4KD4 A;  3P1H A;  5I6W A;  2KJX A;  5IGB A;  4Q5V A;  4XT1 B;  1WTW A;  5A2Q E;  1F2Y A;  1I4P A;  4K8J A;  5E1F A;  3I4N B;  2V4D A;  3Q0A A;  2PYK A;  1LAB A;  2R6G A;  1WTO A;  1C4Q A;  1UEA B;  2VUM B;  4RCO A;  3HRZ C;  4ILW A;  4Z9C B;  4HN7 A;  2IJ0 A;  5K36 G;  1TWH B;  5G3L D;  1K83 B;  4QCL A;  5IGG A;  4O1N A;  2NBF A;  1B2T A;  1GHK A;  2DY7 A;  1WD0 A;  2XN9 C;  2HQE A;  2NN6 I;  2CW0 D;  2I46 A;  2FJ2 A;  4U67 3;  1Y69 U;  1SYC A;  1BOS A;  3OMC A;  4CJ1 B;  4C56 C;  3Q22 A;  1EWH A;  1D5M C;  1E2V A;  1FNW A;  5LL6 S;  4PMW A;  1SXT A;  3VR4 A;  1LTA D;  4P2C B;  1MSG A;  3E0J A;  1TR5 A;  3S17 B;  1BBX C;  3K6O A;  1B53 A;  1JE4 A;  4MN3 A;  3D6C A;  1C8C A;  3DUZ A;  1CK1 A;  4O42 A;  1PZI D;  1KNA A;  2JA7 B;  1GUW A;  2PZT A;  3E6Z X;  5I2Y A;  4KHZ A;  2KQ3 A;  4R9W A;  1D1I A;  4DK1 A;  5JEA G;  3SDZ A;  4XIG S;  3IL8 A;  2FHT A;  1O7Z A;  2F0P A;  3I72 A;  2PQE A;  2L12 A;  3NQI A;  1MSH A;  2RA4 A;  2EY2 A;  1PRT C;  1Q1B A;  2MUY A;  3MXU A;  3G7L A;  5KYL A;  1DXM A;  1O78 A;  3RD4 A;  2AUK A;  3M7N A;  4XT3 B;  1WTX A;  2ID0 A;  3I3C A;  2X69 A;  1PRT F;  2SNM A;  1TY2 A;  3BVG A;  5HGT A;  1JIC A;  5EJW A;  4HSV A;  5FO7 B;  1DOM A;  3KUP A;  1H9J A;  1TS4 A;  2ZXP A;  1RF2 D;  3FRP B;  1JR0 D;  1VF5 C;  1SNM A;  2M2L A;  4RGN A;  1VCI A;  2WII B;  4KJN A;  5JOB A;  4FYD A;  1SYE A;  5J22 A;  5CR3 A;  1VDZ A;  4EQN A;  3RZO B;  4OGQ C;  4ZAI A;  4DGZ A;  2F3W A;  5BN4 A;  3NBI A;  2K01 A;  1EZ8 A;  3DWA A;  3HG9 A;  4KMU C;  2R3Z A;  4IFD H;  1PLF A;  4XQJ A;  2AQ1 B;  4ZYS A;  3DMU A;  1X3P A;  1JC7 A;  2ICI A;  3WOF A;  5M5W B;  5C0X J;  2WKD A;  2XSC A;  3GD7 A;  4FVM A;  3K59 A;  1F9R A;  5C5L A;  3N6R A;  2QF7 A;  2YU9 B;  3MZ5 A;  1JOK A;  2B2T C;  1JWU D;  1T5E A;  3MC0 B;  4DA2 A;  3ONA B;  5IGD A;  3Q6S A;  4DAY A;  4C1N I;  2NVT B;  2NZ1 D;  4ZUI A;  2HDL A;  3DWQ A;  4BY1 B;  4TSS A;  3VA7 A;  1Z6H A;  5D65 A;  1RD9 D;  3TDQ A;  1CT1 D;  1R9T B;  1NCV A;  1PRT B;  3R3O A;  4IUR A;  2EJF C;  1MI2 A;  1GUT A;  4MIU A;  4QB4 A;  3S1Q B;  3PO2 B;  3A7A B;  2JA6 B;  2F4I A;  3NE5 B;  2F0U A;  3T51 B;  5E4W C;  1HTP A;  3H0G B;  1B4O A;  3MFY A;  4RHS A;  4NKL A;  1IYU A;  3NQT A;  2PZU A;  5FLX L;  5EQ0 A;  3GO5 A;  1AP0 A;  4M1U B;  4DFA A;  5COY A;  3WOE A;  3QO2 A;  1HUM A;  5LHY 1;  3NBH A;  1JWS D;  2MP1 A;  2CHB D;  5M5Y B;  2EJM A;  1Q90 A;  4I7Z C;  2WIN B;  1F9P A;  2D62 A;  1EU3 A;  1TU2 B;  1K8O A;  1HA6 A;  2BCO A;  4K6L A;  4RGM A;  3GP7 A;  4H13 C;  1V1P A;  4HCS A;  3SR1 A;  1GXD C;  3BDO A;  2RDF A;  4KKS A;  5JPN C;  3TME A;  3PMF A;  1A3V A;  2RQX A;  2QEJ C;  1SFO B;  5I2X A;  3MAQ A;  3NXW A;  2M9V A;  4XXE A;  4RHR A;  1I4Q A;  3MTS A;  5EKK A;  4QIW B;  4KY7 A;  4H7B A;  3MXG A;  2IPK D;  1F77 A;  4R8N A;  1U4P A;  1J8I A;  3EFX D;  1KLG D;  3HKZ B;  2C5C A;  1IL8 A;  4A3F B;  1AN8 A;  1I4X A;  4A93 B;  1SE3 A;  2WV6 D;  4JBW A;  2ICE C;  2N55 A;  1BO0 A;  4X3S A;  1IKM A;  4C3I B;  2XRQ D;  3KBX A;  2EJG C;  2B2V C;  4K2K A;  3PUW A;  5T1I A;  5JJZ A;  5EBD A;  4A3M B;  3TBI B;  1XTC D;  1HQM C;  2MJ8 A;  3MA2 B;  1SYG A;  2L55 A;  1ZKO A;  3FVQ A;  1DD2 A;  5E4X A;  1FYC A;  2NUC A;  1PYW D;  3T53 B;  1HCZ A;  2IWH A;  2NVQ B;  3SK4 A;  4CKE A;  1S5D D;  1DZ1 A;  2XWJ B;  1SE4 A;  1EIH A;  5K5P A;  2OF1 A;  1ENA A;  4N9P A;  2Q8T A;  5D3D A;  2ZT9 C;  5EBC A;  3I8Z A;  1EYA A;  3S16 B;  2H1E A;  1U4M A;  1JOO A;  2PNR C;  1ICW A;  3RLF A;  4DNT B;  2R61 A;  2QKI C;  3LNN A;  1G8Z D;  3A54 A;  3MEH A;  5JAV A;  2M00 A;  1LT6 D;  3X3N A;  2G9H D;  1STN A;  1IKL A;  1TS5 A;  2SNS A;  3FDT A;  3LX0 A;  1SDF A;  1R4Q B;  3S1M B;  2NTT A;  3S15 B;  5KGU A;  4BBR B;  5C0X G;  3OOC A;  4DAV A;  4RGO S;  4FF2 A;  2F0M A;  3DWP A;  1RCV D;  1PMR A;  2FMC A;  2OEO A;  4FXG C;  1ZEQ X;  1OXU A;  4A3E B;  1I4R A;  1QNK A;  1A3U A;  2J7Z A;  2A6E D;  1QG7 A;  4F87 A;  1M8A A;  4LK1 C;  3J81 E;  1B9M A;  3C3L A;  4EQO A;  1UAP A;  3H91 A;  4FO2 A;  5F2D A;  1ENC A;  4Y7N B;  2NVX B;  3URY A;  1II3 A;  2SDF A;  1VMC A;  3C46 A;  1KLU D;  3NTI A;  1NUC A;  1OO9 B;  3JAM L;  1WVL A;  4F88 A;  1WTR A;  4KTA A;  4TKO B;  1HHV A;  4XQN A;  1C48 A;  4PMC A;  3K7A B;  4ZKB B;  2GA4 B;  4FXK C;  1SNP A;  1SND A;  3LWU A;  4QMG A;  1U9R A;  3D3R A;  3HOX B;  1V1O A;  1EWC A;  2K28 A;  1T5X D;  4LMQ D;  2L5T A;  1EY9 A;  1FD7 D;  1Z47 A;  3K5L A;  5IT9 E;  4QUC A;  3GTL B;  2B2U C;  3FMC A;  1M4V A;  4BWG B;  1ENF A;  1K8M A;  3C1E A;  3HGB A;  4A3G B;  3I4M B;  1NSN S;  3ERQ A;  2WP8 J;  3BDC A;  3VR2 A;  4DAP A;  4ABN A;  1AZP A;  1SE2 A;  2JA5 B;  4X3U A;  1Q1E A;  3SK5 A;  1IYV A;  3SK6 A;  2L11 A;  3TP8 A;  1TVX A;  1AEX A;  1FNV A;  2E2D C;  3I70 A;  3RZD B;  4OO1 G;  1RHP A;  5DAU A;  3TZD A;  2PCF B;  5A35 A;  2K7V A;  1NAP A;  3VYR A;  4ZK9 B;  3K57 A;  1CHQ D;  2K32 A;  4RH6 A;  2BDN A;  4Q0F A;  3MXP A;  1HA5 A;  1OXS C;  1EQV A;  3NSW A;  3L9A X;  1A2T A;  2IT1 A;  4GZY C;  2NWG A;  1LT4 D;  4ZUJ A;  5ELF A;  2K04 A;  3OHX C;  2EXZ A;  2H4O A;  2K6A A;  1G91 A;  1A2U A;  3D6W A;  2E76 C;  3K5M A;  5A2Q L;  2Z8L A;  3D8G A;  1SNQ A;  4RCN A;  2BE5 D;  1F2M A;  3A7L A;  1CA6 A;  1HXY D;  2OXP A;  5CV8 A;  2A68 C;  1O7L A;  1A3T A;  1YNN D;  3DXJ C;  4KN7 C;  1UNS A;  4IN3 A;  1HFG A;  5EPJ A;  3PO3 B;  2EYJ A;  4A3D B;  4L8J A;  1GHJ A;  4HCE A;  3FPP A;  2K5Q A;  2Z4H A;  2MGS A;  1F2L A;  1LT5 D;  1Z7T A;  1QWY A;  3H09 A;  4G7H C;  2ENB A;  1BCP F;  2QCP X;  5CBA E;  3Q24 A;  3HOU B;  4V19 0;  1O7Y A;  1Y8N B;  1RTO A;  1NR4 A;  4I65 A;  2O4X A;  1HFN A;  1EU4 A;  1TY0 A;  5CC4 A;  2FIN B;  3F2U A;  2RKS A;  1DCZ A;  2AQ2 B;  5IOD A;  1ET6 A;  4C3H B;  5E3F A;  4EVO A;  3VA5 A;  2XVS A;  2X6L A;  1F9S A;  3HZX A;  4J8Q A;  4HMJ A;  5KRU A;  3NWT A;  2C9O A;  4BY7 B;  1RKN A;  1CZG A;  1LTB D;  2F0L A;  4N9T A;  1SMY D;  3P7J A;  4FNF A;  1LTI D;  1ZXT A;  2QIL A;  5FO8 B;  5DEH A;  5I9O A;  5ELE A;  1S5C D;  3HOW B;  1AFP A;  3AB9 A;  1SYB A;  1TWG B;  2WAQ B;  1L0Y B;  1EY4 A;  5EGT A;  1D1K A;  4EGV A;  2XNA C;  3A56 A;  4J6H A;  2F0I A;  2IL8 A;  2KCC A;  1PRT D;  4K8I A;  4XTC S;  3CRK C;  3PIO 3;  1I6H B;  1CQF A;  2BDO A;  3GTK B;  5COR A;  3NP8 A;  1JOR A;  1PDQ A;  1V1P B;  4G7Z C;  3H6M A;  4A3I B;  4ODG A;  1W6J A;  1BNZ A;  4CHT B;  5I4D A;  3J81 L;  3J7A F;  5D14 A;  1HTL D;  1SYD A;  2B8G A;  1BR9 A;  3TN2 A;  2B2W A;  1QCB D;  3SXH A;  4CJ2 C;  4WFN 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...