1PZID

Heat-labile enterotoxin b-pentamer complexed with nitrophenyl galactoside 2a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3,5-Substituted phenyl galactosides as leads in designing effective cholera toxin antagonists; synthesis and crystallographic studies
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin inhibitor
molecule keywords Heat-labile Enterotoxin B subunit
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pziD00
4O1NA 4UDUC 5D3DA 1LTID 1LT4D 4RGMA 5D3IB 1CK1A 1SJHD 4L63B 3R2TA 1PRTC 1SBBB 3EA6A 1S5CD 5I4DA 2ICIA 4RCOA 4RHRA 2NTTA 3OWEB 2XNAC 3CHBD 1I4QA 1D5XC 1KTKA 3URYA 5ELDA 2R61A 1LTRD 1I4XA 1PTOB 2XRQD 1HTLD 1M4VA 1ET6A 1DJRD 2AQ2B 2XRSD 2Z8LA 4OHJA 1PRTD 1CHPD 1AW7A 1LT3D 1HA5A 1MD2D 2XN9C 1RD9D 1UUPA 1FGBD 1S5BD 2NTSA 2O2LD 1JWUD 1BCPB 1S5ED 1SE2A 5FK9C 3BVMA 1PTOH 1PZJD 1ESFA 3DWAA 1AN8A 1QILA 1RCVD 4BWGB 1LT5D 1PRTF 3W2DA 3O13A 1PYWD 1BXTA 1BCPC 1EU3A 3BVGA 2QILA 1PTOF 4RGNA 4ZYSA 1GOZA 2SEBD 1JR0D 4C56C 1SEBD 1I4PA 1TS5A 3BYTB 3MFGA 2TSSA 1TS2A 3R8BA 1RF2D 1ENFA 3SEBA 1I4HA 1RDPD 4Z9CB 4DXGA 1FNWA 1EU4A 3BVZA 1F77A 1JWSD 1LO5D 3MC0B 3GP7A 3EFXD 1I4GA 1LLRD 1TS3A 1I4RA 4L6TB 5ELEA 2WV6D 1ET9A 1SXTA 1HXYD 1EEID 1PTOC 5TSSA 2QEJC 2RDHA 3BYYB 1D6EC 5ELFA 3R2IA 1FD7D 2IPKD 1D5ZC 1JCKB 1FNUA 1LTBD 4RH6A 1PTOD 1SJED 3BZDB 2J4XA 1XXGA 4RHSA 3TSSA 3DWPA 3DWQA 1TY0A 1CQVA 1L0YB 5FKAC 1JWMD 4TSSA 1V1PB 1V1OA 2CHBD 1FNVA 1XTCD 1G8ZD 1HQRD 1LT6D 1CT1D 1PZKD 1B1ZA 1LTTD 1TY2A 2AQ1B 1L0XB 1BCPF 2RDGA 2IJ0A 5ELBA 1DYQA 1KLGD 1SE4A 1SE3A 1TS4A 4K6LA 1LTGD 2G9HD 1JQYD 1D5MC 1CHQD 1EFID 1EWCA 1STEA 1PZID 1B44D 3KLSX 1KLUD 2AQ3B 1PRTB 4RGTA 5ELCA 1S5DD 4RFBA 1LTSD 1LTAD 1UNSA 4DXFA 1S5FD 1V1PA 1T5XD 1EEFD 4RGOS 3V05A 1BCPD
chains in the Genus database with same CATH superfamily
1WOCA 1JOOA 2GVBA 2X69A 4MNOA 3K8AA 5IYCH 1SSOA 2H5XA 5D3DA 4XTCS 1JOQA 5KEEA 4DAVA 1N36Q 5L37A 3HOYH 2XTIA 2CWAA 1E1OA 1FL0A 1ICFB 1SROA 3CCLA 3UI2A 4KJNA 3RLFA 5EAYA 2DGYA 2RA4A 4MIUA 3S15H 3GDEA 4B3TQ 1MGSA 5M3MG 3CF5A 5LMUQ 1LT3D 4R9WA 3D4RA 4RWSC 1X3EA 5JEAG 1EFWA 1L0WA 1WJJA 2HDLA 2O2LD 1YEZA 2KCMA 1I3QH 3N52A 1CKMA 1YI2A 4DNIA 4BWGB 3R93A 1LACA 3NUCA 4IOAA 1W2BA 1GXDC 1FJGQ 2B2TA 1KRTA 2EY2A 3I3CA 2B3GA 3H94A 3K59A 3I4MG 1GUWA 3F2UA 3MFGA 1UEAB 1QUQB 1JE5A 1J6QA 4TKOB 3VA7A 1V1QA 2K5VA 4R4QA 2E2DC 1PXUA 4U68A 3HRZC 3S9WA 1BOSA 1KABA 1PFSA 1YNNC 4JI1Q 2QW7A 2NWGA 1I3QB 2ZXOA 2B8GA 4A75A 3P7JA 1GHKA 1DXMA 5COYA 4DR2Q 1YNJC 1II3A 1WFQA 3BZDB 3NBHA 1XXGA 2D9UA 4M8AA 3S17B 1TY0A 4HR7B 1XNRL 3GTQB 3FDTA 4OO1I 1HH2P 2DJGC 4DAMA 2YU9B 4ZQ3A 4FF1A 1VQDA 1M8AA 1IZ6A 1TVXA 1E2WA 3S1QH 4BA1I 3MA2B 4XYOA 3M4OH 5AJ3Q 4LF4Q 1PV4A 5E3FA 4GNXB 3OPOA 1TS4A 2K5QA 1SN8A 1JQYD 2YV5A 3PIOA 2K1BA 3NK9A 5IT9c 1XNQL 2HHHL 2KEEA 1Q3LA 1A2UA 1VCIA 2M9VA 1WTQA 2LY7A 2EYMA 4LK1C 2C5CA 3D8GA 4OIJA 3LWEA 3U58A 1N32Q 1VQ8A 2FMMA 4GKKL 4PNYA 1NTGA 3A0JA 3T16A 4WRDA 3J7ZC 3TN2A 4DV0L 1CZWA 2KECA 4ZAIA 4KMUC 2R61A 2MO0A 4X62Q 2FHTA 1XMQL 2AQ2B 3TZDA 3Q24A 3HOVB 1KDAA 2XGTA 5E4XA 1N33L 1VMCA 2C35B 2PI2E 3KDFB 5KNCA 3CPWA 3K5OA 3A55A 4HIMA 2E2HH 3W2DA 2Q2TA 1PYWD 1EYCA 1GOZA 4KKTA 4ODGA 3SK8A 4IUVA 1I4PA 3VR5A 3K6OA 4A3MH 2UUCQ 2MUYA 1YNND 1HA6A 1UE6A 4FNFA 4JI2L 2GN5A 2Y0SE 4L8JA 4JI6Q 1B9MA 1IL8A 4A3LG 3NHHA 3NWTA 1NNXA 1TS3A 2PZUA 3OYYA 1PTOC 3S16H 3FP9A 2EYLA 1PH7A 2VUMG 1QNUA 2SNSA 1XPOA 4ME5A 3S2HH 1O7IA 3PUZA 4MHEA 3RUZA 2F0SA 1PH4A 4OWWB 4ULLA 1SFOH 3OHXC 1K0RA 1HJPA 3PGZA 3WOFA 2PW7A 2HDMA 1QCBD 1PVOA 2PQAA 3W3AA 4KHZA 2KVMA 4KHPL 4CBVA 2O5IC 1WCMB 2B63B 2WFWA 2ZJPA 1ICWA 1SRUA 1VQIA 1GKHA 3DHQA 1W6KA 1CHQD 2ZTEA 3MTSA 4QUCA 4DAYA 1VQPA 5C4JB 3I91A 3SK4A 2EYOA 3GTLH 1BCPD 3GTKH 2YYZA 2A69C 4TRDA 5M3FG 1EZ8A 1SJHD 3T13A 4YHHL 3ULPA 5JEAJ 2ES2A 1E22A 1SNCA 1HNXQ 2VS1A 4R8NA 4ALPA 3GTOH 3PQIA 1K9MC 4QQBX 1JICA 2L0CA 5C3EG 3OOCA 3KLSA 2XRQD 1M4VA 4FF4A 3RZDH 2Z8LA 1KC8C 4A3IH 3PF4A 4QY7A 2UXDL 3SE0A 1JE4A 1Q8KA 1C8CA 4DK1A 3JAML 2JA6G 3BVMA 4DK6C 1IYJB 1IW7C 1NMFA 2KOLA 2OF1A 1HNWL 1A2TA 3HKZG 4LF8Q 3MXNB 1U5KA 1VQNA 3H6MA 4R4IA 2HQLA 4PZ6A 4PV1C 4KN4C 3MXGA 1X54A 2UUCL 3H3VC 1RF2D 1ENFA 4DV5Q 3M9BA 1E3PA 1VQJA 4JOIA 1KNEA 1X6OA 4DXGA 1AEXA 2B2VC 2F4VQ 2R92H 4DV7L 2NN6G 3BS1A 1Z6HA 1ML0D 1XX8A 2M00A 4BXXH 5I6YA 1IKMA 2PZWA 2VL6A 4BY7G 1SMYD 1MIUA 1Z7TA 2K5NA 1V43A 4FYDA 4KY5A 1P8LA 1ZYRC 1HZ9A 1NUCA 2NVYH 4DV1L 1PH6A 2IW3A 4NW2A 2XIWA 2F0MA 3IRBA 4QIWB 3SXHA 4RHSA 3TSSA 5JJZA 1EY0A 5EKKA 5LHY1 3FHWA 1Y1WH 3E6ZX 1AH9A 2F0GA 1G6ZA 5JAVA 3HOWG 3J7AV 1X3GA 2D62A 3T53B 3W1BA 5C4XH 1TY2A 2I5MX 2WINB 5KRUA 1HR0L 3P20A 4GOPB 4F8MA 2XWBB 3RR5A 2K05A 5EKIA 2HD3A 4JI4Q 1CZGA 5KIXA 4KJOA 2WAQG 4C3HG 3HOUH 1P16A 5EBDA 3QB3A 2KCNA 1I50B 1C7YA 1MJEA 4IN3A 3EN2A 2NN6I 3CMAA 1VQFA 1LT4D 3J81L 1Y69U 5D3IB 3ULJA 5EJWA 1MKHA 5IGBA 1D2BA 4C3IG 1JORA 2PCFB 1WCMH 1KIXA 2R7ZG 3PCOB 4B3ML 5ELDA 4A93B 1AE2A 5C4XB 2XRSD 4OHJA 5G3LF 2FXQA 5CORA 1SAPA 1CHPD 3AFPA 1E1TA 2L11A 2ZTCA 1C9OA 3ONAB 1QVFA 4A3KB 3ERSX 3VYUA 4IQZA 1IBML 1YJ9A 1XWEA 2K33A 3HZXA 1XPUA 1SYGA 1WI5A 3M4YA 3VA5A 4DUYQ 1LT5D 1TWAB 1YZ6A 3U4VA 3CCJA 2MJ8A 1PLFA 4DV5L 4IOCA 3CCQA 1NR4A 1BXTA 3BVGA 2N8NA 3CC7A 2CVRA 4X3TA 1FR3A 5FLXE 4JYAL 1TKWB 1O7YA 3SEBA 4GN3B 4H7BA 1EL0A 1X56A 1K0SA 4NKLA 1PHJA 5CV4A 3GP7A 4A3GB 3GTGH 3H3VH 5ELEA 5EKLA 1N8RC 3D4DA 2WV6D 1N34L 1J9OA 4UPAA 5A2QE 1EIFA 3G71A 4A3KH 5ELFA 3J80c 1RODA 1VQ5A 3PO3G 1R4PB 1B3AA 1STAA 3QOJA 4R4OA 1M1KC 2IPKD 4N9PA 3RN2A 3I55A 3NQTA 1WTXA 1DD2A 5EPLA 1GUOA 4A4IA 1AFPA 4G7OC 4ZKBB 1PH9A 2Y0SB 2KHSA 5FKAC 4DV6L 1EQTA 4UAIA 4GOPC 1FNVA 4KD3A 3G6EA 1XTDA 2UXCL 2NVTB 1A3VA 1JJGA 1JMCA 4A3IG 3LNNA 1Q12A 1A6XA 2R7FA 1L0XB 2Z6KA 3CCSA 1VDZA 1J5EQ 1SE4A 4QF4A 1FJGL 4LF6L 2BH2A 1H9KA 4A3FG 4BY7B 5E7NA 4X3SA 1V9PA 2VNUD 2L5TA 2EOTA 1VQ6A 4DXFA 2EIFA 2JA7G 1BVSA 1VQMA 2EY6A 2FJ2A 1TWGH 1HNXL 1U9RA 1STNA 3BDCA 1EY4A 4P71A 2E2IH 1CK1A 3V96A 4DFAA 4DUZQ 1IYUA 2A19A 3RD4A 4A3FB 4DAYB 5LMNW 3KBXA 3MXNA 5CV8A 1HQMC 4A3GH 4DPGA 3P75A 3MFYA 2D0PA 1BDOA 2AWNA 1EOTA 3G48A 4C1NI 3WOEA 1E2VA 3IAYA 4IFDH 1M90C 4F88A 3MWYW 1PZJD 2K4KA 4CDEC 1O7LA 2NVQH 1SNOA 1K8GA 2N55A 4JI0Q 3HS0C 1GHJA 5C5MA 1XYIA 3J7A5 1A3UA 1KAWA 4ZYSA 2SEBD 2Z6BA 3A5ZB 2EYPA 4DV7Q 5JJIA 3SHLA 2ZJQA 4LFCQ 3PUXA 1FVIA 5FJ8H 1EY9A 1D7QA 1MHWC 3NEMA 4JI7Q 3S2DB 3DM1A 2K50A 4B9XA 1LM0A 4JCVE 2EVBA 1EU4A 2FMCA 2KENA 3S1QB 2EY1A 3EFXD 1EZ6A 2ZTDA 2R6GA 4JYAQ 3K5MA 2KUMA 1ASZA 1TWAH 1NE3A 2AKWB 2E8GA 4GLAC 5IGDA 4AYBG 1XMQQ 2Z0SA 1EIHA 1SJED 4DK0A 3SR1A 1YNXA 3C1FA 2GA4B 1OXUA 1NMGA 4JI0L 4A3CH 4OO1G 3M7GA 1YHAA 3A7AB 3S14B 4A3MB 1YHQA 4JI4L 1K73C 4I7ZC 4R4CA 4A3BG 3UDIA 4JI8L 1Q46A 1HUNA 3LGJA 2F0DA 5AJ3L 1S4ZA 2IJ0A 1DGSA 2WP8J 3E9HA 1Y1VB 4KI0A 3RMHA 4TVAB 4DF7A 4IUUA 2RQXA 3W5OA 1B9NA 1D1KA 4A3JH 3AU7A 2ZXPA 1H9JA 4CGYB 3EVQA 4RGMA 1EIYB 3K7UC 2EYFA 5DLQE 4CJ0B 3S1MH 3OTOL 4LUOA 4RCOA 2NTTA 1G2SA 3JC66 1F9QA 4OELB 3MVVA 5C44B 4B3MQ 1EY7A 1SR3A 3L9AX 4A3EH 2PMZE 3L0OA 3BZKA 2E76C 2UU9L 3DXJC 1AW7A 1NY4A 2PZTA 1R9TB 1UUPA 2A74C 2UUBQ 1GUNA 3PO3H 2A68C 5NUCA 3PUWA 4QL5A 3VYSA 1NAPA 1TWFH 2N49A 4AYBE 4LF5Q 3VYTA 1BBWA 3TMEA 2MHVA 5C4JH 4C3HB 1RCVD 4K8IA 1UE7A 2EQSA 4DR4Q 1QNKA 4JOIC 2OTLA 2DUDA 1Q82C 4OGQC 1PTOF 3ND9A 3U9OA 3G4SA 4JI6L 5ISRA 4ZK9B 2EYJA 2B2WA 3GTQH 2JA5B 2TSSA 3BZCA 2J0TD 1XNQQ 3PO2G 2JA5H 3KF8B 1FNWA 2JN4A 2R7ZB 5IODA 4DV4Q 4KHVA 1F2ZA 3K7AB 2PI2A 1TT2A 1CSQA 1HNZL 4NXML 4XIGS 2A6HC 2F0UA 1SNPA 3GTJB 2JA8G 4LF9Q 2EJMA 2EDGA 2BDOA 1BQQT 4IO9A 1ENAA 4DR2L 2OXPA 4ZUJA 5CBAE 2NBFA 2OWOA 1Q81C 1KD1C 4BBSG 1L1OB 4ZKCB 3M4OB 4LUZA 1EQQA 4CKBA 1ZXTA 1NR2A 1GM5A 1IXRA 4DV2L 1CA5A 5M3MH 5E1FA 2NUCA 1H95A 3HOZB 5DNFA 1R4QB 2VQFQ 1PFNA 5LMNL 3NE5B 2I5HA 2CH4W 3CQZH 1VQLA 3JAME 2EXDA 4A3IB 1SMXA 1PZID 3T1HQ 2F0HA 3GTJH 4NB3A 4OWXB 3GTLB 2AQ3B 3KF6B 1CSPA 2UUAL 1A8VA 3CKIB 3DMUA 4HIDA 2V4DA 3TP7A 4POFA 5IT9L 4YIJA 3KUPA 4L63B 4IURA 3AB9A 4IJLA 1WD0A 2KEDA 2E75C 2EZVA 4IFDI 1VQ4A 3BG3A 4FF3A 3K58A 3PO2B 2K75A 1YITA 5DEHA 5J22A 4KY6A 4C3HH 2CCZA 3STBC 1B7YB 1CKOA 1SMYC 3M85A 4UP7A 4ZRZA 1STYA 1BCPB 1H9SB 1PTOH 1GUTA 1SYBA 2Q2UA 1X3FA 3DWAA 1AN8A 3T4AC 2IWHA 3QO2A 1WTPA 2DNEA 4HJ9A 1F9RA 1F2LA 4KV6A 4EVOA 2KJXA 3Q8DA 4RGNA 3CCEA 2Y0SG 1U4RA 2Q2IA 4UHVA 1OXTA 4IPGA 2B2VA 1Y1WB 3UDXA 4IPCA 4WJWA 2A8VA 1RDPD 3A5UA 1VQCA 3ERQA 1STGA 3NBHB 2B63H 5C3EH 2RCFA 1I4RA 1U0LA 3UE0A 4MN3A 5TSSA 1OTCA 5IT9E 4K2LA 3BYYB 4PMBA 1RKNA 4HN7A 1EOVA 3S24A 4PZ7A 5C0XJ 3QIAA 1N33Q 4OX9Q 1I50H 2PNHA 2AUKA 3GO5A 4DKAC 4KKUA 1XMOQ 3KYHC 3PUVA 5HY6A 4DV1Q 4X62L 3HOWB 4R1JA 3UDGA 3NTKA 4YY3L 3F2CA 1E0BA 1PH2A 5JEAH 4TSSA 2JYOA 2O5JC 1X3QA 4K14A 1XTCD 2EYHA 3J81j 4C2MH 5KYLA 2WAQB 4NXNQ 5JOBA 3U9SA 2K7VA 3QR8A 5C0XH 2D5DA 4A3KG 1TXYA 3GTPB 1DYQA 4P2CB 2B2UC 1D5MC 2R7DA 2Z9HA 2R93H 1KLUD 1KNAA 1Y1WG 1A63A 1CI3M 3LX0A 3HOWH 2EJGC 1MSGA 3T56B 2Q8IB 4DR1L 1LTID 2LXKA 4A3EB 1CA6A 2RBMA 4APVA 4LFBL 5JVH3 1PRTC 4FO2A 5I4DA 3TRZA 2BA1A 4XT1B 4HTHA 1I94Q 2LXJA 1B50A 3M3YH 5CV5A 4DV0Q 3F2BA 1SYFA 1K8MA 2B2YC 4J8QA 2RF4A 3GQBA 1O80A 1PTOB 5D65A 3NTIA 5I2YA 1A15A 2MQHA 4LFAL 3VR4A 2NTSA 2VUMH 4N9TA 2WIIB 1RTNA 4C3JB 1UE1A 4IUTA 3JAMc 2ZM6L 3FVQA 1PRTF 2JP1A 1VQ7A 4PMCA 4BBSH 2B39A 4H0LC 4ME3A 3HOVG 1E24A 1WYDA 3OMGA 3BYTB 2E2HB 1HRJA 2F0QA 4JG2A 2F3IA 3E3XA 1HHVA 3D6WA 1HR0W 2VUMB 3S15B 1N9WA 1RHPA 4CKCA 3K5NA 1VQGA 4DR7L 1HNZQ 4NXMQ 3S1MB 4IUQA 4HMIA 2R93B 4IFDJ 2CFMA 3PIPA 4AQYL 4EX5A 2NYZD 3L3OC 2KCCA 2YTXA 4JW0A 4F7XA 1BNZA 3J7AF 3QG1A 1EY6A 2R93G 1SNDA 3AYHB 3KF8A 2UU9Q 2J4XA 4WFN3 1S72A 3RZOB 2KHIA 3FPPA 5FLXL 2K5WA 4GLXA 1IBMQ 3K0YA 4DK3C 1LT6D 4BXXG 4LJZC 1T9HA 4C1NK 1G51A 4DNRB 4BY7H 5C44H 2K01A 3S1NH 4FXGC 4LFCL 2IX0A 5CC4A 3DLLA 5IOCA 4DR1Q 2OTJA 2CWPA 3I4NG 1L1OA 1LTAD 2BE5C 1IHZA 3X3MA 5JJKA 1K8AC 2JSOA 1LABA 1Q1BA 3HOYB 4IZ8A 4GOPA 4A3FH 1E7ZA 1H9SA 4L5QA 1STBA 3PIO3 2F0EA 1IL2A 2NVTH 1KTKA 2F0FA 3OIQA 3GTMB 1LTRD 5IYCG 4XYQA 1WTHA 1BF4A 1VQAA 2VB3X 2VQEQ 1QZGA 2M2LA 1CQFA 2NZ1D 4JI3Q 4MTKA 2PW5A 1I6HH 1B3QA 1UE5A 4LFAQ 2R3ZA 2ZM6Q 4OWTB 4A3GG 3EQLC 3O13A 1UWVA 3Q6SA 1BCPC 3A8IE 4C56C 1X3PA 4B3RQ 5LL6S 4JI7L 3D3RA 2F4IA 1WVLA 5IGCA 1K3RA 5A2QL 1Y1VG 1XJVA 5C0XG 3S14H 1EY8A 3BVZA 4P73A 4K0KL 1YNJD 1VQEA 3NSWA 3SVMA 4QJFA 4YCVA 2EJFC 4X64L 3KFUA 1IBLQ 5H1SE 1AE3A 2RDHA 3L7ZC 1F2MA 2N78A 5DM63 4C3JG 3M7NA 5JPNC 2BE5D 5C44G 4X6AH 1GD7A 1PMRA 5IYBH 1A3TA 3K80C 3J81E 4LAAA 5LMUL 5T1GA 4A3JB 1DCZA 2JXMB 4H44C 3GTPH 1O7ZA 3HGBA 4GS3A 2CHBD 4G7HC 2E5LQ 1B4OA 1QVCA 4GZYC 3HOUB 1PZKD 2Z4IA 2NVXB 3CCRA 2RDGA 2A68D 1KLGD 2DJFC 2DN8A 3H91A 1R9TH 4WJ4A 3FPUB 2CW0C 2NZHA 2WKCA 4A3CG 1S3OA 3I56A 1STEA 2PYKA 3RZDB 3NENA 1IW7D 1PRTB 2VB2X 3MZ5A 4H13C 4N8X1 4RGTA 5K36H 3HOXH 5GAEC 2I07B 2PO4A 2HCIA 3V05A 3VYRA 2RHQB 2B2UA 3NBIA 3HOZG 4OX9L 4M1UB 1YIJA 1VF5C 1PYBA 3CC2A 5DAUA 4RHRA 4IPHA 2K32A 1GUSA 3CHBD 2Q8RE 2AMCB 1I4QA 3CC4A 4K0KQ 2VW9A 2QGQA 3WDNA 3NXWA 4GLVB 1Y8NB 3HFZB 4JI3L 1PRTD 1I6HB 1Y1VH 4I7AA 5CBEE 2F0TA 3RLOA 4X66L 3HOVH 1GVPA 1S5ED 1TWGB 1PFBA 2UXCQ 5F2DA 4CDFC 3TP5A 3CD6A 1HPCA 3DUZA 3T1YQ 2AWOA 5G3LD 2QDLA 3HOYG 4IUPA 4BS9A 4LF7L 5BN5A 1TWHB 4IPDA 1SNQA 1K28A 2A73B 4KKSA 2N3SA 1JC7A 2JA7B 2ENBA 1SE8A 4Z9CB 2WACA 2O4XA 5T1IA 5EPKA 3ULLA 3PO3B 4DV4L 1CFMA 3I2ZA 4LFBQ 4EGVA 2RCNA 1HXYD 4QMGA 5M5XH 5C4XG 1LUZA 1PYSB 5GADC 3KOJA 2F03A 3J80L 4DV3Q 1W3SA 1PH1A 1XPRA 1AZQA 1TWHH 1A0IA 5CGKA 4WJ3M 2RDFA 3HOUG 3TEHB 1PTOD 3F1ZA 1HZAA 4J1MA 5CV9A 3SDZA 3NTHA 4A3EG 1EWIA 4DV2Q 4BBRG 4HJAA 1EQRA 4HMJA 4DR5Q 4U673 4R4TA 1DOMA 1LV9A 2EXZA 3EROA 2B63G 2CW0D 1V1PB 1EYDA 1RJTA 4L5TA 3A74A 1Z47A 1EWHA 1G291 1HQRD 3F2DA 5FLMG 1CT1D 2EY5A 3F8TA 5M3FB 2IHFA 5IP9H 5FO9B 3C46A 3I4LA 1NSNS 1BKBA 1WD1A 3I4OA 1H9RA 4XQJA 1B44D 5KNBA 4Q5VA 4HIOA 1Y8OB 4LF8L 2UXBL 3BDOA 2HHHQ 3QJYA 4KN7C 2ALYB 1EEFD 2OQKA 1K8OA 4PG3A 1TWCH 3E5SA 3I72A 4LW1A 4O2DA 4G7ZC 1VQKA 1EY5A 4A3BH 1CM9A 2DNCA 3EA6A 3IFDA 3GTOB 3N6RA 2XNAC 4AQYQ 2BH8A 4DR5L 5KYIA 2JA8H 2B2TC 3I73A 1TU2B 3CMEA 2K52A 1B2TA 4TQUS 4B9WA 1DJRD 1LYLA 2Z1CA 1HA5A 1MD2D 2WB1E 2K5DA 1FGBD 1CKNA 1PH3A 1HR0Q 1SNMA 1QUQA 2G5DA 5IYBG 1AP0A 1OO9B 1D1IA 3J80i 4XXEA 2PNRC 4DR4L 3SK6A 1X9NA 4Y7NB 3T1YL 2NVYB 3TBIB 2F0PA 2I5LX 3KJOA 4BY1G 5JPMC 4UP9A 2KHJA 5GAGC 2L1BA 3CRLC 3HKZB 1QOHA 1KXLA 4HIKA 4O0AA 1TS2A 2F0WA 2JA9A 2MNAA 3HOXB 2BOSA 2F3WA 4LUVA 4HSVA 4EQNA 3AMUA 4HJ5A 3CQZB 1I4GA 1X55A 1DOKA 2VXWA 2WAQE 3J81c 3ICEA 5IP9G 4OONA 1FYCA 2HQEA 4Y7NH 3ND8A 3OIPA 1FD7D 1UEBA 1D5ZC 1WTWA 2FFKB 3H3VI 4BA2I 1LTBD 1L2FA 1QB5D 3DWPA 3H0GH 2OQ0A 3DWQA 2NZOA 1BUVT 3NELA 1XNRQ 1CQVA 1QJOA 2F0NA 3Q22A 2K5HA 1MI2A 4LNQA 1BR9A 2X6GA 3GV3A 2B29A 1VS0A 3D6CA 4XDXA 2L55A 4YWLA 4ZUIA 2BCOA 4ZCKA 4C3IH 4DU9A 4RFBA 4ABNA 5LL6X 4JI1L 2ZT9C 5EBCA 2Z6KC 3FKIG 1T5XD 3HKSA 3EIVA 4KK7A 3ZYYX 2H1EA 4UDUC 4HJ8A 4F87A 3CCUA 5M9OA 2CKZB 1IBLL 3OWEB 1HFNA 5C3XA 3VDYA 1QVGA 5JVG3 1GO3E 1HFGA 3M4PA 1D5XC 1JB3A 1KDCA 1QG7A 3URYA 2R92B 3I4MH 3QOLA 4QCLA 4DUZL 5FO7B 2AUJD 3VR2A 3MXPA 3D0FA 2KCTA 2YTVA 3IFTA 5CV7A 1RD9D 4DNTB 5IGEA 4WORA 1IYVA 1WCMG 4O42A 4KY7A 1ESFA 1QILA 2D2CC 2PQEA 3HP3A 3A54A 3J81i 2K04A 2JE6I 1HCZA 2OEOA 2QILA 2E2JB 1JR0D 4FP5D 4PQXA 4XQNA 2A69D 2Q8TA 4DR3Q 1WTVA 1VQOA 4L5RC 1EYAA 3I4MB 1JJCB 3R8BA 5FLMH 1ASYA 2SDFA 5C0XI 3EBEA 1SDFA 2A6ED 3FKIH 3DEOA 1LLRD 4CJ2C 2PQAB 3S1NB 2IX1A 1OXVA 1SLJA 4X64Q 4H02A 1O78A 2L15A 2ATWA 2KBNA 1HUMA 1IBKQ 4NPSA 1XMOL 4BBSB 4B3SQ 1GJXA 2G9DA 2MO1A 5IWAL 3H15A 4NMZA 4GN5A 2VZAA 1F9PA 4V0BA 3NPPA 3Q23A 3M4QA 3G6JB 1EQVA 5EPJA 1QWYA 1DONA 1PDQA 2F0OA 5IIFA 4CHTB 2QA4A 2IT1A 2AQ1B 3KLWA 3MAQA 5I6WA 3I70A 3TS0A 4J6HA 4A76A 2G9HD 5I2XA 4A3BB 4MZ9A 1V1PA 3MXUA 4CKEA 4POGA 4DR7Q 4O1NA 1T5EA 4R8IA 3I8ZA 3PO2H 1ZYRD 2JQOA 3CXCA 4UY8C 1ZKOA 4JV5Q 3GD7A 4GN4B 2QDBA 4AYBB 3I90A 1PH8A 2XWJB 3K81C 1C0AA 4V190 3E0EA 3KF6A 4BY1B 1VQBA 1Q1EA 5I9OA 3J80E 1JOKA 2IX3A 2E74C 2A6HD 1MJCA 4X65L 4S3SA 3RNUA 4P72A 1CUKA 1J5EL 1FGUA 1SE2A 5KNDA 5ELNA 1B8AA 4JBMA 1TQOA 3I4NH 4B3TL 2P5ZX 1DM0B 4DR6Q 3A8KE 4DUYL 4K8JA 2K03A 1WTOA 2UXBQ 4QB4A 3NWSA 4MTNA 4DV6Q 1JB7A 4BBRB 4LF5L 3CW2C 2A6EC 1F2YA 4Y52H 3HG9A 4EQ5A 1SFOB 1ZEQX 4B08A 4DGZA 2YU9H 3KBGA 3RN5A 2QKIC 1DOLA 1F77A 1G91A 3TDQA 1JJ2A 5DM73 3H0GG 4OXPA 3Q0AA 3DEPA 3K0XA 1G6PA 1EEID 1H9MA 1SYEA 2LMCB 3TP8A 1ENCA 2JA6H 3VR3A 1IBKL 4FF2A 2OCEA 2KQ3A 1PH5A 1FNUA 1BO0A 2F0IA 5BN3A 4G4KA 2H4OA 1PFMA 5GROA 3S17H 2IY5B 1MSHA 3C2PA 1YJWA 2RSOA 4HCEA 2MFIA 5BN4A 1KAAA 2B2YA 1JWMD 5FOBB 4GNXC 5IP7H 2LS01 4HAEA 1G8ZD 5EQ0A 4A3JG 3J7YW 4RAUC 2UXDQ 4YY3Q 4J15A 2F52A 3AEVA 2C9OA 1STHA 2DY8A 3TZUA 3LWUA 3K57A 1OXSC 3KLSX 1WTRA 4CJ1B 1UNSA 3KK7A 3ITPA 4JI2Q 4A3LH 4IALA 4CDDC 2F4VL 1HTPA 1CKNB 1MBYA 1SBBB 1S5CD 2WB1G 2L4NA 2F0VA 1JT8A 3HOXG 1Q8IA 4P74A 1KRSA 2NVXH 1HTLD 5M3MB 1ET6A 2D0OA 1QE6A 3SK5A 2NVQB 3H0GB 2IL8A 2XVSA 1SYDA 3EJIA 2I46A 4RKBA 1I6VC 2XN9C 2BA0A 1J8IA 1JWUD 1U4PA 5FK9C 3D4WA 4A93H 5M5XB 2ID0A 5C5LA 4JI8Q 3PMFA 5M5WB 1HNWQ 1W6JA 3E9IA 5M5WH 1EU3A 4IUNA 5AFWA 1B70B 2HUGA 4AIMA 2DY7A 4I65A 3KLRA 5IYDH 1TR5A 2JEAI 2EPBA 5CMDA 2ZJRA 1I4HA 3G7LA 2CQOA 1Y14B 3AFQA 3K7AH 4ID6A 2B2WC 1UAPA 1LO5D 4PMWA 4L6TB 2A5HA 2B8FA 4E6IA 2RVLA 2QCPX 3I4NB 3HOZH 2MP1A 3X3NA 2JJQA 1YJNA 1RTOA 4CDCC 2A1AA 1Q90A 1TIID 3FKIB 1QZHA 2K28A 3NP8A 4EQOA 1TWCB 3R3OA 3A56A 4X3KA 2FINB 4IFDG 3S2DH 1SYCA 1NCVA 1Z9FA 3BU2A 3FEWX 3PSIA 4HSPA 4Q0FA 3B6YA 1RIPA 1BBUA 5FLXc 1KL9A 3MEHA 1ESRA 3A8JE 4A93G 2UUBL 5KGUA 1EUJA 3I7FA 5M3FH 2SOBA 1ONLA 4YCUA 4K6LA 4YWKA 3U50C 4B3RL 2SNMA 1I5FA 1TWFB 2NB0A 4NXNL 1N34Q 1S5DD 2BDNA 1LTSD 4K6DA 5IYDG 4RKLA 4JK1C 3DM3A 5ELOA 1RL2A 5EGTA 3PV0A 5ELBA 3AQQA 4JBKA 4ZLTF 3OW2A 4KTAA 2WKDA 2MGSA 3PUYA 3GTMH 4LMQD 4YHHQ 1NJIC 4LF9L 5BR8Q 1YBYA 4X65Q 4HJ7A 2IHEA 4OEMB 2ICEC 4C2MB 2NN6H 4K2KA 2N88A 3QWNA 2LSSA 2ASBA 5HGTA 4QIWE 3CAMA 4JBWA 2PPBC 3M3YB 1S5BD 2JK8A 2LKVA 4C3IB 4IJHA 2HCCA 4BBRH 5CV6A 4FXDA 4UP8A 4JVZA 5M5YB 4OIKA 5A35A 4JBJA 4XT3B 2R92G 1ILQA 3STBD 1D8LA 2QF7A 4RG1A 3VR6A 5K5PA 3WWVA 1SEBD 4NP5A 3CCVA 1TS5A 1HZBA 3ER0A 2KA7A 3KDFA 1S40A 2JA6B 5J39A 4G57A 2F0KA 1KDBA 2Q2HA 3MEFA 4QUFA 3CRKC 4ILWA 1ET9A 1AZPA 4HEDA 4GKKQ 2QEJC 3JAMi 1PA6A 5J1ZA 4FXKC 1C4QA 2GVAA 2OT2A 1X65A 3HEJA 1N32L 5IP7G 3R2IA 1I94L 4FDBA 2JEBI 3T51B 1U4LA 4DAPA 1HZCA 4PZ8A 3GTGB 1Q7YC 4P75A 4QGUA 3GTKB 4B3SL 2HIXA 4NDXA 4RH6A 4GNXA 2MPMA 2JA7H 3PF5A 1GUGA 4DR6L 5J3BA 3TREA 2V1CC 3V2TA 1EIGA 3GV6A 1KQSA 5C6AA 3UDFA 1L0YB 2K6AA 3BDLA 5C4ZA 4X66Q 2HT1A 2R7ZH 1F9SA 5GAHC 2I0QA 3CCMA 1V1OA 5FJ8G 4GKJL 3L2PA 3BJUA 3OSOA 1LTTD 3S16B 5C3EB 3P1HA 4L5SA 4RA8A 1NBWA 1Y8PB 4X3UA 1SE3A 5D14A 5LMNQ 2E5LL 1LTGD 1EFID 1EWCA 1IKLA 4JPBW 4OO1H 4FVMA 4OL7A 4RCNA 2JA5G 1E2ZA 3TP6A 3OW7A 4LF7Q 3D31A 4JI5L 3HKZE 5M5YH 3K5LA 5BR8L 1VF7A 4RGOS 2J7ZA 2F1MA 2JA8B 1VQHA 3RLNA 3NQIA 2TMPA 3OTOQ 1G2TA 3R2TA 1DZ1A 2ICIA 3A7LA 4K5XA 2CH4A 3RZOH 3C3LA 1VMPA 3CPFA 5GQOA 5I9PA 2E2IB 2WB1B 2K14A 1I4XA 4XQQA 3TQYA 3OMCA 4K5VA 1N36L 2EE1A 3SGIA 2YTYA 1V8QA 2QEXA 3MHBA 4N8FA 1U4MA 1ILPA 2PMZB 2RKSA 2F0JA 1K83H 4C3JH 5JJLA 2RHSB 1YVCA 4YCWA 1A62A 3ZJYC 2Z4HA 2F0LA 3FRPB 3W1GA 4LWCA 5IY0A 3TS2A 2LFNA 2AHOB 3UE1A 5IGGA 3CU7A 1C48A 1YHBA 3S2HB 3H09A 5C4HA 3S1RH 1JWSD 3MC0B 5IE8A 5HGQA 4AH6A 4DA2A 4DR3L 1K3BC 2X6LA 4HCSA 2ZXRA 4KD4A 1SXTA 2CQAA 5CR3A 3U4ZA 4A3DG 1D6EC 4A3MG 1L1OC 4EQPA 3IL8A 1B53A 1VQ9A 1K83B 3C1EA 1JCKB 4A3DB 2RSNA 4GKJQ 5FO8B 3E0JA 5K36G 1X32A 3KJPA 2E2JH 5E4WC 4DV3L 1LTLA 5CYUA 4LF4L 3OWFA 2VQEL 2HIVA 5C3WA 4KLKA 4BY1H 5IWAQ 4YWMA 1KHIA 1EYGA 1B1ZA 4JC0A 3S1RB 2VQFL 1BCPF 2UUAQ 1BBXC 2VY3A 5HURA 2F3VA 1CTMA 2XSCA 3PIP3 3T1HL 4KHPQ 3IKJA 4RMFA 1OXXK 1Q86C 3CP0A 4A3DH 5ELCA 4JV5L 2L12A 1S5FD 4K5WA 3FMCA 5IGFA 4JI5Q 4DN4M 4LF6Q 2L9HA
chains in the Genus database with same CATH topology
1JOOA 2X69A 1SSOA 5D3DA 4XTCS 1JOQA 5KEEA 4DAVA 3UI2A 4KJNA 3RLFA 2RA4A 4MIUA 1MGSA 1LT3D 4R9WA 3D4RA 4RWSC 5JEAG 2HDLA 2O2LD 3N52A 4BWGB 3R93A 1LACA 3NUCA 1GXDC 2B2TA 2EY2A 3I3CA 3H94A 3K59A 1GUWA 3F2UA 3MFGA 1UEAB 4TKOB 3VA7A 2E2DC 1PXUA 4U68A 3HRZC 3S9WA 1BOSA 1KABA 1YNNC 2NWGA 1I3QB 2ZXOA 2B8GA 3P7JA 1GHKA 1DXMA 5COYA 1YNJC 1II3A 3BZDB 3NBHA 1XXGA 2D9UA 4M8AA 3S17B 1TY0A 4HR7B 3GTQB 3FDTA 4OO1I 2YU9B 4ZQ3A 4FF1A 1M8AA 1TVXA 1E2WA 4BA1I 3MA2B 4XYOA 5E3FA 3OPOA 1TS4A 2K5QA 1JQYD 2K1BA 3NK9A 2KEEA 1Q3LA 1A2UA 1VCIA 2M9VA 1WTQA 2LY7A 2EYMA 4LK1C 2C5CA 3D8GA 4OIJA 3LWEA 2FMMA 4PNYA 3T16A 4WRDA 3TN2A 1CZWA 2KECA 4ZAIA 4KMUC 2R61A 2FHTA 2AQ2B 3TZDA 3Q24A 3HOVB 1KDAA 5E4XA 1VMCA 5KNCA 3K5OA 3A55A 3W2DA 1PYWD 1EYCA 1GOZA 4KKTA 4ODGA 3SK8A 4IUVA 1I4PA 3VR5A 3K6OA 2MUYA 1YNND 1HA6A 4FNFA 4L8JA 1B9MA 1IL8A 3NHHA 3NWTA 1TS3A 2PZUA 1PTOC 2EYLA 1QNUA 2SNSA 4ME5A 3PUZA 4MHEA 3RUZA 2F0SA 4ULLA 3OHXC 3WOFA 2PW7A 2HDMA 1QCBD 3W3AA 4KHZA 2KVMA 4CBVA 2O5IC 1WCMB 2B63B 1ICWA 3DHQA 1W6KA 1CHQD 3MTSA 4QUCA 4DAYA 5C4JB 3I91A 3SK4A 2EYOA 1BCPD 2YYZA 2A69C 4TRDA 1EZ8A 1SJHD 3T13A 5JEAJ 1SNCA 4R8NA 1JICA 2L0CA 3OOCA 3KLSA 2XRQD 1M4VA 4FF4A 2Z8LA 3SE0A 1JE4A 1C8CA 4DK1A 3JAML 3BVMA 1IW7C 2KOLA 2OF1A 1A2TA 3H6MA 4PV1C 4KN4C 3MXGA 3H3VC 1RF2D 1ENFA 1KNEA 4DXGA 1AEXA 2B2VC 2NN6G 3BS1A 1Z6HA 1ML0D 1XX8A 2M00A 5I6YA 1IKMA 2PZWA 1SMYD 1Z7TA 1V43A 4FYDA 4KY5A 1ZYRC 1NUCA 2IW3A 4NW2A 2XIWA 2F0MA 4QIWB 3SXHA 3TSSA 4RHSA 5JJZA 1EY0A 5EKKA 5LHY1 3E6ZX 2F0GA 1G6ZA 5JAVA 3J7AV 2D62A 3T53B 1TY2A 2WINB 5KRUA 3P20A 4F8MA 2XWBB 2K05A 5EKIA 1CZGA 5KIXA 4KJOA 4C3HG 5EBDA 3QB3A 2KCNA 1I50B 4IN3A 2NN6I 1LT4D 3J81L 1Y69U 5D3IB 5EJWA 5IGBA 1D2BA 4C3IG 1JORA 2PCFB 5ELDA 4A93B 5C4XB 2XRSD 4OHJA 5G3LF 5CORA 1SAPA 1CHPD 2L11A 3ONAB 4A3KB 3VYUA 4IQZA 1XWEA 2K33A 3HZXA 1SYGA 3M4YA 3VA5A 1LT5D 1TWAB 2MJ8A 1PLFA 1NR4A 1BXTA 3BVGA 2CVRA 4X3TA 1FR3A 5FLXE 1TKWB 1O7YA 3SEBA 4H7BA 1EL0A 4NKLA 5CV4A 3GP7A 4A3GB 5ELEA 5EKLA 3D4DA 2WV6D 1J9OA 5A2QE 5ELFA 1RODA 1R4PB 1B3AA 1STAA 3QOJA 2IPKD 4N9PA 3NQTA 1WTXA 1DD2A 5EPLA 1GUOA 1AFPA 4G7OC 4ZKBB 2Y0SB 2KHSA 5FKAC 1EQTA 4UAIA 1FNVA 4KD3A 2NVTB 1A3VA 3LNNA 1Q12A 1A6XA 1L0XB 1VDZA 1SE4A 4QF4A 1H9KA 4BY7B 4X3SA 2VNUD 2L5TA 2EOTA 4DXFA 2EY6A 2FJ2A 1U9RA 1STNA 3BDCA 1EY4A 1CK1A 3V96A 4DFAA 1IYUA 3RD4A 4A3FB 3KBXA 3MXNA 5CV8A 1HQMC 3P75A 3MFYA 1BDOA 2AWNA 1EOTA 4C1NI 3WOEA 1E2VA 3IAYA 4IFDH 4F88A 3MWYW 1PZJD 1O7LA 1SNOA 2N55A 3HS0C 1GHJA 5C5MA 1XYIA 1A3UA 4ZYSA 2SEBD 2EYPA 3SHLA 3PUXA 1EY9A 3S2DB 3DM1A 4B9XA 2EVBA 1EU4A 2FMCA 3S1QB 2EY1A 3EFXD 1EZ6A 2R6GA 3K5MA 2KUMA 5IGDA 1EIHA 1SJED 4DK0A 3SR1A 3C1FA 2GA4B 1OXUA 4OO1G 3M7GA 3A7AB 3S14B 4A3MB 4I7ZC 1HUNA 2F0DA 1S4ZA 2IJ0A 2WP8J 1Y1VB 4KI0A 3RMHA 4DF7A 4IUUA 2RQXA 1B9NA 1D1KA 3AU7A 2ZXPA 1H9JA 4CGYB 3EVQA 4RGMA 2EYFA 4CJ0B 4RCOA 2NTTA 1G2SA 1F9QA 3MVVA 5C44B 1EY7A 3L9AX 2E76C 3DXJC 1AW7A 2PZTA 1R9TB 1UUPA 2A74C 1GUNA 2A68C 5NUCA 3PUWA 3VYSA 1NAPA 3VYTA 3TMEA 2MHVA 4C3HB 1RCVD 4K8IA 1QNKA 4OGQC 1PTOF 3ND9A 3U9OA 5ISRA 4ZK9B 2EYJA 2B2WA 2JA5B 2TSSA 2J0TD 1FNWA 2R7ZB 5IODA 4KHVA 1F2ZA 3K7AB 1TT2A 4XIGS 2A6HC 2F0UA 1SNPA 3GTJB 2EJMA 2EDGA 2BDOA 1BQQT 1ENAA 2OXPA 4ZUJA 5CBAE 2NBFA 4ZKCB 3M4OB 4CKBA 1ZXTA 1NR2A 1CA5A 5E1FA 2NUCA 3HOZB 5DNFA 1R4QB 1PFNA 3NE5B 3JAME 4A3IB 1PZID 2F0HA 3GTLB 2AQ3B 3CKIB 3DMUA 2V4DA 3TP7A 5IT9L 4YIJA 3KUPA 4L63B 4IURA 3AB9A 1WD0A 2KEDA 2E75C 2EZVA 4IFDI 3BG3A 4FF3A 3K58A 3PO2B 5DEHA 5J22A 4KY6A 1SMYC 3M85A 4ZRZA 1STYA 1BCPB 1H9SB 1PTOH 1GUTA 1SYBA 3DWAA 1AN8A 3T4AC 2IWHA 3QO2A 1WTPA 2DNEA 1F9RA 1F2LA 4KV6A 4EVOA 2KJXA 4RGNA 1U4RA 1OXTA 2B2VA 1Y1WB 4WJWA 1RDPD 3ERQA 1STGA 1I4RA 4MN3A 5TSSA 5IT9E 4K2LA 3BYYB 4PMBA 1RKNA 4HN7A 5C0XJ 3QIAA 3GO5A 2AUKA 4KKUA 3PUVA 3HOWB 3NTKA 1E0BA 5JEAH 4TSSA 2JYOA 2O5JC 1X3QA 4K14A 1XTCD 2EYHA 5KYLA 2WAQB 5JOBA 3U9SA 2K7VA 5C0XH 2D5DA 3GTPB 1DYQA 4P2CB 2B2UC 1D5MC 1KLUD 1KNAA 1CI3M 3LX0A 2EJGC 1MSGA 3T56B 2Q8IB 1LTID 4A3EB 1CA6A 2RBMA 5JVH3 1PRTC 4FO2A 5I4DA 2BA1A 4XT1B 4HTHA 1B50A 5CV5A 1SYFA 1K8MA 2B2YC 4J8QA 3GQBA 5D65A 1O80A 1PTOB 5I2YA 3NTIA 1A15A 3VR4A 2NTSA 4N9TA 2WIIB 1RTNA 4C3JB 4IUTA 3FVQA 1PRTF 2JP1A 4PMCA 2B39A 4H0LC 3OMGA 3BYTB 2E2HB 1HRJA 2F0QA 1HHVA 3D6WA 2VUMB 3S15B 1RHPA 4CKCA 3K5NA 3S1MB 4IUQA 4HMIA 2R93B 4IFDJ 2NYZD 3L3OC 2KCCA 4F7XA 1BNZA 3J7AF 3QG1A 1EY6A 1SNDA 3KF8A 2J4XA 4WFN3 3RZOB 3FPPA 5FLXL 2K5WA 3K0YA 1LT6D 4LJZC 4C1NK 4DNRB 2K01A 4FXGC 2IX0A 5CC4A 5IOCA 1LTAD 2BE5C 1IHZA 3X3MA 2JSOA 1LABA 1Q1BA 3HOYB 4IZ8A 1H9SA 1STBA 3PIO3 2F0EA 1KTKA 2F0FA 3OIQA 3GTMB 1LTRD 4XYQA 1BF4A 2VB3X 2M2LA 1CQFA 2NZ1D 2PW5A 2R3ZA 3EQLC 3O13A 3Q6SA 1BCPC 3A8IE 4C56C 1X3PA 5LL6S 3D3RA 2F4IA 1WVLA 5IGCA 5A2QL 5C0XG 1EY8A 3BVZA 1YNJD 3NSWA 3SVMA 2EJFC 5DM63 2RDHA 3L7ZC 1F2MA 3M7NA 4C3JG 5JPNC 2BE5D 1PMRA 1A3TA 3J81E 4LAAA 5T1GA 4A3JB 1DCZA 2JXMB 4H44C 1O7ZA 3HGBA 4G7HC 2CHBD 1B4OA 4GZYC 3HOUB 1PZKD 2Z4IA 2NVXB 2RDGA 2A68D 1KLGD 2DN8A 3H91A 3FPUB 2CW0C 2WKCA 1STEA 2PYKA 3RZDB 1IW7D 1PRTB 2VB2X 3MZ5A 4H13C 4RGTA 5K36H 2I07B 2PO4A 2HCIA 3V05A 3VYRA 2B2UA 3NBIA 4M1UB 1VF5C 5DAUA 4RHRA 2K32A 1GUSA 3CHBD 2Q8RE 1I4QA 3WDNA 3NXWA 1Y8NB 1PRTD 1I6HB 5CBEE 2F0TA 1S5ED 1TWGB 1PFBA 5F2DA 3TP5A 1HPCA 3DUZA 2AWOA 5G3LD 4IUPA 4BS9A 5BN5A 1TWHB 1SNQA 2A73B 4KKSA 1JC7A 2JA7B 2ENBA 4Z9CB 2WACA 2O4XA 5T1IA 5EPKA 3PO3B 1CFMA 4EGVA 1HXYD 4QMGA 2F03A 3J80L 1AZQA 5CGKA 2RDFA 1PTOD 4J1MA 3SDZA 5CV9A 3NTHA 4HMJA 4U673 1DOMA 1LV9A 2EXZA 3EROA 2CW0D 1V1PB 1EYDA 1RJTA 1Z47A 1EWHA 1G291 1HQRD 1CT1D 2EY5A 5M3FB 5FO9B 3C46A 3I4LA 1NSNS 1WD1A 1H9RA 4XQJA 1B44D 5KNBA 4Q5VA 1Y8OB 3BDOA 3QJYA 4KN7C 1EEFD 1K8OA 3E5SA 3I72A 4G7ZC 1EY5A 1CM9A 2DNCA 3EA6A 3IFDA 3GTOB 3N6RA 2XNAC 5KYIA 2B2TC 3I73A 1TU2B 1B2TA 4TQUS 4B9WA 1DJRD 2Z1CA 1HA5A 1MD2D 2K5DA 1FGBD 1SNMA 1AP0A 1OO9B 1D1IA 4XXEA 2PNRC 3SK6A 4Y7NB 2NVYB 3TBIB 2F0PA 5JPMC 2L1BA 3CRLC 3HKZB 1QOHA 1TS2A 2F0WA 3HOXB 2BOSA 2F3WA 4HSVA 4EQNA 3AMUA 3CQZB 1I4GA 1DOKA 2VXWA 1FYCA 2HQEA 3ND8A 3OIPA 1FD7D 1D5ZC 1WTWA 2FFKB 4BA2I 1LTBD 1QB5D 3DWPA 3DWQA 1BUVT 1CQVA 1QJOA 2F0NA 3Q22A 1MI2A 1BR9A 2X6GA 3GV3A 3D6CA 4XDXA 2L55A 4ZUIA 2BCOA 4DU9A 4RFBA 5LL6X 4ABNA 2ZT9C 5EBCA 1T5XD 4KK7A 3ZYYX 2H1EA 4UDUC 4F87A 5M9OA 3OWEB 1HFNA 5C3XA 5JVG3 1HFGA 1D5XC 1JB3A 1KDCA 1QG7A 3URYA 2R92B 3QOLA 4QCLA 5FO7B 2AUJD 3VR2A 3MXPA 3IFTA 5CV7A 1RD9D 4DNTB 5IGEA 4WORA 1IYVA 4O42A 4KY7A 1ESFA 1QILA 2D2CC 2PQEA 3HP3A 3A54A 2K04A 2JE6I 1HCZA 2OEOA 2QILA 2E2JB 1JR0D 4FP5D 4PQXA 4XQNA 2A69D 2Q8TA 1WTVA 1EYAA 3I4MB 3R8BA 2SDFA 5C0XI 1SDFA 2A6ED 3DEOA 1LLRD 4CJ2C 3S1NB 2IX1A 1OXVA 1O78A 1HUMA 4BBSB 1GJXA 2G9DA 4NMZA 1F9PA 4V0BA 3NPPA 3Q23A 3G6JB 1EQVA 5EPJA 1QWYA 1DONA 1PDQA 2F0OA 5IIFA 4CHTB 2IT1A 2AQ1B 3MAQA 5I6WA 3I70A 4J6HA 2G9HD 5I2XA 4A3BB 1V1PA 3MXUA 4CKEA 4O1NA 1T5EA 4R8IA 3I8ZA 1ZYRD 1ZKOA 3GD7A 2QDBA 4AYBB 3I90A 2XWJB 4V190 4BY1B 1Q1EA 5I9OA 3J80E 1JOKA 2IX3A 2E74C 2A6HD 4S3SA 1SE2A 5KNDA 1TQOA 1DM0B 3A8KE 4K8JA 2K03A 1WTOA 4QB4A 3NWSA 4BBRB 2A6EC 1F2YA 3HG9A 1SFOB 1ZEQX 4B08A 4DGZA 3KBGA 2QKIC 1DOLA 1F77A 1G91A 3TDQA 5DM73 3Q0AA 3DEPA 1EEID 1H9MA 1SYEA 2LMCB 3TP8A 1ENCA 3VR3A 4FF2A 2KQ3A 1FNUA 1BO0A 2F0IA 5BN3A 4G4KA 2H4OA 1PFMA 1MSHA 3C2PA 2RSOA 4HCEA 5BN4A 1KAAA 2B2YA 1JWMD 5FOBB 2LS01 4HAEA 1G8ZD 5EQ0A 3J7YW 4RAUC 2C9OA 1STHA 2DY8A 3TZUA 3LWUA 3K57A 1OXSC 3KLSX 1WTRA 4CJ1B 1UNSA 3KK7A 3ITPA 4IALA 1HTPA 1MBYA 1SBBB 1S5CD 2L4NA 2F0VA 1Q8IA 1HTLD 5M3MB 1ET6A 1QE6A 3SK5A 2NVQB 3H0GB 2IL8A 2XVSA 1SYDA 3EJIA 2I46A 4RKBA 1I6VC 2XN9C 2BA0A 1J8IA 1JWUD 1U4PA 5FK9C 3D4WA 5M5XB 2ID0A 5C5LA 3PMFA 5M5WB 1W6JA 1EU3A 4IUNA 5AFWA 2HUGA 2DY7A 4I65A 3KLRA 1TR5A 2JEAI 2EPBA 5CMDA 1I4HA 3G7LA 4ID6A 2B2WC 1UAPA 1LO5D 4PMWA 2A5HA 2B8FA 4L6TB 4E6IA 2RVLA 2QCPX 3I4NB 2MP1A 3X3NA 1RTOA 1Q90A 1TIID 3FKIB 2K28A 3NP8A 4EQOA 1TWCB 3R3OA 3A56A 4X3KA 2FINB 4IFDG 1SYCA 1NCVA 3FEWX 4HSPA 4Q0FA 3MEHA 1ESRA 3A8JE 5KGUA 2SOBA 1ONLA 4K6LA 2SNMA 1TWFB 2NB0A 1S5DD 2BDNA 1LTSD 4K6DA 4RKLA 4JK1C 5EGTA 3PV0A 5ELBA 4ZLTF 4KTAA 2WKDA 2MGSA 3PUYA 4LMQD 2ICEC 4C2MB 2NN6H 4K2KA 2N88A 3QWNA 5HGTA 4JBWA 2PPBC 3M3YB 1S5BD 2LKVA 4C3IB 4FXDA 2HCCA 5CV6A 5M5YB 4OIKA 5A35A 4XT3B 1ILQA 2QF7A 3VR6A 5K5PA 1SEBD 4NP5A 1TS5A 2KA7A 2JA6B 5J39A 4G57A 2F0KA 1KDBA 4QUFA 3CRKC 4ILWA 1ET9A 1AZPA 4HEDA 2QEJC 5J1ZA 1C4QA 2OT2A 3HEJA 4FXKC 3R2IA 2JEBI 3T51B 1U4LA 4DAPA 3GTGB 3GTKB 4NDXA 4RH6A 2MPMA 1GUGA 3V2TA 1EIGA 3GV6A 5C6AA 1L0YB 2K6AA 3BDLA 5C4ZA 1F9SA 1V1OA 3OSOA 1LTTD 3S16B 5C3EB 3P1HA 4RA8A 1Y8PB 4X3UA 1SE3A 5D14A 1LTGD 1EFID 1EWCA 1IKLA 4OO1H 4FVMA 4OL7A 4RCNA 1E2ZA 3TP6A 3OW7A 3D31A 3K5LA 1VF7A 4RGOS 2J7ZA 2F1MA 2JA8B 3NQIA 2TMPA 1G2TA 3R2TA 1DZ1A 2ICIA 3A7LA 4K5XA 3C3LA 1VMPA 5I9PA 2E2IB 2WB1B 1I4XA 4XQQA 3OMCA 4K5VA 2EE1A 1V8QA 3MHBA 1U4MA 1ILPA 2PMZB 2RKSA 2F0JA 2Z4HA 2F0LA 3FRPB 2LFNA 5IGGA 3CU7A 1C48A 3S2HB 3H09A 5C4HA 1JWSD 3MC0B 4DA2A 2X6LA 4HCSA 2ZXRA 4KD4A 1SXTA 2CQAA 5CR3A 1D6EC 4EQPA 3IL8A 1B53A 1K83B 3C1EA 1JCKB 4A3DB 2RSNA 5FO8B 3E0JA 5K36G 1X32A 5E4WC 5CYUA 3OWFA 5C3WA 1B1ZA 3S1RB 1BCPF 1BBXC 5HURA 2F3VA 1CTMA 2XSCA 3PIP3 3IKJA 1OXXK 5ELCA 2L12A 5IGFA 1S5FD 4K5WA 3FMCA 4DN4M 2L9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O1N A;  4UDU C;  5D3D A;  1LTI D;  1LT4 D;  4RGM A;  5D3I B;  1CK1 A;  1SJH D;  4L63 B;  3R2T A;  1PRT C;  1SBB B;  3EA6 A;  1S5C D;  5I4D A;  2ICI A;  4RCO A;  4RHR A;  2NTT A;  3OWE B;  2XNA C;  3CHB D;  1I4Q A;  1D5X C;  1KTK A;  3URY A;  5ELD A;  2R61 A;  1LTR D;  1I4X A;  1PTO B;  2XRQ D;  1HTL D;  1M4V A;  1ET6 A;  1DJR D;  2AQ2 B;  2XRS D;  2Z8L A;  4OHJ A;  1PRT D;  1CHP D;  1AW7 A;  1LT3 D;  1HA5 A;  1MD2 D;  2XN9 C;  1RD9 D;  1UUP A;  1FGB D;  1S5B D;  2NTS A;  2O2L D;  1JWU D;  1BCP B;  1S5E D;  1SE2 A;  5FK9 C;  3BVM A;  1PTO H;  1PZJ D;  1ESF A;  3DWA A;  1AN8 A;  1QIL A;  1RCV D;  4BWG B;  1LT5 D;  1PRT F;  3W2D A;  3O13 A;  1PYW D;  1BXT A;  1BCP C;  1EU3 A;  3BVG A;  2QIL A;  1PTO F;  4RGN A;  4ZYS A;  1GOZ A;  2SEB D;  1JR0 D;  4C56 C;  1SEB D;  1I4P A;  1TS5 A;  3BYT B;  3MFG A;  2TSS A;  1TS2 A;  3R8B A;  1RF2 D;  1ENF A;  3SEB A;  1I4H A;  1RDP D;  4Z9C B;  4DXG A;  1FNW A;  1EU4 A;  3BVZ A;  1F77 A;  1JWS D;  1LO5 D;  3MC0 B;  3GP7 A;  3EFX D;  1I4G A;  1LLR D;  1TS3 A;  1I4R A;  4L6T B;  5ELE A;  2WV6 D;  1ET9 A;  1SXT A;  1HXY D;  1EEI D;  1PTO C;  5TSS A;  2QEJ C;  2RDH A;  3BYY B;  1D6E C;  5ELF A;  3R2I A;  1FD7 D;  2IPK D;  1D5Z C;  1JCK B;  1FNU A;  1LTB D;  4RH6 A;  1PTO D;  1SJE D;  3BZD B;  2J4X A;  1XXG A;  4RHS A;  3TSS A;  3DWP A;  3DWQ A;  1TY0 A;  1CQV A;  1L0Y B;  5FKA C;  1JWM D;  4TSS A;  1V1P B;  1V1O A;  2CHB D;  1FNV A;  1XTC D;  1G8Z D;  1HQR D;  1LT6 D;  1CT1 D;  1PZK D;  1B1Z A;  1LTT D;  1TY2 A;  2AQ1 B;  1L0X B;  1BCP F;  2RDG A;  2IJ0 A;  5ELB A;  1DYQ A;  1KLG D;  1SE4 A;  1SE3 A;  1TS4 A;  4K6L A;  1LTG D;  2G9H D;  1JQY D;  1D5M C;  1CHQ D;  1EFI D;  1EWC A;  1STE A;  1PZI D;  1B44 D;  3KLS X;  1KLU D;  2AQ3 B;  1PRT B;  4RGT A;  5ELC A;  1S5D D;  4RFB A;  1LTS D;  1LTA D;  1UNS A;  4DXF A;  1S5F D;  1V1P A;  1T5X D;  1EEF D;  4RGO S;  3V05 A;  1BCP D; 
#chains in the Genus database with same CATH topology
 1WOC A;  1JOO A;  2GVB A;  2X69 A;  4MNO A;  3K8A A;  5IYC H;  1SSO A;  2H5X A;  5D3D A;  4XTC S;  1JOQ A;  5KEE A;  4DAV A;  1N36 Q;  5L37 A;  3HOY H;  2XTI A;  2CWA A;  1E1O A;  1FL0 A;  1ICF B;  1SRO A;  3CCL A;  3UI2 A;  4KJN A;  3RLF A;  5EAY A;  2DGY A;  2RA4 A;  4MIU A;  3S15 H;  3GDE A;  4B3T Q;  1MGS A;  5M3M G;  3CF5 A;  5LMU Q;  1LT3 D;  4R9W A;  3D4R A;  4RWS C;  1X3E A;  5JEA G;  1EFW A;  1L0W A;  1WJJ A;  2HDL A;  2O2L D;  1YEZ A;  2KCM A;  1I3Q H;  3N52 A;  1CKM A;  1YI2 A;  4DNI A;  4BWG B;  3R93 A;  1LAC A;  3NUC A;  4IOA A;  1W2B A;  1GXD C;  1FJG Q;  2B2T A;  1KRT A;  2EY2 A;  3I3C A;  2B3G A;  3H94 A;  3K59 A;  3I4M G;  1GUW A;  3F2U A;  3MFG A;  1UEA B;  1QUQ B;  1JE5 A;  1J6Q A;  4TKO B;  3VA7 A;  1V1Q A;  2K5V A;  4R4Q A;  2E2D C;  1PXU A;  4U68 A;  3HRZ C;  3S9W A;  1BOS A;  1KAB A;  1PFS A;  1YNN C;  4JI1 Q;  2QW7 A;  2NWG A;  1I3Q B;  2ZXO A;  2B8G A;  4A75 A;  3P7J A;  1GHK A;  1DXM A;  5COY A;  4DR2 Q;  1YNJ C;  1II3 A;  1WFQ A;  3BZD B;  3NBH A;  1XXG A;  2D9U A;  4M8A A;  3S17 B;  1TY0 A;  4HR7 B;  1XNR L;  3GTQ B;  3FDT A;  4OO1 I;  1HH2 P;  2DJG C;  4DAM A;  2YU9 B;  4ZQ3 A;  4FF1 A;  1VQD A;  1M8A A;  1IZ6 A;  1TVX A;  1E2W A;  3S1Q H;  4BA1 I;  3MA2 B;  4XYO A;  3M4O H;  5AJ3 Q;  4LF4 Q;  1PV4 A;  5E3F A;  4GNX B;  3OPO A;  1TS4 A;  2K5Q A;  1SN8 A;  1JQY D;  2YV5 A;  3PIO A;  2K1B A;  3NK9 A;  5IT9 c;  1XNQ L;  2HHH L;  2KEE A;  1Q3L A;  1A2U A;  1VCI A;  2M9V A;  1WTQ A;  2LY7 A;  2EYM A;  4LK1 C;  2C5C A;  3D8G A;  4OIJ A;  3LWE A;  3U58 A;  1N32 Q;  1VQ8 A;  2FMM A;  4GKK L;  4PNY A;  1NTG A;  3A0J A;  3T16 A;  4WRD A;  3J7Z C;  3TN2 A;  4DV0 L;  1CZW A;  2KEC A;  4ZAI A;  4KMU C;  2R61 A;  2MO0 A;  4X62 Q;  2FHT A;  1XMQ L;  2AQ2 B;  3TZD A;  3Q24 A;  3HOV B;  1KDA A;  2XGT A;  5E4X A;  1N33 L;  1VMC A;  2C35 B;  2PI2 E;  3KDF B;  5KNC A;  3CPW A;  3K5O A;  3A55 A;  4HIM A;  2E2H H;  3W2D A;  2Q2T A;  1PYW D;  1EYC A;  1GOZ A;  4KKT A;  4ODG A;  3SK8 A;  4IUV A;  1I4P A;  3VR5 A;  3K6O A;  4A3M H;  2UUC Q;  2MUY A;  1YNN D;  1HA6 A;  1UE6 A;  4FNF A;  4JI2 L;  2GN5 A;  2Y0S E;  4L8J A;  4JI6 Q;  1B9M A;  1IL8 A;  4A3L G;  3NHH A;  3NWT A;  1NNX A;  1TS3 A;  2PZU A;  3OYY A;  1PTO C;  3S16 H;  3FP9 A;  2EYL A;  1PH7 A;  2VUM G;  1QNU A;  2SNS A;  1XPO A;  4ME5 A;  3S2H H;  1O7I A;  3PUZ A;  4MHE A;  3RUZ A;  2F0S A;  1PH4 A;  4OWW B;  4ULL A;  1SFO H;  3OHX C;  1K0R A;  1HJP A;  3PGZ A;  3WOF A;  2PW7 A;  2HDM A;  1QCB D;  1PVO A;  2PQA A;  3W3A A;  4KHZ A;  2KVM A;  4KHP L;  4CBV A;  2O5I C;  1WCM B;  2B63 B;  2WFW A;  2ZJP A;  1ICW A;  1SRU A;  1VQI A;  1GKH A;  3DHQ A;  1W6K A;  1CHQ D;  2ZTE A;  3MTS A;  4QUC A;  4DAY A;  1VQP A;  5C4J B;  3I91 A;  3SK4 A;  2EYO A;  3GTL H;  1BCP D;  3GTK H;  2YYZ A;  2A69 C;  4TRD A;  5M3F G;  1EZ8 A;  1SJH D;  3T13 A;  4YHH L;  3ULP A;  5JEA J;  2ES2 A;  1E22 A;  1SNC A;  1HNX Q;  2VS1 A;  4R8N A;  4ALP A;  3GTO H;  3PQI A;  1K9M C;  4QQB X;  1JIC A;  2L0C A;  5C3E G;  3OOC A;  3KLS A;  2XRQ D;  1M4V A;  4FF4 A;  3RZD H;  2Z8L A;  1KC8 C;  4A3I H;  3PF4 A;  4QY7 A;  2UXD L;  3SE0 A;  1JE4 A;  1Q8K A;  1C8C A;  4DK1 A;  3JAM L;  2JA6 G;  3BVM A;  4DK6 C;  1IYJ B;  1IW7 C;  1NMF A;  2KOL A;  2OF1 A;  1HNW L;  1A2T A;  3HKZ G;  4LF8 Q;  3MXN B;  1U5K A;  1VQN A;  3H6M A;  4R4I A;  2HQL A;  4PZ6 A;  4PV1 C;  4KN4 C;  3MXG A;  1X54 A;  2UUC L;  3H3V C;  1RF2 D;  1ENF A;  4DV5 Q;  3M9B A;  1E3P A;  1VQJ A;  4JOI A;  1KNE A;  1X6O A;  4DXG A;  1AEX A;  2B2V C;  2F4V Q;  2R92 H;  4DV7 L;  2NN6 G;  3BS1 A;  1Z6H A;  1ML0 D;  1XX8 A;  2M00 A;  4BXX H;  5I6Y A;  1IKM A;  2PZW A;  2VL6 A;  4BY7 G;  1SMY D;  1MIU A;  1Z7T A;  2K5N A;  1V43 A;  4FYD A;  4KY5 A;  1P8L A;  1ZYR C;  1HZ9 A;  1NUC A;  2NVY H;  4DV1 L;  1PH6 A;  2IW3 A;  4NW2 A;  2XIW A;  2F0M A;  3IRB A;  4QIW B;  3SXH A;  4RHS A;  3TSS A;  5JJZ A;  1EY0 A;  5EKK A;  5LHY 1;  3FHW A;  1Y1W H;  3E6Z X;  1AH9 A;  2F0G A;  1G6Z A;  5JAV A;  3HOW G;  3J7A V;  1X3G A;  2D62 A;  3T53 B;  3W1B A;  5C4X H;  1TY2 A;  2I5M X;  2WIN B;  5KRU A;  1HR0 L;  3P20 A;  4GOP B;  4F8M A;  2XWB B;  3RR5 A;  2K05 A;  5EKI A;  2HD3 A;  4JI4 Q;  1CZG A;  5KIX A;  4KJO A;  2WAQ G;  4C3H G;  3HOU H;  1P16 A;  5EBD A;  3QB3 A;  2KCN A;  1I50 B;  1C7Y A;  1MJE A;  4IN3 A;  3EN2 A;  2NN6 I;  3CMA A;  1VQF A;  1LT4 D;  3J81 L;  1Y69 U;  5D3I B;  3ULJ A;  5EJW A;  1MKH A;  5IGB A;  1D2B A;  4C3I G;  1JOR A;  2PCF B;  1WCM H;  1KIX A;  2R7Z G;  3PCO B;  4B3M L;  5ELD A;  4A93 B;  1AE2 A;  5C4X B;  2XRS D;  4OHJ A;  5G3L F;  2FXQ A;  5COR A;  1SAP A;  1CHP D;  3AFP A;  1E1T A;  2L11 A;  2ZTC A;  1C9O A;  3ONA B;  1QVF A;  4A3K B;  3ERS X;  3VYU A;  4IQZ A;  1IBM L;  1YJ9 A;  1XWE A;  2K33 A;  3HZX A;  1XPU A;  1SYG A;  1WI5 A;  3M4Y A;  3VA5 A;  4DUY Q;  1LT5 D;  1TWA B;  1YZ6 A;  3U4V A;  3CCJ A;  2MJ8 A;  1PLF A;  4DV5 L;  4IOC A;  3CCQ A;  1NR4 A;  1BXT A;  3BVG A;  2N8N A;  3CC7 A;  2CVR A;  4X3T A;  1FR3 A;  5FLX E;  4JYA L;  1TKW B;  1O7Y A;  3SEB A;  4GN3 B;  4H7B A;  1EL0 A;  1X56 A;  1K0S A;  4NKL A;  1PHJ A;  5CV4 A;  3GP7 A;  4A3G B;  3GTG H;  3H3V H;  5ELE A;  5EKL A;  1N8R C;  3D4D A;  2WV6 D;  1N34 L;  1J9O A;  4UPA A;  5A2Q E;  1EIF A;  3G71 A;  4A3K H;  5ELF A;  3J80 c;  1ROD A;  1VQ5 A;  3PO3 G;  1R4P B;  1B3A A;  1STA A;  3QOJ A;  4R4O A;  1M1K C;  2IPK D;  4N9P A;  3RN2 A;  3I55 A;  3NQT A;  1WTX A;  1DD2 A;  5EPL A;  1GUO A;  4A4I A;  1AFP A;  4G7O C;  4ZKB B;  1PH9 A;  2Y0S B;  2KHS A;  5FKA C;  4DV6 L;  1EQT A;  4UAI A;  4GOP C;  1FNV A;  4KD3 A;  3G6E A;  1XTD A;  2UXC L;  2NVT B;  1A3V A;  1JJG A;  1JMC A;  4A3I G;  3LNN A;  1Q12 A;  1A6X A;  2R7F A;  1L0X B;  2Z6K A;  3CCS A;  1VDZ A;  1J5E Q;  1SE4 A;  4QF4 A;  1FJG L;  4LF6 L;  2BH2 A;  1H9K A;  4A3F G;  4BY7 B;  5E7N A;  4X3S A;  1V9P A;  2VNU D;  2L5T A;  2EOT A;  1VQ6 A;  4DXF A;  2EIF A;  2JA7 G;  1BVS A;  1VQM A;  2EY6 A;  2FJ2 A;  1TWG H;  1HNX L;  1U9R A;  1STN A;  3BDC A;  1EY4 A;  4P71 A;  2E2I H;  1CK1 A;  3V96 A;  4DFA A;  4DUZ Q;  1IYU A;  2A19 A;  3RD4 A;  4A3F B;  4DAY B;  5LMN W;  3KBX A;  3MXN A;  5CV8 A;  1HQM C;  4A3G H;  4DPG A;  3P75 A;  3MFY A;  2D0P A;  1BDO A;  2AWN A;  1EOT A;  3G48 A;  4C1N I;  3WOE A;  1E2V A;  3IAY A;  4IFD H;  1M90 C;  4F88 A;  3MWY W;  1PZJ D;  2K4K A;  4CDE C;  1O7L A;  2NVQ H;  1SNO A;  1K8G A;  2N55 A;  4JI0 Q;  3HS0 C;  1GHJ A;  5C5M A;  1XYI A;  3J7A 5;  1A3U A;  1KAW A;  4ZYS A;  2SEB D;  2Z6B A;  3A5Z B;  2EYP A;  4DV7 Q;  5JJI A;  3SHL A;  2ZJQ A;  4LFC Q;  3PUX A;  1FVI A;  5FJ8 H;  1EY9 A;  1D7Q A;  1MHW C;  3NEM A;  4JI7 Q;  3S2D B;  3DM1 A;  2K50 A;  4B9X A;  1LM0 A;  4JCV E;  2EVB A;  1EU4 A;  2FMC A;  2KEN A;  3S1Q B;  2EY1 A;  3EFX D;  1EZ6 A;  2ZTD A;  2R6G A;  4JYA Q;  3K5M A;  2KUM A;  1ASZ A;  1TWA H;  1NE3 A;  2AKW B;  2E8G A;  4GLA C;  5IGD A;  4AYB G;  1XMQ Q;  2Z0S A;  1EIH A;  1SJE D;  4DK0 A;  3SR1 A;  1YNX A;  3C1F A;  2GA4 B;  1OXU A;  1NMG A;  4JI0 L;  4A3C H;  4OO1 G;  3M7G A;  1YHA A;  3A7A B;  3S14 B;  4A3M B;  1YHQ A;  4JI4 L;  1K73 C;  4I7Z C;  4R4C A;  4A3B G;  3UDI A;  4JI8 L;  1Q46 A;  1HUN A;  3LGJ A;  2F0D A;  5AJ3 L;  1S4Z A;  2IJ0 A;  1DGS A;  2WP8 J;  3E9H A;  1Y1V B;  4KI0 A;  3RMH A;  4TVA B;  4DF7 A;  4IUU A;  2RQX A;  3W5O A;  1B9N A;  1D1K A;  4A3J H;  3AU7 A;  2ZXP A;  1H9J A;  4CGY B;  3EVQ A;  4RGM A;  1EIY B;  3K7U C;  2EYF A;  5DLQ E;  4CJ0 B;  3S1M H;  3OTO L;  4LUO A;  4RCO A;  2NTT A;  1G2S A;  3JC6 6;  1F9Q A;  4OEL B;  3MVV A;  5C44 B;  4B3M Q;  1EY7 A;  1SR3 A;  3L9A X;  4A3E H;  2PMZ E;  3L0O A;  3BZK A;  2E76 C;  2UU9 L;  3DXJ C;  1AW7 A;  1NY4 A;  2PZT A;  1R9T B;  1UUP A;  2A74 C;  2UUB Q;  1GUN A;  3PO3 H;  2A68 C;  5NUC A;  3PUW A;  4QL5 A;  3VYS A;  1NAP A;  1TWF H;  2N49 A;  4AYB E;  4LF5 Q;  3VYT A;  1BBW A;  3TME A;  2MHV A;  5C4J H;  4C3H B;  1RCV D;  4K8I A;  1UE7 A;  2EQS A;  4DR4 Q;  1QNK A;  4JOI C;  2OTL A;  2DUD A;  1Q82 C;  4OGQ C;  1PTO F;  3ND9 A;  3U9O A;  3G4S A;  4JI6 L;  5ISR A;  4ZK9 B;  2EYJ A;  2B2W A;  3GTQ H;  2JA5 B;  2TSS A;  3BZC A;  2J0T D;  1XNQ Q;  3PO2 G;  2JA5 H;  3KF8 B;  1FNW A;  2JN4 A;  2R7Z B;  5IOD A;  4DV4 Q;  4KHV A;  1F2Z A;  3K7A B;  2PI2 A;  1TT2 A;  1CSQ A;  1HNZ L;  4NXM L;  4XIG S;  2A6H C;  2F0U A;  1SNP A;  3GTJ B;  2JA8 G;  4LF9 Q;  2EJM A;  2EDG A;  2BDO A;  1BQQ T;  4IO9 A;  1ENA A;  4DR2 L;  2OXP A;  4ZUJ A;  5CBA E;  2NBF A;  2OWO A;  1Q81 C;  1KD1 C;  4BBS G;  1L1O B;  4ZKC B;  3M4O B;  4LUZ A;  1EQQ A;  4CKB A;  1ZXT A;  1NR2 A;  1GM5 A;  1IXR A;  4DV2 L;  1CA5 A;  5M3M H;  5E1F A;  2NUC A;  1H95 A;  3HOZ B;  5DNF A;  1R4Q B;  2VQF Q;  1PFN A;  5LMN L;  3NE5 B;  2I5H A;  2CH4 W;  3CQZ H;  1VQL A;  3JAM E;  2EXD A;  4A3I B;  1SMX A;  1PZI D;  3T1H Q;  2F0H A;  3GTJ H;  4NB3 A;  4OWX B;  3GTL B;  2AQ3 B;  3KF6 B;  1CSP A;  2UUA L;  1A8V A;  3CKI B;  3DMU A;  4HID A;  2V4D A;  3TP7 A;  4POF A;  5IT9 L;  4YIJ A;  3KUP A;  4L63 B;  4IUR A;  3AB9 A;  4IJL A;  1WD0 A;  2KED A;  2E75 C;  2EZV A;  4IFD I;  1VQ4 A;  3BG3 A;  4FF3 A;  3K58 A;  3PO2 B;  2K75 A;  1YIT A;  5DEH A;  5J22 A;  4KY6 A;  4C3H H;  2CCZ A;  3STB C;  1B7Y B;  1CKO A;  1SMY C;  3M85 A;  4UP7 A;  4ZRZ A;  1STY A;  1BCP B;  1H9S B;  1PTO H;  1GUT A;  1SYB A;  2Q2U A;  1X3F A;  3DWA A;  1AN8 A;  3T4A C;  2IWH A;  3QO2 A;  1WTP A;  2DNE A;  4HJ9 A;  1F9R A;  1F2L A;  4KV6 A;  4EVO A;  2KJX A;  3Q8D A;  4RGN A;  3CCE A;  2Y0S G;  1U4R A;  2Q2I A;  4UHV A;  1OXT A;  4IPG A;  2B2V A;  1Y1W B;  3UDX A;  4IPC A;  4WJW A;  2A8V A;  1RDP D;  3A5U A;  1VQC A;  3ERQ A;  1STG A;  3NBH B;  2B63 H;  5C3E H;  2RCF A;  1I4R A;  1U0L A;  3UE0 A;  4MN3 A;  5TSS A;  1OTC A;  5IT9 E;  4K2L A;  3BYY B;  4PMB A;  1RKN A;  4HN7 A;  1EOV A;  3S24 A;  4PZ7 A;  5C0X J;  3QIA A;  1N33 Q;  4OX9 Q;  1I50 H;  2PNH A;  2AUK A;  3GO5 A;  4DKA C;  4KKU A;  1XMO Q;  3KYH C;  3PUV A;  5HY6 A;  4DV1 Q;  4X62 L;  3HOW B;  4R1J A;  3UDG A;  3NTK A;  4YY3 L;  3F2C A;  1E0B A;  1PH2 A;  5JEA H;  4TSS A;  2JYO A;  2O5J C;  1X3Q A;  4K14 A;  1XTC D;  2EYH A;  3J81 j;  4C2M H;  5KYL A;  2WAQ B;  4NXN Q;  5JOB A;  3U9S A;  2K7V A;  3QR8 A;  5C0X H;  2D5D A;  4A3K G;  1TXY A;  3GTP B;  1DYQ A;  4P2C B;  2B2U C;  1D5M C;  2R7D A;  2Z9H A;  2R93 H;  1KLU D;  1KNA A;  1Y1W G;  1A63 A;  1CI3 M;  3LX0 A;  3HOW H;  2EJG C;  1MSG A;  3T56 B;  2Q8I B;  4DR1 L;  1LTI D;  2LXK A;  4A3E B;  1CA6 A;  2RBM A;  4APV A;  4LFB L;  5JVH 3;  1PRT C;  4FO2 A;  5I4D A;  3TRZ A;  2BA1 A;  4XT1 B;  4HTH A;  1I94 Q;  2LXJ A;  1B50 A;  3M3Y H;  5CV5 A;  4DV0 Q;  3F2B A;  1SYF A;  1K8M A;  2B2Y C;  4J8Q A;  2RF4 A;  3GQB A;  1O80 A;  1PTO B;  5D65 A;  3NTI A;  5I2Y A;  1A15 A;  2MQH A;  4LFA L;  3VR4 A;  2NTS A;  2VUM H;  4N9T A;  2WII B;  1RTN A;  4C3J B;  1UE1 A;  4IUT A;  3JAM c;  2ZM6 L;  3FVQ A;  1PRT F;  2JP1 A;  1VQ7 A;  4PMC A;  4BBS H;  2B39 A;  4H0L C;  4ME3 A;  3HOV G;  1E24 A;  1WYD A;  3OMG A;  3BYT B;  2E2H B;  1HRJ A;  2F0Q A;  4JG2 A;  2F3I A;  3E3X A;  1HHV A;  3D6W A;  1HR0 W;  2VUM B;  3S15 B;  1N9W A;  1RHP A;  4CKC A;  3K5N A;  1VQG A;  4DR7 L;  1HNZ Q;  4NXM Q;  3S1M B;  4IUQ A;  4HMI A;  2R93 B;  4IFD J;  2CFM A;  3PIP A;  4AQY L;  4EX5 A;  2NYZ D;  3L3O C;  2KCC A;  2YTX A;  4JW0 A;  4F7X A;  1BNZ A;  3J7A F;  3QG1 A;  1EY6 A;  2R93 G;  1SND A;  3AYH B;  3KF8 A;  2UU9 Q;  2J4X A;  4WFN 3;  1S72 A;  3RZO B;  2KHI A;  3FPP A;  5FLX L;  2K5W A;  4GLX A;  1IBM Q;  3K0Y A;  4DK3 C;  1LT6 D;  4BXX G;  4LJZ C;  1T9H A;  4C1N K;  1G51 A;  4DNR B;  4BY7 H;  5C44 H;  2K01 A;  3S1N H;  4FXG C;  4LFC L;  2IX0 A;  5CC4 A;  3DLL A;  5IOC A;  4DR1 Q;  2OTJ A;  2CWP A;  3I4N G;  1L1O A;  1LTA D;  2BE5 C;  1IHZ A;  3X3M A;  5JJK A;  1K8A C;  2JSO A;  1LAB A;  1Q1B A;  3HOY B;  4IZ8 A;  4GOP A;  4A3F H;  1E7Z A;  1H9S A;  4L5Q A;  1STB A;  3PIO 3;  2F0E A;  1IL2 A;  2NVT H;  1KTK A;  2F0F A;  3OIQ A;  3GTM B;  1LTR D;  5IYC G;  4XYQ A;  1WTH A;  1BF4 A;  1VQA A;  2VB3 X;  2VQE Q;  1QZG A;  2M2L A;  1CQF A;  2NZ1 D;  4JI3 Q;  4MTK A;  2PW5 A;  1I6H H;  1B3Q A;  1UE5 A;  4LFA Q;  2R3Z A;  2ZM6 Q;  4OWT B;  4A3G G;  3EQL C;  3O13 A;  1UWV A;  3Q6S A;  1BCP C;  3A8I E;  4C56 C;  1X3P A;  4B3R Q;  5LL6 S;  4JI7 L;  3D3R A;  2F4I A;  1WVL A;  5IGC A;  1K3R A;  5A2Q L;  1Y1V G;  1XJV A;  5C0X G;  3S14 H;  1EY8 A;  3BVZ A;  4P73 A;  4K0K L;  1YNJ D;  1VQE A;  3NSW A;  3SVM A;  4QJF A;  4YCV A;  2EJF C;  4X64 L;  3KFU A;  1IBL Q;  5H1S E;  1AE3 A;  2RDH A;  3L7Z C;  1F2M A;  2N78 A;  5DM6 3;  4C3J G;  3M7N A;  5JPN C;  2BE5 D;  5C44 G;  4X6A H;  1GD7 A;  1PMR A;  5IYB H;  1A3T A;  3K80 C;  3J81 E;  4LAA A;  5LMU L;  5T1G A;  4A3J B;  1DCZ A;  2JXM B;  4H44 C;  3GTP H;  1O7Z A;  3HGB A;  4GS3 A;  2CHB D;  4G7H C;  2E5L Q;  1B4O A;  1QVC A;  4GZY C;  3HOU B;  1PZK D;  2Z4I A;  2NVX B;  3CCR A;  2RDG A;  2A68 D;  1KLG D;  2DJF C;  2DN8 A;  3H91 A;  1R9T H;  4WJ4 A;  3FPU B;  2CW0 C;  2NZH A;  2WKC A;  4A3C G;  1S3O A;  3I56 A;  1STE A;  2PYK A;  3RZD B;  3NEN A;  1IW7 D;  1PRT B;  2VB2 X;  3MZ5 A;  4H13 C;  4N8X 1;  4RGT A;  5K36 H;  3HOX H;  5GAE C;  2I07 B;  2PO4 A;  2HCI A;  3V05 A;  3VYR A;  2RHQ B;  2B2U A;  3NBI A;  3HOZ G;  4OX9 L;  4M1U B;  1YIJ A;  1VF5 C;  1PYB A;  3CC2 A;  5DAU A;  4RHR A;  4IPH A;  2K32 A;  1GUS A;  3CHB D;  2Q8R E;  2AMC B;  1I4Q A;  3CC4 A;  4K0K Q;  2VW9 A;  2QGQ A;  3WDN A;  3NXW A;  4GLV B;  1Y8N B;  3HFZ B;  4JI3 L;  1PRT D;  1I6H B;  1Y1V H;  4I7A A;  5CBE E;  2F0T A;  3RLO A;  4X66 L;  3HOV H;  1GVP A;  1S5E D;  1TWG B;  1PFB A;  2UXC Q;  5F2D A;  4CDF C;  3TP5 A;  3CD6 A;  1HPC A;  3DUZ A;  3T1Y Q;  2AWO A;  5G3L D;  2QDL A;  3HOY G;  4IUP A;  4BS9 A;  4LF7 L;  5BN5 A;  1TWH B;  4IPD A;  1SNQ A;  1K28 A;  2A73 B;  4KKS A;  2N3S A;  1JC7 A;  2JA7 B;  2ENB A;  1SE8 A;  4Z9C B;  2WAC A;  2O4X A;  5T1I A;  5EPK A;  3ULL A;  3PO3 B;  4DV4 L;  1CFM A;  3I2Z A;  4LFB Q;  4EGV A;  2RCN A;  1HXY D;  4QMG A;  5M5X H;  5C4X G;  1LUZ A;  1PYS B;  5GAD C;  3KOJ A;  2F03 A;  3J80 L;  4DV3 Q;  1W3S A;  1PH1 A;  1XPR A;  1AZQ A;  1TWH H;  1A0I A;  5CGK A;  4WJ3 M;  2RDF A;  3HOU G;  3TEH B;  1PTO D;  3F1Z A;  1HZA A;  4J1M A;  5CV9 A;  3SDZ A;  3NTH A;  4A3E G;  1EWI A;  4DV2 Q;  4BBR G;  4HJA A;  1EQR A;  4HMJ A;  4DR5 Q;  4U67 3;  4R4T A;  1DOM A;  1LV9 A;  2EXZ A;  3ERO A;  2B63 G;  2CW0 D;  1V1P B;  1EYD A;  1RJT A;  4L5T A;  3A74 A;  1Z47 A;  1EWH A;  1G29 1;  1HQR D;  3F2D A;  5FLM G;  1CT1 D;  2EY5 A;  3F8T A;  5M3F B;  2IHF A;  5IP9 H;  5FO9 B;  3C46 A;  3I4L A;  1NSN S;  1BKB A;  1WD1 A;  3I4O A;  1H9R A;  4XQJ A;  1B44 D;  5KNB A;  4Q5V A;  4HIO A;  1Y8O B;  4LF8 L;  2UXB L;  3BDO A;  2HHH Q;  3QJY A;  4KN7 C;  2ALY B;  1EEF D;  2OQK A;  1K8O A;  4PG3 A;  1TWC H;  3E5S A;  3I72 A;  4LW1 A;  4O2D A;  4G7Z C;  1VQK A;  1EY5 A;  4A3B H;  1CM9 A;  2DNC A;  3EA6 A;  3IFD A;  3GTO B;  3N6R A;  2XNA C;  4AQY Q;  2BH8 A;  4DR5 L;  5KYI A;  2JA8 H;  2B2T C;  3I73 A;  1TU2 B;  3CME A;  2K52 A;  1B2T A;  4TQU S;  4B9W A;  1DJR D;  1LYL A;  2Z1C A;  1HA5 A;  1MD2 D;  2WB1 E;  2K5D A;  1FGB D;  1CKN A;  1PH3 A;  1HR0 Q;  1SNM A;  1QUQ A;  2G5D A;  5IYB G;  1AP0 A;  1OO9 B;  1D1I A;  3J80 i;  4XXE A;  2PNR C;  4DR4 L;  3SK6 A;  1X9N A;  4Y7N B;  3T1Y L;  2NVY B;  3TBI B;  2F0P A;  2I5L X;  3KJO A;  4BY1 G;  5JPM C;  4UP9 A;  2KHJ A;  5GAG C;  2L1B A;  3CRL C;  3HKZ B;  1QOH A;  1KXL A;  4HIK A;  4O0A A;  1TS2 A;  2F0W A;  2JA9 A;  2MNA A;  3HOX B;  2BOS A;  2F3W A;  4LUV A;  4HSV A;  4EQN A;  3AMU A;  4HJ5 A;  3CQZ B;  1I4G A;  1X55 A;  1DOK A;  2VXW A;  2WAQ E;  3J81 c;  3ICE A;  5IP9 G;  4OON A;  1FYC A;  2HQE A;  4Y7N H;  3ND8 A;  3OIP A;  1FD7 D;  1UEB A;  1D5Z C;  1WTW A;  2FFK B;  3H3V I;  4BA2 I;  1LTB D;  1L2F A;  1QB5 D;  3DWP A;  3H0G H;  2OQ0 A;  3DWQ A;  2NZO A;  1BUV T;  3NEL A;  1XNR Q;  1CQV A;  1QJO A;  2F0N A;  3Q22 A;  2K5H A;  1MI2 A;  4LNQ A;  1BR9 A;  2X6G A;  3GV3 A;  2B29 A;  1VS0 A;  3D6C A;  4XDX A;  2L55 A;  4YWL A;  4ZUI A;  2BCO A;  4ZCK A;  4C3I H;  4DU9 A;  4RFB A;  4ABN A;  5LL6 X;  4JI1 L;  2ZT9 C;  5EBC A;  2Z6K C;  3FKI G;  1T5X D;  3HKS A;  3EIV A;  4KK7 A;  3ZYY X;  2H1E A;  4UDU C;  4HJ8 A;  4F87 A;  3CCU A;  5M9O A;  2CKZ B;  1IBL L;  3OWE B;  1HFN A;  5C3X A;  3VDY A;  1QVG A;  5JVG 3;  1GO3 E;  1HFG A;  3M4P A;  1D5X C;  1JB3 A;  1KDC A;  1QG7 A;  3URY A;  2R92 B;  3I4M H;  3QOL A;  4QCL A;  4DUZ L;  5FO7 B;  2AUJ D;  3VR2 A;  3MXP A;  3D0F A;  2KCT A;  2YTV A;  3IFT A;  5CV7 A;  1RD9 D;  4DNT B;  5IGE A;  4WOR A;  1IYV A;  1WCM G;  4O42 A;  4KY7 A;  1ESF A;  1QIL A;  2D2C C;  2PQE A;  3HP3 A;  3A54 A;  3J81 i;  2K04 A;  2JE6 I;  1HCZ A;  2OEO A;  2QIL A;  2E2J B;  1JR0 D;  4FP5 D;  4PQX A;  4XQN A;  2A69 D;  2Q8T A;  4DR3 Q;  1WTV A;  1VQO A;  4L5R C;  1EYA A;  3I4M B;  1JJC B;  3R8B A;  5FLM H;  1ASY A;  2SDF A;  5C0X I;  3EBE A;  1SDF A;  2A6E D;  3FKI H;  3DEO A;  1LLR D;  4CJ2 C;  2PQA B;  3S1N B;  2IX1 A;  1OXV A;  1SLJ A;  4X64 Q;  4H02 A;  1O78 A;  2L15 A;  2ATW A;  2KBN A;  1HUM A;  1IBK Q;  4NPS A;  1XMO L;  4BBS B;  4B3S Q;  1GJX A;  2G9D A;  2MO1 A;  5IWA L;  3H15 A;  4NMZ A;  4GN5 A;  2VZA A;  1F9P A;  4V0B A;  3NPP A;  3Q23 A;  3M4Q A;  3G6J B;  1EQV A;  5EPJ A;  1QWY A;  1DON A;  1PDQ A;  2F0O A;  5IIF A;  4CHT B;  2QA4 A;  2IT1 A;  2AQ1 B;  3KLW A;  3MAQ A;  5I6W A;  3I70 A;  3TS0 A;  4J6H A;  4A76 A;  2G9H D;  5I2X A;  4A3B B;  4MZ9 A;  1V1P A;  3MXU A;  4CKE A;  4POG A;  4DR7 Q;  4O1N A;  1T5E A;  4R8I A;  3I8Z A;  3PO2 H;  1ZYR D;  2JQO A;  3CXC A;  4UY8 C;  1ZKO A;  4JV5 Q;  3GD7 A;  4GN4 B;  2QDB A;  4AYB B;  3I90 A;  1PH8 A;  2XWJ B;  3K81 C;  1C0A A;  4V19 0;  3E0E A;  3KF6 A;  4BY1 B;  1VQB A;  1Q1E A;  5I9O A;  3J80 E;  1JOK A;  2IX3 A;  2E74 C;  2A6H D;  1MJC A;  4X65 L;  4S3S A;  3RNU A;  4P72 A;  1CUK A;  1J5E L;  1FGU A;  1SE2 A;  5KND A;  5ELN A;  1B8A A;  4JBM A;  1TQO A;  3I4N H;  4B3T L;  2P5Z X;  1DM0 B;  4DR6 Q;  3A8K E;  4DUY L;  4K8J A;  2K03 A;  1WTO A;  2UXB Q;  4QB4 A;  3NWS A;  4MTN A;  4DV6 Q;  1JB7 A;  4BBR B;  4LF5 L;  3CW2 C;  2A6E C;  1F2Y A;  4Y52 H;  3HG9 A;  4EQ5 A;  1SFO B;  1ZEQ X;  4B08 A;  4DGZ A;  2YU9 H;  3KBG A;  3RN5 A;  2QKI C;  1DOL A;  1F77 A;  1G91 A;  3TDQ A;  1JJ2 A;  5DM7 3;  3H0G G;  4OXP A;  3Q0A A;  3DEP A;  3K0X A;  1G6P A;  1EEI D;  1H9M A;  1SYE A;  2LMC B;  3TP8 A;  1ENC A;  2JA6 H;  3VR3 A;  1IBK L;  4FF2 A;  2OCE A;  2KQ3 A;  1PH5 A;  1FNU A;  1BO0 A;  2F0I A;  5BN3 A;  4G4K A;  2H4O A;  1PFM A;  5GRO A;  3S17 H;  2IY5 B;  1MSH A;  3C2P A;  1YJW A;  2RSO A;  4HCE A;  2MFI A;  5BN4 A;  1KAA A;  2B2Y A;  1JWM D;  5FOB B;  4GNX C;  5IP7 H;  2LS0 1;  4HAE A;  1G8Z D;  5EQ0 A;  4A3J G;  3J7Y W;  4RAU C;  2UXD Q;  4YY3 Q;  4J15 A;  2F52 A;  3AEV A;  2C9O A;  1STH A;  2DY8 A;  3TZU A;  3LWU A;  3K57 A;  1OXS C;  3KLS X;  1WTR A;  4CJ1 B;  1UNS A;  3KK7 A;  3ITP A;  4JI2 Q;  4A3L H;  4IAL A;  4CDD C;  2F4V L;  1HTP A;  1CKN B;  1MBY A;  1SBB B;  1S5C D;  2WB1 G;  2L4N A;  2F0V A;  1JT8 A;  3HOX G;  1Q8I A;  4P74 A;  1KRS A;  2NVX H;  1HTL D;  5M3M B;  1ET6 A;  2D0O A;  1QE6 A;  3SK5 A;  2NVQ B;  3H0G B;  2IL8 A;  2XVS A;  1SYD A;  3EJI A;  2I46 A;  4RKB A;  1I6V C;  2XN9 C;  2BA0 A;  1J8I A;  1JWU D;  1U4P A;  5FK9 C;  3D4W A;  4A93 H;  5M5X B;  2ID0 A;  5C5L A;  4JI8 Q;  3PMF A;  5M5W B;  1HNW Q;  1W6J A;  3E9I A;  5M5W H;  1EU3 A;  4IUN A;  5AFW A;  1B70 B;  2HUG A;  4AIM A;  2DY7 A;  4I65 A;  3KLR A;  5IYD H;  1TR5 A;  2JEA I;  2EPB A;  5CMD A;  2ZJR A;  1I4H A;  3G7L A;  2CQO A;  1Y14 B;  3AFQ A;  3K7A H;  4ID6 A;  2B2W C;  1UAP A;  1LO5 D;  4PMW A;  4L6T B;  2A5H A;  2B8F A;  4E6I A;  2RVL A;  2QCP X;  3I4N B;  3HOZ H;  2MP1 A;  3X3N A;  2JJQ A;  1YJN A;  1RTO A;  4CDC C;  2A1A A;  1Q90 A;  1TII D;  3FKI B;  1QZH A;  2K28 A;  3NP8 A;  4EQO A;  1TWC B;  3R3O A;  3A56 A;  4X3K A;  2FIN B;  4IFD G;  3S2D H;  1SYC A;  1NCV A;  1Z9F A;  3BU2 A;  3FEW X;  3PSI A;  4HSP A;  4Q0F A;  3B6Y A;  1RIP A;  1BBU A;  5FLX c;  1KL9 A;  3MEH A;  1ESR A;  3A8J E;  4A93 G;  2UUB L;  5KGU A;  1EUJ A;  3I7F A;  5M3F H;  2SOB A;  1ONL A;  4YCU A;  4K6L A;  4YWK A;  3U50 C;  4B3R L;  2SNM A;  1I5F A;  1TWF B;  2NB0 A;  4NXN L;  1N34 Q;  1S5D D;  2BDN A;  1LTS D;  4K6D A;  5IYD G;  4RKL A;  4JK1 C;  3DM3 A;  5ELO A;  1RL2 A;  5EGT A;  3PV0 A;  5ELB A;  3AQQ A;  4JBK A;  4ZLT F;  3OW2 A;  4KTA A;  2WKD A;  2MGS A;  3PUY A;  3GTM H;  4LMQ D;  4YHH Q;  1NJI C;  4LF9 L;  5BR8 Q;  1YBY A;  4X65 Q;  4HJ7 A;  2IHE A;  4OEM B;  2ICE C;  4C2M B;  2NN6 H;  4K2K A;  2N88 A;  3QWN A;  2LSS A;  2ASB A;  5HGT A;  4QIW E;  3CAM A;  4JBW A;  2PPB C;  3M3Y B;  1S5B D;  2JK8 A;  2LKV A;  4C3I B;  4IJH A;  2HCC A;  4BBR H;  5CV6 A;  4FXD A;  4UP8 A;  4JVZ A;  5M5Y B;  4OIK A;  5A35 A;  4JBJ A;  4XT3 B;  2R92 G;  1ILQ A;  3STB D;  1D8L A;  2QF7 A;  4RG1 A;  3VR6 A;  5K5P A;  3WWV A;  1SEB D;  4NP5 A;  3CCV A;  1TS5 A;  1HZB A;  3ER0 A;  2KA7 A;  3KDF A;  1S40 A;  2JA6 B;  5J39 A;  4G57 A;  2F0K A;  1KDB A;  2Q2H A;  3MEF A;  4QUF A;  3CRK C;  4ILW A;  1ET9 A;  1AZP A;  4HED A;  4GKK Q;  2QEJ C;  3JAM i;  1PA6 A;  5J1Z A;  4FXK C;  1C4Q A;  2GVA A;  2OT2 A;  1X65 A;  3HEJ A;  1N32 L;  5IP7 G;  3R2I A;  1I94 L;  4FDB A;  2JEB I;  3T51 B;  1U4L A;  4DAP A;  1HZC A;  4PZ8 A;  3GTG B;  1Q7Y C;  4P75 A;  4QGU A;  3GTK B;  4B3S L;  2HIX A;  4NDX A;  4RH6 A;  4GNX A;  2MPM A;  2JA7 H;  3PF5 A;  1GUG A;  4DR6 L;  5J3B A;  3TRE A;  2V1C C;  3V2T A;  1EIG A;  3GV6 A;  1KQS A;  5C6A A;  3UDF A;  1L0Y B;  2K6A A;  3BDL A;  5C4Z A;  4X66 Q;  2HT1 A;  2R7Z H;  1F9S A;  5GAH C;  2I0Q A;  3CCM A;  1V1O A;  5FJ8 G;  4GKJ L;  3L2P A;  3BJU A;  3OSO A;  1LTT D;  3S16 B;  5C3E B;  3P1H A;  4L5S A;  4RA8 A;  1NBW A;  1Y8P B;  4X3U A;  1SE3 A;  5D14 A;  5LMN Q;  2E5L L;  1LTG D;  1EFI D;  1EWC A;  1IKL A;  4JPB W;  4OO1 H;  4FVM A;  4OL7 A;  4RCN A;  2JA5 G;  1E2Z A;  3TP6 A;  3OW7 A;  4LF7 Q;  3D31 A;  4JI5 L;  3HKZ E;  5M5Y H;  3K5L A;  5BR8 L;  1VF7 A;  4RGO S;  2J7Z A;  2F1M A;  2JA8 B;  1VQH A;  3RLN A;  3NQI A;  2TMP A;  3OTO Q;  1G2T A;  3R2T A;  1DZ1 A;  2ICI A;  3A7L A;  4K5X A;  2CH4 A;  3RZO H;  3C3L A;  1VMP A;  3CPF A;  5GQO A;  5I9P A;  2E2I B;  2WB1 B;  2K14 A;  1I4X A;  4XQQ A;  3TQY A;  3OMC A;  4K5V A;  1N36 L;  2EE1 A;  3SGI A;  2YTY A;  1V8Q A;  2QEX A;  3MHB A;  4N8F A;  1U4M A;  1ILP A;  2PMZ B;  2RKS A;  2F0J A;  1K83 H;  4C3J H;  5JJL A;  2RHS B;  1YVC A;  4YCW A;  1A62 A;  3ZJY C;  2Z4H A;  2F0L A;  3FRP B;  3W1G A;  4LWC A;  5IY0 A;  3TS2 A;  2LFN A;  2AHO B;  3UE1 A;  5IGG A;  3CU7 A;  1C48 A;  1YHB A;  3S2H B;  3H09 A;  5C4H A;  3S1R H;  1JWS D;  3MC0 B;  5IE8 A;  5HGQ A;  4AH6 A;  4DA2 A;  4DR3 L;  1K3B C;  2X6L A;  4HCS A;  2ZXR A;  4KD4 A;  1SXT A;  2CQA A;  5CR3 A;  3U4Z A;  4A3D G;  1D6E C;  4A3M G;  1L1O C;  4EQP A;  3IL8 A;  1B53 A;  1VQ9 A;  1K83 B;  3C1E A;  1JCK B;  4A3D B;  2RSN A;  4GKJ Q;  5FO8 B;  3E0J A;  5K36 G;  1X32 A;  3KJP A;  2E2J H;  5E4W C;  4DV3 L;  1LTL A;  5CYU A;  4LF4 L;  3OWF A;  2VQE L;  2HIV A;  5C3W A;  4KLK A;  4BY1 H;  5IWA Q;  4YWM A;  1KHI A;  1EYG A;  1B1Z A;  4JC0 A;  3S1R B;  2VQF L;  1BCP F;  2UUA Q;  1BBX C;  2VY3 A;  5HUR A;  2F3V A;  1CTM A;  2XSC A;  3PIP 3;  3T1H L;  4KHP Q;  3IKJ A;  4RMF A;  1OXX K;  1Q86 C;  3CP0 A;  4A3D H;  5ELC A;  4JV5 L;  2L12 A;  1S5F D;  4K5W A;  3FMC A;  5IGF A;  4JI5 Q;  4DN4 M;  4LF6 Q;  2L9H A; 
#chains in the Genus database with same CATH homology
 1JOO A;  2X69 A;  1SSO A;  5D3D A;  4XTC S;  1JOQ A;  5KEE A;  4DAV A;  3UI2 A;  4KJN A;  3RLF A;  2RA4 A;  4MIU A;  1MGS A;  1LT3 D;  4R9W A;  3D4R A;  4RWS C;  5JEA G;  2HDL A;  2O2L D;  3N52 A;  4BWG B;  3R93 A;  1LAC A;  3NUC A;  1GXD C;  2B2T A;  2EY2 A;  3I3C A;  3H94 A;  3K59 A;  1GUW A;  3F2U A;  3MFG A;  1UEA B;  4TKO B;  3VA7 A;  2E2D C;  1PXU A;  4U68 A;  3HRZ C;  3S9W A;  1BOS A;  1KAB A;  1YNN C;  2NWG A;  1I3Q B;  2ZXO A;  2B8G A;  3P7J A;  1GHK A;  1DXM A;  5COY A;  1YNJ C;  1II3 A;  3BZD B;  3NBH A;  1XXG A;  2D9U A;  4M8A A;  3S17 B;  1TY0 A;  4HR7 B;  3GTQ B;  3FDT A;  4OO1 I;  2YU9 B;  4ZQ3 A;  4FF1 A;  1M8A A;  1TVX A;  1E2W A;  4BA1 I;  3MA2 B;  4XYO A;  5E3F A;  3OPO A;  1TS4 A;  2K5Q A;  1JQY D;  2K1B A;  3NK9 A;  2KEE A;  1Q3L A;  1A2U A;  1VCI A;  2M9V A;  1WTQ A;  2LY7 A;  2EYM A;  4LK1 C;  2C5C A;  3D8G A;  4OIJ A;  3LWE A;  2FMM A;  4PNY A;  3T16 A;  4WRD A;  3TN2 A;  1CZW A;  2KEC A;  4ZAI A;  4KMU C;  2R61 A;  2FHT A;  2AQ2 B;  3TZD A;  3Q24 A;  3HOV B;  1KDA A;  5E4X A;  1VMC A;  5KNC A;  3K5O A;  3A55 A;  3W2D A;  1PYW D;  1EYC A;  1GOZ A;  4KKT A;  4ODG A;  3SK8 A;  4IUV A;  1I4P A;  3VR5 A;  3K6O A;  2MUY A;  1YNN D;  1HA6 A;  4FNF A;  4L8J A;  1B9M A;  1IL8 A;  3NHH A;  3NWT A;  1TS3 A;  2PZU A;  1PTO C;  2EYL A;  1QNU A;  2SNS A;  4ME5 A;  3PUZ A;  4MHE A;  3RUZ A;  2F0S A;  4ULL A;  3OHX C;  3WOF A;  2PW7 A;  2HDM A;  1QCB D;  3W3A A;  4KHZ A;  2KVM A;  4CBV A;  2O5I C;  1WCM B;  2B63 B;  1ICW A;  3DHQ A;  1W6K A;  1CHQ D;  3MTS A;  4QUC A;  4DAY A;  5C4J B;  3I91 A;  3SK4 A;  2EYO A;  1BCP D;  2YYZ A;  2A69 C;  4TRD A;  1EZ8 A;  1SJH D;  3T13 A;  5JEA J;  1SNC A;  4R8N A;  1JIC A;  2L0C A;  3OOC A;  3KLS A;  2XRQ D;  1M4V A;  4FF4 A;  2Z8L A;  3SE0 A;  1JE4 A;  1C8C A;  4DK1 A;  3JAM L;  3BVM A;  1IW7 C;  2KOL A;  2OF1 A;  1A2T A;  3H6M A;  4PV1 C;  4KN4 C;  3MXG A;  3H3V C;  1RF2 D;  1ENF A;  1KNE A;  4DXG A;  1AEX A;  2B2V C;  2NN6 G;  3BS1 A;  1Z6H A;  1ML0 D;  1XX8 A;  2M00 A;  5I6Y A;  1IKM A;  2PZW A;  1SMY D;  1Z7T A;  1V43 A;  4FYD A;  4KY5 A;  1ZYR C;  1NUC A;  2IW3 A;  4NW2 A;  2XIW A;  2F0M A;  4QIW B;  3SXH A;  3TSS A;  4RHS A;  5JJZ A;  1EY0 A;  5EKK A;  5LHY 1;  3E6Z X;  2F0G A;  1G6Z A;  5JAV A;  3J7A V;  2D62 A;  3T53 B;  1TY2 A;  2WIN B;  5KRU A;  3P20 A;  4F8M A;  2XWB B;  2K05 A;  5EKI A;  1CZG A;  5KIX A;  4KJO A;  4C3H G;  5EBD A;  3QB3 A;  2KCN A;  1I50 B;  4IN3 A;  2NN6 I;  1LT4 D;  3J81 L;  1Y69 U;  5D3I B;  5EJW A;  5IGB A;  1D2B A;  4C3I G;  1JOR A;  2PCF B;  5ELD A;  4A93 B;  5C4X B;  2XRS D;  4OHJ A;  5G3L F;  5COR A;  1SAP A;  1CHP D;  2L11 A;  3ONA B;  4A3K B;  3VYU A;  4IQZ A;  1XWE A;  2K33 A;  3HZX A;  1SYG A;  3M4Y A;  3VA5 A;  1LT5 D;  1TWA B;  2MJ8 A;  1PLF A;  1NR4 A;  1BXT A;  3BVG A;  2CVR A;  4X3T A;  1FR3 A;  5FLX E;  1TKW B;  1O7Y A;  3SEB A;  4H7B A;  1EL0 A;  4NKL A;  5CV4 A;  3GP7 A;  4A3G B;  5ELE A;  5EKL A;  3D4D A;  2WV6 D;  1J9O A;  5A2Q E;  5ELF A;  1ROD A;  1R4P B;  1B3A A;  1STA A;  3QOJ A;  2IPK D;  4N9P A;  3NQT A;  1WTX A;  1DD2 A;  5EPL A;  1GUO A;  1AFP A;  4G7O C;  4ZKB B;  2Y0S B;  2KHS A;  5FKA C;  1EQT A;  4UAI A;  1FNV A;  4KD3 A;  2NVT B;  1A3V A;  3LNN A;  1Q12 A;  1A6X A;  1L0X B;  1VDZ A;  1SE4 A;  4QF4 A;  1H9K A;  4BY7 B;  4X3S A;  2VNU D;  2L5T A;  2EOT A;  4DXF A;  2EY6 A;  2FJ2 A;  1U9R A;  1STN A;  3BDC A;  1EY4 A;  1CK1 A;  3V96 A;  4DFA A;  1IYU A;  3RD4 A;  4A3F B;  3KBX A;  3MXN A;  5CV8 A;  1HQM C;  3P75 A;  3MFY A;  1BDO A;  2AWN A;  1EOT A;  4C1N I;  3WOE A;  1E2V A;  3IAY A;  4IFD H;  4F88 A;  3MWY W;  1PZJ D;  1O7L A;  1SNO A;  2N55 A;  3HS0 C;  1GHJ A;  5C5M A;  1XYI A;  1A3U A;  4ZYS A;  2SEB D;  2EYP A;  3SHL A;  3PUX A;  1EY9 A;  3S2D B;  3DM1 A;  4B9X A;  2EVB A;  1EU4 A;  2FMC A;  3S1Q B;  2EY1 A;  3EFX D;  1EZ6 A;  2R6G A;  3K5M A;  2KUM A;  5IGD A;  1EIH A;  1SJE D;  4DK0 A;  3SR1 A;  3C1F A;  2GA4 B;  1OXU A;  4OO1 G;  3M7G A;  3A7A B;  3S14 B;  4A3M B;  4I7Z C;  1HUN A;  2F0D A;  1S4Z A;  2IJ0 A;  2WP8 J;  1Y1V B;  4KI0 A;  3RMH A;  4DF7 A;  4IUU A;  2RQX A;  1B9N A;  1D1K A;  3AU7 A;  2ZXP A;  1H9J A;  4CGY B;  3EVQ A;  4RGM A;  2EYF A;  4CJ0 B;  4RCO A;  2NTT A;  1G2S A;  1F9Q A;  3MVV A;  5C44 B;  1EY7 A;  3L9A X;  2E76 C;  3DXJ C;  1AW7 A;  2PZT A;  1R9T B;  1UUP A;  2A74 C;  1GUN A;  2A68 C;  5NUC A;  3PUW A;  3VYS A;  1NAP A;  3VYT A;  3TME A;  2MHV A;  4C3H B;  1RCV D;  4K8I A;  1QNK A;  4OGQ C;  1PTO F;  3ND9 A;  3U9O A;  5ISR A;  4ZK9 B;  2EYJ A;  2B2W A;  2JA5 B;  2TSS A;  2J0T D;  1FNW A;  2R7Z B;  5IOD A;  4KHV A;  1F2Z A;  3K7A B;  1TT2 A;  4XIG S;  2A6H C;  2F0U A;  1SNP A;  3GTJ B;  2EJM A;  2EDG A;  2BDO A;  1BQQ T;  1ENA A;  2OXP A;  4ZUJ A;  5CBA E;  2NBF A;  4ZKC B;  3M4O B;  4CKB A;  1ZXT A;  1NR2 A;  1CA5 A;  5E1F A;  2NUC A;  3HOZ B;  5DNF A;  1R4Q B;  1PFN A;  3NE5 B;  3JAM E;  4A3I B;  1PZI D;  2F0H A;  3GTL B;  2AQ3 B;  3CKI B;  3DMU A;  2V4D A;  3TP7 A;  5IT9 L;  4YIJ A;  3KUP A;  4L63 B;  4IUR A;  3AB9 A;  1WD0 A;  2KED A;  2E75 C;  2EZV A;  4IFD I;  3BG3 A;  4FF3 A;  3K58 A;  3PO2 B;  5DEH A;  5J22 A;  4KY6 A;  1SMY C;  3M85 A;  4ZRZ A;  1STY A;  1BCP B;  1H9S B;  1PTO H;  1GUT A;  1SYB A;  3DWA A;  1AN8 A;  3T4A C;  2IWH A;  3QO2 A;  1WTP A;  2DNE A;  1F9R A;  1F2L A;  4KV6 A;  4EVO A;  2KJX A;  4RGN A;  1U4R A;  1OXT A;  2B2V A;  1Y1W B;  4WJW A;  1RDP D;  3ERQ A;  1STG A;  1I4R A;  4MN3 A;  5TSS A;  5IT9 E;  4K2L A;  3BYY B;  4PMB A;  1RKN A;  4HN7 A;  5C0X J;  3QIA A;  3GO5 A;  2AUK A;  4KKU A;  3PUV A;  3HOW B;  3NTK A;  1E0B A;  5JEA H;  4TSS A;  2JYO A;  2O5J C;  1X3Q A;  4K14 A;  1XTC D;  2EYH A;  5KYL A;  2WAQ B;  5JOB A;  3U9S A;  2K7V A;  5C0X H;  2D5D A;  3GTP B;  1DYQ A;  4P2C B;  2B2U C;  1D5M C;  1KLU D;  1KNA A;  1CI3 M;  3LX0 A;  2EJG C;  1MSG A;  3T56 B;  2Q8I B;  1LTI D;  4A3E B;  1CA6 A;  2RBM A;  5JVH 3;  1PRT C;  4FO2 A;  5I4D A;  2BA1 A;  4XT1 B;  4HTH A;  1B50 A;  5CV5 A;  1SYF A;  1K8M A;  2B2Y C;  4J8Q A;  3GQB A;  5D65 A;  1O80 A;  1PTO B;  5I2Y A;  3NTI A;  1A15 A;  3VR4 A;  2NTS A;  4N9T A;  2WII B;  1RTN A;  4C3J B;  4IUT A;  3FVQ A;  1PRT F;  2JP1 A;  4PMC A;  2B39 A;  4H0L C;  3OMG A;  3BYT B;  2E2H B;  1HRJ A;  2F0Q A;  1HHV A;  3D6W A;  2VUM B;  3S15 B;  1RHP A;  4CKC A;  3K5N A;  3S1M B;  4IUQ A;  4HMI A;  2R93 B;  4IFD J;  2NYZ D;  3L3O C;  2KCC A;  4F7X A;  1BNZ A;  3J7A F;  3QG1 A;  1EY6 A;  1SND A;  3KF8 A;  2J4X A;  4WFN 3;  3RZO B;  3FPP A;  5FLX L;  2K5W A;  3K0Y A;  1LT6 D;  4LJZ C;  4C1N K;  4DNR B;  2K01 A;  4FXG C;  2IX0 A;  5CC4 A;  5IOC A;  1LTA D;  2BE5 C;  1IHZ A;  3X3M A;  2JSO A;  1LAB A;  1Q1B A;  3HOY B;  4IZ8 A;  1H9S A;  1STB A;  3PIO 3;  2F0E A;  1KTK A;  2F0F A;  3OIQ A;  3GTM B;  1LTR D;  4XYQ A;  1BF4 A;  2VB3 X;  2M2L A;  1CQF A;  2NZ1 D;  2PW5 A;  2R3Z A;  3EQL C;  3O13 A;  3Q6S A;  1BCP C;  3A8I E;  4C56 C;  1X3P A;  5LL6 S;  3D3R A;  2F4I A;  1WVL A;  5IGC A;  5A2Q L;  5C0X G;  1EY8 A;  3BVZ A;  1YNJ D;  3NSW A;  3SVM A;  2EJF C;  5DM6 3;  2RDH A;  3L7Z C;  1F2M A;  3M7N A;  4C3J G;  5JPN C;  2BE5 D;  1PMR A;  1A3T A;  3J81 E;  4LAA A;  5T1G A;  4A3J B;  1DCZ A;  2JXM B;  4H44 C;  1O7Z A;  3HGB A;  4G7H C;  2CHB D;  1B4O A;  4GZY C;  3HOU B;  1PZK D;  2Z4I A;  2NVX B;  2RDG A;  2A68 D;  1KLG D;  2DN8 A;  3H91 A;  3FPU B;  2CW0 C;  2WKC A;  1STE A;  2PYK A;  3RZD B;  1IW7 D;  1PRT B;  2VB2 X;  3MZ5 A;  4H13 C;  4RGT A;  5K36 H;  2I07 B;  2PO4 A;  2HCI A;  3V05 A;  3VYR A;  2B2U A;  3NBI A;  4M1U B;  1VF5 C;  5DAU A;  4RHR A;  2K32 A;  1GUS A;  3CHB D;  2Q8R E;  1I4Q A;  3WDN A;  3NXW A;  1Y8N B;  1PRT D;  1I6H B;  5CBE E;  2F0T A;  1S5E D;  1TWG B;  1PFB A;  5F2D A;  3TP5 A;  1HPC A;  3DUZ A;  2AWO A;  5G3L D;  4IUP A;  4BS9 A;  5BN5 A;  1TWH B;  1SNQ A;  2A73 B;  4KKS A;  1JC7 A;  2JA7 B;  2ENB A;  4Z9C B;  2WAC A;  2O4X A;  5T1I A;  5EPK A;  3PO3 B;  1CFM A;  4EGV A;  1HXY D;  4QMG A;  2F03 A;  3J80 L;  1AZQ A;  5CGK A;  2RDF A;  1PTO D;  4J1M A;  3SDZ A;  5CV9 A;  3NTH A;  4HMJ A;  4U67 3;  1DOM A;  1LV9 A;  2EXZ A;  3ERO A;  2CW0 D;  1V1P B;  1EYD A;  1RJT A;  1Z47 A;  1EWH A;  1G29 1;  1HQR D;  1CT1 D;  2EY5 A;  5M3F B;  5FO9 B;  3C46 A;  3I4L A;  1NSN S;  1WD1 A;  1H9R A;  4XQJ A;  1B44 D;  5KNB A;  4Q5V A;  1Y8O B;  3BDO A;  3QJY A;  4KN7 C;  1EEF D;  1K8O A;  3E5S A;  3I72 A;  4G7Z C;  1EY5 A;  1CM9 A;  2DNC A;  3EA6 A;  3IFD A;  3GTO B;  3N6R A;  2XNA C;  5KYI A;  2B2T C;  3I73 A;  1TU2 B;  1B2T A;  4TQU S;  4B9W A;  1DJR D;  2Z1C A;  1HA5 A;  1MD2 D;  2K5D A;  1FGB D;  1SNM A;  1AP0 A;  1OO9 B;  1D1I A;  4XXE A;  2PNR C;  3SK6 A;  4Y7N B;  2NVY B;  3TBI B;  2F0P A;  5JPM C;  2L1B A;  3CRL C;  3HKZ B;  1QOH A;  1TS2 A;  2F0W A;  3HOX B;  2BOS A;  2F3W A;  4HSV A;  4EQN A;  3AMU A;  3CQZ B;  1I4G A;  1DOK A;  2VXW A;  1FYC A;  2HQE A;  3ND8 A;  3OIP A;  1FD7 D;  1D5Z C;  1WTW A;  2FFK B;  4BA2 I;  1LTB D;  1QB5 D;  3DWP A;  3DWQ A;  1BUV T;  1CQV A;  1QJO A;  2F0N A;  3Q22 A;  1MI2 A;  1BR9 A;  2X6G A;  3GV3 A;  3D6C A;  4XDX A;  2L55 A;  4ZUI A;  2BCO A;  4DU9 A;  4RFB A;  5LL6 X;  4ABN A;  2ZT9 C;  5EBC A;  1T5X D;  4KK7 A;  3ZYY X;  2H1E A;  4UDU C;  4F87 A;  5M9O A;  3OWE B;  1HFN A;  5C3X A;  5JVG 3;  1HFG A;  1D5X C;  1JB3 A;  1KDC A;  1QG7 A;  3URY A;  2R92 B;  3QOL A;  4QCL A;  5FO7 B;  2AUJ D;  3VR2 A;  3MXP A;  3IFT A;  5CV7 A;  1RD9 D;  4DNT B;  5IGE A;  4WOR A;  1IYV A;  4O42 A;  4KY7 A;  1ESF A;  1QIL A;  2D2C C;  2PQE A;  3HP3 A;  3A54 A;  2K04 A;  2JE6 I;  1HCZ A;  2OEO A;  2QIL A;  2E2J B;  1JR0 D;  4FP5 D;  4PQX A;  4XQN A;  2A69 D;  2Q8T A;  1WTV A;  1EYA A;  3I4M B;  3R8B A;  2SDF A;  5C0X I;  1SDF A;  2A6E D;  3DEO A;  1LLR D;  4CJ2 C;  3S1N B;  2IX1 A;  1OXV A;  1O78 A;  1HUM A;  4BBS B;  1GJX A;  2G9D A;  4NMZ A;  1F9P A;  4V0B A;  3NPP A;  3Q23 A;  3G6J B;  1EQV A;  5EPJ A;  1QWY A;  1DON A;  1PDQ A;  2F0O A;  5IIF A;  4CHT B;  2IT1 A;  2AQ1 B;  3MAQ A;  5I6W A;  3I70 A;  4J6H A;  2G9H D;  5I2X A;  4A3B B;  1V1P A;  3MXU A;  4CKE A;  4O1N A;  1T5E A;  4R8I A;  3I8Z A;  1ZYR D;  1ZKO A;  3GD7 A;  2QDB A;  4AYB B;  3I90 A;  2XWJ B;  4V19 0;  4BY1 B;  1Q1E A;  5I9O A;  3J80 E;  1JOK A;  2IX3 A;  2E74 C;  2A6H D;  4S3S A;  1SE2 A;  5KND A;  1TQO A;  1DM0 B;  3A8K E;  4K8J A;  2K03 A;  1WTO A;  4QB4 A;  3NWS A;  4BBR B;  2A6E C;  1F2Y A;  3HG9 A;  1SFO B;  1ZEQ X;  4B08 A;  4DGZ A;  3KBG A;  2QKI C;  1DOL A;  1F77 A;  1G91 A;  3TDQ A;  5DM7 3;  3Q0A A;  3DEP A;  1EEI D;  1H9M A;  1SYE A;  2LMC B;  3TP8 A;  1ENC A;  3VR3 A;  4FF2 A;  2KQ3 A;  1FNU A;  1BO0 A;  2F0I A;  5BN3 A;  4G4K A;  2H4O A;  1PFM A;  1MSH A;  3C2P A;  2RSO A;  4HCE A;  5BN4 A;  1KAA A;  2B2Y A;  1JWM D;  5FOB B;  2LS0 1;  4HAE A;  1G8Z D;  5EQ0 A;  3J7Y W;  4RAU C;  2C9O A;  1STH A;  2DY8 A;  3TZU A;  3LWU A;  3K57 A;  1OXS C;  3KLS X;  1WTR A;  4CJ1 B;  1UNS A;  3KK7 A;  3ITP A;  4IAL A;  1HTP A;  1MBY A;  1SBB B;  1S5C D;  2L4N A;  2F0V A;  1Q8I A;  1HTL D;  5M3M B;  1ET6 A;  1QE6 A;  3SK5 A;  2NVQ B;  3H0G B;  2IL8 A;  2XVS A;  1SYD A;  3EJI A;  2I46 A;  4RKB A;  1I6V C;  2XN9 C;  2BA0 A;  1J8I A;  1JWU D;  1U4P A;  5FK9 C;  3D4W A;  5M5X B;  2ID0 A;  5C5L A;  3PMF A;  5M5W B;  1W6J A;  1EU3 A;  4IUN A;  5AFW A;  2HUG A;  2DY7 A;  4I65 A;  3KLR A;  1TR5 A;  2JEA I;  2EPB A;  5CMD A;  1I4H A;  3G7L A;  4ID6 A;  2B2W C;  1UAP A;  1LO5 D;  4PMW A;  2A5H A;  2B8F A;  4L6T B;  4E6I A;  2RVL A;  2QCP X;  3I4N B;  2MP1 A;  3X3N A;  1RTO A;  1Q90 A;  1TII D;  3FKI B;  2K28 A;  3NP8 A;  4EQO A;  1TWC B;  3R3O A;  3A56 A;  4X3K A;  2FIN B;  4IFD G;  1SYC A;  1NCV A;  3FEW X;  4HSP A;  4Q0F A;  3MEH A;  1ESR A;  3A8J E;  5KGU A;  2SOB A;  1ONL A;  4K6L A;  2SNM A;  1TWF B;  2NB0 A;  1S5D D;  2BDN A;  1LTS D;  4K6D A;  4RKL A;  4JK1 C;  5EGT A;  3PV0 A;  5ELB A;  4ZLT F;  4KTA A;  2WKD A;  2MGS A;  3PUY A;  4LMQ D;  2ICE C;  4C2M B;  2NN6 H;  4K2K A;  2N88 A;  3QWN A;  5HGT A;  4JBW A;  2PPB C;  3M3Y B;  1S5B D;  2LKV A;  4C3I B;  4FXD A;  2HCC A;  5CV6 A;  5M5Y B;  4OIK A;  5A35 A;  4XT3 B;  1ILQ A;  2QF7 A;  3VR6 A;  5K5P A;  1SEB D;  4NP5 A;  1TS5 A;  2KA7 A;  2JA6 B;  5J39 A;  4G57 A;  2F0K A;  1KDB A;  4QUF A;  3CRK C;  4ILW A;  1ET9 A;  1AZP A;  4HED A;  2QEJ C;  5J1Z A;  1C4Q A;  2OT2 A;  3HEJ A;  4FXK C;  3R2I A;  2JEB I;  3T51 B;  1U4L A;  4DAP A;  3GTG B;  3GTK B;  4NDX A;  4RH6 A;  2MPM A;  1GUG A;  3V2T A;  1EIG A;  3GV6 A;  5C6A A;  1L0Y B;  2K6A A;  3BDL A;  5C4Z A;  1F9S A;  1V1O A;  3OSO A;  1LTT D;  3S16 B;  5C3E B;  3P1H A;  4RA8 A;  1Y8P B;  4X3U A;  1SE3 A;  5D14 A;  1LTG D;  1EFI D;  1EWC A;  1IKL A;  4OO1 H;  4FVM A;  4OL7 A;  4RCN A;  1E2Z A;  3TP6 A;  3OW7 A;  3D31 A;  3K5L A;  1VF7 A;  4RGO S;  2J7Z A;  2F1M A;  2JA8 B;  3NQI A;  2TMP A;  1G2T A;  3R2T A;  1DZ1 A;  2ICI A;  3A7L A;  4K5X A;  3C3L A;  1VMP A;  5I9P A;  2E2I B;  2WB1 B;  1I4X A;  4XQQ A;  3OMC A;  4K5V A;  2EE1 A;  1V8Q A;  3MHB A;  1U4M A;  1ILP A;  2PMZ B;  2RKS A;  2F0J A;  2Z4H A;  2F0L A;  3FRP B;  2LFN A;  5IGG A;  3CU7 A;  1C48 A;  3S2H B;  3H09 A;  5C4H A;  1JWS D;  3MC0 B;  4DA2 A;  2X6L A;  4HCS A;  2ZXR A;  4KD4 A;  1SXT A;  2CQA A;  5CR3 A;  1D6E C;  4EQP A;  3IL8 A;  1B53 A;  1K83 B;  3C1E A;  1JCK B;  4A3D B;  2RSN A;  5FO8 B;  3E0J A;  5K36 G;  1X32 A;  5E4W C;  5CYU A;  3OWF A;  5C3W A;  1B1Z A;  3S1R B;  1BCP F;  1BBX C;  5HUR A;  2F3V A;  1CTM A;  2XSC A;  3PIP 3;  3IKJ A;  1OXX K;  5ELC A;  2L12 A;  5IGF A;  1S5F D;  4K5W A;  3FMC A;  4DN4 M;  2L9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...