1PZID

Heat-labile enterotoxin b-pentamer complexed with nitrophenyl galactoside 2a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
b'APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat-labile Enterotoxin B subunit
publication title 3,5-Substituted phenyl galactosides as leads in designing effective cholera toxin antagonists; synthesis and crystallographic studies
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin inhibitor
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pziD00
1CQVA 1D5XC 1RCVD 1ESFA 3BZDB 2ICIA 1D5ZC 3W2DA 1SBBB 1EU4A 1LT6D 1SXTA 3CHBD 4RGTA 1CHPD 2AQ3B 3DWQA 4ZYSA 3OWEB 1F77A 1V1OA 2WV6D 1AW7A 1LT4D 3BVGA 2RDHA 1SEBD 1JR0D 1XTCD 3O13A 1G8ZD 4DXGA 1M4VA 1BCPD 1JQYD 1LTID 1EEID 2XRQD 1HXYD 1TS3A 2R61A 1BCPB 1PTOH 1L0YB 1LT3D 1RD9D 5ELDA 1KTKA 1BCPF 1PZKD 4OHJA 4Z9CB 1SE4A 3MC0B 1ENFA 1RDPD 1KLUD 5FKAC 1I4PA 3V05A 4RCOA 1LLRD 2CHBD 1V1PA 2NTTA 1PZID 3EFXD 4BWGB 3EA6A 2Z8LA 1I4GA 4UDUC 1ET6A 3DWPA 4RGOS 5I4DA 3TSSA 1V1PB 1HQRD 2XN9C 4K6LA 1CT1D 2TSSA 2NTSA 2IJ0A 1LT5D 5D3DA 1DYQA 1PRTF 2XNAC 5D3IB 1BCPC 3SEBA 1B1ZA 1PYWD 1D5MC 1LO5D 1TS5A 2QILA 4L63B 1EEFD 2J4XA 1PTOD 1UNSA 5ELBA 1SJHD 1PTOB 1L0XB 1PTOF 1EWCA 3BYTB 1CHQD 1B44D 1HA5A 1S5CD 1S5FD 1S5ED 1FNVA 1FNWA 1EFID 4RHRA 3MFGA 5ELFA 2IPKD 1FGBD 3BVMA 1JWMD 3R2IA 1T5XD 4C56C 5TSSA 1ET9A 1PRTD 1LTAD 1JWUD 1PRTB 5ELEA 1I4QA 3R2TA 4RGMA 1FNUA 3GP7A 1I4XA 1AN8A 1LTSD 1D6EC 1HTLD 1STEA 2AQ2B 2XRSD 4O1NA 4L6TB 1XXGA 1KLGD 2RDGA 1TS4A 3BYYB 1TY0A 1JWSD 4DXFA 3R8BA 4TSSA 1SE3A 1PTOC 1TY2A 1JCKB 4RFBA 3DWAA 1SJED 5ELCA 4RH6A 2G9HD 1S5BD 1SE2A 3BVZA 3URYA 1I4RA 1MD2D 1TS2A 1EU3A 1GOZA 4RHSA 1LTRD 1FD7D 2O2LD 2QEJC 1QILA 1DJRD 1S5DD 1PRTC 1LTTD 2SEBD 1I4HA 5FK9C 1LTBD 3KLSX 2AQ1B 4RGNA 1RF2D 1BXTA 1LTGD 1CK1A 1UUPA 1PZJD
chains in the Genus database with same CATH superfamily
5M5XB 3DM3A 4DV7L 2YU9H 3DLLA 1D5XC 3S16B 1E1TA 3K5OA 3GQBA 5M5WH 1O7ZA 1I6HH 4IFDI 5AJ3Q 5LHY1 4KD4A 2BDOA 2V1CC 2L5TA 1H95A 1KNAA 4OEMB 3LNNA 4KY5A 4DR3L 4G7OC 2A69D 3BDLA 2YTYA 2JK8A 1B50A 2EXZA 1HXYD 1EZ6A 1X6OA 4A3JH 1JE5A 4B3ML 2NZOA 4A93G 1GUOA 4PZ6A 3GTPH 2MQHA 4BWGB 3P7JA 4EQ5A 1ILQA 2NB0A 1UE1A 3AU7A 1YVCA 2KBNA 4OIJA 4C3HG 1XWEA 4PZ8A 1DGSA 3HKZB 1XYIA 2B39A 1JORA 4ZCKA 5FLMH 1U0LA 4EQPA 1XNRL 4XYOA 5ELNA 2K6AA 4GZYC 3UDIA 4A3FH 4LF6Q 3EIVA 3VR6A 1Y69U 1GO3E 2L12A 3TBIB 2K50A 3PV0A 3Q23A 2R7ZH 3E9HA 2EXDA 1J5EL 1F9SA 1R4QB 5EGTA 4LFCL 5EJWA 1KABA 2WB1G 4ZUIA 4DV2L 2F0OA 3OMGA 1NE3A 4IOCA 2IWHA 3PO2H 1FGUA 4QCLA 3TP6A 2ZJPA 4OIKA 2XWBB 2K04A 3TDQA 1O78A 3CCJA 3NSWA 1CI3M 2C5CA 2DN8A 2R7DA 2F0FA 3G48A 3RN5A 4DR6Q 2VB2X 1HJPA 2R7FA 3H0GH 1SYBA 2R93B 5E7NA 5JEAJ 1YNND 3S2DB 2I46A 1N33Q 4LNQA 4GN5A 2PZWA 4LK1C 4DGZA 1OXUA 5A2QL 3GTQB 1PHJA 4JI2Q 1FD7D 4HR7B 2UXBQ 2LSSA 5IP9H 1QUQB 4AYBG 2E2IB 1HZBA 2B2UC 1LV9A 1B7YB 1HCZA 1CK1A 2B2VA 3K5MA 4C3JH 3AEVA 1AH9A 1KAWA 1NMFA 5LMNQ 1UEBA 4KY7A 2Z9HA 1EU4A 2ZM6L 2XVSA 2JYOA 3J7ZC 4IPCA 4CDCC 4UP9A 4BXXG 3IAYA 5JOBA 4A3GH 3OIQA 3EQLC 3CU7A 3RN2A 3UDGA 1HFNA 1WTPA 2JA7B 4DV1Q 2EYOA 4LF6L 1X65A 1V1QA 3S1RB 1CZWA 1HQMC 4P74A 3CCQA 4EQOA 4HSPA 1MBYA 4Q0FA 3CCEA 3BJUA 4BA2I 2EY5A 3DHQA 3K7UC 4KI0A 2KCNA 1EOTA 5NUCA 2YU9B 3OTOQ 3NTIA 5I4DA 1J9OA 5D65A 4B9XA 4POFA 3LGJA 4CBVA 2VXWA 5M5WB 1I6HB 1G6PA 2XNAC 4LW1A 4A3IH 3ONAB 2A69C 2A73B 2OT2A 1DOLA 5E4XA 1K0RA 3G6EA 1GD7A 2O5IC 3W1GA 1UNSA 4DR4Q 1SJHD 4A3JB 2B2WC 1Z9FA 3WDNA 3OOCA 4BY1G 2DGYA 3M4PA 2E2HH 1HZCA 2KHIA 3R2IA 2J0TD 5KRUA 2UXBL 2HIVA 3G4SA 1O7LA 1FNUA 3A54A 3S1MH 4LFBL 1D1IA 2UXCQ 4B3TQ 3FHWA 1KLGD 2L11A 3BU2A 5LMNL 4OXPA 5K5PA 1W3SA 2SDFA 1VQAA 4B3SQ 1SE3A 2EQSA 2JP1A 4A3EH 5ELCA 1SJED 4A3FB 1WTQA 1NY4A 3ERQA 3PUWA 2I5MX 3SR1A 3QR8A 1MSHA 1EU3A 1SNDA 2F0TA 1P8LA 4FF3A 2F03A 2E76C 2NUCA 1FVIA 2NN6I 5JPNC 1Q1EA 3PO2B 2F0DA 1GXDC 3G71A 1XPUA 1EYGA 4CGYB 4C3IH 5IGGA 1A62A 2A19A 4CKBA 1J8IA 1YNNC 1RKNA 1VQ8A 3C46A 1JR0D 4ALPA 1B3AA 3I4MG 1EEID 4B3RL 1PTOH 1L0YB 4PG3A 3N52A 3R93A 2BH8A 4OHJA 3PO3G 4A3DH 4I7ZC 2PI2E 2RSNA 4ZLTF 4IPHA 1KLUD 2B63B 4DR4L 1I4PA 4RCNA 2VB3X 1SLJA 4JPBW 2F0VA 5CGKA 2PQEA 3VR3A 4ZQ3A 4PV1C 3PF4A 4KMUC 2FMCA 2B8FA 1NR4A 2CQOA 5KEEA 3CC2A 2E2JH 4NXML 2F4VQ 5H1SE 1N9WA 1C0AA 1E22A 2E5LL 4CJ1B 1X3GA 4DV4L 4B3TL 1IBKQ 3EN2A 4R4TA 3QOLA 3HOYH 4IFDJ 4MZ9A 2NVQB 5CV5A 1TS5A 3J80L 3WOFA 3NE5B 2FFKB 2IX3A 2F0EA 4LUOA 1KD1C 2AUJD 3BYTB 1S5CD 2PYKA 1RODA 2EYFA 1Z6HA 2N55A 1NJIC 5DM73 2VQEL 4YCVA 4DAVA 1PH9A 1Y1VG 3FRPB 4OO1G 2LY7A 1B9MA 4JI6Q 3E0JA 2NVYH 3HOVH 2K5QA 3CRKC 4K14A 1IYUA 4OX9Q 1I4XA 1AN8A 1B3QA 2B29A 3PUVA 3MXNB 3BYYB 4JBKA 4GLXA 4N8FA 4GLAC 1KC8C 4TSSA 1SYCA 3GDEA 4ZK9B 4FXKC 3VR2A 2I0QA 4WJ4A 1X9NA 2ZXPA 4POGA 4KLKA 1K0SA 4O0AA 2BE5D 1EYCA 3SDZA 3H09A 3I70A 3KFUA 1JB3A 5FJ8H 3MEHA 1EYAA 4L5TA 4F87A 1HZAA 3QJYA 5I6YA 5IP7G 3D4DA 1SNCA 2IHEA 4P72A 4GKKQ 2ZJQA 4ME3A 2Y0SB 1Y1WH 1C9OA 3HRZC 3S1MB 4M1UB 3JC66 4FF2A 1PH3A 2G9DA 3M4OH 1D5ZC 4IZ8A 2HUGA 1CHPD 1HZ9A 1QCBD 2ALYB 1U4PA 2H4OA 2D0PA 4YHHL 1NMGA 1II3A 4A3BH 4HJ9A 4KHPQ 3EROA 4FNFA 1IBKL 1RD9D 2OQKA 1EQVA 1VQ9A 4UY8C 2JA7G 1N34Q 1STAA 1LYLA 2N8NA 2B2YC 2A6ED 5IYCG 4IALA 1ML0D 2CWAA 4LJZC 1BOSA 1K3RA 1ZEQX 1A8VA 2CVRA 1IXRA 3GTKH 1G291 1X3FA 4ABNA 1KQSA 2EIFA 3KLWA 3QWNA 1O7IA 2XN9C 2UUCQ 2QKIC 4C3IB 5CORA 1CT1D 4RG1A 4JI3L 4CHTB 3OHXC 4G7HC 1SROA 4DAMA 1IBLL 2F3VA 2NZ1D 3NBHB 3T51B 3CD6A 4EVOA 1KRTA 1PTOB 4YY3Q 3PQIA 1D7QA 1F2LA 1SDFA 3K5LA 2L4NA 4A3DB 2PNRC 4A3JG 3GD7A 4RHRA 1SAPA 4QF4A 2K5HA 3TN2A 2E75C 4DUZQ 5CR3A 1ET9A 3NWSA 2K4KA 3TQYA 4YCWA 2VQFL 4OO1I 3T1YQ 4QJFA 3E9IA 5LMUQ 3S1NH 3J7AV 4K2KA 1G51A 4F7XA 1XPRA 4RAUC 3M9BA 2RCNA 4DV3Q 1PV4A 4XT1B 5C4JH 1L0WA 1MJEA 1SYFA 5C44H 3HOYB 3MXUA 1B8AA 3MAQA 5FLMG 3TP5A 2SNSA 3RZDH 3S1QH 1EQQA 1CTMA 3J81i 1H9MA 4J15A 1VQBA 2EYHA 3IKJA 3ZJYC 4DR1Q 4A3FG 3D8GA 1C4QA 2VY3A 2QEJC 2R7ZG 1U4LA 1DJRD 1VQFA 2K28A 3S16H 1Z47A 4OWTB 1LUZA 2NVYB 3HOVB 1E24A 3PO2G 2ZXOA 3K0XA 2YTXA 1STBA 1UWVA 2PI2A 3CCRA 5IIFA 1BUVT 2I5LX 3W2DA 1NAPA 4KHVA 1H9SA 3CHBD 4RGTA 3HOWH 1B9NA 1EQTA 2EY2A 3H0GG 1YJWA 2XRQD 3EBEA 1WTHA 2BE5C 4LFAQ 1VQLA 4DKAC 3GV3A 4DF7A 1CKNB 5JVH3 1DXMA 3L2PA 1Q3LA 1RTOA 1LLRD 2A6HD 2ZXRA 1PH4A 1VQ7A 2VUMH 1C7YA 4HIOA 1XJVA 2ZT9C 3NK9A 3ERSX 4DUZL 4OWWB 4UAIA 3M4OB 1A2UA 4C3JG 2Z6BA 2LFNA 3BZCA 2NTSA 3W5OA 3H3VH 5K36H 5LMUL 1TT2A 2R92H 2MHVA 5IGFA 1I50B 1LO5D 1NBWA 1PTOD 2HQLA 3SK4A 2LXKA 2ZTCA 1PTOF 4A3GG 3KF6A 5C4XB 1CHQD 2KECA 1PYSB 4DV7Q 2XWJB 3HOXG 1FNVA 3TEHB 4DR1L 3KBXA 4N9PA 4DFAA 2KCCA 1NSNS 3PIOA 3V2TA 1Q81C 5FLXc 1CM9A 4DR3Q 3KLSA 3EJIA 4YWMA 3TMEA 1H9KA 2AQ2B 2C35B 4O1NA 2R93H 3MHBA 2RDGA 3S2DH 5G3LF 1VQEA 4B3MQ 1DD2A 3NEMA 3HP3A 5IGCA 1YNXA 3R8BA 1TY2A 3CXCA 2B2TA 3BDCA 1MHWC 4A3IG 1JCKB 3OPOA 5FLXL 3J81c 2PQAA 1HR0W 2E2IH 1BR9A 3S9WA 1A2TA 1D1KA 5E3FA 3E0EA 3M3YH 3BZKA 1S5DD 2X69A 1EL0A 1UE6A 1LTBD 4P71A 1FL0A 4B08A 1XNRQ 5M3MH 2JSOA 2K03A 3A7LA 1WD1A 3S1NB 2Y0SG 1SBBB 4LF9L 5FOBB 3DWQA 3HG9A 2GA4B 1J5EQ 2WV6D 5C4JB 4XXEA 4LFCQ 5A35A 3CRLC 4KTAA 3VYUA 5C44B 3E6ZX 1XTCD 4DNRB 4J1MA 5C6AA 1VQHA 4MIUA 2ASBA 4DK1A 3OYYA 4DV2Q 1VQDA 4DXGA 3E3XA 4GOPC 3FKIH 3D3RA 3K7AH 2UUBL 1M8AA 4A3EG 1I94L 2GVBA 2I5HA 3A8KE 4V0BA 2EZVA 5JAVA 3S2HH 2JA8H 4KN7C 1W6JA 3GTGH 1QVGA 1ET6A 1WTWA 3F8TA 3MA2B 5HURA 3D4WA 1VS0A 4DNTB 4A3KH 4LF5L 5EQ0A 3CC4A 3UDFA 3M85A 4C3IG 1A3VA 4B9WA 4JW0A 2M00A 3HOWB 4I7AA 3KF8B 3K58A 1LTLA 2L1BA 1NCVA 1WJJA 2ES2A 2KEEA 2I07B 3NUCA 3A55A 4R8IA 1B44D 4XQJA 2A6HC 3UE1A 3ZYYX 3TRZA 2ATWA 2Z1CA 2ZM6Q 5FO9B 4A3DG 3VR4A 1SNPA 2L9HA 5IE8A 1XMQL 3CP0A 2P5ZX 2B8GA 2TMPA 2VUMB 2WB1E 2X6LA 1IL8A 3AFPA 3GP7A 2YTVA 2K75A 1PDQA 1PH5A 1HTLD 1SNQA 3DMUA 3H15A 3GV6A 5IT9c 2OWOA 2DUDA 2BCOA 1GUWA 4BBRG 1PH2A 1X55A 4JI1L 2HCIA 2R92B 3F2UA 3D0FA 1QZHA 1PTOC 4UPAA 4K6DA 4RFBA 1B4OA 1VDZA 3CCLA 3HOYG 2WAQG 1LTRD 4JCVE 4U68A 1H9SB 3A74A 2WKDA 1QILA 4MHEA 5IT9L 1H9RA 4JI8L 5EBDA 5FK9C 5C3EB 3T1HQ 5C3WA 3L0OA 4AYBE 2VNUD 1AFPA 2F0PA 2HHHL 1RTNA 2KUMA 2O4XA 1A63A 1TWHH 5AFWA 3HOVG 4JVZA 3FPUB 3I7FA 2WP8J 3CCVA 1QG7A 1V1OA 1IYJB 2MGSA 3J81E 4FDBA 2A1AA 1CA5A 4LF8L 1CSQA 2PMZE 1CA6A 2B63H 1AEXA 1TS3A 2LKVA 5C4ZA 4IUNA 4XDXA 4QGUA 3U9OA 2WKCA 4LFBQ 4JOIA 2GN5A 3V05A 1EIFA 3M3YB 4ME5A 3A5UA 3CKIB 5M9OA 3D4RA 2C9OA 1A3TA 2MPMA 2F0MA 5FJ8G 5M3MB 4NKLA 2RDFA 1U4MA 2RSOA 3NP8A 1VMCA 4HAEA 1DM0B 4PZ7A 3KF6B 3P1HA 2K33A 2KEDA 2MO0A 4KY6A 3KYHC 1Y1WG 2NVQH 4IFDH 3RLNA 4FXDA 2IL8A 5HGQA 5D3IB 3NXWA 3ER0A 2Q2IA 3GTJB 1EY6A 2EYJA 1NNXA 5CV9A 4TQUS 1BKBA 1F2ZA 5I6WA 3FKIB 2HD3A 3K7AB 4A3BG 3J80i 2JA6B 1I5FA 2FINB 5BN3A 3DEPA 1FNWA 2KENA 3C1FA 5C3XA 3NHHA 3J7YW 3S2HB 2JA8B 4R9WA 1YBYA 5KYLA 2BDNA 1UE7A 3GTGB 1LTAD 4MN3A 3CQZB 3T1HL 4Y7NH 1ESRA 2PQAB 4A3KB 3CF5A 4B3RQ 3RZOB 4J6HA 3Q8DA 2OTJA 2MUYA 1SYGA 1YI2A 1HH2P 4LAAA 2Z4HA 4IN3A 5I9OA 5HY6A 2JEBI 1QWYA 2V4DA 2Z0SA 4TVAB 2RVLA 3CW2C 3QOJA 3ULPA 2VW9A 5E1FA 1Q90A 5ELOA 3J7AF 4I65A 1P16A 3CMEA 3MVVA 4NXMQ 3TS2A 1YHBA 1I4HA 2E5LQ 4DV4Q 3Q0AA 2KCMA 3T53B 2F0SA 1CQVA 4GN3B 3VR5A 3CMAA 1Q1BA 1RCVD 4JI5L 1BQQT 3DXJC 4IUTA 2BA0A 3SK5A 4ZUJA 4X3SA 1QZGA 3E5SA 1AW7A 5JJLA 3NWTA 1DOMA 4L5SA 2VQEQ 5CMDA 1LTID 5A2QE 4NMZA 4JBJA 1U4RA 1TWAH 4Z9CB 2K01A 3X3NA 4IPDA 1RDPD 2WACA 4QQBX 5CBAE 3U58A 2JQOA 4KD3A 1SSOA 4IOAA 1V1PA 1EY9A 5C5LA 3EA6A 2A5HA 2L15A 3DM1A 3U9SA 4UDUC 2M2LA 1CQFA 4DV6L 2JXMB 1WFQA 2CWPA 2ZTDA 1TWHB 1CFMA 2TSSA 4LUZA 3BS1A 4X65Q 4CKEA 1HNWL 1STYA 5C0XH 3QO2A 2AHOB 1O7YA 4KN4C 4DAPA 3A8IE 4A75A 3MXPA 4PMBA 3GTMH 1L1OA 3Q6SA 1TR5A 1WTRA 3HOWG 4N8X1 4DU9A 1VQGA 1EWCA 3J80c 2E2DC 1WTOA 3AFQA 2B2UA 1KL9A 1FGBD 3SXHA 2Q8RE 4RWSC 4YHHQ 3HKZG 1DONA 2EYLA 4G57A 1LTSD 3NELA 1ZKOA 1TS4A 5EPLA 3J7A5 2XSCA 5KYIA 1A0IA 2EJFC 5BR8L 4DXFA 3X3MA 5K36G 2OXPA 1Y8NB 1B70B 2QGQA 2R92G 3SK6A 1HNZL 5GQOA 5JJZA 4L5RC 1KDCA 4R4CA 2NWGA 1XX8A 1F9QA 4DK3C 3D6CA 1GUGA 1ICFB 5KIXA 1VQMA 1K73C 3KDFA 4JI3Q 1HFGA 1VMPA 3PIO3 2EE1A 1IBLQ 4IUPA 4BY7H 2NYZD 1E0BA 1H9JA 3H3VC 3TS0A 5M3FH 4Y7NB 1X54A 1VQCA 3K5NA 3R3OA 4FVMA 4LF4L 5I2YA 1N36L 3OW7A 1QVCA 1SNOA 4KHZA 2R93G 4JI4L 4OONA 1GJXA 3KLRA 4C1NK 5IY0A 4X65L 2BA1A 2E74C 3GTLH 3T16A 4UP8A 4WRDA 1XMOL 2H5XA 3PUXA 1S40A 1BCPB 1STNA 1SFOH 2EJMA 2VQFQ 2HCCA 2LS01 3A0JA 3Q24A 4PMCA 4HTHA 4S3SA 4DN4M 2NN6H 4KKSA 2FMMA 3S17B 2JN4A 1AZPA 3FMCA 1PVOA 1X3QA 3FDTA 3U50C 5M3MG 2HQEA 3RUZA 1I50H 1LT5D 1PRTF 1GKHA 3Q22A 2PW7A 3PUYA 1SYDA 3IRBA 3N6RA 2ID0A 1A15A 3SEBA 5C4XH 1PYWD 4DR5L 4BXXH 1TKWB 4BS9A 1S72A 1L0XB 3SHLA 2QDLA 2JEAI 1TWAB 2F3IA 4UP7A 2MNAA 2YV5A 3FKIG 1S5FD 2RKSA 3HOUH 4G7ZC 3UDXA 1JWMD 1A6XA 3IL8A 2JA8G 4ODGA 1F9PA 2KOLA 1MSGA 4KV6A 1PFNA 1VQ6A 4CJ0B 5F2DA 3F2DA 2WINB 4A3KG 2D9UA 4MTNA 4K2LA 5KGUA 3MEFA 3J80E 1FJGL 3GTMB 2F0GA 4IUQA 3H3VI 3I56A 4DK6C 4ZRZA 1XNQQ 4RH6A 3KJOA 1S5BD 1JOQA 1DOKA 2AUKA 2F1MA 4QL5A 1UEAB 1CKOA 4A3CH 1SN8A 4BY1H 3KUPA 3D6WA 4DV0L 1WVLA 1G6ZA 1YEZA 2HIXA 3QG1A 5EBCA 4FYDA 4H13C 1LTGD 1UUPA 5J3BA 2X6GA 5ISRA 4C3HB 1BNZA 1CUKA 2Z4IA 4JBMA 2DJGC 3HZXA 2IY5B 4ILWA 4ZYSA 2Q2HA 1IL2A 4OGQC 5IYBH 1PA6A 1SEBD 2F0JA 1EZ8A 2D2CC 1EUJA 3NTHA 3F2CA 1BCPD 1YNJD 5COYA 1IKLA 5IWAL 1BCPF 1M90C 2OCEA 1K28A 3HGBA 1VQJA 1RJTA 3MC0B 3CCUA 2M9VA 4RCOA 3NQIA 1EWHA 3K6OA 2Z8LA 1L1OB 2QEXA 4ID6A 4BY7B 1QVFA 2GVAA 5M3FB 1RL2A 4QMGA 4ZKBB 2Z6KC 1BDOA 2OF1A 2F4IA 2PZUA 1VQOA 2Q8IB 3GTLB 3JAMc 3NBIA 4L63B 1I3QH 1J6QA 1EY5A 3L3OC 4EQNA 1SFOB 1ZXTA 3RLFA 2B63G 1OXSC 1XNQL 4IQZA 3PO3H 1HR0L 2HT1A 5IP9G 2K52A 2CCZA 5ELFA 4QY7A 4LF9Q 1WTVA 3PIPA 4XQNA 5JPMC 4AYBB 2IX1A 5C5MA 1Q46A 5GADC 1Q12A 3JAML 1SYEA 3T13A 4DAYA 1K83B 4L6TB 2UUBQ 3DUZA 1N32L 1I94Q 1E2VA 3D31A 3IFDA 1OXXK 1BBXC 3OW2A 2IX0A 1KDBA 2EYMA 4LF7L 3PSIA 1QUQA 1SE2A 4V190 1K8MA 4GLVB 2B2YA 3RMHA 3URYA 3VA7A 5C3EH 4Q5VA 1SMYD 4L5QA 3UE0A 1E1OA 4LF5Q 2OTLA 4OWXB 3A8JE 3FVQA 4N9TA 4NW2A 3HOUB 5G3LD 3P20A 5IYDH 1EIYB 1C48A 5JEAH 1SMXA 1NUCA 1JOKA 2IT1A 3T4AC 4HCSA 4DV5L 3M4YA 4O2DA 5KNBA 1SXTA 1IZ6A 2Y0SE 1GHJA 1GUSA 3OWEB 4X66L 1X32A 2R3ZA 2D0OA 3TZDA 3AB9A 3BVGA 4HEDA 2F0HA 2K1BA 1YITA 1G8ZD 1XMQQ 1HTPA 1KNEA 3SE0A 3AYHB 2F0QA 1WD0A 1X3PA 4JYAL 1WCMH 1VQ5A 1ZYRD 2CHBD 4BY1B 5T1GA 4DR2Q 2DNEA 1NR2A 1B53A 2R6GA 4JI1Q 1PH7A 2KVMA 2L0CA 1ILPA 2CH4W 3GTJH 2B2VC 4J8QA 5GAHC 2MO1A 2EYPA 3I8ZA 4K0KQ 1KIXA 1JMCA 2JA6H 1BCPC 1YNJC 1D5MC 1R9TB 4JI8Q 1C8CA 2UXDQ 3I90A 3FP9A 5L37A 1YJ9A 2K5NA 2HHHQ 4AQYL 3F2BA 4HN7A 3HOZH 3RLOA 4X62Q 4GNXA 4JV5L 1EFID 5BN4A 3MFGA 2KCTA 3CQZH 3S15H 4C56C 1TWFH 2SOBA 4KK7A 3RZOH 4F88A 4LF8Q 1U9RA 5DLQE 3QIAA 3H91A 4WFN3 2N49A 1STEA 1TWCH 4XQQA 4HJ7A 2D5DA 2CW0C 4E6IA 1M1KC 4IJLA 5IGDA 1TWGH 5C0XG 2N78A 1I3QB 3I4MB 4X3UA 5M5YH 4IURA 1VCIA 1TS2A 3KJPA 1AE3A 1EY0A 3KK7A 1KXLA 1S3OA 5CBEE 4A3MH 3PO3B 1E3PA 2WAQE 3TP8A 3F1ZA 4JI7L 3I4NH 4KKUA 1RF2D 4TKOB 2B3GA 3EFXD 4K8IA 2QA4A 4DR2L 2MJ8A 2PPBC 1AP0A 1DCZA 1LABA 3NENA 3VDYA 4NPSA 1V8QA 1K8AC 4QIWE 3SGIA 4DR7L 5EKLA 1XPOA 4JI0L 1F77A 3WWVA 1AZQA 5FO8B 2NVXH 4K0KL 1HNXL 5EPJA 5T1IA 1VF5C 1MIUA 5FLXE 3I55A 1TU2B 1M4VA 5TSSA 3U4VA 1LT3D 1KTKA 1W2BA 1SMYC 4KJOA 1PZKD 2UUAL 2UXDL 1Q8KA 1OO9B 1E2ZA 1YHQA 4M8AA 1PZID 1UE5A 4K5VA 2H1EA 3RD4A 3K0YA 4X62L 3RR5A 1Y1VB 1W6KA 3DWPA 3ND9A 4BY7G 3LWUA 1EY8A 4HSVA 4KKTA 5M3FG 1K3BC 1XTDA 4RA8A 2L55A 4XT3B 5HGTA 3CCMA 2QILA 1EEFD 2J4XA 2MFIA 2Q2TA 1BO0A 3G7LA 4A3LH 4H44C 4Y52H 2IW3A 1IW7D 5AJ3L 2XIWA 4DAYB 1HA5A 1DZ1A 1WCMB 1ZYRC 5IGEA 1PFMA 3TZUA 4JI5Q 1JE4A 1L1OC 2PO4A 3GTOB 2IPKD 1WTXA 4ZKCB 2A74C 1CSPA 1MI2A 1PH8A 1V43A 2EJGC 2LMCB 2XTIA 4GKJQ 3MXNA 5ELEA 1YZ6A 2NN6G 1JOOA 3OMCA 4L8JA 4AIMA 4FF4A 1GM5A 1D6EC 1EIGA 4K5WA 2DNCA 1IBMQ 1PH1A 2KHSA 3SVMA 3MWYW 5IOCA 4GOPA 2YYZA 1KHIA 1OTCA 5JJKA 5C0XI 5C4XG 5JJIA 1G2SA 3I91A 4DV6Q 4HJ5A 4BBSH 4JC0A 3QB3A 4RHSA 4TRDA 3H6MA 3HOZB 1K8OA 1JICA 1R4PB 2AWOA 1GUNA 2PNHA 3HOXH 1HNWQ 1K9MC 3S15B 1TWFB 3KLSX 4K8JA 2AQ1B 5GAGC 3HOUG 5JVG3 1PZJD 4R4QA 3NQTA 1TVXA 2JA5H 1STGA 1TWCB 3FEWX 4RKLA 3H94A 2AQ3B 3FPPA 4DUYQ 1JJ2A 1VQIA 5IODA 1PXUA 1VQKA 5KNCA 1JJCB 3O13A 1TWGB 4HMJA 5CYUA 4ZAIA 1KRSA 2NBFA 5BN5A 5ELDA 5LL6S 5M5YB 1HHVA 4APVA 1Z7TA 1SE4A 3B6YA 4DR6L 3MXGA 5FKAC 4A3MB 5IT9E 4EX5A 2O5JC 2K32A 1BVSA 3S17H 2NTTA 1PMRA 1N33L 1NTGA 3I4NB 4A3CG 5BR8Q 3C3LA 3GTPB 1GHKA 1QNUA 2NVTH 4BA1I 2G5DA 3M7NA 1T5EA 1QB5D 4JI2L 1HNZQ 2F0WA 1Q7YC 4GKJL 1VQ4A 3NBHA 4C2MH 1Y8PB 2AWNA 1V9PA 3DEOA 4GNXB 4X3TA 5I2XA 5C44G 1WYDA 2CH4A 3S24A 2NVXB 1VQNA 1IBML 3CAMA 4A4IA 5IYBG 4U673 1JB7A 1LM0A 4DA2A 2HDMA 2EY6A 5I9PA 2LXJA 3ITPA 5LL6X 4LF4Q 1N8RC 1SR3A 3C2PA 2R7ZB 1ENAA 1N36Q 1T5XD 4JI4Q 4DV1L 5DM63 1PRTB 3ND8A 3S14H 1E2WA 2KQ3A 4QB4A 2JE6I 2K5VA 1D2BA 4X6AH 1XMOQ 1Q8IA 2XRSD 5J1ZA 3HKZE 2Q8TA 2JA9A 1F2YA 3HS0C 1JWSD 3OIPA 5DEHA 3CCSA 3OTOL 4DUYL 1IW7C 4HIKA 2MP1A 3H0GB 4A93H 1EY7A 3BVZA 1MD2D 4FO2A 1Y8OB 1VF7A 2VS1A 3VYSA 5CV4A 1BF4A 2RA4A 4CDEC 1GUTA 4C3HH 1STHA 2VUMG 2CQAA 5DAUA 5E4WC 3PIP3 3CPWA 1QJOA 4RGNA 2IHFA 4HCEA 5D3DA 4DR5Q 2OQ0A 3HEJA 2ICIA 1VQPA 3PMFA 5LMNW 1ICWA 4C3JB 2VL6A 5J22A 4BBRH 2QDBA 1CKNA 2RDHA 3I4OA 3NTKA 3STBD 2DJFC 3K8AA 2UXCL 3MTSA 1JT8A 1MKHA 2K5DA 2R61A 1PYBA 1BBWA 4LUVA 4BBSB 2QW7A 4G4KA 1ENFA 3I73A 4A3GB 4B3SL 2F0NA 3A7AB 4FXGC 5C3EG 3HOXB 2D62A 2BOSA 1X56A 2A68D 3BDOA 3ULJA 4JK1C 1AE2A 5EKKA 4C1NI 1FJGQ 1U5KA 2CFMA 3K81C 5IYDG 1YIJA 1HQRD 3AQQA 4K6LA 5JEAG 2JA5B 2IJ0A 1EOVA 2WFWA 3LX0A 4YIJA 2B2WA 1PFBA 5D14A 3BG3A 3VYTA 4DV0Q 2HDLA 2K5WA 1TQOA 4A3IB 2FHTA 3UI2A 2FXQA 3VA5A 3KBGA 3OWFA 1TXYA 5J39A 2FJ2A 1A3UA 4PQXA 1WCMG 3BVMA 4GOPB 3MFYA 4IUUA 1K83H 1PRTD 4OELB 3I72A 5FO7B 2NVTB 3R2TA 2E2HB 4RGMA 3RNUA 4JG2A 2J7ZA 4C2MB 5IWAQ 2E8GA 3JAMi 1G91A 3MZ5A 1HUNA 3DWAA 1QNKA 2RCFA 2JA6G 2G9HD 4GN4B 4DNIA 1PLFA 2F4VL 5C4HA 4IJHA 5IGBA 1Q82C 4A3EB 1ASZA 4NXNQ 1F2MA 1T9HA 1EWIA 3HOZG 1LTTD 2KJXA 4MTKA 1WI5A 2AKWB 3S14B 2BH2A 4NDXA 3LWEA 2JJQA 2F0KA 1D8LA 1ESFA 4OL7A 2XGTA 1LT6D 4WJWA 1HUMA 4IO9A 4XYQA 2QCPX 1HR0Q 1PH6A 1FYCA 2A8VA 4JI6L 2NZHA 2N88A 4OX9L 2B2TC 4A93B 4HJAA 2ZTEA 3L7ZC 4HIDA 5C0XJ 2ENBA 1IYVA 3SK8A 2ZJRA 1K8GA 2ICEC 1UAPA 1N32Q 4A3MG 2CKZB 3PGZA 5EKIA 4ULLA 1I4GA 1SNMA 1JC7A 1IKMA 3I4NG 2KHJA 4H7BA 3TP7A 3KF8A 4WORA 2EVBA 3TSSA 3K59A 1V1PB 4LF7Q 1JJGA 1MJCA 1IHZA 1R9TH 1DYQA 4X3KA 4YCUA 3STBC 2N3SA 4BBRB 4GKKL 1S4ZA 1B1ZA 3I2ZA 3ICEA 1TIID 2E2JB 2K7VA 3C1EA 5DNFA 3A5ZB 2F0LA 3PCOB 2WB1B 2WAQB 1S5ED 4DV5Q 1HPCA 3PUZA 4QUCA 1GVPA 2K05A 4P75A 2A68C 4R4IA 4NXNL 4KHPL 4PNYA 4RKBA 3G6JB 4X66Q 5CC4A 5EAYA 1JWUD 1BBUA 1I4QA 4X64Q 5M5XH 1B2TA 1CKMA 4FF1A 1N34L 5CV6A 2CW0D 4R4OA 4GNXC 4QIWB 1FR3A 3L9AX 4H02A 4JYAQ 4DK0A 3W1BA 1Q86C 3NPPA 4CDFC 1EY4A 3I4MH 1X3EA 1KAAA 2EY1A 2AMCB 2EPBA 3W3AA 2RF4A 4R1JA 2UUCL 4IUVA 1SRUA 2PW5A 1GOZA 4JBWA 3T56B 4A3LG 4DPGA 3VYRA 2O2LD 2F52A 4H0LC 5GAEC 1LACA 1PRTC 2SEBD 2UU9Q 3IFTA 4YY3L 1RIPA 1BXTA 1SE8A 4HJ8A 4A76A 3P75A 3KDFB 4IFDG 4RMFA 3BZDB 3AMUA 3I4LA 3U4ZA 2PMZB 4YWLA 1Y1WB 1L2FA 4AQYQ 4YWKA 3WOEA 2VZAA 1LT4D 4XTCS 4JV5Q 2DY8A 3HKSA 4CKCA 3T1YL 4LWCA 5EPKA 1EQRA 1JQYD 2F0UA 2PZTA 2EOTA 4CJ2C 1QE6A 2RHQB 4DV3L 3K80C 4A3BB 3OSOA 1PFSA 3CC7A 1Y1VH 1EFWA 4BBSG 3K57A 1ONLA 4OO1H 2Q2UA 2F3WA 5CV7A 4R8NA 2A6EC 3M4QA 2EDGA 3GO5A 4HMIA 2SNMA 4EGVA 1ENCA 3HFZB 1QOHA 4RGOS 5CV8A 4K5XA 1KDAA 3PF5A 4X64L 3GTKB 4O42A 2JA5G 4P73A 4HIMA 3TREA 2DY7A 2OEOA 4KJNA 4JI7Q 5ELBA 4QUFA 3GTOH 3GTQH 1ASYA 4GS3A 4NP5A 4WJ3M 5IP7H 1MGSA 4IPGA 4DR7Q 1YHAA 4FP5D 4JOIC 4JI0Q 4F8MA 1Y14B 4NB3A 3V96A 4AH6A 4XIGS 4LFAL 1OXVA 1HNXQ 1HA6A 2RHSB 1I6VC 2UU9L 4MNOA 2WIIB 1XXGA 1CZGA 3EVQA 1WOCA 3I3CA 4UHVA 2UUAQ 3M7GA 1TY0A 4LMQD 4PMWA 3KOJA 3A56A 3J81L 1HRJA 2KA7A 5KNDA 1G2TA 2QF7A 3J81j 1RHPA 2JA7H 2F0IA 2RBMA 1I4RA 5GROA 3ULLA 5IYCH 3RZDB 3CPFA 3S1QB 3S1RH 1EIHA 2PCFB 4CDDC 1F9RA 2RQXA 4P2CB 1YJNA 1OXTA 1EYDA 1O80A 1E7ZA 3JAME 2K14A 2Z6KA
chains in the Genus database with same CATH topology
5M5XB 1D5XC 3S16B 3K5OA 3GQBA 1O7ZA 4IFDI 5LHY1 4KD4A 2BDOA 2L5TA 1KNAA 3LNNA 4KY5A 4G7OC 2A69D 3BDLA 1B50A 2EXZA 1HXYD 1EZ6A 1GUOA 4BWGB 3P7JA 1ILQA 2NB0A 3AU7A 4OIJA 4C3HG 1XWEA 3HKZB 1XYIA 2B39A 1JORA 4EQPA 4XYOA 2K6AA 4GZYC 3VR6A 1Y69U 2L12A 3TBIB 3PV0A 3Q23A 1F9SA 1R4QB 5EGTA 5EJWA 1KABA 4ZUIA 2F0OA 3OMGA 2IWHA 4QCLA 3TP6A 4OIKA 2XWBB 2K04A 3TDQA 1O78A 3NSWA 1CI3M 2C5CA 2DN8A 2F0FA 2VB2X 1SYBA 2R93B 5JEAJ 1YNND 3S2DB 2I46A 4LK1C 2PZWA 4DGZA 1OXUA 5A2QL 3GTQB 1FD7D 4HR7B 2E2IB 2B2UC 1LV9A 1HCZA 1CK1A 2B2VA 3K5MA 4KY7A 1EU4A 2XVSA 2JYOA 3IAYA 5JOBA 3EQLC 3CU7A 3OIQA 1HFNA 1WTPA 2JA7B 2EYOA 3S1RB 1CZWA 1HQMC 4EQOA 4HSPA 1MBYA 4Q0FA 4BA2I 2EY5A 3DHQA 4KI0A 2KCNA 1EOTA 5NUCA 2YU9B 3NTIA 5I4DA 1J9OA 5D65A 4B9XA 4CBVA 2VXWA 5M5WB 1I6HB 2XNAC 3ONAB 2A69C 2A73B 2OT2A 1DOLA 5E4XA 2O5IC 1UNSA 1SJHD 4A3JB 2B2WC 3WDNA 3OOCA 3R2IA 2J0TD 5KRUA 1O7LA 1FNUA 3A54A 1D1IA 1KLGD 2L11A 5K5PA 2SDFA 1SE3A 2JP1A 5ELCA 1SJED 4A3FB 1WTQA 3ERQA 3PUWA 3SR1A 1MSHA 1EU3A 1SNDA 2F0TA 4FF3A 2F03A 2E76C 2NUCA 2NN6I 5JPNC 1Q1EA 3PO2B 2F0DA 1GXDC 4CGYB 5IGGA 4CKBA 1J8IA 1YNNC 1RKNA 3C46A 1JR0D 1B3AA 1EEID 1PTOH 1L0YB 3N52A 3R93A 4OHJA 4I7ZC 4ZLTF 2RSNA 1KLUD 2B63B 1I4PA 4RCNA 2VB3X 2F0VA 5CGKA 2PQEA 3VR3A 4ZQ3A 4PV1C 4KMUC 2FMCA 2B8FA 1NR4A 5KEEA 4CJ1B 3QOLA 4IFDJ 2NVQB 5CV5A 1TS5A 3J80L 3WOFA 3NE5B 2FFKB 2IX3A 2F0EA 2AUJD 3BYTB 1S5CD 2PYKA 1RODA 2EYFA 1Z6HA 2N55A 5DM73 4DAVA 3FRPB 4OO1G 2LY7A 1B9MA 3E0JA 2K5QA 3CRKC 4K14A 1IYUA 1I4XA 1AN8A 3PUVA 3BYYB 4TSSA 1SYCA 4ZK9B 4FXKC 3VR2A 2ZXPA 2BE5D 1EYCA 3SDZA 3H09A 3I70A 1JB3A 3MEHA 1EYAA 4F87A 3QJYA 5I6YA 3D4DA 1SNCA 2Y0SB 3HRZC 3S1MB 4M1UB 4FF2A 2G9DA 1D5ZC 4IZ8A 2HUGA 1CHPD 1QCBD 1U4PA 2H4OA 1II3A 3EROA 4FNFA 1RD9D 1EQVA 1STAA 2B2YC 2A6ED 4IALA 1ML0D 4LJZC 1BOSA 1ZEQX 2CVRA 1G291 4ABNA 3QWNA 2XN9C 2QKIC 4C3IB 5CORA 1CT1D 4CHTB 4G7HC 3OHXC 2F3VA 2NZ1D 3T51B 4EVOA 1PTOB 1F2LA 1SDFA 3K5LA 2L4NA 4A3DB 2PNRC 3GD7A 4RHRA 1SAPA 4QF4A 3TN2A 2E75C 5CR3A 1ET9A 3NWSA 4OO1I 3J7AV 4K2KA 4F7XA 4RAUC 4XT1B 1SYFA 3HOYB 3MXUA 3MAQA 3TP5A 2SNSA 1CTMA 1H9MA 2EYHA 3IKJA 3D8GA 1C4QA 2QEJC 1U4LA 1DJRD 2K28A 1Z47A 2NVYB 3HOVB 2ZXOA 1STBA 5IIFA 1BUVT 3W2DA 1NAPA 4KHVA 1H9SA 3CHBD 4RGTA 1B9NA 1EQTA 2EY2A 2XRQD 2BE5C 3GV3A 4DF7A 5JVH3 1DXMA 1Q3LA 1RTOA 1LLRD 2A6HD 2ZXRA 2ZT9C 3NK9A 4UAIA 3M4OB 1A2UA 4C3JG 2LFNA 2NTSA 5K36H 1TT2A 2MHVA 5IGFA 1I50B 1LO5D 1PTOD 3SK4A 1PTOF 5C4XB 1CHQD 2KECA 2XWJB 1FNVA 3KBXA 4N9PA 4DFAA 2KCCA 1NSNS 3V2TA 1CM9A 3KLSA 3EJIA 3TMEA 1H9KA 2AQ2B 4O1NA 3MHBA 2RDGA 5G3LF 1DD2A 3HP3A 5IGCA 3R8BA 1TY2A 2B2TA 3BDCA 1JCKB 3OPOA 5FLXL 1BR9A 3S9WA 1A2TA 1D1KA 5E3FA 1S5DD 2X69A 1EL0A 1LTBD 4B08A 2JSOA 2K03A 3A7LA 1WD1A 3S1NB 1SBBB 5FOBB 3DWQA 3HG9A 2GA4B 2WV6D 5C4JB 4XXEA 5A35A 3CRLC 4KTAA 3VYUA 5C44B 3E6ZX 1XTCD 4DNRB 4J1MA 5C6AA 4MIUA 4DK1A 4DXGA 3D3RA 1M8AA 3A8KE 4V0BA 2EZVA 5JAVA 4KN7C 1W6JA 1ET6A 1WTWA 3MA2B 5HURA 3D4WA 4DNTB 5EQ0A 3M85A 4C3IG 1A3VA 4B9WA 2M00A 3HOWB 3K58A 2L1BA 1NCVA 2KEEA 2I07B 3NUCA 3A55A 4R8IA 1B44D 4XQJA 2A6HC 3ZYYX 2Z1CA 5FO9B 3VR4A 1SNPA 2L9HA 2B8GA 2TMPA 2VUMB 2X6LA 1IL8A 3GP7A 1PDQA 1HTLD 1SNQA 3DMUA 3GV6A 1GUWA 2BCOA 2HCIA 2R92B 3F2UA 1PTOC 4K6DA 4RFBA 1B4OA 1VDZA 1LTRD 4U68A 1H9SB 2WKDA 1QILA 4MHEA 5IT9L 1H9RA 5EBDA 5FK9C 5C3EB 5C3WA 2VNUD 1AFPA 2F0PA 1RTNA 2KUMA 2O4XA 5AFWA 3FPUB 2WP8J 1QG7A 1V1OA 2MGSA 3J81E 1CA5A 1CA6A 1AEXA 1TS3A 2LKVA 5C4ZA 4IUNA 4XDXA 3U9OA 2WKCA 3V05A 3M3YB 4ME5A 3CKIB 5M9OA 3D4RA 2C9OA 1A3TA 2MPMA 2F0MA 5M3MB 4NKLA 2RDFA 1U4MA 2RSOA 3NP8A 1VMCA 4HAEA 1DM0B 2KEDA 2K33A 3P1HA 4KY6A 4IFDH 4FXDA 2IL8A 5D3IB 3NXWA 3GTJB 5CV9A 1EY6A 2EYJA 4TQUS 1F2ZA 5I6WA 3FKIB 3K7AB 2JA6B 2FINB 5BN3A 3DEPA 1FNWA 3C1FA 5C3XA 3NHHA 3J7YW 3S2HB 2JA8B 4R9WA 5KYLA 2BDNA 3GTGB 1LTAD 4MN3A 3CQZB 1ESRA 4A3KB 3RZOB 4J6HA 2MUYA 1SYGA 4LAAA 2Z4HA 4IN3A 5I9OA 2JEBI 1QWYA 2V4DA 2RVLA 3QOJA 5E1FA 1Q90A 3J7AF 4I65A 3MVVA 1I4HA 3Q0AA 3T53B 2F0SA 1CQVA 3VR5A 1Q1BA 1RCVD 1BQQT 3DXJC 4IUTA 2BA0A 3SK5A 4ZUJA 4X3SA 3E5SA 1AW7A 3NWTA 1DOMA 5CMDA 1LTID 5A2QE 4NMZA 1U4RA 4Z9CB 2K01A 3X3NA 1RDPD 2WACA 5CBAE 4KD3A 1SSOA 1V1PA 1EY9A 5C5LA 3EA6A 2A5HA 3U9SA 3DM1A 4UDUC 2M2LA 1CQFA 2JXMB 1TWHB 1CFMA 2TSSA 3BS1A 4CKEA 1STYA 5C0XH 3QO2A 1O7YA 4KN4C 4DAPA 3A8IE 3MXPA 4PMBA 3Q6SA 1TR5A 1WTRA 4DU9A 1EWCA 2E2DC 1WTOA 2B2UA 1FGBD 3SXHA 2Q8RE 4RWSC 1DONA 2EYLA 4G57A 1LTSD 1ZKOA 1TS4A 5EPLA 2XSCA 5KYIA 2EJFC 4DXFA 3X3MA 5K36G 2OXPA 1Y8NB 3SK6A 5JJZA 1KDCA 2NWGA 1XX8A 1F9QA 3D6CA 1GUGA 5KIXA 1HFGA 1VMPA 3PIO3 2EE1A 4IUPA 2NYZD 1E0BA 1H9JA 3H3VC 4Y7NB 3K5NA 3R3OA 4FVMA 5I2YA 3OW7A 1SNOA 4KHZA 1GJXA 3KLRA 4C1NK 2BA1A 2E74C 3T16A 4WRDA 3PUXA 1BCPB 1STNA 2EJMA 2HCCA 2LS01 3Q24A 4PMCA 4HTHA 4S3SA 4DN4M 2NN6H 4KKSA 2FMMA 3S17B 1AZPA 3FMCA 1X3QA 3FDTA 2HQEA 3RUZA 1LT5D 1PRTF 3Q22A 2PW7A 3PUYA 1SYDA 3N6RA 2ID0A 1A15A 3SEBA 1PYWD 1TKWB 4BS9A 1L0XB 3SHLA 2JEAI 1TWAB 1S5FD 2RKSA 4G7ZC 1JWMD 1A6XA 3IL8A 4ODGA 1F9PA 2KOLA 1MSGA 4KV6A 1PFNA 4CJ0B 5F2DA 2WINB 2D9UA 4K2LA 5KGUA 3J80E 3GTMB 2F0GA 4IUQA 4ZRZA 4RH6A 1S5BD 1JOQA 1DOKA 2AUKA 2F1MA 1UEAB 3KUPA 3D6WA 1WVLA 1G6ZA 3QG1A 5EBCA 4FYDA 4H13C 1LTGD 1UUPA 5ISRA 2X6GA 4C3HB 1BNZA 2Z4IA 3HZXA 4ILWA 4ZYSA 4OGQC 1SEBD 2F0JA 1EZ8A 2D2CC 3NTHA 1BCPD 1YNJD 5COYA 1IKLA 1BCPF 3HGBA 1RJTA 3MC0B 2M9VA 4RCOA 3NQIA 1EWHA 3K6OA 2Z8LA 4ID6A 4BY7B 5M3FB 4QMGA 4ZKBB 1BDOA 2OF1A 2F4IA 2PZUA 2Q8IB 3GTLB 3NBIA 4L63B 1EY5A 3L3OC 4EQNA 1SFOB 1ZXTA 3RLFA 1OXSC 4IQZA 5ELFA 1WTVA 4XQNA 5JPMC 4AYBB 2IX1A 5C5MA 1Q12A 3JAML 1SYEA 3T13A 4DAYA 1K83B 4L6TB 3DUZA 1E2VA 3D31A 3IFDA 1OXXK 1BBXC 2IX0A 1KDBA 2EYMA 1SE2A 4V190 1K8MA 2B2YA 3RMHA 3URYA 3VA7A 4Q5VA 1SMYD 3A8JE 3FVQA 4N9TA 4NW2A 3HOUB 5G3LD 3P20A 1C48A 5JEAH 1NUCA 1JOKA 2IT1A 3T4AC 4HCSA 3M4YA 5KNBA 1SXTA 1GHJA 1GUSA 3OWEB 1X32A 2R3ZA 3TZDA 3AB9A 3BVGA 4HEDA 2F0HA 2K1BA 1G8ZD 1HTPA 1KNEA 3SE0A 2F0QA 1WD0A 1X3PA 1ZYRD 2CHBD 4BY1B 5T1GA 2DNEA 1NR2A 1B53A 2R6GA 2KVMA 2L0CA 1ILPA 2B2VC 4J8QA 2EYPA 3I8ZA 1BCPC 1YNJC 1D5MC 1R9TB 1C8CA 3I90A 4HN7A 1EFID 5BN4A 3MFGA 4C56C 2SOBA 4KK7A 4F88A 1U9RA 3QIAA 3H91A 4WFN3 1STEA 4XQQA 2D5DA 2CW0C 4E6IA 5IGDA 5C0XG 1I3QB 3I4MB 4X3UA 4IURA 1VCIA 1TS2A 1EY0A 3KK7A 3PO3B 5CBEE 3TP8A 4KKUA 1RF2D 4TKOB 3EFXD 4K8IA 2PPBC 2MJ8A 1AP0A 1DCZA 1LABA 1V8QA 5EKLA 1F77A 1AZQA 5FO8B 5EPJA 5T1IA 1VF5C 5FLXE 1TU2B 1M4VA 5TSSA 1LT3D 1KTKA 1SMYC 4KJOA 1PZKD 1OO9B 1E2ZA 4M8AA 1PZID 4K5VA 2H1EA 3RD4A 3K0YA 1Y1VB 1W6KA 3DWPA 3ND9A 3LWUA 1EY8A 4HSVA 4KKTA 4RA8A 2L55A 4XT3B 5HGTA 2QILA 1EEFD 2J4XA 1BO0A 3G7LA 4H44C 2IW3A 1IW7D 2XIWA 1HA5A 1DZ1A 1WCMB 1ZYRC 5IGEA 1PFMA 3TZUA 1JE4A 2PO4A 3GTOB 2IPKD 1WTXA 4ZKCB 2A74C 1MI2A 1V43A 2EJGC 2LMCB 3MXNA 5ELEA 2NN6G 1JOOA 3OMCA 4L8JA 4FF4A 1D6EC 1EIGA 4K5WA 2DNCA 2KHSA 3SVMA 3MWYW 5IOCA 2YYZA 5C0XI 1G2SA 3I91A 3QB3A 4RHSA 4TRDA 3H6MA 3HOZB 1K8OA 1JICA 1R4PB 2AWOA 1GUNA 3S15B 1TWFB 3KLSX 4K8JA 2AQ1B 5JVG3 1PZJD 3NQTA 1TVXA 1STGA 1TWCB 3FEWX 4RKLA 3H94A 2AQ3B 3FPPA 5IODA 1PXUA 5KNCA 3O13A 1TWGB 4HMJA 5CYUA 4ZAIA 2NBFA 5BN5A 5ELDA 5LL6S 5M5YB 1HHVA 1Z7TA 1SE4A 3MXGA 5FKAC 4A3MB 5IT9E 2O5JC 2K32A 2NTTA 1PMRA 3I4NB 3C3LA 3GTPB 1GHKA 1QNUA 4BA1I 3M7NA 1T5EA 1QB5D 2F0WA 3NBHA 1Y8PB 2AWNA 3DEOA 4X3TA 5I2XA 2NVXB 4U673 4DA2A 2HDMA 2EY6A 5I9PA 3ITPA 5LL6X 3C2PA 2R7ZB 1ENAA 1T5XD 5DM63 1PRTB 3ND8A 1E2WA 2KQ3A 4QB4A 2JE6I 1D2BA 1Q8IA 2XRSD 5J1ZA 2Q8TA 1F2YA 3HS0C 1JWSD 3OIPA 5DEHA 1IW7C 2MP1A 3H0GB 1EY7A 3BVZA 1MD2D 4FO2A 1Y8OB 1VF7A 3VYSA 5CV4A 1BF4A 2RA4A 1GUTA 1STHA 2CQAA 5DAUA 5E4WC 3PIP3 1QJOA 4RGNA 4HCEA 5D3DA 3HEJA 2ICIA 3PMFA 1ICWA 4C3JB 5J22A 2QDBA 2RDHA 3NTKA 3MTSA 2K5DA 2R61A 4BBSB 4G4KA 1ENFA 3I73A 4A3GB 2F0NA 3A7AB 4FXGC 3HOXB 2D62A 2BOSA 2A68D 3BDOA 4JK1C 5EKKA 4C1NI 1HQRD 4K6LA 5JEAG 2JA5B 2IJ0A 4YIJA 3LX0A 2B2WA 1PFBA 5D14A 3BG3A 3VYTA 2HDLA 2K5WA 1TQOA 4A3IB 2FHTA 3UI2A 3VA5A 3KBGA 3OWFA 5J39A 2FJ2A 1A3UA 4PQXA 3BVMA 3MFYA 4IUUA 1PRTD 3I72A 5FO7B 2NVTB 3R2TA 2E2HB 4RGMA 2J7ZA 4C2MB 1G91A 3MZ5A 1HUNA 3DWAA 1QNKA 2G9HD 1PLFA 5C4HA 5IGBA 4A3EB 1F2MA 1LTTD 2KJXA 3S14B 4NDXA 3LWEA 2F0KA 1ESFA 4OL7A 1LT6D 4WJWA 1HUMA 4XYQA 2QCPX 1FYCA 2N88A 2B2TC 4A93B 3L7ZC 5C0XJ 2ENBA 1IYVA 3SK8A 2ICEC 1UAPA 5EKIA 4ULLA 1I4GA 1SNMA 1JC7A 1IKMA 4H7BA 3TP7A 3KF8A 4WORA 2EVBA 3TSSA 3K59A 1V1PB 1IHZA 1DYQA 4X3KA 4BBRB 1S4ZA 1B1ZA 2E2JB 1TIID 2K7VA 3C1EA 5DNFA 2F0LA 2WB1B 2WAQB 1S5ED 1HPCA 3PUZA 4QUCA 2K05A 2A68C 4PNYA 4RKBA 3G6JB 5CC4A 1JWUD 1I4QA 1B2TA 4FF1A 5CV6A 2CW0D 4QIWB 1FR3A 3L9AX 4DK0A 3NPPA 1EY4A 1KAAA 2EY1A 2EPBA 3W3AA 4IUVA 2PW5A 1GOZA 4JBWA 3T56B 3VYRA 2O2LD 4H0LC 1LACA 1PRTC 2SEBD 3IFTA 1BXTA 3P75A 4IFDG 3BZDB 3AMUA 3I4LA 2PMZB 1Y1WB 3WOEA 1LT4D 4XTCS 2DY8A 4CKCA 5EPKA 1JQYD 2F0UA 2PZTA 2EOTA 4CJ2C 1QE6A 4A3BB 3OSOA 3K57A 1ONLA 4OO1H 2F3WA 5CV7A 4R8NA 2A6EC 2EDGA 3GO5A 4HMIA 2SNMA 4EGVA 1ENCA 1QOHA 4RGOS 5CV8A 4K5XA 1KDAA 3GTKB 4O42A 2DY7A 2OEOA 4KJNA 5ELBA 4QUFA 4NP5A 1MGSA 4FP5D 4F8MA 3V96A 4XIGS 1OXVA 1HA6A 1I6VC 2WIIB 1XXGA 1CZGA 3EVQA 3I3CA 3M7GA 1TY0A 4LMQD 4PMWA 3A56A 3J81L 1HRJA 2KA7A 5KNDA 1G2TA 2QF7A 1RHPA 2F0IA 2RBMA 1I4RA 3RZDB 3S1QB 1EIHA 2PCFB 1F9RA 2RQXA 4P2CB 1EYDA 1O80A 1OXTA 3JAME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CQV A;  1D5X C;  1RCV D;  1ESF A;  3BZD B;  2ICI A;  1D5Z C;  3W2D A;  1SBB B;  1EU4 A;  1LT6 D;  1SXT A;  3CHB D;  4RGT A;  1CHP D;  2AQ3 B;  3DWQ A;  4ZYS A;  3OWE B;  1F77 A;  1V1O A;  2WV6 D;  1AW7 A;  1LT4 D;  3BVG A;  2RDH A;  1SEB D;  1JR0 D;  1XTC D;  3O13 A;  1G8Z D;  4DXG A;  1M4V A;  1BCP D;  1JQY D;  1LTI D;  1EEI D;  2XRQ D;  1HXY D;  1TS3 A;  2R61 A;  1BCP B;  1PTO H;  1L0Y B;  1LT3 D;  1RD9 D;  5ELD A;  1KTK A;  1BCP F;  1PZK D;  4OHJ A;  4Z9C B;  1SE4 A;  3MC0 B;  1ENF A;  1RDP D;  1KLU D;  5FKA C;  1I4P A;  3V05 A;  4RCO A;  1LLR D;  2CHB D;  1V1P A;  2NTT A;  1PZI D;  3EFX D;  4BWG B;  3EA6 A;  2Z8L A;  1I4G A;  4UDU C;  1ET6 A;  3DWP A;  4RGO S;  5I4D A;  3TSS A;  1V1P B;  1HQR D;  2XN9 C;  4K6L A;  1CT1 D;  2TSS A;  2NTS A;  2IJ0 A;  1LT5 D;  5D3D A;  1DYQ A;  1PRT F;  2XNA C;  5D3I B;  1BCP C;  3SEB A;  1B1Z A;  1PYW D;  1D5M C;  1LO5 D;  1TS5 A;  2QIL A;  4L63 B;  1EEF D;  2J4X A;  1PTO D;  1UNS A;  5ELB A;  1SJH D;  1PTO B;  1L0X B;  1PTO F;  1EWC A;  3BYT B;  1CHQ D;  1B44 D;  1HA5 A;  1S5C D;  1S5F D;  1S5E D;  1FNV A;  1FNW A;  1EFI D;  4RHR A;  3MFG A;  5ELF A;  2IPK D;  1FGB D;  3BVM A;  1JWM D;  3R2I A;  1T5X D;  4C56 C;  5TSS A;  1ET9 A;  1PRT D;  1LTA D;  1JWU D;  1PRT B;  5ELE A;  1I4Q A;  3R2T A;  4RGM A;  1FNU A;  3GP7 A;  1I4X A;  1AN8 A;  1LTS D;  1D6E C;  1HTL D;  1STE A;  2AQ2 B;  2XRS D;  4O1N A;  4L6T B;  1XXG A;  1KLG D;  2RDG A;  1TS4 A;  3BYY B;  1TY0 A;  1JWS D;  4DXF A;  3R8B A;  4TSS A;  1SE3 A;  1PTO C;  1TY2 A;  1JCK B;  4RFB A;  3DWA A;  1SJE D;  5ELC A;  4RH6 A;  2G9H D;  1S5B D;  1SE2 A;  3BVZ A;  3URY A;  1I4R A;  1MD2 D;  1TS2 A;  1EU3 A;  1GOZ A;  4RHS A;  1LTR D;  1FD7 D;  2O2L D;  2QEJ C;  1QIL A;  1DJR D;  1S5D D;  1PRT C;  1LTT D;  2SEB D;  1I4H A;  5FK9 C;  1LTB D;  3KLS X;  2AQ1 B;  4RGN A;  1RF2 D;  1BXT A;  1LTG D;  1CK1 A;  1UUP A;  1PZJ D; 
#chains in the Genus database with same CATH topology
 5M5X B;  3DM3 A;  4DV7 L;  2YU9 H;  3DLL A;  1D5X C;  3S16 B;  1E1T A;  3K5O A;  3GQB A;  5M5W H;  1O7Z A;  1I6H H;  4IFD I;  5AJ3 Q;  5LHY 1;  4KD4 A;  2BDO A;  2V1C C;  2L5T A;  1H95 A;  1KNA A;  4OEM B;  3LNN A;  4KY5 A;  4DR3 L;  4G7O C;  2A69 D;  3BDL A;  2YTY A;  2JK8 A;  1B50 A;  2EXZ A;  1HXY D;  1EZ6 A;  1X6O A;  4A3J H;  1JE5 A;  4B3M L;  2NZO A;  4A93 G;  1GUO A;  4PZ6 A;  3GTP H;  2MQH A;  4BWG B;  3P7J A;  4EQ5 A;  1ILQ A;  2NB0 A;  1UE1 A;  3AU7 A;  1YVC A;  2KBN A;  4OIJ A;  4C3H G;  1XWE A;  4PZ8 A;  1DGS A;  3HKZ B;  1XYI A;  2B39 A;  1JOR A;  4ZCK A;  5FLM H;  1U0L A;  4EQP A;  1XNR L;  4XYO A;  5ELN A;  2K6A A;  4GZY C;  3UDI A;  4A3F H;  4LF6 Q;  3EIV A;  3VR6 A;  1Y69 U;  1GO3 E;  2L12 A;  3TBI B;  2K50 A;  3PV0 A;  3Q23 A;  2R7Z H;  3E9H A;  2EXD A;  1J5E L;  1F9S A;  1R4Q B;  5EGT A;  4LFC L;  5EJW A;  1KAB A;  2WB1 G;  4ZUI A;  4DV2 L;  2F0O A;  3OMG A;  1NE3 A;  4IOC A;  2IWH A;  3PO2 H;  1FGU A;  4QCL A;  3TP6 A;  2ZJP A;  4OIK A;  2XWB B;  2K04 A;  3TDQ A;  1O78 A;  3CCJ A;  3NSW A;  1CI3 M;  2C5C A;  2DN8 A;  2R7D A;  2F0F A;  3G48 A;  3RN5 A;  4DR6 Q;  2VB2 X;  1HJP A;  2R7F A;  3H0G H;  1SYB A;  2R93 B;  5E7N A;  5JEA J;  1YNN D;  3S2D B;  2I46 A;  1N33 Q;  4LNQ A;  4GN5 A;  2PZW A;  4LK1 C;  4DGZ A;  1OXU A;  5A2Q L;  3GTQ B;  1PHJ A;  4JI2 Q;  1FD7 D;  4HR7 B;  2UXB Q;  2LSS A;  5IP9 H;  1QUQ B;  4AYB G;  2E2I B;  1HZB A;  2B2U C;  1LV9 A;  1B7Y B;  1HCZ A;  1CK1 A;  2B2V A;  3K5M A;  4C3J H;  3AEV A;  1AH9 A;  1KAW A;  1NMF A;  5LMN Q;  1UEB A;  4KY7 A;  2Z9H A;  1EU4 A;  2ZM6 L;  2XVS A;  2JYO A;  3J7Z C;  4IPC A;  4CDC C;  4UP9 A;  4BXX G;  3IAY A;  5JOB A;  4A3G H;  3OIQ A;  3EQL C;  3CU7 A;  3RN2 A;  3UDG A;  1HFN A;  1WTP A;  2JA7 B;  4DV1 Q;  2EYO A;  4LF6 L;  1X65 A;  1V1Q A;  3S1R B;  1CZW A;  1HQM C;  4P74 A;  3CCQ A;  4EQO A;  4HSP A;  1MBY A;  4Q0F A;  3CCE A;  3BJU A;  4BA2 I;  2EY5 A;  3DHQ A;  3K7U C;  4KI0 A;  2KCN A;  1EOT A;  5NUC A;  2YU9 B;  3OTO Q;  3NTI A;  5I4D A;  1J9O A;  5D65 A;  4B9X A;  4POF A;  3LGJ A;  4CBV A;  2VXW A;  5M5W B;  1I6H B;  1G6P A;  2XNA C;  4LW1 A;  4A3I H;  3ONA B;  2A69 C;  2A73 B;  2OT2 A;  1DOL A;  5E4X A;  1K0R A;  3G6E A;  1GD7 A;  2O5I C;  3W1G A;  1UNS A;  4DR4 Q;  1SJH D;  4A3J B;  2B2W C;  1Z9F A;  3WDN A;  3OOC A;  4BY1 G;  2DGY A;  3M4P A;  2E2H H;  1HZC A;  2KHI A;  3R2I A;  2J0T D;  5KRU A;  2UXB L;  2HIV A;  3G4S A;  1O7L A;  1FNU A;  3A54 A;  3S1M H;  4LFB L;  1D1I A;  2UXC Q;  4B3T Q;  3FHW A;  1KLG D;  2L11 A;  3BU2 A;  5LMN L;  4OXP A;  5K5P A;  1W3S A;  2SDF A;  1VQA A;  4B3S Q;  1SE3 A;  2EQS A;  2JP1 A;  4A3E H;  5ELC A;  1SJE D;  4A3F B;  1WTQ A;  1NY4 A;  3ERQ A;  3PUW A;  2I5M X;  3SR1 A;  3QR8 A;  1MSH A;  1EU3 A;  1SND A;  2F0T A;  1P8L A;  4FF3 A;  2F03 A;  2E76 C;  2NUC A;  1FVI A;  2NN6 I;  5JPN C;  1Q1E A;  3PO2 B;  2F0D A;  1GXD C;  3G71 A;  1XPU A;  1EYG A;  4CGY B;  4C3I H;  5IGG A;  1A62 A;  2A19 A;  4CKB A;  1J8I A;  1YNN C;  1RKN A;  1VQ8 A;  3C46 A;  1JR0 D;  4ALP A;  1B3A A;  3I4M G;  1EEI D;  4B3R L;  1PTO H;  1L0Y B;  4PG3 A;  3N52 A;  3R93 A;  2BH8 A;  4OHJ A;  3PO3 G;  4A3D H;  4I7Z C;  2PI2 E;  2RSN A;  4ZLT F;  4IPH A;  1KLU D;  2B63 B;  4DR4 L;  1I4P A;  4RCN A;  2VB3 X;  1SLJ A;  4JPB W;  2F0V A;  5CGK A;  2PQE A;  3VR3 A;  4ZQ3 A;  4PV1 C;  3PF4 A;  4KMU C;  2FMC A;  2B8F A;  1NR4 A;  2CQO A;  5KEE A;  3CC2 A;  2E2J H;  4NXM L;  2F4V Q;  5H1S E;  1N9W A;  1C0A A;  1E22 A;  2E5L L;  4CJ1 B;  1X3G A;  4DV4 L;  4B3T L;  1IBK Q;  3EN2 A;  4R4T A;  3QOL A;  3HOY H;  4IFD J;  4MZ9 A;  2NVQ B;  5CV5 A;  1TS5 A;  3J80 L;  3WOF A;  3NE5 B;  2FFK B;  2IX3 A;  2F0E A;  4LUO A;  1KD1 C;  2AUJ D;  3BYT B;  1S5C D;  2PYK A;  1ROD A;  2EYF A;  1Z6H A;  2N55 A;  1NJI C;  5DM7 3;  2VQE L;  4YCV A;  4DAV A;  1PH9 A;  1Y1V G;  3FRP B;  4OO1 G;  2LY7 A;  1B9M A;  4JI6 Q;  3E0J A;  2NVY H;  3HOV H;  2K5Q A;  3CRK C;  4K14 A;  1IYU A;  4OX9 Q;  1I4X A;  1AN8 A;  1B3Q A;  2B29 A;  3PUV A;  3MXN B;  3BYY B;  4JBK A;  4GLX A;  4N8F A;  4GLA C;  1KC8 C;  4TSS A;  1SYC A;  3GDE A;  4ZK9 B;  4FXK C;  3VR2 A;  2I0Q A;  4WJ4 A;  1X9N A;  2ZXP A;  4POG A;  4KLK A;  1K0S A;  4O0A A;  2BE5 D;  1EYC A;  3SDZ A;  3H09 A;  3I70 A;  3KFU A;  1JB3 A;  5FJ8 H;  3MEH A;  1EYA A;  4L5T A;  4F87 A;  1HZA A;  3QJY A;  5I6Y A;  5IP7 G;  3D4D A;  1SNC A;  2IHE A;  4P72 A;  4GKK Q;  2ZJQ A;  4ME3 A;  2Y0S B;  1Y1W H;  1C9O A;  3HRZ C;  3S1M B;  4M1U B;  3JC6 6;  4FF2 A;  1PH3 A;  2G9D A;  3M4O H;  1D5Z C;  4IZ8 A;  2HUG A;  1CHP D;  1HZ9 A;  1QCB D;  2ALY B;  1U4P A;  2H4O A;  2D0P A;  4YHH L;  1NMG A;  1II3 A;  4A3B H;  4HJ9 A;  4KHP Q;  3ERO A;  4FNF A;  1IBK L;  1RD9 D;  2OQK A;  1EQV A;  1VQ9 A;  4UY8 C;  2JA7 G;  1N34 Q;  1STA A;  1LYL A;  2N8N A;  2B2Y C;  2A6E D;  5IYC G;  4IAL A;  1ML0 D;  2CWA A;  4LJZ C;  1BOS A;  1K3R A;  1ZEQ X;  1A8V A;  2CVR A;  1IXR A;  3GTK H;  1G29 1;  1X3F A;  4ABN A;  1KQS A;  2EIF A;  3KLW A;  3QWN A;  1O7I A;  2XN9 C;  2UUC Q;  2QKI C;  4C3I B;  5COR A;  1CT1 D;  4RG1 A;  4JI3 L;  4CHT B;  3OHX C;  4G7H C;  1SRO A;  4DAM A;  1IBL L;  2F3V A;  2NZ1 D;  3NBH B;  3T51 B;  3CD6 A;  4EVO A;  1KRT A;  1PTO B;  4YY3 Q;  3PQI A;  1D7Q A;  1F2L A;  1SDF A;  3K5L A;  2L4N A;  4A3D B;  2PNR C;  4A3J G;  3GD7 A;  4RHR A;  1SAP A;  4QF4 A;  2K5H A;  3TN2 A;  2E75 C;  4DUZ Q;  5CR3 A;  1ET9 A;  3NWS A;  2K4K A;  3TQY A;  4YCW A;  2VQF L;  4OO1 I;  3T1Y Q;  4QJF A;  3E9I A;  5LMU Q;  3S1N H;  3J7A V;  4K2K A;  1G51 A;  4F7X A;  1XPR A;  4RAU C;  3M9B A;  2RCN A;  4DV3 Q;  1PV4 A;  4XT1 B;  5C4J H;  1L0W A;  1MJE A;  1SYF A;  5C44 H;  3HOY B;  3MXU A;  1B8A A;  3MAQ A;  5FLM G;  3TP5 A;  2SNS A;  3RZD H;  3S1Q H;  1EQQ A;  1CTM A;  3J81 i;  1H9M A;  4J15 A;  1VQB A;  2EYH A;  3IKJ A;  3ZJY C;  4DR1 Q;  4A3F G;  3D8G A;  1C4Q A;  2VY3 A;  2QEJ C;  2R7Z G;  1U4L A;  1DJR D;  1VQF A;  2K28 A;  3S16 H;  1Z47 A;  4OWT B;  1LUZ A;  2NVY B;  3HOV B;  1E24 A;  3PO2 G;  2ZXO A;  3K0X A;  2YTX A;  1STB A;  1UWV A;  2PI2 A;  3CCR A;  5IIF A;  1BUV T;  2I5L X;  3W2D A;  1NAP A;  4KHV A;  1H9S A;  3CHB D;  4RGT A;  3HOW H;  1B9N A;  1EQT A;  2EY2 A;  3H0G G;  1YJW A;  2XRQ D;  3EBE A;  1WTH A;  2BE5 C;  4LFA Q;  1VQL A;  4DKA C;  3GV3 A;  4DF7 A;  1CKN B;  5JVH 3;  1DXM A;  3L2P A;  1Q3L A;  1RTO A;  1LLR D;  2A6H D;  2ZXR A;  1PH4 A;  1VQ7 A;  2VUM H;  1C7Y A;  4HIO A;  1XJV A;  2ZT9 C;  3NK9 A;  3ERS X;  4DUZ L;  4OWW B;  4UAI A;  3M4O B;  1A2U A;  4C3J G;  2Z6B A;  2LFN A;  3BZC A;  2NTS A;  3W5O A;  3H3V H;  5K36 H;  5LMU L;  1TT2 A;  2R92 H;  2MHV A;  5IGF A;  1I50 B;  1LO5 D;  1NBW A;  1PTO D;  2HQL A;  3SK4 A;  2LXK A;  2ZTC A;  1PTO F;  4A3G G;  3KF6 A;  5C4X B;  1CHQ D;  2KEC A;  1PYS B;  4DV7 Q;  2XWJ B;  3HOX G;  1FNV A;  3TEH B;  4DR1 L;  3KBX A;  4N9P A;  4DFA A;  2KCC A;  1NSN S;  3PIO A;  3V2T A;  1Q81 C;  5FLX c;  1CM9 A;  4DR3 Q;  3KLS A;  3EJI A;  4YWM A;  3TME A;  1H9K A;  2AQ2 B;  2C35 B;  4O1N A;  2R93 H;  3MHB A;  2RDG A;  3S2D H;  5G3L F;  1VQE A;  4B3M Q;  1DD2 A;  3NEM A;  3HP3 A;  5IGC A;  1YNX A;  3R8B A;  1TY2 A;  3CXC A;  2B2T A;  3BDC A;  1MHW C;  4A3I G;  1JCK B;  3OPO A;  5FLX L;  3J81 c;  2PQA A;  1HR0 W;  2E2I H;  1BR9 A;  3S9W A;  1A2T A;  1D1K A;  5E3F A;  3E0E A;  3M3Y H;  3BZK A;  1S5D D;  2X69 A;  1EL0 A;  1UE6 A;  1LTB D;  4P71 A;  1FL0 A;  4B08 A;  1XNR Q;  5M3M H;  2JSO A;  2K03 A;  3A7L A;  1WD1 A;  3S1N B;  2Y0S G;  1SBB B;  4LF9 L;  5FOB B;  3DWQ A;  3HG9 A;  2GA4 B;  1J5E Q;  2WV6 D;  5C4J B;  4XXE A;  4LFC Q;  5A35 A;  3CRL C;  4KTA A;  3VYU A;  5C44 B;  3E6Z X;  1XTC D;  4DNR B;  4J1M A;  5C6A A;  1VQH A;  4MIU A;  2ASB A;  4DK1 A;  3OYY A;  4DV2 Q;  1VQD A;  4DXG A;  3E3X A;  4GOP C;  3FKI H;  3D3R A;  3K7A H;  2UUB L;  1M8A A;  4A3E G;  1I94 L;  2GVB A;  2I5H A;  3A8K E;  4V0B A;  2EZV A;  5JAV A;  3S2H H;  2JA8 H;  4KN7 C;  1W6J A;  3GTG H;  1QVG A;  1ET6 A;  1WTW A;  3F8T A;  3MA2 B;  5HUR A;  3D4W A;  1VS0 A;  4DNT B;  4A3K H;  4LF5 L;  5EQ0 A;  3CC4 A;  3UDF A;  3M85 A;  4C3I G;  1A3V A;  4B9W A;  4JW0 A;  2M00 A;  3HOW B;  4I7A A;  3KF8 B;  3K58 A;  1LTL A;  2L1B A;  1NCV A;  1WJJ A;  2ES2 A;  2KEE A;  2I07 B;  3NUC A;  3A55 A;  4R8I A;  1B44 D;  4XQJ A;  2A6H C;  3UE1 A;  3ZYY X;  3TRZ A;  2ATW A;  2Z1C A;  2ZM6 Q;  5FO9 B;  4A3D G;  3VR4 A;  1SNP A;  2L9H A;  5IE8 A;  1XMQ L;  3CP0 A;  2P5Z X;  2B8G A;  2TMP A;  2VUM B;  2WB1 E;  2X6L A;  1IL8 A;  3AFP A;  3GP7 A;  2YTV A;  2K75 A;  1PDQ A;  1PH5 A;  1HTL D;  1SNQ A;  3DMU A;  3H15 A;  3GV6 A;  5IT9 c;  2OWO A;  2DUD A;  2BCO A;  1GUW A;  4BBR G;  1PH2 A;  1X55 A;  4JI1 L;  2HCI A;  2R92 B;  3F2U A;  3D0F A;  1QZH A;  1PTO C;  4UPA A;  4K6D A;  4RFB A;  1B4O A;  1VDZ A;  3CCL A;  3HOY G;  2WAQ G;  1LTR D;  4JCV E;  4U68 A;  1H9S B;  3A74 A;  2WKD A;  1QIL A;  4MHE A;  5IT9 L;  1H9R A;  4JI8 L;  5EBD A;  5FK9 C;  5C3E B;  3T1H Q;  5C3W A;  3L0O A;  4AYB E;  2VNU D;  1AFP A;  2F0P A;  2HHH L;  1RTN A;  2KUM A;  2O4X A;  1A63 A;  1TWH H;  5AFW A;  3HOV G;  4JVZ A;  3FPU B;  3I7F A;  2WP8 J;  3CCV A;  1QG7 A;  1V1O A;  1IYJ B;  2MGS A;  3J81 E;  4FDB A;  2A1A A;  1CA5 A;  4LF8 L;  1CSQ A;  2PMZ E;  1CA6 A;  2B63 H;  1AEX A;  1TS3 A;  2LKV A;  5C4Z A;  4IUN A;  4XDX A;  4QGU A;  3U9O A;  2WKC A;  4LFB Q;  4JOI A;  2GN5 A;  3V05 A;  1EIF A;  3M3Y B;  4ME5 A;  3A5U A;  3CKI B;  5M9O A;  3D4R A;  2C9O A;  1A3T A;  2MPM A;  2F0M A;  5FJ8 G;  5M3M B;  4NKL A;  2RDF A;  1U4M A;  2RSO A;  3NP8 A;  1VMC A;  4HAE A;  1DM0 B;  4PZ7 A;  3KF6 B;  3P1H A;  2K33 A;  2KED A;  2MO0 A;  4KY6 A;  3KYH C;  1Y1W G;  2NVQ H;  4IFD H;  3RLN A;  4FXD A;  2IL8 A;  5HGQ A;  5D3I B;  3NXW A;  3ER0 A;  2Q2I A;  3GTJ B;  1EY6 A;  2EYJ A;  1NNX A;  5CV9 A;  4TQU S;  1BKB A;  1F2Z A;  5I6W A;  3FKI B;  2HD3 A;  3K7A B;  4A3B G;  3J80 i;  2JA6 B;  1I5F A;  2FIN B;  5BN3 A;  3DEP A;  1FNW A;  2KEN A;  3C1F A;  5C3X A;  3NHH A;  3J7Y W;  3S2H B;  2JA8 B;  4R9W A;  1YBY A;  5KYL A;  2BDN A;  1UE7 A;  3GTG B;  1LTA D;  4MN3 A;  3CQZ B;  3T1H L;  4Y7N H;  1ESR A;  2PQA B;  4A3K B;  3CF5 A;  4B3R Q;  3RZO B;  4J6H A;  3Q8D A;  2OTJ A;  2MUY A;  1SYG A;  1YI2 A;  1HH2 P;  4LAA A;  2Z4H A;  4IN3 A;  5I9O A;  5HY6 A;  2JEB I;  1QWY A;  2V4D A;  2Z0S A;  4TVA B;  2RVL A;  3CW2 C;  3QOJ A;  3ULP A;  2VW9 A;  5E1F A;  1Q90 A;  5ELO A;  3J7A F;  4I65 A;  1P16 A;  3CME A;  3MVV A;  4NXM Q;  3TS2 A;  1YHB A;  1I4H A;  2E5L Q;  4DV4 Q;  3Q0A A;  2KCM A;  3T53 B;  2F0S A;  1CQV A;  4GN3 B;  3VR5 A;  3CMA A;  1Q1B A;  1RCV D;  4JI5 L;  1BQQ T;  3DXJ C;  4IUT A;  2BA0 A;  3SK5 A;  4ZUJ A;  4X3S A;  1QZG A;  3E5S A;  1AW7 A;  5JJL A;  3NWT A;  1DOM A;  4L5S A;  2VQE Q;  5CMD A;  1LTI D;  5A2Q E;  4NMZ A;  4JBJ A;  1U4R A;  1TWA H;  4Z9C B;  2K01 A;  3X3N A;  4IPD A;  1RDP D;  2WAC A;  4QQB X;  5CBA E;  3U58 A;  2JQO A;  4KD3 A;  1SSO A;  4IOA A;  1V1P A;  1EY9 A;  5C5L A;  3EA6 A;  2A5H A;  2L15 A;  3DM1 A;  3U9S A;  4UDU C;  2M2L A;  1CQF A;  4DV6 L;  2JXM B;  1WFQ A;  2CWP A;  2ZTD A;  1TWH B;  1CFM A;  2TSS A;  4LUZ A;  3BS1 A;  4X65 Q;  4CKE A;  1HNW L;  1STY A;  5C0X H;  3QO2 A;  2AHO B;  1O7Y A;  4KN4 C;  4DAP A;  3A8I E;  4A75 A;  3MXP A;  4PMB A;  3GTM H;  1L1O A;  3Q6S A;  1TR5 A;  1WTR A;  3HOW G;  4N8X 1;  4DU9 A;  1VQG A;  1EWC A;  3J80 c;  2E2D C;  1WTO A;  3AFQ A;  2B2U A;  1KL9 A;  1FGB D;  3SXH A;  2Q8R E;  4RWS C;  4YHH Q;  3HKZ G;  1DON A;  2EYL A;  4G57 A;  1LTS D;  3NEL A;  1ZKO A;  1TS4 A;  5EPL A;  3J7A 5;  2XSC A;  5KYI A;  1A0I A;  2EJF C;  5BR8 L;  4DXF A;  3X3M A;  5K36 G;  2OXP A;  1Y8N B;  1B70 B;  2QGQ A;  2R92 G;  3SK6 A;  1HNZ L;  5GQO A;  5JJZ A;  4L5R C;  1KDC A;  4R4C A;  2NWG A;  1XX8 A;  1F9Q A;  4DK3 C;  3D6C A;  1GUG A;  1ICF B;  5KIX A;  1VQM A;  1K73 C;  3KDF A;  4JI3 Q;  1HFG A;  1VMP A;  3PIO 3;  2EE1 A;  1IBL Q;  4IUP A;  4BY7 H;  2NYZ D;  1E0B A;  1H9J A;  3H3V C;  3TS0 A;  5M3F H;  4Y7N B;  1X54 A;  1VQC A;  3K5N A;  3R3O A;  4FVM A;  4LF4 L;  5I2Y A;  1N36 L;  3OW7 A;  1QVC A;  1SNO A;  4KHZ A;  2R93 G;  4JI4 L;  4OON A;  1GJX A;  3KLR A;  4C1N K;  5IY0 A;  4X65 L;  2BA1 A;  2E74 C;  3GTL H;  3T16 A;  4UP8 A;  4WRD A;  1XMO L;  2H5X A;  3PUX A;  1S40 A;  1BCP B;  1STN A;  1SFO H;  2EJM A;  2VQF Q;  2HCC A;  2LS0 1;  3A0J A;  3Q24 A;  4PMC A;  4HTH A;  4S3S A;  4DN4 M;  2NN6 H;  4KKS A;  2FMM A;  3S17 B;  2JN4 A;  1AZP A;  3FMC A;  1PVO A;  1X3Q A;  3FDT A;  3U50 C;  5M3M G;  2HQE A;  3RUZ A;  1I50 H;  1LT5 D;  1PRT F;  1GKH A;  3Q22 A;  2PW7 A;  3PUY A;  1SYD A;  3IRB A;  3N6R A;  2ID0 A;  1A15 A;  3SEB A;  5C4X H;  1PYW D;  4DR5 L;  4BXX H;  1TKW B;  4BS9 A;  1S72 A;  1L0X B;  3SHL A;  2QDL A;  2JEA I;  1TWA B;  2F3I A;  4UP7 A;  2MNA A;  2YV5 A;  3FKI G;  1S5F D;  2RKS A;  3HOU H;  4G7Z C;  3UDX A;  1JWM D;  1A6X A;  3IL8 A;  2JA8 G;  4ODG A;  1F9P A;  2KOL A;  1MSG A;  4KV6 A;  1PFN A;  1VQ6 A;  4CJ0 B;  5F2D A;  3F2D A;  2WIN B;  4A3K G;  2D9U A;  4MTN A;  4K2L A;  5KGU A;  3MEF A;  3J80 E;  1FJG L;  3GTM B;  2F0G A;  4IUQ A;  3H3V I;  3I56 A;  4DK6 C;  4ZRZ A;  1XNQ Q;  4RH6 A;  3KJO A;  1S5B D;  1JOQ A;  1DOK A;  2AUK A;  2F1M A;  4QL5 A;  1UEA B;  1CKO A;  4A3C H;  1SN8 A;  4BY1 H;  3KUP A;  3D6W A;  4DV0 L;  1WVL A;  1G6Z A;  1YEZ A;  2HIX A;  3QG1 A;  5EBC A;  4FYD A;  4H13 C;  1LTG D;  1UUP A;  5J3B A;  2X6G A;  5ISR A;  4C3H B;  1BNZ A;  1CUK A;  2Z4I A;  4JBM A;  2DJG C;  3HZX A;  2IY5 B;  4ILW A;  4ZYS A;  2Q2H A;  1IL2 A;  4OGQ C;  5IYB H;  1PA6 A;  1SEB D;  2F0J A;  1EZ8 A;  2D2C C;  1EUJ A;  3NTH A;  3F2C A;  1BCP D;  1YNJ D;  5COY A;  1IKL A;  5IWA L;  1BCP F;  1M90 C;  2OCE A;  1K28 A;  3HGB A;  1VQJ A;  1RJT A;  3MC0 B;  3CCU A;  2M9V A;  4RCO A;  3NQI A;  1EWH A;  3K6O A;  2Z8L A;  1L1O B;  2QEX A;  4ID6 A;  4BY7 B;  1QVF A;  2GVA A;  5M3F B;  1RL2 A;  4QMG A;  4ZKB B;  2Z6K C;  1BDO A;  2OF1 A;  2F4I A;  2PZU A;  1VQO A;  2Q8I B;  3GTL B;  3JAM c;  3NBI A;  4L63 B;  1I3Q H;  1J6Q A;  1EY5 A;  3L3O C;  4EQN A;  1SFO B;  1ZXT A;  3RLF A;  2B63 G;  1OXS C;  1XNQ L;  4IQZ A;  3PO3 H;  1HR0 L;  2HT1 A;  5IP9 G;  2K52 A;  2CCZ A;  5ELF A;  4QY7 A;  4LF9 Q;  1WTV A;  3PIP A;  4XQN A;  5JPM C;  4AYB B;  2IX1 A;  5C5M A;  1Q46 A;  5GAD C;  1Q12 A;  3JAM L;  1SYE A;  3T13 A;  4DAY A;  1K83 B;  4L6T B;  2UUB Q;  3DUZ A;  1N32 L;  1I94 Q;  1E2V A;  3D31 A;  3IFD A;  1OXX K;  1BBX C;  3OW2 A;  2IX0 A;  1KDB A;  2EYM A;  4LF7 L;  3PSI A;  1QUQ A;  1SE2 A;  4V19 0;  1K8M A;  4GLV B;  2B2Y A;  3RMH A;  3URY A;  3VA7 A;  5C3E H;  4Q5V A;  1SMY D;  4L5Q A;  3UE0 A;  1E1O A;  4LF5 Q;  2OTL A;  4OWX B;  3A8J E;  3FVQ A;  4N9T A;  4NW2 A;  3HOU B;  5G3L D;  3P20 A;  5IYD H;  1EIY B;  1C48 A;  5JEA H;  1SMX A;  1NUC A;  1JOK A;  2IT1 A;  3T4A C;  4HCS A;  4DV5 L;  3M4Y A;  4O2D A;  5KNB A;  1SXT A;  1IZ6 A;  2Y0S E;  1GHJ A;  1GUS A;  3OWE B;  4X66 L;  1X32 A;  2R3Z A;  2D0O A;  3TZD A;  3AB9 A;  3BVG A;  4HED A;  2F0H A;  2K1B A;  1YIT A;  1G8Z D;  1XMQ Q;  1HTP A;  1KNE A;  3SE0 A;  3AYH B;  2F0Q A;  1WD0 A;  1X3P A;  4JYA L;  1WCM H;  1VQ5 A;  1ZYR D;  2CHB D;  4BY1 B;  5T1G A;  4DR2 Q;  2DNE A;  1NR2 A;  1B53 A;  2R6G A;  4JI1 Q;  1PH7 A;  2KVM A;  2L0C A;  1ILP A;  2CH4 W;  3GTJ H;  2B2V C;  4J8Q A;  5GAH C;  2MO1 A;  2EYP A;  3I8Z A;  4K0K Q;  1KIX A;  1JMC A;  2JA6 H;  1BCP C;  1YNJ C;  1D5M C;  1R9T B;  4JI8 Q;  1C8C A;  2UXD Q;  3I90 A;  3FP9 A;  5L37 A;  1YJ9 A;  2K5N A;  2HHH Q;  4AQY L;  3F2B A;  4HN7 A;  3HOZ H;  3RLO A;  4X62 Q;  4GNX A;  4JV5 L;  1EFI D;  5BN4 A;  3MFG A;  2KCT A;  3CQZ H;  3S15 H;  4C56 C;  1TWF H;  2SOB A;  4KK7 A;  3RZO H;  4F88 A;  4LF8 Q;  1U9R A;  5DLQ E;  3QIA A;  3H91 A;  4WFN 3;  2N49 A;  1STE A;  1TWC H;  4XQQ A;  4HJ7 A;  2D5D A;  2CW0 C;  4E6I A;  1M1K C;  4IJL A;  5IGD A;  1TWG H;  5C0X G;  2N78 A;  1I3Q B;  3I4M B;  4X3U A;  5M5Y H;  4IUR A;  1VCI A;  1TS2 A;  3KJP A;  1AE3 A;  1EY0 A;  3KK7 A;  1KXL A;  1S3O A;  5CBE E;  4A3M H;  3PO3 B;  1E3P A;  2WAQ E;  3TP8 A;  3F1Z A;  4JI7 L;  3I4N H;  4KKU A;  1RF2 D;  4TKO B;  2B3G A;  3EFX D;  4K8I A;  2QA4 A;  4DR2 L;  2MJ8 A;  2PPB C;  1AP0 A;  1DCZ A;  1LAB A;  3NEN A;  3VDY A;  4NPS A;  1V8Q A;  1K8A C;  4QIW E;  3SGI A;  4DR7 L;  5EKL A;  1XPO A;  4JI0 L;  1F77 A;  3WWV A;  1AZQ A;  5FO8 B;  2NVX H;  4K0K L;  1HNX L;  5EPJ A;  5T1I A;  1VF5 C;  1MIU A;  5FLX E;  3I55 A;  1TU2 B;  1M4V A;  5TSS A;  3U4V A;  1LT3 D;  1KTK A;  1W2B A;  1SMY C;  4KJO A;  1PZK D;  2UUA L;  2UXD L;  1Q8K A;  1OO9 B;  1E2Z A;  1YHQ A;  4M8A A;  1PZI D;  1UE5 A;  4K5V A;  2H1E A;  3RD4 A;  3K0Y A;  4X62 L;  3RR5 A;  1Y1V B;  1W6K A;  3DWP A;  3ND9 A;  4BY7 G;  3LWU A;  1EY8 A;  4HSV A;  4KKT A;  5M3F G;  1K3B C;  1XTD A;  4RA8 A;  2L55 A;  4XT3 B;  5HGT A;  3CCM A;  2QIL A;  1EEF D;  2J4X A;  2MFI A;  2Q2T A;  1BO0 A;  3G7L A;  4A3L H;  4H44 C;  4Y52 H;  2IW3 A;  1IW7 D;  5AJ3 L;  2XIW A;  4DAY B;  1HA5 A;  1DZ1 A;  1WCM B;  1ZYR C;  5IGE A;  1PFM A;  3TZU A;  4JI5 Q;  1JE4 A;  1L1O C;  2PO4 A;  3GTO B;  2IPK D;  1WTX A;  4ZKC B;  2A74 C;  1CSP A;  1MI2 A;  1PH8 A;  1V43 A;  2EJG C;  2LMC B;  2XTI A;  4GKJ Q;  3MXN A;  5ELE A;  1YZ6 A;  2NN6 G;  1JOO A;  3OMC A;  4L8J A;  4AIM A;  4FF4 A;  1GM5 A;  1D6E C;  1EIG A;  4K5W A;  2DNC A;  1IBM Q;  1PH1 A;  2KHS A;  3SVM A;  3MWY W;  5IOC A;  4GOP A;  2YYZ A;  1KHI A;  1OTC A;  5JJK A;  5C0X I;  5C4X G;  5JJI A;  1G2S A;  3I91 A;  4DV6 Q;  4HJ5 A;  4BBS H;  4JC0 A;  3QB3 A;  4RHS A;  4TRD A;  3H6M A;  3HOZ B;  1K8O A;  1JIC A;  1R4P B;  2AWO A;  1GUN A;  2PNH A;  3HOX H;  1HNW Q;  1K9M C;  3S15 B;  1TWF B;  3KLS X;  4K8J A;  2AQ1 B;  5GAG C;  3HOU G;  5JVG 3;  1PZJ D;  4R4Q A;  3NQT A;  1TVX A;  2JA5 H;  1STG A;  1TWC B;  3FEW X;  4RKL A;  3H94 A;  2AQ3 B;  3FPP A;  4DUY Q;  1JJ2 A;  1VQI A;  5IOD A;  1PXU A;  1VQK A;  5KNC A;  1JJC B;  3O13 A;  1TWG B;  4HMJ A;  5CYU A;  4ZAI A;  1KRS A;  2NBF A;  5BN5 A;  5ELD A;  5LL6 S;  5M5Y B;  1HHV A;  4APV A;  1Z7T A;  1SE4 A;  3B6Y A;  4DR6 L;  3MXG A;  5FKA C;  4A3M B;  5IT9 E;  4EX5 A;  2O5J C;  2K32 A;  1BVS A;  3S17 H;  2NTT A;  1PMR A;  1N33 L;  1NTG A;  3I4N B;  4A3C G;  5BR8 Q;  3C3L A;  3GTP B;  1GHK A;  1QNU A;  2NVT H;  4BA1 I;  2G5D A;  3M7N A;  1T5E A;  1QB5 D;  4JI2 L;  1HNZ Q;  2F0W A;  1Q7Y C;  4GKJ L;  1VQ4 A;  3NBH A;  4C2M H;  1Y8P B;  2AWN A;  1V9P A;  3DEO A;  4GNX B;  4X3T A;  5I2X A;  5C44 G;  1WYD A;  2CH4 A;  3S24 A;  2NVX B;  1VQN A;  1IBM L;  3CAM A;  4A4I A;  5IYB G;  4U67 3;  1JB7 A;  1LM0 A;  4DA2 A;  2HDM A;  2EY6 A;  5I9P A;  2LXJ A;  3ITP A;  5LL6 X;  4LF4 Q;  1N8R C;  1SR3 A;  3C2P A;  2R7Z B;  1ENA A;  1N36 Q;  1T5X D;  4JI4 Q;  4DV1 L;  5DM6 3;  1PRT B;  3ND8 A;  3S14 H;  1E2W A;  2KQ3 A;  4QB4 A;  2JE6 I;  2K5V A;  1D2B A;  4X6A H;  1XMO Q;  1Q8I A;  2XRS D;  5J1Z A;  3HKZ E;  2Q8T A;  2JA9 A;  1F2Y A;  3HS0 C;  1JWS D;  3OIP A;  5DEH A;  3CCS A;  3OTO L;  4DUY L;  1IW7 C;  4HIK A;  2MP1 A;  3H0G B;  4A93 H;  1EY7 A;  3BVZ A;  1MD2 D;  4FO2 A;  1Y8O B;  1VF7 A;  2VS1 A;  3VYS A;  5CV4 A;  1BF4 A;  2RA4 A;  4CDE C;  1GUT A;  4C3H H;  1STH A;  2VUM G;  2CQA A;  5DAU A;  5E4W C;  3PIP 3;  3CPW A;  1QJO A;  4RGN A;  2IHF A;  4HCE A;  5D3D A;  4DR5 Q;  2OQ0 A;  3HEJ A;  2ICI A;  1VQP A;  3PMF A;  5LMN W;  1ICW A;  4C3J B;  2VL6 A;  5J22 A;  4BBR H;  2QDB A;  1CKN A;  2RDH A;  3I4O A;  3NTK A;  3STB D;  2DJF C;  3K8A A;  2UXC L;  3MTS A;  1JT8 A;  1MKH A;  2K5D A;  2R61 A;  1PYB A;  1BBW A;  4LUV A;  4BBS B;  2QW7 A;  4G4K A;  1ENF A;  3I73 A;  4A3G B;  4B3S L;  2F0N A;  3A7A B;  4FXG C;  5C3E G;  3HOX B;  2D62 A;  2BOS A;  1X56 A;  2A68 D;  3BDO A;  3ULJ A;  4JK1 C;  1AE2 A;  5EKK A;  4C1N I;  1FJG Q;  1U5K A;  2CFM A;  3K81 C;  5IYD G;  1YIJ A;  1HQR D;  3AQQ A;  4K6L A;  5JEA G;  2JA5 B;  2IJ0 A;  1EOV A;  2WFW A;  3LX0 A;  4YIJ A;  2B2W A;  1PFB A;  5D14 A;  3BG3 A;  3VYT A;  4DV0 Q;  2HDL A;  2K5W A;  1TQO A;  4A3I B;  2FHT A;  3UI2 A;  2FXQ A;  3VA5 A;  3KBG A;  3OWF A;  1TXY A;  5J39 A;  2FJ2 A;  1A3U A;  4PQX A;  1WCM G;  3BVM A;  4GOP B;  3MFY A;  4IUU A;  1K83 H;  1PRT D;  4OEL B;  3I72 A;  5FO7 B;  2NVT B;  3R2T A;  2E2H B;  4RGM A;  3RNU A;  4JG2 A;  2J7Z A;  4C2M B;  5IWA Q;  2E8G A;  3JAM i;  1G91 A;  3MZ5 A;  1HUN A;  3DWA A;  1QNK A;  2RCF A;  2JA6 G;  2G9H D;  4GN4 B;  4DNI A;  1PLF A;  2F4V L;  5C4H A;  4IJH A;  5IGB A;  1Q82 C;  4A3E B;  1ASZ A;  4NXN Q;  1F2M A;  1T9H A;  1EWI A;  3HOZ G;  1LTT D;  2KJX A;  4MTK A;  1WI5 A;  2AKW B;  3S14 B;  2BH2 A;  4NDX A;  3LWE A;  2JJQ A;  2F0K A;  1D8L A;  1ESF A;  4OL7 A;  2XGT A;  1LT6 D;  4WJW A;  1HUM A;  4IO9 A;  4XYQ A;  2QCP X;  1HR0 Q;  1PH6 A;  1FYC A;  2A8V A;  4JI6 L;  2NZH A;  2N88 A;  4OX9 L;  2B2T C;  4A93 B;  4HJA A;  2ZTE A;  3L7Z C;  4HID A;  5C0X J;  2ENB A;  1IYV A;  3SK8 A;  2ZJR A;  1K8G A;  2ICE C;  1UAP A;  1N32 Q;  4A3M G;  2CKZ B;  3PGZ A;  5EKI A;  4ULL A;  1I4G A;  1SNM A;  1JC7 A;  1IKM A;  3I4N G;  2KHJ A;  4H7B A;  3TP7 A;  3KF8 A;  4WOR A;  2EVB A;  3TSS A;  3K59 A;  1V1P B;  4LF7 Q;  1JJG A;  1MJC A;  1IHZ A;  1R9T H;  1DYQ A;  4X3K A;  4YCU A;  3STB C;  2N3S A;  4BBR B;  4GKK L;  1S4Z A;  1B1Z A;  3I2Z A;  3ICE A;  1TII D;  2E2J B;  2K7V A;  3C1E A;  5DNF A;  3A5Z B;  2F0L A;  3PCO B;  2WB1 B;  2WAQ B;  1S5E D;  4DV5 Q;  1HPC A;  3PUZ A;  4QUC A;  1GVP A;  2K05 A;  4P75 A;  2A68 C;  4R4I A;  4NXN L;  4KHP L;  4PNY A;  4RKB A;  3G6J B;  4X66 Q;  5CC4 A;  5EAY A;  1JWU D;  1BBU A;  1I4Q A;  4X64 Q;  5M5X H;  1B2T A;  1CKM A;  4FF1 A;  1N34 L;  5CV6 A;  2CW0 D;  4R4O A;  4GNX C;  4QIW B;  1FR3 A;  3L9A X;  4H02 A;  4JYA Q;  4DK0 A;  3W1B A;  1Q86 C;  3NPP A;  4CDF C;  1EY4 A;  3I4M H;  1X3E A;  1KAA A;  2EY1 A;  2AMC B;  2EPB A;  3W3A A;  2RF4 A;  4R1J A;  2UUC L;  4IUV A;  1SRU A;  2PW5 A;  1GOZ A;  4JBW A;  3T56 B;  4A3L G;  4DPG A;  3VYR A;  2O2L D;  2F52 A;  4H0L C;  5GAE C;  1LAC A;  1PRT C;  2SEB D;  2UU9 Q;  3IFT A;  4YY3 L;  1RIP A;  1BXT A;  1SE8 A;  4HJ8 A;  4A76 A;  3P75 A;  3KDF B;  4IFD G;  4RMF A;  3BZD B;  3AMU A;  3I4L A;  3U4Z A;  2PMZ B;  4YWL A;  1Y1W B;  1L2F A;  4AQY Q;  4YWK A;  3WOE A;  2VZA A;  1LT4 D;  4XTC S;  4JV5 Q;  2DY8 A;  3HKS A;  4CKC A;  3T1Y L;  4LWC A;  5EPK A;  1EQR A;  1JQY D;  2F0U A;  2PZT A;  2EOT A;  4CJ2 C;  1QE6 A;  2RHQ B;  4DV3 L;  3K80 C;  4A3B B;  3OSO A;  1PFS A;  3CC7 A;  1Y1V H;  1EFW A;  4BBS G;  3K57 A;  1ONL A;  4OO1 H;  2Q2U A;  2F3W A;  5CV7 A;  4R8N A;  2A6E C;  3M4Q A;  2EDG A;  3GO5 A;  4HMI A;  2SNM A;  4EGV A;  1ENC A;  3HFZ B;  1QOH A;  4RGO S;  5CV8 A;  4K5X A;  1KDA A;  3PF5 A;  4X64 L;  3GTK B;  4O42 A;  2JA5 G;  4P73 A;  4HIM A;  3TRE A;  2DY7 A;  2OEO A;  4KJN A;  4JI7 Q;  5ELB A;  4QUF A;  3GTO H;  3GTQ H;  1ASY A;  4GS3 A;  4NP5 A;  4WJ3 M;  5IP7 H;  1MGS A;  4IPG A;  4DR7 Q;  1YHA A;  4FP5 D;  4JOI C;  4JI0 Q;  4F8M A;  1Y14 B;  4NB3 A;  3V96 A;  4AH6 A;  4XIG S;  4LFA L;  1OXV A;  1HNX Q;  1HA6 A;  2RHS B;  1I6V C;  2UU9 L;  4MNO A;  2WII B;  1XXG A;  1CZG A;  3EVQ A;  1WOC A;  3I3C A;  4UHV A;  2UUA Q;  3M7G A;  1TY0 A;  4LMQ D;  4PMW A;  3KOJ A;  3A56 A;  3J81 L;  1HRJ A;  2KA7 A;  5KND A;  1G2T A;  2QF7 A;  3J81 j;  1RHP A;  2JA7 H;  2F0I A;  2RBM A;  1I4R A;  5GRO A;  3ULL A;  5IYC H;  3RZD B;  3CPF A;  3S1Q B;  3S1R H;  1EIH A;  2PCF B;  4CDD C;  1F9R A;  2RQX A;  4P2C B;  1YJN A;  1OXT A;  1EYD A;  1O80 A;  1E7Z A;  3JAM E;  2K14 A;  2Z6K A; 
#chains in the Genus database with same CATH homology
 5M5X B;  1D5X C;  3S16 B;  3K5O A;  3GQB A;  1O7Z A;  4IFD I;  5LHY 1;  4KD4 A;  2BDO A;  2L5T A;  1KNA A;  3LNN A;  4KY5 A;  4G7O C;  2A69 D;  3BDL A;  1B50 A;  2EXZ A;  1HXY D;  1EZ6 A;  1GUO A;  4BWG B;  3P7J A;  1ILQ A;  2NB0 A;  3AU7 A;  4OIJ A;  4C3H G;  1XWE A;  3HKZ B;  1XYI A;  2B39 A;  1JOR A;  4EQP A;  4XYO A;  2K6A A;  4GZY C;  3VR6 A;  1Y69 U;  2L12 A;  3TBI B;  3PV0 A;  3Q23 A;  1F9S A;  1R4Q B;  5EGT A;  5EJW A;  1KAB A;  4ZUI A;  2F0O A;  3OMG A;  2IWH A;  4QCL A;  3TP6 A;  4OIK A;  2XWB B;  2K04 A;  3TDQ A;  1O78 A;  3NSW A;  1CI3 M;  2C5C A;  2DN8 A;  2F0F A;  2VB2 X;  1SYB A;  2R93 B;  5JEA J;  1YNN D;  3S2D B;  2I46 A;  4LK1 C;  2PZW A;  4DGZ A;  1OXU A;  5A2Q L;  3GTQ B;  1FD7 D;  4HR7 B;  2E2I B;  2B2U C;  1LV9 A;  1HCZ A;  1CK1 A;  2B2V A;  3K5M A;  4KY7 A;  1EU4 A;  2XVS A;  2JYO A;  3IAY A;  5JOB A;  3EQL C;  3CU7 A;  3OIQ A;  1HFN A;  1WTP A;  2JA7 B;  2EYO A;  3S1R B;  1CZW A;  1HQM C;  4EQO A;  4HSP A;  1MBY A;  4Q0F A;  4BA2 I;  2EY5 A;  3DHQ A;  4KI0 A;  2KCN A;  1EOT A;  5NUC A;  2YU9 B;  3NTI A;  5I4D A;  1J9O A;  5D65 A;  4B9X A;  4CBV A;  2VXW A;  5M5W B;  1I6H B;  2XNA C;  3ONA B;  2A69 C;  2A73 B;  2OT2 A;  1DOL A;  5E4X A;  2O5I C;  1UNS A;  1SJH D;  4A3J B;  2B2W C;  3WDN A;  3OOC A;  3R2I A;  2J0T D;  5KRU A;  1O7L A;  1FNU A;  3A54 A;  1D1I A;  1KLG D;  2L11 A;  5K5P A;  2SDF A;  1SE3 A;  2JP1 A;  5ELC A;  1SJE D;  4A3F B;  1WTQ A;  3ERQ A;  3PUW A;  3SR1 A;  1MSH A;  1EU3 A;  1SND A;  2F0T A;  4FF3 A;  2F03 A;  2E76 C;  2NUC A;  2NN6 I;  5JPN C;  1Q1E A;  3PO2 B;  2F0D A;  1GXD C;  4CGY B;  5IGG A;  4CKB A;  1J8I A;  1YNN C;  1RKN A;  3C46 A;  1JR0 D;  1B3A A;  1EEI D;  1PTO H;  1L0Y B;  3N52 A;  3R93 A;  4OHJ A;  4I7Z C;  4ZLT F;  2RSN A;  1KLU D;  2B63 B;  1I4P A;  4RCN A;  2VB3 X;  2F0V A;  5CGK A;  2PQE A;  3VR3 A;  4ZQ3 A;  4PV1 C;  4KMU C;  2FMC A;  2B8F A;  1NR4 A;  5KEE A;  4CJ1 B;  3QOL A;  4IFD J;  2NVQ B;  5CV5 A;  1TS5 A;  3J80 L;  3WOF A;  3NE5 B;  2FFK B;  2IX3 A;  2F0E A;  2AUJ D;  3BYT B;  1S5C D;  2PYK A;  1ROD A;  2EYF A;  1Z6H A;  2N55 A;  5DM7 3;  4DAV A;  3FRP B;  4OO1 G;  2LY7 A;  1B9M A;  3E0J A;  2K5Q A;  3CRK C;  4K14 A;  1IYU A;  1I4X A;  1AN8 A;  3PUV A;  3BYY B;  4TSS A;  1SYC A;  4ZK9 B;  4FXK C;  3VR2 A;  2ZXP A;  2BE5 D;  1EYC A;  3SDZ A;  3H09 A;  3I70 A;  1JB3 A;  3MEH A;  1EYA A;  4F87 A;  3QJY A;  5I6Y A;  3D4D A;  1SNC A;  2Y0S B;  3HRZ C;  3S1M B;  4M1U B;  4FF2 A;  2G9D A;  1D5Z C;  4IZ8 A;  2HUG A;  1CHP D;  1QCB D;  1U4P A;  2H4O A;  1II3 A;  3ERO A;  4FNF A;  1RD9 D;  1EQV A;  1STA A;  2B2Y C;  2A6E D;  4IAL A;  1ML0 D;  4LJZ C;  1BOS A;  1ZEQ X;  2CVR A;  1G29 1;  4ABN A;  3QWN A;  2XN9 C;  2QKI C;  4C3I B;  5COR A;  1CT1 D;  4CHT B;  4G7H C;  3OHX C;  2F3V A;  2NZ1 D;  3T51 B;  4EVO A;  1PTO B;  1F2L A;  1SDF A;  3K5L A;  2L4N A;  4A3D B;  2PNR C;  3GD7 A;  4RHR A;  1SAP A;  4QF4 A;  3TN2 A;  2E75 C;  5CR3 A;  1ET9 A;  3NWS A;  4OO1 I;  3J7A V;  4K2K A;  4F7X A;  4RAU C;  4XT1 B;  1SYF A;  3HOY B;  3MXU A;  3MAQ A;  3TP5 A;  2SNS A;  1CTM A;  1H9M A;  2EYH A;  3IKJ A;  3D8G A;  1C4Q A;  2QEJ C;  1U4L A;  1DJR D;  2K28 A;  1Z47 A;  2NVY B;  3HOV B;  2ZXO A;  1STB A;  5IIF A;  1BUV T;  3W2D A;  1NAP A;  4KHV A;  1H9S A;  3CHB D;  4RGT A;  1B9N A;  1EQT A;  2EY2 A;  2XRQ D;  2BE5 C;  3GV3 A;  4DF7 A;  5JVH 3;  1DXM A;  1Q3L A;  1RTO A;  1LLR D;  2A6H D;  2ZXR A;  2ZT9 C;  3NK9 A;  4UAI A;  3M4O B;  1A2U A;  4C3J G;  2LFN A;  2NTS A;  5K36 H;  1TT2 A;  2MHV A;  5IGF A;  1I50 B;  1LO5 D;  1PTO D;  3SK4 A;  1PTO F;  5C4X B;  1CHQ D;  2KEC A;  2XWJ B;  1FNV A;  3KBX A;  4N9P A;  4DFA A;  2KCC A;  1NSN S;  3V2T A;  1CM9 A;  3KLS A;  3EJI A;  3TME A;  1H9K A;  2AQ2 B;  4O1N A;  3MHB A;  2RDG A;  5G3L F;  1DD2 A;  3HP3 A;  5IGC A;  3R8B A;  1TY2 A;  2B2T A;  3BDC A;  1JCK B;  3OPO A;  5FLX L;  1BR9 A;  3S9W A;  1A2T A;  1D1K A;  5E3F A;  1S5D D;  2X69 A;  1EL0 A;  1LTB D;  4B08 A;  2JSO A;  2K03 A;  3A7L A;  1WD1 A;  3S1N B;  1SBB B;  5FOB B;  3DWQ A;  3HG9 A;  2GA4 B;  2WV6 D;  5C4J B;  4XXE A;  5A35 A;  3CRL C;  4KTA A;  3VYU A;  5C44 B;  3E6Z X;  1XTC D;  4DNR B;  4J1M A;  5C6A A;  4MIU A;  4DK1 A;  4DXG A;  3D3R A;  1M8A A;  3A8K E;  4V0B A;  2EZV A;  5JAV A;  4KN7 C;  1W6J A;  1ET6 A;  1WTW A;  3MA2 B;  5HUR A;  3D4W A;  4DNT B;  5EQ0 A;  3M85 A;  4C3I G;  1A3V A;  4B9W A;  2M00 A;  3HOW B;  3K58 A;  2L1B A;  1NCV A;  2KEE A;  2I07 B;  3NUC A;  3A55 A;  4R8I A;  1B44 D;  4XQJ A;  2A6H C;  3ZYY X;  2Z1C A;  5FO9 B;  3VR4 A;  1SNP A;  2L9H A;  2B8G A;  2TMP A;  2VUM B;  2X6L A;  1IL8 A;  3GP7 A;  1PDQ A;  1HTL D;  1SNQ A;  3DMU A;  3GV6 A;  1GUW A;  2BCO A;  2HCI A;  2R92 B;  3F2U A;  1PTO C;  4K6D A;  4RFB A;  1B4O A;  1VDZ A;  1LTR D;  4U68 A;  1H9S B;  2WKD A;  1QIL A;  4MHE A;  5IT9 L;  1H9R A;  5EBD A;  5FK9 C;  5C3E B;  5C3W A;  2VNU D;  1AFP A;  2F0P A;  1RTN A;  2KUM A;  2O4X A;  5AFW A;  3FPU B;  2WP8 J;  1QG7 A;  1V1O A;  2MGS A;  3J81 E;  1CA5 A;  1CA6 A;  1AEX A;  1TS3 A;  2LKV A;  5C4Z A;  4IUN A;  4XDX A;  3U9O A;  2WKC A;  3V05 A;  3M3Y B;  4ME5 A;  3CKI B;  5M9O A;  3D4R A;  2C9O A;  1A3T A;  2MPM A;  2F0M A;  5M3M B;  4NKL A;  2RDF A;  1U4M A;  2RSO A;  3NP8 A;  1VMC A;  4HAE A;  1DM0 B;  2KED A;  2K33 A;  3P1H A;  4KY6 A;  4IFD H;  4FXD A;  2IL8 A;  5D3I B;  3NXW A;  3GTJ B;  5CV9 A;  1EY6 A;  2EYJ A;  4TQU S;  1F2Z A;  5I6W A;  3FKI B;  3K7A B;  2JA6 B;  2FIN B;  5BN3 A;  3DEP A;  1FNW A;  3C1F A;  5C3X A;  3NHH A;  3J7Y W;  3S2H B;  2JA8 B;  4R9W A;  5KYL A;  2BDN A;  3GTG B;  1LTA D;  4MN3 A;  3CQZ B;  1ESR A;  4A3K B;  3RZO B;  4J6H A;  2MUY A;  1SYG A;  4LAA A;  2Z4H A;  4IN3 A;  5I9O A;  2JEB I;  1QWY A;  2V4D A;  2RVL A;  3QOJ A;  5E1F A;  1Q90 A;  3J7A F;  4I65 A;  3MVV A;  1I4H A;  3Q0A A;  3T53 B;  2F0S A;  1CQV A;  3VR5 A;  1Q1B A;  1RCV D;  1BQQ T;  3DXJ C;  4IUT A;  2BA0 A;  3SK5 A;  4ZUJ A;  4X3S A;  3E5S A;  1AW7 A;  3NWT A;  1DOM A;  5CMD A;  1LTI D;  5A2Q E;  4NMZ A;  1U4R A;  4Z9C B;  2K01 A;  3X3N A;  1RDP D;  2WAC A;  5CBA E;  4KD3 A;  1SSO A;  1V1P A;  1EY9 A;  5C5L A;  3EA6 A;  2A5H A;  3U9S A;  3DM1 A;  4UDU C;  2M2L A;  1CQF A;  2JXM B;  1TWH B;  1CFM A;  2TSS A;  3BS1 A;  4CKE A;  1STY A;  5C0X H;  3QO2 A;  1O7Y A;  4KN4 C;  4DAP A;  3A8I E;  3MXP A;  4PMB A;  3Q6S A;  1TR5 A;  1WTR A;  4DU9 A;  1EWC A;  2E2D C;  1WTO A;  2B2U A;  1FGB D;  3SXH A;  2Q8R E;  4RWS C;  1DON A;  2EYL A;  4G57 A;  1LTS D;  1ZKO A;  1TS4 A;  5EPL A;  2XSC A;  5KYI A;  2EJF C;  4DXF A;  3X3M A;  5K36 G;  2OXP A;  1Y8N B;  3SK6 A;  5JJZ A;  1KDC A;  2NWG A;  1XX8 A;  1F9Q A;  3D6C A;  1GUG A;  5KIX A;  1HFG A;  1VMP A;  3PIO 3;  2EE1 A;  4IUP A;  2NYZ D;  1E0B A;  1H9J A;  3H3V C;  4Y7N B;  3K5N A;  3R3O A;  4FVM A;  5I2Y A;  3OW7 A;  1SNO A;  4KHZ A;  1GJX A;  3KLR A;  4C1N K;  2BA1 A;  2E74 C;  3T16 A;  4WRD A;  3PUX A;  1BCP B;  1STN A;  2EJM A;  2HCC A;  2LS0 1;  3Q24 A;  4PMC A;  4HTH A;  4S3S A;  4DN4 M;  2NN6 H;  4KKS A;  2FMM A;  3S17 B;  1AZP A;  3FMC A;  1X3Q A;  3FDT A;  2HQE A;  3RUZ A;  1LT5 D;  1PRT F;  3Q22 A;  2PW7 A;  3PUY A;  1SYD A;  3N6R A;  2ID0 A;  1A15 A;  3SEB A;  1PYW D;  1TKW B;  4BS9 A;  1L0X B;  3SHL A;  2JEA I;  1TWA B;  1S5F D;  2RKS A;  4G7Z C;  1JWM D;  1A6X A;  3IL8 A;  4ODG A;  1F9P A;  2KOL A;  1MSG A;  4KV6 A;  1PFN A;  4CJ0 B;  5F2D A;  2WIN B;  2D9U A;  4K2L A;  5KGU A;  3J80 E;  3GTM B;  2F0G A;  4IUQ A;  4ZRZ A;  4RH6 A;  1S5B D;  1JOQ A;  1DOK A;  2AUK A;  2F1M A;  1UEA B;  3KUP A;  3D6W A;  1WVL A;  1G6Z A;  3QG1 A;  5EBC A;  4FYD A;  4H13 C;  1LTG D;  1UUP A;  5ISR A;  2X6G A;  4C3H B;  1BNZ A;  2Z4I A;  3HZX A;  4ILW A;  4ZYS A;  4OGQ C;  1SEB D;  2F0J A;  1EZ8 A;  2D2C C;  3NTH A;  1BCP D;  1YNJ D;  5COY A;  1IKL A;  1BCP F;  3HGB A;  1RJT A;  3MC0 B;  2M9V A;  4RCO A;  3NQI A;  1EWH A;  3K6O A;  2Z8L A;  4ID6 A;  4BY7 B;  5M3F B;  4QMG A;  4ZKB B;  1BDO A;  2OF1 A;  2F4I A;  2PZU A;  2Q8I B;  3GTL B;  3NBI A;  4L63 B;  1EY5 A;  3L3O C;  4EQN A;  1SFO B;  1ZXT A;  3RLF A;  1OXS C;  4IQZ A;  5ELF A;  1WTV A;  4XQN A;  5JPM C;  4AYB B;  2IX1 A;  5C5M A;  1Q12 A;  3JAM L;  1SYE A;  3T13 A;  4DAY A;  1K83 B;  4L6T B;  3DUZ A;  1E2V A;  3D31 A;  3IFD A;  1OXX K;  1BBX C;  2IX0 A;  1KDB A;  2EYM A;  1SE2 A;  4V19 0;  1K8M A;  2B2Y A;  3RMH A;  3URY A;  3VA7 A;  4Q5V A;  1SMY D;  3A8J E;  3FVQ A;  4N9T A;  4NW2 A;  3HOU B;  5G3L D;  3P20 A;  1C48 A;  5JEA H;  1NUC A;  1JOK A;  2IT1 A;  3T4A C;  4HCS A;  3M4Y A;  5KNB A;  1SXT A;  1GHJ A;  1GUS A;  3OWE B;  1X32 A;  2R3Z A;  3TZD A;  3AB9 A;  3BVG A;  4HED A;  2F0H A;  2K1B A;  1G8Z D;  1HTP A;  1KNE A;  3SE0 A;  2F0Q A;  1WD0 A;  1X3P A;  1ZYR D;  2CHB D;  4BY1 B;  5T1G A;  2DNE A;  1NR2 A;  1B53 A;  2R6G A;  2KVM A;  2L0C A;  1ILP A;  2B2V C;  4J8Q A;  2EYP A;  3I8Z A;  1BCP C;  1YNJ C;  1D5M C;  1R9T B;  1C8C A;  3I90 A;  4HN7 A;  1EFI D;  5BN4 A;  3MFG A;  4C56 C;  2SOB A;  4KK7 A;  4F88 A;  1U9R A;  3QIA A;  3H91 A;  4WFN 3;  1STE A;  4XQQ A;  2D5D A;  2CW0 C;  4E6I A;  5IGD A;  5C0X G;  1I3Q B;  3I4M B;  4X3U A;  4IUR A;  1VCI A;  1TS2 A;  1EY0 A;  3KK7 A;  3PO3 B;  5CBE E;  3TP8 A;  4KKU A;  1RF2 D;  4TKO B;  3EFX D;  4K8I A;  2PPB C;  2MJ8 A;  1AP0 A;  1DCZ A;  1LAB A;  1V8Q A;  5EKL A;  1F77 A;  1AZQ A;  5FO8 B;  5EPJ A;  5T1I A;  1VF5 C;  5FLX E;  1TU2 B;  1M4V A;  5TSS A;  1LT3 D;  1KTK A;  1SMY C;  4KJO A;  1PZK D;  1OO9 B;  1E2Z A;  4M8A A;  1PZI D;  4K5V A;  2H1E A;  3RD4 A;  3K0Y A;  1Y1V B;  1W6K A;  3DWP A;  3ND9 A;  3LWU A;  1EY8 A;  4HSV A;  4KKT A;  4RA8 A;  2L55 A;  4XT3 B;  5HGT A;  2QIL A;  1EEF D;  2J4X A;  1BO0 A;  3G7L A;  4H44 C;  2IW3 A;  1IW7 D;  2XIW A;  1HA5 A;  1DZ1 A;  1WCM B;  1ZYR C;  5IGE A;  1PFM A;  3TZU A;  1JE4 A;  2PO4 A;  3GTO B;  2IPK D;  1WTX A;  4ZKC B;  2A74 C;  1MI2 A;  1V43 A;  2EJG C;  2LMC B;  3MXN A;  5ELE A;  2NN6 G;  1JOO A;  3OMC A;  4L8J A;  4FF4 A;  1D6E C;  1EIG A;  4K5W A;  2DNC A;  2KHS A;  3SVM A;  3MWY W;  5IOC A;  2YYZ A;  5C0X I;  1G2S A;  3I91 A;  3QB3 A;  4RHS A;  4TRD A;  3H6M A;  3HOZ B;  1K8O A;  1JIC A;  1R4P B;  2AWO A;  1GUN A;  3S15 B;  1TWF B;  3KLS X;  4K8J A;  2AQ1 B;  5JVG 3;  1PZJ D;  3NQT A;  1TVX A;  1STG A;  1TWC B;  3FEW X;  4RKL A;  3H94 A;  2AQ3 B;  3FPP A;  5IOD A;  1PXU A;  5KNC A;  3O13 A;  1TWG B;  4HMJ A;  5CYU A;  4ZAI A;  2NBF A;  5BN5 A;  5ELD A;  5LL6 S;  5M5Y B;  1HHV A;  1Z7T A;  1SE4 A;  3MXG A;  5FKA C;  4A3M B;  5IT9 E;  2O5J C;  2K32 A;  2NTT A;  1PMR A;  3I4N B;  3C3L A;  3GTP B;  1GHK A;  1QNU A;  4BA1 I;  3M7N A;  1T5E A;  1QB5 D;  2F0W A;  3NBH A;  1Y8P B;  2AWN A;  3DEO A;  4X3T A;  5I2X A;  2NVX B;  4U67 3;  4DA2 A;  2HDM A;  2EY6 A;  5I9P A;  3ITP A;  5LL6 X;  3C2P A;  2R7Z B;  1ENA A;  1T5X D;  5DM6 3;  1PRT B;  3ND8 A;  1E2W A;  2KQ3 A;  4QB4 A;  2JE6 I;  1D2B A;  1Q8I A;  2XRS D;  5J1Z A;  2Q8T A;  1F2Y A;  3HS0 C;  1JWS D;  3OIP A;  5DEH A;  1IW7 C;  2MP1 A;  3H0G B;  1EY7 A;  3BVZ A;  1MD2 D;  4FO2 A;  1Y8O B;  1VF7 A;  3VYS A;  5CV4 A;  1BF4 A;  2RA4 A;  1GUT A;  1STH A;  2CQA A;  5DAU A;  5E4W C;  3PIP 3;  1QJO A;  4RGN A;  4HCE A;  5D3D A;  3HEJ A;  2ICI A;  3PMF A;  1ICW A;  4C3J B;  5J22 A;  2QDB A;  2RDH A;  3NTK A;  3MTS A;  2K5D A;  2R61 A;  4BBS B;  4G4K A;  1ENF A;  3I73 A;  4A3G B;  2F0N A;  3A7A B;  4FXG C;  3HOX B;  2D62 A;  2BOS A;  2A68 D;  3BDO A;  4JK1 C;  5EKK A;  4C1N I;  1HQR D;  4K6L A;  5JEA G;  2JA5 B;  2IJ0 A;  4YIJ A;  3LX0 A;  2B2W A;  1PFB A;  5D14 A;  3BG3 A;  3VYT A;  2HDL A;  2K5W A;  1TQO A;  4A3I B;  2FHT A;  3UI2 A;  3VA5 A;  3KBG A;  3OWF A;  5J39 A;  2FJ2 A;  1A3U A;  4PQX A;  3BVM A;  3MFY A;  4IUU A;  1PRT D;  3I72 A;  5FO7 B;  2NVT B;  3R2T A;  2E2H B;  4RGM A;  2J7Z A;  4C2M B;  1G91 A;  3MZ5 A;  1HUN A;  3DWA A;  1QNK A;  2G9H D;  1PLF A;  5C4H A;  5IGB A;  4A3E B;  1F2M A;  1LTT D;  2KJX A;  3S14 B;  4NDX A;  3LWE A;  2F0K A;  1ESF A;  4OL7 A;  1LT6 D;  4WJW A;  1HUM A;  4XYQ A;  2QCP X;  1FYC A;  2N88 A;  2B2T C;  4A93 B;  3L7Z C;  5C0X J;  2ENB A;  1IYV A;  3SK8 A;  2ICE C;  1UAP A;  5EKI A;  4ULL A;  1I4G A;  1SNM A;  1JC7 A;  1IKM A;  4H7B A;  3TP7 A;  3KF8 A;  4WOR A;  2EVB A;  3TSS A;  3K59 A;  1V1P B;  1IHZ A;  1DYQ A;  4X3K A;  4BBR B;  1S4Z A;  1B1Z A;  2E2J B;  1TII D;  2K7V A;  3C1E A;  5DNF A;  2F0L A;  2WB1 B;  2WAQ B;  1S5E D;  1HPC A;  3PUZ A;  4QUC A;  2K05 A;  2A68 C;  4PNY A;  4RKB A;  3G6J B;  5CC4 A;  1JWU D;  1I4Q A;  1B2T A;  4FF1 A;  5CV6 A;  2CW0 D;  4QIW B;  1FR3 A;  3L9A X;  4DK0 A;  3NPP A;  1EY4 A;  1KAA A;  2EY1 A;  2EPB A;  3W3A A;  4IUV A;  2PW5 A;  1GOZ A;  4JBW A;  3T56 B;  3VYR A;  2O2L D;  4H0L C;  1LAC A;  1PRT C;  2SEB D;  3IFT A;  1BXT A;  3P75 A;  4IFD G;  3BZD B;  3AMU A;  3I4L A;  2PMZ B;  1Y1W B;  3WOE A;  1LT4 D;  4XTC S;  2DY8 A;  4CKC A;  5EPK A;  1JQY D;  2F0U A;  2PZT A;  2EOT A;  4CJ2 C;  1QE6 A;  4A3B B;  3OSO A;  3K57 A;  1ONL A;  4OO1 H;  2F3W A;  5CV7 A;  4R8N A;  2A6E C;  2EDG A;  3GO5 A;  4HMI A;  2SNM A;  4EGV A;  1ENC A;  1QOH A;  4RGO S;  5CV8 A;  4K5X A;  1KDA A;  3GTK B;  4O42 A;  2DY7 A;  2OEO A;  4KJN A;  5ELB A;  4QUF A;  4NP5 A;  1MGS A;  4FP5 D;  4F8M A;  3V96 A;  4XIG S;  1OXV A;  1HA6 A;  1I6V C;  2WII B;  1XXG A;  1CZG A;  3EVQ A;  3I3C A;  3M7G A;  1TY0 A;  4LMQ D;  4PMW A;  3A56 A;  3J81 L;  1HRJ A;  2KA7 A;  5KND A;  1G2T A;  2QF7 A;  1RHP A;  2F0I A;  2RBM A;  1I4R A;  3RZD B;  3S1Q B;  1EIH A;  2PCF B;  1F9R A;  2RQX A;  4P2C B;  1EYD A;  1O80 A;  1OXT A;  3JAM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...