1PZID

Heat-labile enterotoxin b-pentamer complexed with nitrophenyl galactoside 2a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat-labile Enterotoxin B subunit
publication title 3,5-Substituted phenyl galactosides as leads in designing effective cholera toxin antagonists; synthesis and crystallographic studies
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin inhibitor
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pziD00
1D6EC 2XRSD 4RHRA 1LTAD 1LT6D 1D5XC 1L0YB 2WV6D 1GOZA 3DWQA 1JWUD 1KTKA 1SE4A 1FNUA 3BVGA 1RDPD 1SE2A 2RDGA 1PTOC 1XTCD 1PZJD 3W2DA 1AW7A 5FKAC 1BCPF 2Z8LA 3KLSX 1LTRD 1S5ED 3V05A 2NTSA 1HA5A 4L6TB 2XRQD 4TSSA 1ET9A 4RGNA 1S5CD 1UUPA 1I4XA 1LTID 5ELFA 4UDUC 1TS5A 1V1OA 4RCOA 1QILA 1AN8A 1PTOH 1TY2A 4RH6A 3MFGA 5ELDA 4DXFA 1V1PB 3R8BA 1EU4A 2R61A 1F77A 1LLRD 3R2IA 1JCKB 1JQYD 1I4GA 1SJED 2O2LD 4K6LA 4BWGB 1MD2D 1S5DD 2XNAC 1STEA 3EA6A 1ENFA 2IPKD 1PYWD 2RDHA 5ELCA 1BCPC 1SBBB 1FNWA 3DWPA 1RCVD 4OHJA 4RHSA 1G8ZD 1PTOD 5ELEA 2SEBD 1EEID 1SE3A 1FNVA 4RGOS 1SEBD 2XN9C 1JWMD 5TSSA 3BYYB 1PTOB 1PZID 1LT3D 3MC0B 2G9HD 3TSSA 4RGTA 1PRTF 1PRTC 4L63B 1D5MC 1KLGD 1RD9D 1I4PA 1S5BD 1HTLD 1XXGA 1EFID 5D3DA 3URYA 1FD7D 1BXTA 1JWSD 1LT4D 1LT5D 1TS4A 3BVZA 1B44D 4DXGA 1CQVA 2TSSA 3R2TA 1B1ZA 2NTTA 1HXYD 1DJRD 1LTTD 1T5XD 4Z9CB 5FK9C 1V1PA 1D5ZC 1DYQA 2QILA 1FGBD 2AQ2B 1BCPD 1EU3A 2ICIA 3EFXD 1CT1D 3BZDB 2IJ0A 2J4XA 3BVMA 5D3IB 4RFBA 4ZYSA 1LTGD 1L0XB 1BCPB 1M4VA 4RGMA 4C56C 2AQ1B 1ET6A 4O1NA 1PRTD 1LO5D 2QEJC 1CHQD 5I4DA 1SXTA 1CK1A 1HQRD 1I4QA 1PTOF 1S5FD 1TS3A 3OWEB 1TY0A 1PRTB 1PZKD 1RF2D 3SEBA 3DWAA 1LTBD 1TS2A 3CHBD 1JR0D 1LTSD 1KLUD 5ELBA 1EWCA 2CHBD 1SJHD 2AQ3B 3O13A 3GP7A 1UNSA 1EEFD 1I4RA 1I4HA 3BYTB 1ESFA 1CHPD
chains in the Genus database with same CATH superfamily
1G6ZA 2O4XA 4MIUA 3L2PA 1PH6A 2X6LA 3BDLA 2R7ZH 1FNUA 3FP9A 2R7FA 2QKIC 2PW5A 3N6RA 4KY5A 4C3IB 2NTSA 1IL2A 2UXDL 3E9IA 5JVG3 1SYEA 1VDZA 2L15A 4ME3A 2NZOA 4TQUS 3PUYA 1II3A 4NDXA 5JOBA 2R7ZB 2F0KA 3K58A 2F0NA 4M8AA 3R8BA 2RSOA 2JA5H 5C3EH 2ZJPA 2RCFA 1VQIA 2HHHQ 4E6IA 4ZKCB 2KCNA 2CQAA 3S1QH 4H7BA 4B3RQ 3HOUH 1PMRA 1O80A 1TVXA 4DR3L 3HOWH 3I4MG 4DR1L 2L55A 2SDFA 1BDOA 1K8GA 2OTJA 2JA5B 1H9SA 4YWMA 3RN5A 4X62L 4Q5VA 3S2DH 4DKAC 5D3DA 2EY1A 3AMUA 4DV3L 1UE7A 4RMFA 2A68D 3C3LA 5DM73 2B2WA 2BA1A 1Z47A 1WD1A 5C4XG 2R92G 3S1QB 3W1BA 1QOHA 1S72A 3HOUB 3HOYG 4ZUIA 1HXYD 2EE1A 3JAML 4LFAL 1VQGA 1G6PA 2RQXA 2IJ0A 1UE5A 3S2DB 1DM0B 3S16H 1EY5A 4F8MA 1CKNB 4HAEA 1EWIA 1QJOA 1K3RA 1VQCA 3UI2A 2KCTA 4ODGA 1PTOF 1HR0L 1J8IA 3P20A 5JJIA 3OSOA 1VQKA 4KN7C 1MSGA 5ELBA 4DV7L 3S16B 3O13A 2Q2TA 3PF4A 5C4JH 2XN9C 3I70A 1ESFA 1VQAA 2VL6A 2F0UA 3DEPA 1EY4A 2ZTDA 4G57A 1IXRA 4FXDA 1FGUA 1RKNA 3CCMA 5C4XH 3CP0A 3DWQA 2FFKB 3MWYW 1JWUD 3VR5A 2FJ2A 4OGQC 3HOYH 2Y0SE 3I4MB 3NTKA 2UXDQ 4LJZC 1CM9A 4JCVE 1H95A 4C1NK 2A73B 3MTSA 1TS5A 4DV0L 4PG3A 2PZTA 2K03A 2E2JH 2B63G 5C4XB 2UXBL 2R92B 3E0EA 3HOYB 1QVFA 4CDCC 4BWGB 4XDXA 1JB3A 1MD2D 4IUPA 1I94Q 5M5WB 2RCNA 1BBWA 4AYBG 3DWPA 1XPOA 1K8MA 1PXUA 1RCVD 2EQSA 4LUOA 1EY8A 3J80i 1L1OB 2QW7A 3LGJA 3NPPA 4TVAB 4DR3Q 2VW9A 2KEEA 2E2JB 5A2QL 1WJJA 2F0MA 2OXPA 1A0IA 1R9TH 3MC0B 1CFMA 1H9MA 4GZYC 1PRTC 1D5MC 1EY7A 1K3BC 4X62Q 3M7NA 3TEHB 4HSVA 1PH3A 5IGGA 4DK0A 4DV3Q 3CCLA 4L5SA 4R4OA 4R8NA 3K5NA 1HR0W 1HUMA 2E75C 1SMXA 1AFPA 1OTCA 1SNDA 2WFWA 4CDEC 5C0XI 4FF3A 1B1ZA 3GTJH 3KF6A 2ES2A 4WFN3 1HZAA 5FO9B 4OO1G 1CT1D 3CQZH 4X6AH 3J7AF 1V9PA 4K6DA 4ZYSA 1Q3LA 1BCPB 2B8GA 3B6YA 3HOVG 4IOAA 2ZXOA 4BBRG 3U9OA 1OXXK 1HNXL 2YV5A 2JA6G 4IFDJ 1HQMC 5JEAG 1HR0Q 3GTJB 4A3LH 4IURA 3I90A 3UDFA 2EXZA 5CC4A 2OWOA 1F2MA 3GV6A 3J81i 3SEBA 4A3EG 1K28A 4N8FA 1Q1BA 1KNEA 2FMCA 3BG3A 1FL0A 2MQHA 2VXWA 3V2TA 3BU2A 4DV7Q 3GTKB 2B63B 1XMQQ 3CAMA 3WWVA 1RTNA 4DNTB 2AQ3B 1GUWA 4JI5L 2I0QA 1YZ6A 1KDBA 3OMGA 1U5KA 4JI4L 3PIOA 4Y7NH 3T51B 1GUNA 2K5HA 4GNXB 2Q8IB 2XRSD 1QB5D 2FXQA 1Q7YC 3DMUA 1MI2A 2HQLA 2WINB 2PMZB 4A3GH 4EQPA 3ULPA 4NPSA 1SE4A 1SE2A 1PTOC 2F0HA 3H94A 2O5IC 2B2UA 2GVBA 2CKZB 1HHVA 2BA0A 1X32A 4OO1H 1J9OA 4TSSA 1R4PB 2KQ3A 4DFAA 1UEAB 3I72A 3RZOH 2P5ZX 2AMCB 4LK1C 4B08A 4IUUA 4BXXG 3TZUA 4A93G 5ELDA 1EIGA 2JA6H 5JEAH 3CCQA 4HJAA 1HTPA 3PCOB 1GHKA 2OCEA 1X9NA 3AU7A 4A3EH 1LTLA 2K32A 1PFBA 3RZOB 1JJGA 1YNJC 1WTRA 1QZHA 3HOVB 1PYSB 5LMUQ 2CH4A 5GAGC 4I7AA 1Y8NB 3OMCA 4ZKBB 1MJCA 2ASBA 2JA6B 2K33A 4FP5D 3NE5B 3DHQA 1SMYC 3UDIA 1BXTA 4A3EB 5E3FA 1UWVA 2RF4A 4JW0A 1KAAA 4LFBL 2WB1E 1Y1VG 5C4HA 3GTQH 3A7LA 1L0WA 3T53B 3SVMA 3NUCA 2ZJRA 1SNOA 1EIFA 4S3SA 1DYQA 2QILA 4L5TA 3EIVA 3N52A 3AFQA 1BKBA 2VUMG 1VQ9A 1MSHA 5I9OA 4BXXH 1LV9A 3QOLA 4JVZA 1TT2A 2R93G 1M4VA 3K0XA 3PO3H 1Q12A 3NP8A 4G7OC 1ML0D 2ZXRA 3QG1A 3GTQB 4DUYL 3D6CA 1RJTA 4CKCA 1TS3A 2CQOA 1YJ9A 1IBLQ 3H6MA 4PV1C 5C5MA 3G6JB 3QWNA 2F0TA 3M3YH 4XQQA 2MO0A 1AZPA 1QVCA 2RSNA 2A8VA 1YNXA 4A3FG 4P71A 1X3GA 4PZ7A 4JI5Q 4A93B 5CV8A 1JICA 4JI4Q 4EVOA 3M4YA 3HG9A 4GN3B 1I4HA 1STYA 4IPGA 5I6WA 2KHIA 3C2PA 3A8IE 1PLFA 2RA4A 1DONA 1BOSA 1W6JA 1X3EA 3M3YB 2N3SA 1Q8IA 1SNMA 3FPUB 1S4ZA 1XNQL 1Y1VH 5LHY1 1KTKA 4YWLA 1RDPD 4KV6A 1BUVT 1VCIA 2N8NA 5IP9G 1OXSC 2A6EC 1E24A 5G3LD 1FR3A 5CYUA 1VQ4A 4QF4A 1AE2A 3ICEA 3F2BA 2BDNA 1IL8A 1LTID 2R6GA 1V1OA 5IWAQ 3T13A 1VQHA 3F2UA 3FHWA 1AN8A 2UUAL 3ZJYC 1Y1VB 4A3IG 4B3TL 4JI7Q 2V1CC 1F77A 1PHJA 1ESRA 3CRKC 4Q0FA 3U4ZA 5IT9c 3T1YQ 2NVYH 3D4RA 4JV5L 4OXPA 5EBCA 2VUMB 1D2BA 4A3FH 3S1RB 4UY8C 4C3IH 4A3KG 1LM0A 1SE3A 2B2VA 1EYAA 1Q86C 1TWCH 4DK3C 5CV6A 4PMWA 5I2XA 2VS1A 3MXUA 4K5VA 2B2TA 1WTVA 1WTPA 1HNWQ 5H1SE 1N34Q 3S1NH 2I5MX 4GLXA 1EQVA 1VQDA 2KBNA 1JOKA 4GOPA 4A3FB 4IFDH 1NR4A 3R2TA 2OQ0A 5CORA 2HIXA 4OELB 4O42A 1SAPA 1SNPA 2Q2IA 1DJRD 1TWCB 2B2UC 4B3SL 3D31A 1LYLA 4RKBA 2Q2HA 1YNNC 3P75A 5E4XA 2PI2E 5EBDA 2ICIA 1C8CA 2D0OA 1B8AA 3S1NB 1HFNA 1F2LA 1RIPA 1PH8A 4P72A 3K59A 4A3IH 4V190 1ZEQX 3EQLC 4L5RC 1PH1A 4KKUA 1CHQD 5I4DA 1QNKA 1A15A 2EOTA 5KIXA 5G3LF 3T56B 1TY0A 3RD4A 1RF2D 1PFMA 3KJOA 1VQPA 4N8X1 4GKJL 4A3KH 4NB3A 5LL6X 1LTSD 2K14A 4B9XA 4KTAA 4A3IB 1IBML 3CD6A 4YCUA 5IT9L 3GV3A 1HRJA 1D6EC 2LMCB 5IGDA 2WP8J 4X3TA 4K8IA 1XNQQ 4C1NI 4A3BG 1OXUA 1F2YA 2A69C 3FRPB 1QZGA 1GM5A 1DOMA 2A74C 1CZGA 4A3KB 3W2DA 2M00A 4LF4L 2NN6G 4DAMA 1FVIA 1E1TA 2F0OA 2NWGA 1TWGH 1E1OA 1IYJB 3HKZE 1A8VA 4XT1B 1A2UA 5C6AA 4DR2L 1HPCA 2UUAQ 1A3VA 2A5HA 1EWHA 3PMFA 1PFNA 4A3MH 4B3TQ 2PPBC 4DU9A 1OXVA 1SN8A 5IOCA 3BJUA 4MHEA 1N9WA 5KNCA 1I4GA 1SYCA 4JV5Q 2LKVA 3ND8A 1Y69U 3L3OC 1TWGB 1VQFA 4F7XA 3H0GG 2ID0A 4MZ9A 4MTNA 4MTKA 1UE1A 4FXKC 2ATWA 4IPCA 4JI3L 3OW2A 1VQEA 3NSWA 3I55A 3J7AV 2QF7A 4A3BH 2F0IA 3A54A 2A1AA 3E3XA 1B7YB 1UAPA 3WOFA 3KDFB 2ZT9C 2NTTA 4B3SQ 4CJ0B 4BBSH 4DAPA 1VQNA 2PZUA 2RVLA 4OX9L 5M5XH 4A3BB 1JJCB 4LF8L 3WDNA 3TDQA 2KCCA 3OW7A 2A19A 2F1MA 2E2HH 1ET6A 1PRTD 2KUMA 3A5UA 1Q46A 4JI2Q 2F0VA 4A76A 3E9HA 4YIJA 3GTPH 2SNSA 4DAYB 2NZ1D 4LF9Q 3H0GH 1PYBA 5FLMG 5CMDA 2WKCA 1KLUD 2PMZE 2KCMA 1IBMQ 3HRZC 3Q6SA 1UNSA 1I4RA 3EROA 3BYTB 2IHEA 3RLNA 1CHPD 3P1HA 1GUOA 1F2ZA 4ZK9B 2FMMA 3GTPB 3SR1A 3G7LA 3BVGA 1EYCA 3EBEA 3H0GB 1ONLA 4LF4Q 1PZJD 1VQLA 4KKSA 3F8TA 2L0CA 3KLSX 1KIXA 1SE8A 1K0RA 4YY3L 1ET9A 2IW3A 3QIAA 4LWCA 2GA4B 3F2CA 1K83H 4CHTB 4GKKQ 3NBHA 3RNUA 3TRZA 3GDEA 2QA4A 1CKMA 1WD0A 1HJPA 3C46A 3A74A 4HTHA 4L8JA 2EYFA 1VQOA 1Y14B 4R4IA 4F87A 3U9SA 5J1ZA 5FLMH 4N9TA 5BN5A 2F0DA 1PTOD 4X64Q 1CA5A 4DR6L 1OXTA 1K83B 3ZYYX 4DV1Q 3PIPA 3TP8A 3PSIA 2XVSA 1PRTF 2VQFQ 1I4PA 1VQ7A 2RHSB 2ZXPA 5FO7B 4QB4A 1LT4D 3L0OA 2EVBA 4HIOA 3TMEA 5D14A 2JE6I 1LUZA 4MNOA 3TP7A 1N8RC 1CQVA 2MP1A 5DLQE 4CKBA 3QB3A 4XQNA 3VYUA 1V1PA 1ASZA 3GTLH 2VB2X 4OX9Q 4OIJA 1I5FA 4RG1A 1QE6A 2D5DA 2AUKA 2J4XA 3NHHA 5IGBA 1HZCA 3V96A 4RFBA 1C4QA 4LF8Q 4BA1I 1YNJD 2WACA 2JYOA 4A3CG 3Q8DA 1V8QA 5JEAJ 4HIKA 4I65A 4K5WA 2ICEC 2QEJC 1O7YA 3SDZA 2MFIA 3UDGA 2UUBL 1H9KA 5IYDG 1SMYD 4KKTA 3GTLB 1JC7A 2AHOB 4O2DA 4CKEA 2B2YC 1DZ1A 1JOOA 1TS2A 2KENA 4DA2A 5C0XG 1WCMG 1EWCA 3I4LA 1X6OA 3K7UC 3NENA 1KC8C 5L37A 4DV6Q 3PO2G 1HA6A 1CI3M 3ERQA 1L0YB 2PCFB 4EX5A 1GOZA 3PUZA 2K05A 5IYCG 4PMCA 1WI5A 2L5TA 3CMAA 2VZAA 4X65Q 2EIFA 1H9SB 4QMGA 3I91A 4DN4M 1XMOL 3PUWA 3SK8A 3I4MH 5C5LA 5NUCA 5ELFA 2EJGC 2BOSA 3A5ZB 4ZLTF 3S14H 4A3CH 4HN7A 2AWNA 4LFCL 3M4OH 3P7JA 3GTGB 4DXFA 2I07B 5T1IA 3CCRA 5IYDH 3RN2A 5KYLA 2VY3A 3MFYA 5KNDA 1PH7A 1T9HA 2HCCA 4KN4C 2R92H 2XNAC 2B3GA 2ZTEA 2PQAA 3KK7A 4DR6Q 2HDMA 1G8ZD 3S14B 1ICWA 3K8AA 4P75A 5M5WH 1A6XA 3RMHA 1O78A 2A6ED 3M4OB 4HJ7A 1Y1WG 3VR3A 3K5MA 2JP1A 2C35B 1KLGD 3PO2H 3RZDB 4GN5A 5A2QE 1LT5D 2QCPX 2C9OA 1KL9A 5ELOA 1JE4A 3KF8B 4NXML 4ID6A 3S24A 1J6QA 4POFA 2CH4W 3BZKA 4WJ3M 4Z9CB 1Q8KA 4TRDA 5FK9C 2UUCL 2J7ZA 1I6VC 2NVXB 2IY5B 4CJ2C 5KRUA 1ZXTA 1ASYA 3PO2B 2XSCA 1UEBA 4X66L 3VYTA 4CDFC 3Q22A 4DR1Q 3OTOL 2M9VA 4LUZA 3OIQA 2X6GA 1N36L 2D9UA 2EYOA 1H9RA 5J39A 1ZYRC 2K01A 3SGIA 5A35A 2IL8A 4LMQD 2IX0A 3I7FA 4CBVA 1PZKD 4LFAQ 1E0BA 1XPUA 2G9DA 1W3SA 4WRDA 3TN2A 2JK8A 1YHQA 4DV4L 1GO3E 5HURA 1N33L 2I5HA 1MBYA 1YNND 3GTKH 2B63H 3CC4A 3E0JA 5EGTA 1P8LA 1WYDA 5JJLA 5CV4A 2KHJA 4X3SA 1WTQA 1C9OA 2E2DC 1AW7A 5FKAC 1BCPF 2BE5C 1B3QA 2Z8LA 1Q82C 3G71A 1Y1WB 1LTRD 3J81j 1XMOQ 3CKIB 1HA5A 5M3FG 1YBYA 2PZWA 2PNHA 1KRSA 5E7NA 1I4XA 3MEHA 2IHFA 2K1BA 2IWHA 4JYAL 3PV0A 4RCOA 2F03A 2KJXA 1BR9A 3CCJA 3CXCA 1P16A 2F0QA 2EJMA 4KJOA 3KF6B 4AYBB 3DUZA 1GKHA 2O2LD 1SJED 4YWKA 2SOBA 4IPDA 4HEDA 3EA6A 4JBKA 2A69D 5C44G 3IRBA 3HFZB 1JT8A 2N88A 1CSQA 3OYYA 4HSPA 4NMZA 2CW0C 2OQKA 4DV0Q 2B39A 2MNAA 3HOVH 4BBRH 2UXBQ 3IL8A 3R3OA 2HDLA 2F0WA 3URYA 1JWSD 1FJGL 3A7AB 4CDDC 1DXMA 5KYIA 1EOTA 4DNIA 1NR2A 2EJFC 1EQTA 4B9WA 3T4AC 1AE3A 2H4OA 5LMNL 2NUCA 4KY6A 4DR7L 5M3FH 2NVQB 3CCUA 2JA7G 3K80C 4R1JA 2EDGA 1FGBD 4X66Q 5ELNA 4BBRB 3HKSA 2F3VA 1YVCA 3SK4A 1R4QB 4C56C 4K0KL 1MKHA 5EAYA 5K36G 2L4NA 4CGYB 2C5CA 5J3BA 3KOJA 4U68A 5DNFA 5M3FB 2N49A 1IKMA 2GN5A 2KEDA 3HZXA 1IBKL 2IT1A 5CV7A 3PIO3 4DV4Q 1N33Q 3J7A5 4JOIC 4HIDA 2Z1CA 4PQXA 2BDOA 3RUZA 1LTAD 1X3FA 2A6HC 4A93H 4HIMA 1L1OC 1HNXQ 2Z6BA 5C44B 5JPNC 3NXWA 2JSOA 2RDGA 1IKLA 1VQ6A 2XTIA 4IPHA 4DR5L 5FJ8G 2JA7H 4QUCA 3FPPA 5J22A 3FEWX 1V43A 1K8AC 1YHAA 1KRTA 1B9NA 2JQOA 1U4MA 4JYAQ 2YTYA 3LX0A 1UE6A 4HJ5A 2D0PA 2HCIA 5K36H 2DY8A 3MFGA 2YU9B 5M9OA 4H0LC 3MAQA 1DD2A 2N55A 3J80E 3R2IA 4L5QA 4XYQA 2JA7B 1SYFA 2RDHA 3AB9A 5LMNW 1BCPC 4UPAA 1VQ8A 1I6HH 1Q1EA 2N78A 2PO4A 2KOLA 1TWFH 4H44C 4RA8A 1SEBD 1I3QH 1NTGA 2VUMH 3S1RH 1WTOA 2R93H 4GS3A 5FO8B 2HUGA 4ZQ3A 1RD9D 1XXGA 1HTLD 1FJGQ 2K52A 5EKKA 3DLLA 4JBMA 4UAIA 3A55A 4Y52H 1KXLA 5GROA 1I6HB 1EY0A 5DEHA 1BF4A 3TQYA 4GNXC 5FJ8H 1BBXC 1TWFB 1JE5A 3C1EA 3TS2A 1I3QB 1B70B 4RAUC 1O7ZA 4HR7B 1D5ZC 4NXNL 2R93B 2D62A 1C0AA 3NTIA 1Q90A 2K5VA 2FHTA 3MZ5A 3D3RA 5IYBG 3W3AA 3H09A 2X69A 4K0KQ 2J0TD 3J81E 5AJ3L 4LFBQ 3NWSA 1IBKQ 5IP9H 2H5XA 4PZ8A 3ULLA 4JI0L 4A3DG 3E6ZX 3PF5A 4K8JA 5EKLA 4WORA 1SNQA 4KD4A 3S15H 4R8IA 4EQOA 4R4QA 2K5WA 1WTXA 2K6AA 5JVH3 5BN4A 3QOJA 1LT6D 5FLXc 2M2LA 1B3AA 2RKSA 1YJWA 3H3VH 4DUYQ 5IP7G 1KD1C 4DV2L 1QG7A 4EQ5A 4C3HG 4WJWA 4KHPL 5JPMC 2EY6A 1ILQA 4DR5Q 4XXEA 1EZ8A 5I2YA 3Q23A 3S15B 1U0LA 1VQJA 4LAAA 4DUZL 5JJZA 3V05A 1B53A 5DM63 1KQSA 1HCZA 3ND9A 5CV5A 4DAVA 2K7VA 4IOCA 2HIVA 3K0YA 4GOPB 1J5EL 4ILWA 1QUQB 1N32L 3K7AH 1XPRA 4OIKA 3VR2A 4J6HA 4J15A 4LF7L 1TKWB 1HFGA 5FLXE 1GJXA 3CU7A 2R61A 5GQOA 4OWWB 4FO2A 4C2MH 1YIJA 2OTLA 3NBIA 3CC2A 4HJ8A 5ELCA 4A3DH 3PUVA 1SBBB 1FNWA 1AP0A 3K81C 1GVPA 1T5EA 1D8LA 1STGA 3GD7A 5IIFA 3K7AB 2Z6KC 1NBWA 4X3UA 3H91A 3U50C 3NWTA 4JI8L 2XIWA 4C2MB 2BH8A 3SK5A 3G4SA 1ENCA 1DOLA 2IX3A 4IFDI 1TXYA 1TS4A 3S9WA 2DNCA 5COYA 3BVZA 1FYCA 1MJEA 3HOZG 4A3DB 3I8ZA 1ILPA 3NQIA 1EFWA 4HMIA 2B2YA 2MO1A 4JI1L 4NXNQ 2RDFA 4KHZA 2BH2A 2IX1A 4LF5L 5BR8L 2PYKA 2WIIB 3BVMA 4WJ4A 1B2TA 4OWTB 4BY1G 2NB0A 4C3HB 5HGTA 2WB1G 2AKWB 2ZTCA 1PDQA 1SXTA 3G6EA 1PA6A 3OWEB 2NN6H 4KLKA 4DNRB 5C0XJ 4ME5A 4JI0Q 2F0GA 4JC0A 4KMUC 4JBWA 4GLVB 2QGQA 3VA5A 1S3OA 3M9BA 3GP7A 4YHHL 4FF1A 3CCVA 5IGCA 2LXJA 1STNA 2EYHA 4BY7G 3U58A 1ZKOA 2BCOA 1HZBA 3HOZH 3PQIA 4DV2Q 2MJ8A 3BDOA 4LUVA 4KHPQ 3HEJA 1Y8OB 1GHJA 1ZYRD 3LNNA 5GAHC 4HMJA 1XYIA 4JK1C 4GKJQ 4ULLA 3S17H 4B3RL 1BVSA 4G7ZC 4AIMA 3MXNA 1VMPA 4RGNA 4AYBE 2UU9L 1J5EQ 3EVQA 3W5OA 5T1GA 3HOZB 2K5NA 1TY2A 1CA6A 1NNXA 3U4VA 1YJNA 2F52A 3AEVA 2F3WA 3OHXC 5C4ZA 4IQZA 3S17B 1XX8A 4K5XA 2DNEA 2EPBA 5AFWA 1RTOA 1TWHH 5I9PA 1DCZA 2EZVA 3VR4A 4XIGS 2BE5D 1B50A 2WB1B 2H1EA 2AWOA 3TSSA 4DR2Q 2UXCL 2QDLA 3TP6A 4IN3A 1IW7C 5E4WC 4ZRZA 4UP7A 2L12A 1TWHB 5C3EG 1CSPA 3I2ZA 5CV9A 4H02A 3H3VC 3H15A 1GXDC 2VQEL 5FOBB 4JI1Q 3VYRA 3T1HL 1PH9A 3GTMB 1SROA 3S2HH 4LF5Q 5BR8Q 3HOUG 1DOKA 1E7ZA 4LF6L 1BBUA 3HOWG 1AEXA 3MVVA 4JI3Q 1RL2A 5HGQA 3JAMc 4UHVA 3MA2B 1L0XB 1WTHA 2CW0D 4X3KA 3STBC 2PQEA 3I56A 2VB3X 1S5FD 2WAQG 1PRTB 5IGEA 3S2HB 3NBHB 1LTBD 4FYDA 5D65A 2QDBA 4DV5L 3HP3A 1JORA 4I7ZC 4YHHQ 3TZDA 3D0FA 3PUXA 5HY6A 3JAME 3TREA 2TMPA 1WFQA 2EYLA 2KHSA 4JG2A 1DGSA 3OOCA 3SK6A 2K50A 1I94L 1G2TA 3FMCA 1CKNA 2YTVA 4M1UB 4K2LA 5CBEE 2PI2A 4L6TB 2XRQD 2UU9Q 1STAA 3D4WA 1K73C 2I46A 5C3EB 1QILA 1KAWA 2F0EA 1IYVA 1V1QA 1PTOH 1E3PA 1V1PB 1EU4A 5GADC 2A6HD 2CWPA 1W6KA 1JCKB 1EQQA 3ERSX 5I6YA 3GTGH 1F9PA 4KY7A 2HQEA 3HOWB 1D1IA 3HKZG 4ZCKA 1GUSA 1VMCA 4FNFA 5C3WA 2HD3A 3PIP3 1NMGA 2SEBD 2JEAI 1E2WA 4YY3Q 4N9PA 3F2DA 3BYYB 1PTOB 2UXCQ 2G9HD 3G48A 1BO0A 5E1FA 2WAQB 2K75A 4JPBW 1B4OA 1U4RA 4DXGA 3DXJC 3RZDH 4K2KA 2VQEQ 3KJPA 4DR4L 3T1HQ 4CJ1B 1TU2B 4APVA 5C0XH 1WCMH 4LF6Q 5CR3A 1XMQL 1BCPD 3EFXD 3KF8A 1VQBA 3BZDB 4HCEA 4JOIA 1VQMA 4R4CA 3KFUA 4POGA 1VS0A 3W1GA 1EIHA 2NVXH 1F9RA 2DN8A 2LY7A 1WOCA 1L1OA 4J1MA 4IJLA 2AQ1B 4O1NA 2K4KA 1EYDA 1Z6HA 1EZ6A 5IYCH 1M1KC 2NYZD 1WCMB 3S1MH 3EJIA 2ALYB 5C4JB 1IHZA 4DV5Q 3HS0C 2F0SA 4XYOA 3R93A 1EEFD 2MHVA 1X65A 2D2CC 3SE0A 3OPOA 2WKDA 2PQAB 4KI0A 1A3UA 3HKZB 1D5XC 3S1MB 2UUBQ 1EL0A 4A3LG 3MXGA 1NCVA 3CMEA 3GQBA 3NK9A 1S5ED 3UE0A 1ENAA 3IFTA 3DM1A 4A3JG 3FDTA 5LMUL 1MIUA 5DAUA 3A0JA 1Y1WH 4QUFA 1TR5A 1XWEA 2Q8RE 3KLSA 3KBGA 4JI6L 4K14A 4RH6A 2OT2A 1WVLA 2E74C 5KEEA 2ENBA 5BN3A 4GLAC 4A3GG 4PNYA 1MHWC 1U4PA 4GNXA 1STEA 2EYMA 5EPLA 2Z0SA 1A63A 2XWBB 3CF5A 1R9TB 4OHJA 5IODA 5ELEA 1EEID 1EQRA 1TQOA 2E5LL 4FF4A 3CCSA 1E2ZA 2FINB 1QWYA 1LT3D 1M90C 4L63B 4LFCQ 3MXPA 1U9RA 3A8JE 2CWAA 3NEMA 2R3ZA 3BZCA 4DR4Q 1IBLL 1YHBA 4MN3A 1QVGA 2TSSA 3CQZB 1CTMA 1XNRL 1LTTD 3CPFA 5KNBA 4A3JH 4QIWB 1O7LA 4QL5A 1PFSA 4U673 2O5JC 1VQ5A 1SSOA 2CCZA 1SFOH 1EUJA 2NVQH 1LTGD 1CZWA 2V4DA 2NZHA 1E2VA 1PH4A 1GD7A 1CK1A 3RLFA 1I4QA 3NTHA 4NXMQ 2B2WC 4A3JB 2F3IA 2EYJA 4H13C 2I5LX 2ZJQA 3X3MA 4XQJA 2CVRA 1HZ9A 2HT1A 3CHBD 5GAEC 4Y7NB 1YITA 1SFOB 3M7GA 2UUCQ 2F4IA 1XTDA 3Q0AA 1YEZA 5IWAL 3OTOQ 4A3GB 5CGKA 1PVOA 1NAPA 4R4TA 4XTCS 3PO3G 1N36Q 1I50H 1NMFA 1C7YA 1STBA 4G7HC 3CPWA 4JI7L 4YCWA 3I4NG 4QY7A 4QQBX 1W2BA 4J8QA 4FVMA 2EXDA 2LS01 3T1YL 1XTCD 1HUNA 3GO5A 2G5DA 5C44H 3KBXA 2JA8G 1X56A 2Z6KA 3LWEA 3X3NA 4KJNA 3DM3A 1UUPA 3RR5A 4B3ML 3CW2C 1I50B 2E2IH 4G4KA 2PNRC 3NQTA 1RODA 3K5OA 4JI6Q 4FF2A 2A68C 2OF1A 4AQYL 2GVAA 2R7DA 1HNWL 1SYGA 4YCVA 1N34L 4NW2A 5JJKA 5EPJA 5EQ0A 5EJWA 3K6OA 3J80c 2Z4HA 3KLWA 1H9JA 3L9AX 2YU9H 3DEOA 1ENFA 1PYWD 2B29A 4AH6A 3KUPA 3HOXG 4OO1I 4RHSA 2E5LQ 1O7IA 2E2IB 1X3PA 1D1KA 4DGZA 1AZQA 5CBAE 4RGOS 2JEBI 5TSSA 1TWAH 3J7YW 3I4NH 1FD7D 2Y0SG 3VR6A 2QEXA 1B44D 4JBJA 3JC66 1SLJA 3M85A 2L9HA 1XNRQ 3FVQA 3M4PA 2JA8H 5LL6S 1JOQA 1F9SA 4DPGA 2K04A 1TWAB 3AFPA 2DY7A 4IO9A 3PO3B 4IALA 1K0SA 2K5DA 5KGUA 2SNMA 5D3IB 3ONAB 2MPMA 3NELA 3I4NB 1X3QA 4IUQA 3KLRA 3I3CA 4RGMA 4QGUA 2JA9A 2PW7A 4ZAIA 3J81c 1LO5D 1Z9FA 4EQNA 2JA8B 4UP9A 1VF7A 1IW7D 2EY5A 2F0FA 4IFDG 3HOXH 4F88A 3DWAA 5LMNQ 1WTWA 4DR7Q 2Q8TA 2LSSA 1KNAA 2F4VL 1AH9A 3UDXA 1JMCA 2CHBD 1KABA 2F0LA 3AYHB 3J80L 1SYBA 3CCEA 2KVMA 1OO9B 1A3TA 1EYGA 4UP8A 1D7QA 1Y8PB 2ZM6L 1E22A 2Z4IA 2WV6D 3EN2A 5M3MG 3HOXB 1K9MC 4DK6C 3QO2A 2K5QA 1KHIA 4DK1A 3KYHC 4HCSA 3SXHA 2MGSA 3STBD 1K8OA 5F2DA 1IZ6A 3VA7A 1HNZL 1A2TA 4B3MQ 1S5CD 1NSNS 2MUYA 2OEOA 1JB7A 4OONA 2Y0SB 3F1ZA 4AQYQ 4EGVA 5M5YH 4KD3A 1G291 2NVYB 2EY2A 5K5PA 1S40A 1NJIC 1JQYD 5IT9E 4K6LA 1QUQA 4C3JG 1CKOA 3HGBA 3VYSA 2WAQE 3I4OA 3C1FA 2YYZA 3J81L 1Q81C 4IZ8A 4RWSC 1FNVA 5M5YB 3K5LA 1Z7TA 1EY6A 1NUCA 4V0BA 3ER0A 5IYBH 2LFNA 5ISRA 1S5BD 4A3MG 1JJ2A 5M3MH 1EFID 2DJFC 2JJQA 4NP5A 4P74A 4BS9A 2NVTH 2RHQB 1MGSA 4RKLA 4JI2L 4KHVA 1SDFA 1KDCA 3M4QA 1STHA 2EYPA 4LF9L 1T5XD 3L7ZC 2XGTA 2AUJD 2AQ2B 1EU3A 4FXGC 2JXMB 2Z9HA 1X55A 5M3MB 4TKOB 3TS0A 2NVTB 4A4IA 1G91A 3K57A 1KDAA 2KA7A 4OWXB 4PZ6A 1TIID 2DGYA 5IP7H 4QCLA 3D6WA 3MHBA 3ITPA 4C3JH 3JAMi 5JAVA 4C3HH 5EPKA 3GTOH 3RLOA 3ULJA 2Q2UA 2F4VQ 4BBSG 3TBIB 1CUKA 1JR0D 1ICFB 5FLXL 1EIYB 3KDFA 3A56A 5C3XA 3QR8A 1SJHD 3IAYA 1VF5C 3H3VI 4ALPA 4GKKL 2L1BA 4RHRA 4C3JB 4ZUJA 3FKIG 2ZM6Q 2F0JA 4NKLA 3GTOB 2E8GA 3T16A 5AJ3Q 3VDYA 1PH5A 1SRUA 1SNCA 2LXKA 2RBMA 2XWJB 3TP5A 1HNZQ 1NE3A 4X64L 1SR3A 4OL7A 4A3MB 4DV1L 4UDUC 4IJHA 4A75A 1XJVA 2VQFL 5IY0A 4DAYA 2VNUD 1L2FA 3J7ZC 2K28A 2KECA 1LLRD 4IUTA 4R9WA 1X54A 1BNZA 1S5DD 1U4LA 3AQQA 2HHHL 3OIPA 3BS1A 1C48A 2IPKD 1CQFA 3MEFA 4DUZQ 4LNQA 2F0PA 4KK7A 2E76C 1A62A 4P73A 1F9QA 2B8FA 4HJ9A 1JWMD 4LW1A 1PZID 3CC7A 3OWFA 1HH2P 2DJGC 4RGTA 4ABNA 3FKIH 4C3IG 4BY1H 1N32Q 3CRLC 1LABA 3WOEA 3D4DA 4LF7Q 4O0AA 3Q24A 4PMBA 2L11A 1EOVA 4QIWE 1PH2A 1GUGA 3PGZA 1PV4A 3E5SA 3I73A 5IE8A 1RHPA 2YTXA 2NBFA 4BBSB 1GUTA 2JN4A 2R7ZG 3D8GA 1G51A 1B9MA 1QCBD 1YI2A 3IKJA 5M5XB 1SYDA 4QJFA 4BY1B 3FKIB 5EKIA 2B2VC 2E2HB 3GTMH 1NY4A 4BY7H 1BQQT 3UE1A 4GN4B 4OEMB 4JI8Q 4BA2I 2B2TC 4DV6L 4RCNA 3QJYA 1LACA 3MXNB 2NN6I 2DUDA 4XT3B 1M8AA 2JA5G 1HQRD 4IUNA 3BDCA 5IGFA 1G2SA 4GOPC 2CFMA 4DF7A 1EY9A 4X65L 4IUVA 1QNUA 4FDBA 4BY7B 1IYUA 3A8KE 3LWUA 3SHLA 3IFDA 4P2CB
chains in the Genus database with same CATH topology
1G6ZA 2O4XA 4MIUA 2X6LA 3BDLA 1FNUA 2QKIC 2PW5A 3N6RA 4KY5A 4C3IB 2NTSA 5JVG3 1SYEA 1VDZA 4TQUS 3PUYA 1II3A 4NDXA 5JOBA 2R7ZB 2F0KA 3K58A 2F0NA 4M8AA 3R8BA 2RSOA 4E6IA 4ZKCB 2KCNA 2CQAA 4H7BA 1PMRA 1O80A 1TVXA 2L55A 2SDFA 1BDOA 2JA5B 1H9SA 4Q5VA 5D3DA 2EY1A 3AMUA 2A68D 3C3LA 5DM73 2B2WA 2BA1A 1Z47A 1WD1A 3S1QB 1QOHA 3HOUB 4ZUIA 1HXYD 2EE1A 3JAML 2RQXA 2IJ0A 3S2DB 1DM0B 1EY5A 4F8MA 4HAEA 1QJOA 3UI2A 4ODGA 1PTOF 1J8IA 3P20A 3OSOA 4KN7C 1MSGA 5ELBA 3S16B 3O13A 2XN9C 3I70A 1ESFA 2F0UA 3DEPA 1EY4A 4G57A 4FXDA 1RKNA 3DWQA 2FFKB 3MWYW 1JWUD 3VR5A 2FJ2A 4OGQC 3I4MB 3NTKA 4LJZC 1CM9A 4C1NK 2A73B 3MTSA 1TS5A 2PZTA 2K03A 5C4XB 2R92B 3HOYB 4BWGB 4XDXA 1JB3A 1MD2D 4IUPA 5M5WB 3DWPA 1K8MA 1PXUA 1RCVD 1EY8A 3NPPA 2KEEA 2E2JB 5A2QL 2F0MA 2OXPA 3MC0B 1CFMA 1H9MA 4GZYC 1PRTC 1D5MC 1EY7A 3M7NA 4HSVA 5IGGA 4DK0A 4R8NA 3K5NA 1HUMA 2E75C 1AFPA 1SNDA 5C0XI 4FF3A 1B1ZA 4WFN3 5FO9B 4OO1G 1CT1D 3J7AF 4K6DA 4ZYSA 1Q3LA 1BCPB 2B8GA 2ZXOA 3U9OA 1OXXK 4IFDJ 1HQMC 5JEAG 3GTJB 4IURA 3I90A 5CC4A 2EXZA 1F2MA 3GV6A 3SEBA 1Q1BA 1KNEA 2FMCA 3BG3A 2VXWA 3V2TA 3GTKB 2B63B 1RTNA 4DNTB 2AQ3B 1GUWA 1KDBA 3OMGA 3T51B 1GUNA 2Q8IB 2XRSD 1QB5D 3DMUA 1MI2A 2WINB 2PMZB 4EQPA 1SE4A 1SE2A 1PTOC 2F0HA 3H94A 2O5IC 2B2UA 1HHVA 2BA0A 1X32A 4OO1H 1J9OA 4TSSA 1R4PB 2KQ3A 4DFAA 1UEAB 3I72A 4LK1C 4B08A 4IUUA 3TZUA 5ELDA 1EIGA 5JEAH 1HTPA 1GHKA 3AU7A 2K32A 1PFBA 3RZOB 1YNJC 1WTRA 3HOVB 1Y8NB 3OMCA 4ZKBB 2JA6B 2K33A 4FP5D 3NE5B 3DHQA 1SMYC 1BXTA 4A3EB 5E3FA 1KAAA 5C4HA 3A7LA 3T53B 3SVMA 3NUCA 1SNOA 4S3SA 1DYQA 2QILA 3N52A 1MSHA 5I9OA 1LV9A 3QOLA 1TT2A 1M4VA 1Q12A 3NP8A 4G7OC 1ML0D 2ZXRA 3QG1A 3GTQB 3D6CA 1RJTA 4CKCA 1TS3A 3H6MA 4PV1C 5C5MA 3G6JB 3QWNA 2F0TA 4XQQA 1AZPA 2RSNA 4A93B 5CV8A 1JICA 4EVOA 3M4YA 3HG9A 1I4HA 1STYA 5I6WA 3C2PA 3A8IE 1PLFA 2RA4A 1DONA 1BOSA 1W6JA 3M3YB 1Q8IA 1SNMA 3FPUB 1S4ZA 5LHY1 1KTKA 1RDPD 4KV6A 1BUVT 1VCIA 1OXSC 2A6EC 5G3LD 1FR3A 5CYUA 4QF4A 2BDNA 1IL8A 1LTID 2R6GA 1V1OA 3T13A 3F2UA 1AN8A 1Y1VB 1F77A 1ESRA 3CRKC 4Q0FA 3D4RA 5EBCA 2VUMB 1D2BA 3S1RB 1SE3A 2B2VA 1EYAA 5CV6A 4PMWA 5I2XA 3MXUA 4K5VA 1WTVA 2B2TA 1WTPA 1EQVA 1JOKA 4A3FB 4IFDH 1NR4A 3R2TA 5CORA 4O42A 1SAPA 1SNPA 1DJRD 1TWCB 2B2UC 3D31A 4RKBA 5E4XA 1YNNC 3P75A 5EBDA 2ICIA 1C8CA 3S1NB 1HFNA 1F2LA 3K59A 4V190 1ZEQX 3EQLC 4KKUA 1CHQD 5I4DA 1QNKA 1A15A 2EOTA 5KIXA 5G3LF 3T56B 1TY0A 3RD4A 1RF2D 1PFMA 5LL6X 1LTSD 4B9XA 4KTAA 4A3IB 5IT9L 3GV3A 1HRJA 1D6EC 2LMCB 5IGDA 2WP8J 4X3TA 4K8IA 4C1NI 1OXUA 1F2YA 2A69C 3FRPB 1DOMA 2A74C 1CZGA 4A3KB 3W2DA 2M00A 2NN6G 2F0OA 2NWGA 4XT1B 1A2UA 5C6AA 1HPCA 1A3VA 2A5HA 1EWHA 3PMFA 1PFNA 2PPBC 4DU9A 1OXVA 5IOCA 4MHEA 5KNCA 1I4GA 1SYCA 2LKVA 3ND8A 1Y69U 3L3OC 1TWGB 4F7XA 2ID0A 4FXKC 3NSWA 3J7AV 2QF7A 2F0IA 3A54A 1UAPA 3WOFA 2ZT9C 2NTTA 4CJ0B 4DAPA 2PZUA 2RVLA 4A3BB 3WDNA 3TDQA 2KCCA 3OW7A 2F1MA 1ET6A 1PRTD 2KUMA 2F0VA 4YIJA 2SNSA 2NZ1D 5CMDA 2WKCA 1KLUD 3HRZC 3Q6SA 1UNSA 1I4RA 3EROA 3BYTB 1CHPD 3P1HA 1GUOA 1F2ZA 4ZK9B 2FMMA 3GTPB 3SR1A 3G7LA 3BVGA 1EYCA 3H0GB 1ONLA 1PZJD 4KKSA 2L0CA 3KLSX 1ET9A 2IW3A 3QIAA 2GA4B 4CHTB 3NBHA 1WD0A 3C46A 4HTHA 4L8JA 2EYFA 4F87A 3U9SA 5J1ZA 4N9TA 5BN5A 2F0DA 1PTOD 1CA5A 1K83B 1OXTA 3ZYYX 3TP8A 2XVSA 1PRTF 1I4PA 2ZXPA 5FO7B 4QB4A 1LT4D 2EVBA 3TMEA 5D14A 2JE6I 3TP7A 1CQVA 2MP1A 4CKBA 3QB3A 4XQNA 3VYUA 1V1PA 2VB2X 4OIJA 1QE6A 2D5DA 2AUKA 2J4XA 3NHHA 5IGBA 3V96A 4RFBA 1C4QA 4BA1I 1YNJD 2WACA 2JYOA 1V8QA 5JEAJ 4I65A 4K5WA 2ICEC 2QEJC 1O7YA 3SDZA 1H9KA 1SMYD 4KKTA 3GTLB 1JC7A 4CKEA 2B2YC 1DZ1A 1JOOA 1TS2A 4DA2A 5C0XG 1EWCA 3I4LA 1HA6A 1CI3M 3ERQA 1L0YB 2PCFB 1GOZA 3PUZA 2K05A 4PMCA 2L5TA 1H9SB 4QMGA 3I91A 4DN4M 3PUWA 3SK8A 5C5LA 5NUCA 5ELFA 2EJGC 2BOSA 4ZLTF 4HN7A 2AWNA 3P7JA 3GTGB 4DXFA 2I07B 5T1IA 5KYLA 3MFYA 5KNDA 2HCCA 4KN4C 2XNAC 3KK7A 2HDMA 1G8ZD 3S14B 1ICWA 1A6XA 3RMHA 1O78A 2A6ED 3M4OB 3VR3A 3K5MA 2JP1A 1KLGD 3RZDB 5A2QE 1LT5D 2QCPX 2C9OA 1JE4A 4ID6A 4Z9CB 5FK9C 4TRDA 2J7ZA 1I6VC 2NVXB 4CJ2C 5KRUA 1ZXTA 3PO2B 2XSCA 3Q22A 3VYTA 2M9VA 3OIQA 2X6GA 2D9UA 2EYOA 1H9RA 5J39A 1ZYRC 2K01A 5A35A 2IL8A 4LMQD 2IX0A 4CBVA 1PZKD 1E0BA 2G9DA 4WRDA 3TN2A 5HURA 1MBYA 1YNND 3E0JA 5EGTA 5CV4A 4X3SA 1WTQA 2E2DC 1AW7A 5FKAC 1BCPF 2BE5C 2Z8LA 1Y1WB 1LTRD 3CKIB 1HA5A 2PZWA 1I4XA 3MEHA 2K1BA 2IWHA 3PV0A 4RCOA 2F03A 2KJXA 1BR9A 2F0QA 2EJMA 4KJOA 4AYBB 3DUZA 2O2LD 1SJED 2SOBA 4HEDA 3EA6A 2A69D 2N88A 4HSPA 4NMZA 2CW0C 2B39A 3IL8A 3R3OA 2HDLA 2F0WA 3URYA 1JWSD 3A7AB 1DXMA 5KYIA 1EOTA 1NR2A 2EJFC 1EQTA 4B9WA 3T4AC 2H4OA 2NUCA 4KY6A 2NVQB 2EDGA 1FGBD 4BBRB 2F3VA 3SK4A 1R4QB 4C56C 5K36G 2L4NA 4CGYB 2C5CA 4U68A 5DNFA 5M3FB 1IKMA 2KEDA 3HZXA 2IT1A 5CV7A 3PIO3 2Z1CA 4PQXA 2BDOA 3RUZA 1LTAD 2A6HC 5C44B 5JPNC 3NXWA 2JSOA 2RDGA 1IKLA 4QUCA 3FPPA 5J22A 3FEWX 1V43A 1B9NA 1U4MA 3LX0A 2HCIA 5K36H 2DY8A 3MFGA 2YU9B 5M9OA 4H0LC 3MAQA 1DD2A 2N55A 3J80E 3R2IA 4XYQA 2JA7B 1SYFA 2RDHA 3AB9A 1BCPC 1Q1EA 2PO4A 2KOLA 4H44C 4RA8A 1SEBD 1WTOA 5FO8B 2HUGA 4ZQ3A 1RD9D 1XXGA 1HTLD 5EKKA 4UAIA 3A55A 1I6HB 1EY0A 5DEHA 1BF4A 1BBXC 1TWFB 3C1EA 1I3QB 4RAUC 1O7ZA 4HR7B 1D5ZC 2R93B 2D62A 3NTIA 1Q90A 2FHTA 3MZ5A 3D3RA 3W3AA 3H09A 2X69A 2J0TD 3J81E 3NWSA 3E6ZX 4K8JA 5EKLA 4WORA 1SNQA 4KD4A 4R8IA 4EQOA 2K5WA 1WTXA 2K6AA 5JVH3 5BN4A 3QOJA 1LT6D 2M2LA 1B3AA 2RKSA 1QG7A 4C3HG 4WJWA 5JPMC 2EY6A 1ILQA 4XXEA 1EZ8A 5I2YA 3Q23A 3S15B 4LAAA 5JJZA 3V05A 1B53A 5DM63 1HCZA 3ND9A 5CV5A 4DAVA 2K7VA 3K0YA 4ILWA 4OIKA 3VR2A 4J6HA 1TKWB 1HFGA 5FLXE 1GJXA 3CU7A 2R61A 4FO2A 3NBIA 5ELCA 3PUVA 1SBBB 1FNWA 1AP0A 1T5EA 5IIFA 1STGA 3GD7A 3K7AB 4X3UA 3H91A 3NWTA 2XIWA 4C2MB 3SK5A 1ENCA 1DOLA 2IX3A 4IFDI 1TS4A 3S9WA 2DNCA 5COYA 3BVZA 1FYCA 4A3DB 3I8ZA 1ILPA 3NQIA 4HMIA 2B2YA 2RDFA 4KHZA 2IX1A 2PYKA 2WIIB 3BVMA 1B2TA 2NB0A 4C3HB 5HGTA 1PDQA 1SXTA 3OWEB 2NN6H 4DNRB 5C0XJ 4ME5A 2F0GA 4KMUC 4JBWA 3VA5A 3GP7A 4FF1A 5IGCA 1STNA 2EYHA 1ZKOA 2BCOA 2MJ8A 3BDOA 3HEJA 1Y8OB 1GHJA 1ZYRD 3LNNA 4HMJA 1XYIA 4JK1C 4ULLA 4G7ZC 3MXNA 1VMPA 4RGNA 3EVQA 5T1GA 3HOZB 1TY2A 1CA6A 2F3WA 3OHXC 5C4ZA 4IQZA 3S17B 1XX8A 4K5XA 2DNEA 2EPBA 5AFWA 1RTOA 5I9PA 1DCZA 2EZVA 3VR4A 4XIGS 2BE5D 1B50A 2WB1B 2H1EA 2AWOA 3TSSA 3TP6A 4IN3A 1IW7C 5E4WC 4ZRZA 2L12A 1TWHB 5CV9A 3H3VC 1GXDC 5FOBB 3VYRA 3GTMB 1DOKA 1AEXA 3MVVA 3MA2B 1L0XB 2CW0D 4X3KA 2PQEA 2VB3X 1S5FD 1PRTB 5IGEA 3S2HB 1LTBD 4FYDA 5D65A 2QDBA 3HP3A 1JORA 4I7ZC 3TZDA 3PUXA 3JAME 2TMPA 2EYLA 2KHSA 3OOCA 3SK6A 1G2TA 3FMCA 4M1UB 4K2LA 5CBEE 4L6TB 2XRQD 1STAA 3D4WA 2I46A 5C3EB 1QILA 2F0EA 1IYVA 1PTOH 1V1PB 1EU4A 2A6HD 1W6KA 1JCKB 5I6YA 1F9PA 4KY7A 2HQEA 3HOWB 1D1IA 1GUSA 1VMCA 4FNFA 5C3WA 3PIP3 2SEBD 2JEAI 1E2WA 4N9PA 3BYYB 1PTOB 2G9HD 1BO0A 5E1FA 2WAQB 1B4OA 1U4RA 4DXGA 3DXJC 4K2KA 4CJ1B 1TU2B 5C0XH 5CR3A 1BCPD 3EFXD 3KF8A 4HCEA 3BZDB 1EIHA 1F9RA 2DN8A 2LY7A 4J1MA 2AQ1B 4O1NA 1EYDA 1Z6HA 1EZ6A 2NYZD 1WCMB 3EJIA 5C4JB 1IHZA 3HS0C 2F0SA 4XYOA 3R93A 1EEFD 2MHVA 2D2CC 3SE0A 3OPOA 2WKDA 4KI0A 1A3UA 3HKZB 1D5XC 3S1MB 1EL0A 3MXGA 1NCVA 3GQBA 3NK9A 1S5ED 1ENAA 3IFTA 3DM1A 3FDTA 5DAUA 4QUFA 1TR5A 1XWEA 2Q8RE 3KLSA 3KBGA 4K14A 4RH6A 2OT2A 1WVLA 2E74C 5KEEA 2ENBA 5BN3A 4PNYA 1U4PA 1STEA 2EYMA 5EPLA 2XWBB 1R9TB 4OHJA 5IODA 5ELEA 1EEID 1TQOA 4FF4A 1E2ZA 2FINB 1QWYA 1LT3D 4L63B 3MXPA 1U9RA 3A8JE 2R3ZA 4MN3A 2TSSA 3CQZB 1CTMA 1LTTD 5KNBA 4QIWB 1O7LA 4U673 2O5JC 1SSOA 1LTGD 1CZWA 2V4DA 1E2VA 1CK1A 3RLFA 1I4QA 3NTHA 2B2WC 4A3JB 2EYJA 4H13C 3X3MA 4XQJA 2CVRA 3CHBD 4Y7NB 1SFOB 3M7GA 2F4IA 3Q0AA 4A3GB 5CGKA 1NAPA 4XTCS 1STBA 4G7HC 4J8QA 4FVMA 2LS01 1XTCD 1HUNA 3GO5A 3KBXA 3LWEA 3X3NA 4KJNA 1UUPA 1I50B 4G4KA 2PNRC 3NQTA 1RODA 3K5OA 4FF2A 2A68C 2OF1A 1SYGA 4NW2A 5EPJA 5EQ0A 5EJWA 3K6OA 2Z4HA 1H9JA 3L9AX 3DEOA 1ENFA 1PYWD 3KUPA 4OO1I 4RHSA 2E2IB 1X3PA 1D1KA 4DGZA 1AZQA 5CBAE 4RGOS 2JEBI 5TSSA 3J7YW 1FD7D 3VR6A 1B44D 3M85A 2L9HA 3FVQA 5LL6S 1JOQA 1F9SA 2K04A 1TWAB 2DY7A 3PO3B 4IALA 2K5DA 5KGUA 2SNMA 5D3IB 3ONAB 2MPMA 3I4NB 1X3QA 4IUQA 3KLRA 3I3CA 4RGMA 2PW7A 4ZAIA 1LO5D 4EQNA 2JA8B 1VF7A 1IW7D 2EY5A 2F0FA 4IFDG 4F88A 3DWAA 1WTWA 2Q8TA 1KNAA 2CHBD 1KABA 2F0LA 3J80L 1SYBA 2KVMA 1OO9B 1A3TA 1Y8PB 2Z4IA 2WV6D 3HOXB 3QO2A 2K5QA 4DK1A 4HCSA 3SXHA 2MGSA 1K8OA 5F2DA 3VA7A 1A2TA 1S5CD 1NSNS 2MUYA 2OEOA 2Y0SB 4EGVA 4KD3A 1G291 2NVYB 2EY2A 5K5PA 1JQYD 5IT9E 4K6LA 4C3JG 3HGBA 3VYSA 3C1FA 2YYZA 3J81L 4IZ8A 4RWSC 1FNVA 5M5YB 3K5LA 1Z7TA 1EY6A 1NUCA 4V0BA 2LFNA 5ISRA 1S5BD 1EFID 4NP5A 4BS9A 1MGSA 4RKLA 4KHVA 1SDFA 1KDCA 1STHA 2EYPA 1T5XD 3L7ZC 2AUJD 2AQ2B 1EU3A 4FXGC 2JXMB 5M3MB 4TKOB 2NVTB 1G91A 3K57A 1KDAA 2KA7A 1TIID 4QCLA 3D6WA 3MHBA 3ITPA 5JAVA 5EPKA 3TBIB 1JR0D 5FLXL 3A56A 5C3XA 1SJHD 3IAYA 1VF5C 2L1BA 4RHRA 4C3JB 4ZUJA 2F0JA 4NKLA 3GTOB 3T16A 2RBMA 1SNCA 2XWJB 3TP5A 4OL7A 4A3MB 4UDUC 4DAYA 2VNUD 2K28A 2KECA 1LLRD 4IUTA 4R9WA 1BNZA 1S5DD 1U4LA 3OIPA 3BS1A 1C48A 2IPKD 1CQFA 2F0PA 4KK7A 2E76C 1F9QA 2B8FA 1JWMD 1PZID 3OWFA 4RGTA 4ABNA 4C3IG 3CRLC 1LABA 3WOEA 3D4DA 3Q24A 4PMBA 2L11A 1GUGA 3E5SA 3I73A 1RHPA 2NBFA 4BBSB 1GUTA 3D8GA 1B9MA 1QCBD 3IKJA 5M5XB 1SYDA 4BY1B 3FKIB 5EKIA 2B2VC 2E2HB 1BQQT 4BA2I 2B2TC 4RCNA 3QJYA 1LACA 2NN6I 4XT3B 1M8AA 1HQRD 4IUNA 3BDCA 5IGFA 1G2SA 4DF7A 1EY9A 4IUVA 1QNUA 4BY7B 1IYUA 3A8KE 3LWUA 3SHLA 3IFDA 4P2CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D6E C;  2XRS D;  4RHR A;  1LTA D;  1LT6 D;  1D5X C;  1L0Y B;  2WV6 D;  1GOZ A;  3DWQ A;  1JWU D;  1KTK A;  1SE4 A;  1FNU A;  3BVG A;  1RDP D;  1SE2 A;  2RDG A;  1PTO C;  1XTC D;  1PZJ D;  3W2D A;  1AW7 A;  5FKA C;  1BCP F;  2Z8L A;  3KLS X;  1LTR D;  1S5E D;  3V05 A;  2NTS A;  1HA5 A;  4L6T B;  2XRQ D;  4TSS A;  1ET9 A;  4RGN A;  1S5C D;  1UUP A;  1I4X A;  1LTI D;  5ELF A;  4UDU C;  1TS5 A;  1V1O A;  4RCO A;  1QIL A;  1AN8 A;  1PTO H;  1TY2 A;  4RH6 A;  3MFG A;  5ELD A;  4DXF A;  1V1P B;  3R8B A;  1EU4 A;  2R61 A;  1F77 A;  1LLR D;  3R2I A;  1JCK B;  1JQY D;  1I4G A;  1SJE D;  2O2L D;  4K6L A;  4BWG B;  1MD2 D;  1S5D D;  2XNA C;  1STE A;  3EA6 A;  1ENF A;  2IPK D;  1PYW D;  2RDH A;  5ELC A;  1BCP C;  1SBB B;  1FNW A;  3DWP A;  1RCV D;  4OHJ A;  4RHS A;  1G8Z D;  1PTO D;  5ELE A;  2SEB D;  1EEI D;  1SE3 A;  1FNV A;  4RGO S;  1SEB D;  2XN9 C;  1JWM D;  5TSS A;  3BYY B;  1PTO B;  1PZI D;  1LT3 D;  3MC0 B;  2G9H D;  3TSS A;  4RGT A;  1PRT F;  1PRT C;  4L63 B;  1D5M C;  1KLG D;  1RD9 D;  1I4P A;  1S5B D;  1HTL D;  1XXG A;  1EFI D;  5D3D A;  3URY A;  1FD7 D;  1BXT A;  1JWS D;  1LT4 D;  1LT5 D;  1TS4 A;  3BVZ A;  1B44 D;  4DXG A;  1CQV A;  2TSS A;  3R2T A;  1B1Z A;  2NTT A;  1HXY D;  1DJR D;  1LTT D;  1T5X D;  4Z9C B;  5FK9 C;  1V1P A;  1D5Z C;  1DYQ A;  2QIL A;  1FGB D;  2AQ2 B;  1BCP D;  1EU3 A;  2ICI A;  3EFX D;  1CT1 D;  3BZD B;  2IJ0 A;  2J4X A;  3BVM A;  5D3I B;  4RFB A;  4ZYS A;  1LTG D;  1L0X B;  1BCP B;  1M4V A;  4RGM A;  4C56 C;  2AQ1 B;  1ET6 A;  4O1N A;  1PRT D;  1LO5 D;  2QEJ C;  1CHQ D;  5I4D A;  1SXT A;  1CK1 A;  1HQR D;  1I4Q A;  1PTO F;  1S5F D;  1TS3 A;  3OWE B;  1TY0 A;  1PRT B;  1PZK D;  1RF2 D;  3SEB A;  3DWA A;  1LTB D;  1TS2 A;  3CHB D;  1JR0 D;  1LTS D;  1KLU D;  5ELB A;  1EWC A;  2CHB D;  1SJH D;  2AQ3 B;  3O13 A;  3GP7 A;  1UNS A;  1EEF D;  1I4R A;  1I4H A;  3BYT B;  1ESF A;  1CHP D; 
#chains in the Genus database with same CATH topology
 1G6Z A;  2O4X A;  4MIU A;  3L2P A;  1PH6 A;  2X6L A;  3BDL A;  2R7Z H;  1FNU A;  3FP9 A;  2R7F A;  2QKI C;  2PW5 A;  3N6R A;  4KY5 A;  4C3I B;  2NTS A;  1IL2 A;  2UXD L;  3E9I A;  5JVG 3;  1SYE A;  1VDZ A;  2L15 A;  4ME3 A;  2NZO A;  4TQU S;  3PUY A;  1II3 A;  4NDX A;  5JOB A;  2R7Z B;  2F0K A;  3K58 A;  2F0N A;  4M8A A;  3R8B A;  2RSO A;  2JA5 H;  5C3E H;  2ZJP A;  2RCF A;  1VQI A;  2HHH Q;  4E6I A;  4ZKC B;  2KCN A;  2CQA A;  3S1Q H;  4H7B A;  4B3R Q;  3HOU H;  1PMR A;  1O80 A;  1TVX A;  4DR3 L;  3HOW H;  3I4M G;  4DR1 L;  2L55 A;  2SDF A;  1BDO A;  1K8G A;  2OTJ A;  2JA5 B;  1H9S A;  4YWM A;  3RN5 A;  4X62 L;  4Q5V A;  3S2D H;  4DKA C;  5D3D A;  2EY1 A;  3AMU A;  4DV3 L;  1UE7 A;  4RMF A;  2A68 D;  3C3L A;  5DM7 3;  2B2W A;  2BA1 A;  1Z47 A;  1WD1 A;  5C4X G;  2R92 G;  3S1Q B;  3W1B A;  1QOH A;  1S72 A;  3HOU B;  3HOY G;  4ZUI A;  1HXY D;  2EE1 A;  3JAM L;  4LFA L;  1VQG A;  1G6P A;  2RQX A;  2IJ0 A;  1UE5 A;  3S2D B;  1DM0 B;  3S16 H;  1EY5 A;  4F8M A;  1CKN B;  4HAE A;  1EWI A;  1QJO A;  1K3R A;  1VQC A;  3UI2 A;  2KCT A;  4ODG A;  1PTO F;  1HR0 L;  1J8I A;  3P20 A;  5JJI A;  3OSO A;  1VQK A;  4KN7 C;  1MSG A;  5ELB A;  4DV7 L;  3S16 B;  3O13 A;  2Q2T A;  3PF4 A;  5C4J H;  2XN9 C;  3I70 A;  1ESF A;  1VQA A;  2VL6 A;  2F0U A;  3DEP A;  1EY4 A;  2ZTD A;  4G57 A;  1IXR A;  4FXD A;  1FGU A;  1RKN A;  3CCM A;  5C4X H;  3CP0 A;  3DWQ A;  2FFK B;  3MWY W;  1JWU D;  3VR5 A;  2FJ2 A;  4OGQ C;  3HOY H;  2Y0S E;  3I4M B;  3NTK A;  2UXD Q;  4LJZ C;  1CM9 A;  4JCV E;  1H95 A;  4C1N K;  2A73 B;  3MTS A;  1TS5 A;  4DV0 L;  4PG3 A;  2PZT A;  2K03 A;  2E2J H;  2B63 G;  5C4X B;  2UXB L;  2R92 B;  3E0E A;  3HOY B;  1QVF A;  4CDC C;  4BWG B;  4XDX A;  1JB3 A;  1MD2 D;  4IUP A;  1I94 Q;  5M5W B;  2RCN A;  1BBW A;  4AYB G;  3DWP A;  1XPO A;  1K8M A;  1PXU A;  1RCV D;  2EQS A;  4LUO A;  1EY8 A;  3J80 i;  1L1O B;  2QW7 A;  3LGJ A;  3NPP A;  4TVA B;  4DR3 Q;  2VW9 A;  2KEE A;  2E2J B;  5A2Q L;  1WJJ A;  2F0M A;  2OXP A;  1A0I A;  1R9T H;  3MC0 B;  1CFM A;  1H9M A;  4GZY C;  1PRT C;  1D5M C;  1EY7 A;  1K3B C;  4X62 Q;  3M7N A;  3TEH B;  4HSV A;  1PH3 A;  5IGG A;  4DK0 A;  4DV3 Q;  3CCL A;  4L5S A;  4R4O A;  4R8N A;  3K5N A;  1HR0 W;  1HUM A;  2E75 C;  1SMX A;  1AFP A;  1OTC A;  1SND A;  2WFW A;  4CDE C;  5C0X I;  4FF3 A;  1B1Z A;  3GTJ H;  3KF6 A;  2ES2 A;  4WFN 3;  1HZA A;  5FO9 B;  4OO1 G;  1CT1 D;  3CQZ H;  4X6A H;  3J7A F;  1V9P A;  4K6D A;  4ZYS A;  1Q3L A;  1BCP B;  2B8G A;  3B6Y A;  3HOV G;  4IOA A;  2ZXO A;  4BBR G;  3U9O A;  1OXX K;  1HNX L;  2YV5 A;  2JA6 G;  4IFD J;  1HQM C;  5JEA G;  1HR0 Q;  3GTJ B;  4A3L H;  4IUR A;  3I90 A;  3UDF A;  2EXZ A;  5CC4 A;  2OWO A;  1F2M A;  3GV6 A;  3J81 i;  3SEB A;  4A3E G;  1K28 A;  4N8F A;  1Q1B A;  1KNE A;  2FMC A;  3BG3 A;  1FL0 A;  2MQH A;  2VXW A;  3V2T A;  3BU2 A;  4DV7 Q;  3GTK B;  2B63 B;  1XMQ Q;  3CAM A;  3WWV A;  1RTN A;  4DNT B;  2AQ3 B;  1GUW A;  4JI5 L;  2I0Q A;  1YZ6 A;  1KDB A;  3OMG A;  1U5K A;  4JI4 L;  3PIO A;  4Y7N H;  3T51 B;  1GUN A;  2K5H A;  4GNX B;  2Q8I B;  2XRS D;  1QB5 D;  2FXQ A;  1Q7Y C;  3DMU A;  1MI2 A;  2HQL A;  2WIN B;  2PMZ B;  4A3G H;  4EQP A;  3ULP A;  4NPS A;  1SE4 A;  1SE2 A;  1PTO C;  2F0H A;  3H94 A;  2O5I C;  2B2U A;  2GVB A;  2CKZ B;  1HHV A;  2BA0 A;  1X32 A;  4OO1 H;  1J9O A;  4TSS A;  1R4P B;  2KQ3 A;  4DFA A;  1UEA B;  3I72 A;  3RZO H;  2P5Z X;  2AMC B;  4LK1 C;  4B08 A;  4IUU A;  4BXX G;  3TZU A;  4A93 G;  5ELD A;  1EIG A;  2JA6 H;  5JEA H;  3CCQ A;  4HJA A;  1HTP A;  3PCO B;  1GHK A;  2OCE A;  1X9N A;  3AU7 A;  4A3E H;  1LTL A;  2K32 A;  1PFB A;  3RZO B;  1JJG A;  1YNJ C;  1WTR A;  1QZH A;  3HOV B;  1PYS B;  5LMU Q;  2CH4 A;  5GAG C;  4I7A A;  1Y8N B;  3OMC A;  4ZKB B;  1MJC A;  2ASB A;  2JA6 B;  2K33 A;  4FP5 D;  3NE5 B;  3DHQ A;  1SMY C;  3UDI A;  1BXT A;  4A3E B;  5E3F A;  1UWV A;  2RF4 A;  4JW0 A;  1KAA A;  4LFB L;  2WB1 E;  1Y1V G;  5C4H A;  3GTQ H;  3A7L A;  1L0W A;  3T53 B;  3SVM A;  3NUC A;  2ZJR A;  1SNO A;  1EIF A;  4S3S A;  1DYQ A;  2QIL A;  4L5T A;  3EIV A;  3N52 A;  3AFQ A;  1BKB A;  2VUM G;  1VQ9 A;  1MSH A;  5I9O A;  4BXX H;  1LV9 A;  3QOL A;  4JVZ A;  1TT2 A;  2R93 G;  1M4V A;  3K0X A;  3PO3 H;  1Q12 A;  3NP8 A;  4G7O C;  1ML0 D;  2ZXR A;  3QG1 A;  3GTQ B;  4DUY L;  3D6C A;  1RJT A;  4CKC A;  1TS3 A;  2CQO A;  1YJ9 A;  1IBL Q;  3H6M A;  4PV1 C;  5C5M A;  3G6J B;  3QWN A;  2F0T A;  3M3Y H;  4XQQ A;  2MO0 A;  1AZP A;  1QVC A;  2RSN A;  2A8V A;  1YNX A;  4A3F G;  4P71 A;  1X3G A;  4PZ7 A;  4JI5 Q;  4A93 B;  5CV8 A;  1JIC A;  4JI4 Q;  4EVO A;  3M4Y A;  3HG9 A;  4GN3 B;  1I4H A;  1STY A;  4IPG A;  5I6W A;  2KHI A;  3C2P A;  3A8I E;  1PLF A;  2RA4 A;  1DON A;  1BOS A;  1W6J A;  1X3E A;  3M3Y B;  2N3S A;  1Q8I A;  1SNM A;  3FPU B;  1S4Z A;  1XNQ L;  1Y1V H;  5LHY 1;  1KTK A;  4YWL A;  1RDP D;  4KV6 A;  1BUV T;  1VCI A;  2N8N A;  5IP9 G;  1OXS C;  2A6E C;  1E24 A;  5G3L D;  1FR3 A;  5CYU A;  1VQ4 A;  4QF4 A;  1AE2 A;  3ICE A;  3F2B A;  2BDN A;  1IL8 A;  1LTI D;  2R6G A;  1V1O A;  5IWA Q;  3T13 A;  1VQH A;  3F2U A;  3FHW A;  1AN8 A;  2UUA L;  3ZJY C;  1Y1V B;  4A3I G;  4B3T L;  4JI7 Q;  2V1C C;  1F77 A;  1PHJ A;  1ESR A;  3CRK C;  4Q0F A;  3U4Z A;  5IT9 c;  3T1Y Q;  2NVY H;  3D4R A;  4JV5 L;  4OXP A;  5EBC A;  2VUM B;  1D2B A;  4A3F H;  3S1R B;  4UY8 C;  4C3I H;  4A3K G;  1LM0 A;  1SE3 A;  2B2V A;  1EYA A;  1Q86 C;  1TWC H;  4DK3 C;  5CV6 A;  4PMW A;  5I2X A;  2VS1 A;  3MXU A;  4K5V A;  2B2T A;  1WTV A;  1WTP A;  1HNW Q;  5H1S E;  1N34 Q;  3S1N H;  2I5M X;  4GLX A;  1EQV A;  1VQD A;  2KBN A;  1JOK A;  4GOP A;  4A3F B;  4IFD H;  1NR4 A;  3R2T A;  2OQ0 A;  5COR A;  2HIX A;  4OEL B;  4O42 A;  1SAP A;  1SNP A;  2Q2I A;  1DJR D;  1TWC B;  2B2U C;  4B3S L;  3D31 A;  1LYL A;  4RKB A;  2Q2H A;  1YNN C;  3P75 A;  5E4X A;  2PI2 E;  5EBD A;  2ICI A;  1C8C A;  2D0O A;  1B8A A;  3S1N B;  1HFN A;  1F2L A;  1RIP A;  1PH8 A;  4P72 A;  3K59 A;  4A3I H;  4V19 0;  1ZEQ X;  3EQL C;  4L5R C;  1PH1 A;  4KKU A;  1CHQ D;  5I4D A;  1QNK A;  1A15 A;  2EOT A;  5KIX A;  5G3L F;  3T56 B;  1TY0 A;  3RD4 A;  1RF2 D;  1PFM A;  3KJO A;  1VQP A;  4N8X 1;  4GKJ L;  4A3K H;  4NB3 A;  5LL6 X;  1LTS D;  2K14 A;  4B9X A;  4KTA A;  4A3I B;  1IBM L;  3CD6 A;  4YCU A;  5IT9 L;  3GV3 A;  1HRJ A;  1D6E C;  2LMC B;  5IGD A;  2WP8 J;  4X3T A;  4K8I A;  1XNQ Q;  4C1N I;  4A3B G;  1OXU A;  1F2Y A;  2A69 C;  3FRP B;  1QZG A;  1GM5 A;  1DOM A;  2A74 C;  1CZG A;  4A3K B;  3W2D A;  2M00 A;  4LF4 L;  2NN6 G;  4DAM A;  1FVI A;  1E1T A;  2F0O A;  2NWG A;  1TWG H;  1E1O A;  1IYJ B;  3HKZ E;  1A8V A;  4XT1 B;  1A2U A;  5C6A A;  4DR2 L;  1HPC A;  2UUA Q;  1A3V A;  2A5H A;  1EWH A;  3PMF A;  1PFN A;  4A3M H;  4B3T Q;  2PPB C;  4DU9 A;  1OXV A;  1SN8 A;  5IOC A;  3BJU A;  4MHE A;  1N9W A;  5KNC A;  1I4G A;  1SYC A;  4JV5 Q;  2LKV A;  3ND8 A;  1Y69 U;  3L3O C;  1TWG B;  1VQF A;  4F7X A;  3H0G G;  2ID0 A;  4MZ9 A;  4MTN A;  4MTK A;  1UE1 A;  4FXK C;  2ATW A;  4IPC A;  4JI3 L;  3OW2 A;  1VQE A;  3NSW A;  3I55 A;  3J7A V;  2QF7 A;  4A3B H;  2F0I A;  3A54 A;  2A1A A;  3E3X A;  1B7Y B;  1UAP A;  3WOF A;  3KDF B;  2ZT9 C;  2NTT A;  4B3S Q;  4CJ0 B;  4BBS H;  4DAP A;  1VQN A;  2PZU A;  2RVL A;  4OX9 L;  5M5X H;  4A3B B;  1JJC B;  4LF8 L;  3WDN A;  3TDQ A;  2KCC A;  3OW7 A;  2A19 A;  2F1M A;  2E2H H;  1ET6 A;  1PRT D;  2KUM A;  3A5U A;  1Q46 A;  4JI2 Q;  2F0V A;  4A76 A;  3E9H A;  4YIJ A;  3GTP H;  2SNS A;  4DAY B;  2NZ1 D;  4LF9 Q;  3H0G H;  1PYB A;  5FLM G;  5CMD A;  2WKC A;  1KLU D;  2PMZ E;  2KCM A;  1IBM Q;  3HRZ C;  3Q6S A;  1UNS A;  1I4R A;  3ERO A;  3BYT B;  2IHE A;  3RLN A;  1CHP D;  3P1H A;  1GUO A;  1F2Z A;  4ZK9 B;  2FMM A;  3GTP B;  3SR1 A;  3G7L A;  3BVG A;  1EYC A;  3EBE A;  3H0G B;  1ONL A;  4LF4 Q;  1PZJ D;  1VQL A;  4KKS A;  3F8T A;  2L0C A;  3KLS X;  1KIX A;  1SE8 A;  1K0R A;  4YY3 L;  1ET9 A;  2IW3 A;  3QIA A;  4LWC A;  2GA4 B;  3F2C A;  1K83 H;  4CHT B;  4GKK Q;  3NBH A;  3RNU A;  3TRZ A;  3GDE A;  2QA4 A;  1CKM A;  1WD0 A;  1HJP A;  3C46 A;  3A74 A;  4HTH A;  4L8J A;  2EYF A;  1VQO A;  1Y14 B;  4R4I A;  4F87 A;  3U9S A;  5J1Z A;  5FLM H;  4N9T A;  5BN5 A;  2F0D A;  1PTO D;  4X64 Q;  1CA5 A;  4DR6 L;  1OXT A;  1K83 B;  3ZYY X;  4DV1 Q;  3PIP A;  3TP8 A;  3PSI A;  2XVS A;  1PRT F;  2VQF Q;  1I4P A;  1VQ7 A;  2RHS B;  2ZXP A;  5FO7 B;  4QB4 A;  1LT4 D;  3L0O A;  2EVB A;  4HIO A;  3TME A;  5D14 A;  2JE6 I;  1LUZ A;  4MNO A;  3TP7 A;  1N8R C;  1CQV A;  2MP1 A;  5DLQ E;  4CKB A;  3QB3 A;  4XQN A;  3VYU A;  1V1P A;  1ASZ A;  3GTL H;  2VB2 X;  4OX9 Q;  4OIJ A;  1I5F A;  4RG1 A;  1QE6 A;  2D5D A;  2AUK A;  2J4X A;  3NHH A;  5IGB A;  1HZC A;  3V96 A;  4RFB A;  1C4Q A;  4LF8 Q;  4BA1 I;  1YNJ D;  2WAC A;  2JYO A;  4A3C G;  3Q8D A;  1V8Q A;  5JEA J;  4HIK A;  4I65 A;  4K5W A;  2ICE C;  2QEJ C;  1O7Y A;  3SDZ A;  2MFI A;  3UDG A;  2UUB L;  1H9K A;  5IYD G;  1SMY D;  4KKT A;  3GTL B;  1JC7 A;  2AHO B;  4O2D A;  4CKE A;  2B2Y C;  1DZ1 A;  1JOO A;  1TS2 A;  2KEN A;  4DA2 A;  5C0X G;  1WCM G;  1EWC A;  3I4L A;  1X6O A;  3K7U C;  3NEN A;  1KC8 C;  5L37 A;  4DV6 Q;  3PO2 G;  1HA6 A;  1CI3 M;  3ERQ A;  1L0Y B;  2PCF B;  4EX5 A;  1GOZ A;  3PUZ A;  2K05 A;  5IYC G;  4PMC A;  1WI5 A;  2L5T A;  3CMA A;  2VZA A;  4X65 Q;  2EIF A;  1H9S B;  4QMG A;  3I91 A;  4DN4 M;  1XMO L;  3PUW A;  3SK8 A;  3I4M H;  5C5L A;  5NUC A;  5ELF A;  2EJG C;  2BOS A;  3A5Z B;  4ZLT F;  3S14 H;  4A3C H;  4HN7 A;  2AWN A;  4LFC L;  3M4O H;  3P7J A;  3GTG B;  4DXF A;  2I07 B;  5T1I A;  3CCR A;  5IYD H;  3RN2 A;  5KYL A;  2VY3 A;  3MFY A;  5KND A;  1PH7 A;  1T9H A;  2HCC A;  4KN4 C;  2R92 H;  2XNA C;  2B3G A;  2ZTE A;  2PQA A;  3KK7 A;  4DR6 Q;  2HDM A;  1G8Z D;  3S14 B;  1ICW A;  3K8A A;  4P75 A;  5M5W H;  1A6X A;  3RMH A;  1O78 A;  2A6E D;  3M4O B;  4HJ7 A;  1Y1W G;  3VR3 A;  3K5M A;  2JP1 A;  2C35 B;  1KLG D;  3PO2 H;  3RZD B;  4GN5 A;  5A2Q E;  1LT5 D;  2QCP X;  2C9O A;  1KL9 A;  5ELO A;  1JE4 A;  3KF8 B;  4NXM L;  4ID6 A;  3S24 A;  1J6Q A;  4POF A;  2CH4 W;  3BZK A;  4WJ3 M;  4Z9C B;  1Q8K A;  4TRD A;  5FK9 C;  2UUC L;  2J7Z A;  1I6V C;  2NVX B;  2IY5 B;  4CJ2 C;  5KRU A;  1ZXT A;  1ASY A;  3PO2 B;  2XSC A;  1UEB A;  4X66 L;  3VYT A;  4CDF C;  3Q22 A;  4DR1 Q;  3OTO L;  2M9V A;  4LUZ A;  3OIQ A;  2X6G A;  1N36 L;  2D9U A;  2EYO A;  1H9R A;  5J39 A;  1ZYR C;  2K01 A;  3SGI A;  5A35 A;  2IL8 A;  4LMQ D;  2IX0 A;  3I7F A;  4CBV A;  1PZK D;  4LFA Q;  1E0B A;  1XPU A;  2G9D A;  1W3S A;  4WRD A;  3TN2 A;  2JK8 A;  1YHQ A;  4DV4 L;  1GO3 E;  5HUR A;  1N33 L;  2I5H A;  1MBY A;  1YNN D;  3GTK H;  2B63 H;  3CC4 A;  3E0J A;  5EGT A;  1P8L A;  1WYD A;  5JJL A;  5CV4 A;  2KHJ A;  4X3S A;  1WTQ A;  1C9O A;  2E2D C;  1AW7 A;  5FKA C;  1BCP F;  2BE5 C;  1B3Q A;  2Z8L A;  1Q82 C;  3G71 A;  1Y1W B;  1LTR D;  3J81 j;  1XMO Q;  3CKI B;  1HA5 A;  5M3F G;  1YBY A;  2PZW A;  2PNH A;  1KRS A;  5E7N A;  1I4X A;  3MEH A;  2IHF A;  2K1B A;  2IWH A;  4JYA L;  3PV0 A;  4RCO A;  2F03 A;  2KJX A;  1BR9 A;  3CCJ A;  3CXC A;  1P16 A;  2F0Q A;  2EJM A;  4KJO A;  3KF6 B;  4AYB B;  3DUZ A;  1GKH A;  2O2L D;  1SJE D;  4YWK A;  2SOB A;  4IPD A;  4HED A;  3EA6 A;  4JBK A;  2A69 D;  5C44 G;  3IRB A;  3HFZ B;  1JT8 A;  2N88 A;  1CSQ A;  3OYY A;  4HSP A;  4NMZ A;  2CW0 C;  2OQK A;  4DV0 Q;  2B39 A;  2MNA A;  3HOV H;  4BBR H;  2UXB Q;  3IL8 A;  3R3O A;  2HDL A;  2F0W A;  3URY A;  1JWS D;  1FJG L;  3A7A B;  4CDD C;  1DXM A;  5KYI A;  1EOT A;  4DNI A;  1NR2 A;  2EJF C;  1EQT A;  4B9W A;  3T4A C;  1AE3 A;  2H4O A;  5LMN L;  2NUC A;  4KY6 A;  4DR7 L;  5M3F H;  2NVQ B;  3CCU A;  2JA7 G;  3K80 C;  4R1J A;  2EDG A;  1FGB D;  4X66 Q;  5ELN A;  4BBR B;  3HKS A;  2F3V A;  1YVC A;  3SK4 A;  1R4Q B;  4C56 C;  4K0K L;  1MKH A;  5EAY A;  5K36 G;  2L4N A;  4CGY B;  2C5C A;  5J3B A;  3KOJ A;  4U68 A;  5DNF A;  5M3F B;  2N49 A;  1IKM A;  2GN5 A;  2KED A;  3HZX A;  1IBK L;  2IT1 A;  5CV7 A;  3PIO 3;  4DV4 Q;  1N33 Q;  3J7A 5;  4JOI C;  4HID A;  2Z1C A;  4PQX A;  2BDO A;  3RUZ A;  1LTA D;  1X3F A;  2A6H C;  4A93 H;  4HIM A;  1L1O C;  1HNX Q;  2Z6B A;  5C44 B;  5JPN C;  3NXW A;  2JSO A;  2RDG A;  1IKL A;  1VQ6 A;  2XTI A;  4IPH A;  4DR5 L;  5FJ8 G;  2JA7 H;  4QUC A;  3FPP A;  5J22 A;  3FEW X;  1V43 A;  1K8A C;  1YHA A;  1KRT A;  1B9N A;  2JQO A;  1U4M A;  4JYA Q;  2YTY A;  3LX0 A;  1UE6 A;  4HJ5 A;  2D0P A;  2HCI A;  5K36 H;  2DY8 A;  3MFG A;  2YU9 B;  5M9O A;  4H0L C;  3MAQ A;  1DD2 A;  2N55 A;  3J80 E;  3R2I A;  4L5Q A;  4XYQ A;  2JA7 B;  1SYF A;  2RDH A;  3AB9 A;  5LMN W;  1BCP C;  4UPA A;  1VQ8 A;  1I6H H;  1Q1E A;  2N78 A;  2PO4 A;  2KOL A;  1TWF H;  4H44 C;  4RA8 A;  1SEB D;  1I3Q H;  1NTG A;  2VUM H;  3S1R H;  1WTO A;  2R93 H;  4GS3 A;  5FO8 B;  2HUG A;  4ZQ3 A;  1RD9 D;  1XXG A;  1HTL D;  1FJG Q;  2K52 A;  5EKK A;  3DLL A;  4JBM A;  4UAI A;  3A55 A;  4Y52 H;  1KXL A;  5GRO A;  1I6H B;  1EY0 A;  5DEH A;  1BF4 A;  3TQY A;  4GNX C;  5FJ8 H;  1BBX C;  1TWF B;  1JE5 A;  3C1E A;  3TS2 A;  1I3Q B;  1B70 B;  4RAU C;  1O7Z A;  4HR7 B;  1D5Z C;  4NXN L;  2R93 B;  2D62 A;  1C0A A;  3NTI A;  1Q90 A;  2K5V A;  2FHT A;  3MZ5 A;  3D3R A;  5IYB G;  3W3A A;  3H09 A;  2X69 A;  4K0K Q;  2J0T D;  3J81 E;  5AJ3 L;  4LFB Q;  3NWS A;  1IBK Q;  5IP9 H;  2H5X A;  4PZ8 A;  3ULL A;  4JI0 L;  4A3D G;  3E6Z X;  3PF5 A;  4K8J A;  5EKL A;  4WOR A;  1SNQ A;  4KD4 A;  3S15 H;  4R8I A;  4EQO A;  4R4Q A;  2K5W A;  1WTX A;  2K6A A;  5JVH 3;  5BN4 A;  3QOJ A;  1LT6 D;  5FLX c;  2M2L A;  1B3A A;  2RKS A;  1YJW A;  3H3V H;  4DUY Q;  5IP7 G;  1KD1 C;  4DV2 L;  1QG7 A;  4EQ5 A;  4C3H G;  4WJW A;  4KHP L;  5JPM C;  2EY6 A;  1ILQ A;  4DR5 Q;  4XXE A;  1EZ8 A;  5I2Y A;  3Q23 A;  3S15 B;  1U0L A;  1VQJ A;  4LAA A;  4DUZ L;  5JJZ A;  3V05 A;  1B53 A;  5DM6 3;  1KQS A;  1HCZ A;  3ND9 A;  5CV5 A;  4DAV A;  2K7V A;  4IOC A;  2HIV A;  3K0Y A;  4GOP B;  1J5E L;  4ILW A;  1QUQ B;  1N32 L;  3K7A H;  1XPR A;  4OIK A;  3VR2 A;  4J6H A;  4J15 A;  4LF7 L;  1TKW B;  1HFG A;  5FLX E;  1GJX A;  3CU7 A;  2R61 A;  5GQO A;  4OWW B;  4FO2 A;  4C2M H;  1YIJ A;  2OTL A;  3NBI A;  3CC2 A;  4HJ8 A;  5ELC A;  4A3D H;  3PUV A;  1SBB B;  1FNW A;  1AP0 A;  3K81 C;  1GVP A;  1T5E A;  1D8L A;  1STG A;  3GD7 A;  5IIF A;  3K7A B;  2Z6K C;  1NBW A;  4X3U A;  3H91 A;  3U50 C;  3NWT A;  4JI8 L;  2XIW A;  4C2M B;  2BH8 A;  3SK5 A;  3G4S A;  1ENC A;  1DOL A;  2IX3 A;  4IFD I;  1TXY A;  1TS4 A;  3S9W A;  2DNC A;  5COY A;  3BVZ A;  1FYC A;  1MJE A;  3HOZ G;  4A3D B;  3I8Z A;  1ILP A;  3NQI A;  1EFW A;  4HMI A;  2B2Y A;  2MO1 A;  4JI1 L;  4NXN Q;  2RDF A;  4KHZ A;  2BH2 A;  2IX1 A;  4LF5 L;  5BR8 L;  2PYK A;  2WII B;  3BVM A;  4WJ4 A;  1B2T A;  4OWT B;  4BY1 G;  2NB0 A;  4C3H B;  5HGT A;  2WB1 G;  2AKW B;  2ZTC A;  1PDQ A;  1SXT A;  3G6E A;  1PA6 A;  3OWE B;  2NN6 H;  4KLK A;  4DNR B;  5C0X J;  4ME5 A;  4JI0 Q;  2F0G A;  4JC0 A;  4KMU C;  4JBW A;  4GLV B;  2QGQ A;  3VA5 A;  1S3O A;  3M9B A;  3GP7 A;  4YHH L;  4FF1 A;  3CCV A;  5IGC A;  2LXJ A;  1STN A;  2EYH A;  4BY7 G;  3U58 A;  1ZKO A;  2BCO A;  1HZB A;  3HOZ H;  3PQI A;  4DV2 Q;  2MJ8 A;  3BDO A;  4LUV A;  4KHP Q;  3HEJ A;  1Y8O B;  1GHJ A;  1ZYR D;  3LNN A;  5GAH C;  4HMJ A;  1XYI A;  4JK1 C;  4GKJ Q;  4ULL A;  3S17 H;  4B3R L;  1BVS A;  4G7Z C;  4AIM A;  3MXN A;  1VMP A;  4RGN A;  4AYB E;  2UU9 L;  1J5E Q;  3EVQ A;  3W5O A;  5T1G A;  3HOZ B;  2K5N A;  1TY2 A;  1CA6 A;  1NNX A;  3U4V A;  1YJN A;  2F52 A;  3AEV A;  2F3W A;  3OHX C;  5C4Z A;  4IQZ A;  3S17 B;  1XX8 A;  4K5X A;  2DNE A;  2EPB A;  5AFW A;  1RTO A;  1TWH H;  5I9P A;  1DCZ A;  2EZV A;  3VR4 A;  4XIG S;  2BE5 D;  1B50 A;  2WB1 B;  2H1E A;  2AWO A;  3TSS A;  4DR2 Q;  2UXC L;  2QDL A;  3TP6 A;  4IN3 A;  1IW7 C;  5E4W C;  4ZRZ A;  4UP7 A;  2L12 A;  1TWH B;  5C3E G;  1CSP A;  3I2Z A;  5CV9 A;  4H02 A;  3H3V C;  3H15 A;  1GXD C;  2VQE L;  5FOB B;  4JI1 Q;  3VYR A;  3T1H L;  1PH9 A;  3GTM B;  1SRO A;  3S2H H;  4LF5 Q;  5BR8 Q;  3HOU G;  1DOK A;  1E7Z A;  4LF6 L;  1BBU A;  3HOW G;  1AEX A;  3MVV A;  4JI3 Q;  1RL2 A;  5HGQ A;  3JAM c;  4UHV A;  3MA2 B;  1L0X B;  1WTH A;  2CW0 D;  4X3K A;  3STB C;  2PQE A;  3I56 A;  2VB3 X;  1S5F D;  2WAQ G;  1PRT B;  5IGE A;  3S2H B;  3NBH B;  1LTB D;  4FYD A;  5D65 A;  2QDB A;  4DV5 L;  3HP3 A;  1JOR A;  4I7Z C;  4YHH Q;  3TZD A;  3D0F A;  3PUX A;  5HY6 A;  3JAM E;  3TRE A;  2TMP A;  1WFQ A;  2EYL A;  2KHS A;  4JG2 A;  1DGS A;  3OOC A;  3SK6 A;  2K50 A;  1I94 L;  1G2T A;  3FMC A;  1CKN A;  2YTV A;  4M1U B;  4K2L A;  5CBE E;  2PI2 A;  4L6T B;  2XRQ D;  2UU9 Q;  1STA A;  3D4W A;  1K73 C;  2I46 A;  5C3E B;  1QIL A;  1KAW A;  2F0E A;  1IYV A;  1V1Q A;  1PTO H;  1E3P A;  1V1P B;  1EU4 A;  5GAD C;  2A6H D;  2CWP A;  1W6K A;  1JCK B;  1EQQ A;  3ERS X;  5I6Y A;  3GTG H;  1F9P A;  4KY7 A;  2HQE A;  3HOW B;  1D1I A;  3HKZ G;  4ZCK A;  1GUS A;  1VMC A;  4FNF A;  5C3W A;  2HD3 A;  3PIP 3;  1NMG A;  2SEB D;  2JEA I;  1E2W A;  4YY3 Q;  4N9P A;  3F2D A;  3BYY B;  1PTO B;  2UXC Q;  2G9H D;  3G48 A;  1BO0 A;  5E1F A;  2WAQ B;  2K75 A;  4JPB W;  1B4O A;  1U4R A;  4DXG A;  3DXJ C;  3RZD H;  4K2K A;  2VQE Q;  3KJP A;  4DR4 L;  3T1H Q;  4CJ1 B;  1TU2 B;  4APV A;  5C0X H;  1WCM H;  4LF6 Q;  5CR3 A;  1XMQ L;  1BCP D;  3EFX D;  3KF8 A;  1VQB A;  3BZD B;  4HCE A;  4JOI A;  1VQM A;  4R4C A;  3KFU A;  4POG A;  1VS0 A;  3W1G A;  1EIH A;  2NVX H;  1F9R A;  2DN8 A;  2LY7 A;  1WOC A;  1L1O A;  4J1M A;  4IJL A;  2AQ1 B;  4O1N A;  2K4K A;  1EYD A;  1Z6H A;  1EZ6 A;  5IYC H;  1M1K C;  2NYZ D;  1WCM B;  3S1M H;  3EJI A;  2ALY B;  5C4J B;  1IHZ A;  4DV5 Q;  3HS0 C;  2F0S A;  4XYO A;  3R93 A;  1EEF D;  2MHV A;  1X65 A;  2D2C C;  3SE0 A;  3OPO A;  2WKD A;  2PQA B;  4KI0 A;  1A3U A;  3HKZ B;  1D5X C;  3S1M B;  2UUB Q;  1EL0 A;  4A3L G;  3MXG A;  1NCV A;  3CME A;  3GQB A;  3NK9 A;  1S5E D;  3UE0 A;  1ENA A;  3IFT A;  3DM1 A;  4A3J G;  3FDT A;  5LMU L;  1MIU A;  5DAU A;  3A0J A;  1Y1W H;  4QUF A;  1TR5 A;  1XWE A;  2Q8R E;  3KLS A;  3KBG A;  4JI6 L;  4K14 A;  4RH6 A;  2OT2 A;  1WVL A;  2E74 C;  5KEE A;  2ENB A;  5BN3 A;  4GLA C;  4A3G G;  4PNY A;  1MHW C;  1U4P A;  4GNX A;  1STE A;  2EYM A;  5EPL A;  2Z0S A;  1A63 A;  2XWB B;  3CF5 A;  1R9T B;  4OHJ A;  5IOD A;  5ELE A;  1EEI D;  1EQR A;  1TQO A;  2E5L L;  4FF4 A;  3CCS A;  1E2Z A;  2FIN B;  1QWY A;  1LT3 D;  1M90 C;  4L63 B;  4LFC Q;  3MXP A;  1U9R A;  3A8J E;  2CWA A;  3NEM A;  2R3Z A;  3BZC A;  4DR4 Q;  1IBL L;  1YHB A;  4MN3 A;  1QVG A;  2TSS A;  3CQZ B;  1CTM A;  1XNR L;  1LTT D;  3CPF A;  5KNB A;  4A3J H;  4QIW B;  1O7L A;  4QL5 A;  1PFS A;  4U67 3;  2O5J C;  1VQ5 A;  1SSO A;  2CCZ A;  1SFO H;  1EUJ A;  2NVQ H;  1LTG D;  1CZW A;  2V4D A;  2NZH A;  1E2V A;  1PH4 A;  1GD7 A;  1CK1 A;  3RLF A;  1I4Q A;  3NTH A;  4NXM Q;  2B2W C;  4A3J B;  2F3I A;  2EYJ A;  4H13 C;  2I5L X;  2ZJQ A;  3X3M A;  4XQJ A;  2CVR A;  1HZ9 A;  2HT1 A;  3CHB D;  5GAE C;  4Y7N B;  1YIT A;  1SFO B;  3M7G A;  2UUC Q;  2F4I A;  1XTD A;  3Q0A A;  1YEZ A;  5IWA L;  3OTO Q;  4A3G B;  5CGK A;  1PVO A;  1NAP A;  4R4T A;  4XTC S;  3PO3 G;  1N36 Q;  1I50 H;  1NMF A;  1C7Y A;  1STB A;  4G7H C;  3CPW A;  4JI7 L;  4YCW A;  3I4N G;  4QY7 A;  4QQB X;  1W2B A;  4J8Q A;  4FVM A;  2EXD A;  2LS0 1;  3T1Y L;  1XTC D;  1HUN A;  3GO5 A;  2G5D A;  5C44 H;  3KBX A;  2JA8 G;  1X56 A;  2Z6K A;  3LWE A;  3X3N A;  4KJN A;  3DM3 A;  1UUP A;  3RR5 A;  4B3M L;  3CW2 C;  1I50 B;  2E2I H;  4G4K A;  2PNR C;  3NQT A;  1ROD A;  3K5O A;  4JI6 Q;  4FF2 A;  2A68 C;  2OF1 A;  4AQY L;  2GVA A;  2R7D A;  1HNW L;  1SYG A;  4YCV A;  1N34 L;  4NW2 A;  5JJK A;  5EPJ A;  5EQ0 A;  5EJW A;  3K6O A;  3J80 c;  2Z4H A;  3KLW A;  1H9J A;  3L9A X;  2YU9 H;  3DEO A;  1ENF A;  1PYW D;  2B29 A;  4AH6 A;  3KUP A;  3HOX G;  4OO1 I;  4RHS A;  2E5L Q;  1O7I A;  2E2I B;  1X3P A;  1D1K A;  4DGZ A;  1AZQ A;  5CBA E;  4RGO S;  2JEB I;  5TSS A;  1TWA H;  3J7Y W;  3I4N H;  1FD7 D;  2Y0S G;  3VR6 A;  2QEX A;  1B44 D;  4JBJ A;  3JC6 6;  1SLJ A;  3M85 A;  2L9H A;  1XNR Q;  3FVQ A;  3M4P A;  2JA8 H;  5LL6 S;  1JOQ A;  1F9S A;  4DPG A;  2K04 A;  1TWA B;  3AFP A;  2DY7 A;  4IO9 A;  3PO3 B;  4IAL A;  1K0S A;  2K5D A;  5KGU A;  2SNM A;  5D3I B;  3ONA B;  2MPM A;  3NEL A;  3I4N B;  1X3Q A;  4IUQ A;  3KLR A;  3I3C A;  4RGM A;  4QGU A;  2JA9 A;  2PW7 A;  4ZAI A;  3J81 c;  1LO5 D;  1Z9F A;  4EQN A;  2JA8 B;  4UP9 A;  1VF7 A;  1IW7 D;  2EY5 A;  2F0F A;  4IFD G;  3HOX H;  4F88 A;  3DWA A;  5LMN Q;  1WTW A;  4DR7 Q;  2Q8T A;  2LSS A;  1KNA A;  2F4V L;  1AH9 A;  3UDX A;  1JMC A;  2CHB D;  1KAB A;  2F0L A;  3AYH B;  3J80 L;  1SYB A;  3CCE A;  2KVM A;  1OO9 B;  1A3T A;  1EYG A;  4UP8 A;  1D7Q A;  1Y8P B;  2ZM6 L;  1E22 A;  2Z4I A;  2WV6 D;  3EN2 A;  5M3M G;  3HOX B;  1K9M C;  4DK6 C;  3QO2 A;  2K5Q A;  1KHI A;  4DK1 A;  3KYH C;  4HCS A;  3SXH A;  2MGS A;  3STB D;  1K8O A;  5F2D A;  1IZ6 A;  3VA7 A;  1HNZ L;  1A2T A;  4B3M Q;  1S5C D;  1NSN S;  2MUY A;  2OEO A;  1JB7 A;  4OON A;  2Y0S B;  3F1Z A;  4AQY Q;  4EGV A;  5M5Y H;  4KD3 A;  1G29 1;  2NVY B;  2EY2 A;  5K5P A;  1S40 A;  1NJI C;  1JQY D;  5IT9 E;  4K6L A;  1QUQ A;  4C3J G;  1CKO A;  3HGB A;  3VYS A;  2WAQ E;  3I4O A;  3C1F A;  2YYZ A;  3J81 L;  1Q81 C;  4IZ8 A;  4RWS C;  1FNV A;  5M5Y B;  3K5L A;  1Z7T A;  1EY6 A;  1NUC A;  4V0B A;  3ER0 A;  5IYB H;  2LFN A;  5ISR A;  1S5B D;  4A3M G;  1JJ2 A;  5M3M H;  1EFI D;  2DJF C;  2JJQ A;  4NP5 A;  4P74 A;  4BS9 A;  2NVT H;  2RHQ B;  1MGS A;  4RKL A;  4JI2 L;  4KHV A;  1SDF A;  1KDC A;  3M4Q A;  1STH A;  2EYP A;  4LF9 L;  1T5X D;  3L7Z C;  2XGT A;  2AUJ D;  2AQ2 B;  1EU3 A;  4FXG C;  2JXM B;  2Z9H A;  1X55 A;  5M3M B;  4TKO B;  3TS0 A;  2NVT B;  4A4I A;  1G91 A;  3K57 A;  1KDA A;  2KA7 A;  4OWX B;  4PZ6 A;  1TII D;  2DGY A;  5IP7 H;  4QCL A;  3D6W A;  3MHB A;  3ITP A;  4C3J H;  3JAM i;  5JAV A;  4C3H H;  5EPK A;  3GTO H;  3RLO A;  3ULJ A;  2Q2U A;  2F4V Q;  4BBS G;  3TBI B;  1CUK A;  1JR0 D;  1ICF B;  5FLX L;  1EIY B;  3KDF A;  3A56 A;  5C3X A;  3QR8 A;  1SJH D;  3IAY A;  1VF5 C;  3H3V I;  4ALP A;  4GKK L;  2L1B A;  4RHR A;  4C3J B;  4ZUJ A;  3FKI G;  2ZM6 Q;  2F0J A;  4NKL A;  3GTO B;  2E8G A;  3T16 A;  5AJ3 Q;  3VDY A;  1PH5 A;  1SRU A;  1SNC A;  2LXK A;  2RBM A;  2XWJ B;  3TP5 A;  1HNZ Q;  1NE3 A;  4X64 L;  1SR3 A;  4OL7 A;  4A3M B;  4DV1 L;  4UDU C;  4IJH A;  4A75 A;  1XJV A;  2VQF L;  5IY0 A;  4DAY A;  2VNU D;  1L2F A;  3J7Z C;  2K28 A;  2KEC A;  1LLR D;  4IUT A;  4R9W A;  1X54 A;  1BNZ A;  1S5D D;  1U4L A;  3AQQ A;  2HHH L;  3OIP A;  3BS1 A;  1C48 A;  2IPK D;  1CQF A;  3MEF A;  4DUZ Q;  4LNQ A;  2F0P A;  4KK7 A;  2E76 C;  1A62 A;  4P73 A;  1F9Q A;  2B8F A;  4HJ9 A;  1JWM D;  4LW1 A;  1PZI D;  3CC7 A;  3OWF A;  1HH2 P;  2DJG C;  4RGT A;  4ABN A;  3FKI H;  4C3I G;  4BY1 H;  1N32 Q;  3CRL C;  1LAB A;  3WOE A;  3D4D A;  4LF7 Q;  4O0A A;  3Q24 A;  4PMB A;  2L11 A;  1EOV A;  4QIW E;  1PH2 A;  1GUG A;  3PGZ A;  1PV4 A;  3E5S A;  3I73 A;  5IE8 A;  1RHP A;  2YTX A;  2NBF A;  4BBS B;  1GUT A;  2JN4 A;  2R7Z G;  3D8G A;  1G51 A;  1B9M A;  1QCB D;  1YI2 A;  3IKJ A;  5M5X B;  1SYD A;  4QJF A;  4BY1 B;  3FKI B;  5EKI A;  2B2V C;  2E2H B;  3GTM H;  1NY4 A;  4BY7 H;  1BQQ T;  3UE1 A;  4GN4 B;  4OEM B;  4JI8 Q;  4BA2 I;  2B2T C;  4DV6 L;  4RCN A;  3QJY A;  1LAC A;  3MXN B;  2NN6 I;  2DUD A;  4XT3 B;  1M8A A;  2JA5 G;  1HQR D;  4IUN A;  3BDC A;  5IGF A;  1G2S A;  4GOP C;  2CFM A;  4DF7 A;  1EY9 A;  4X65 L;  4IUV A;  1QNU A;  4FDB A;  4BY7 B;  1IYU A;  3A8K E;  3LWU A;  3SHL A;  3IFD A;  4P2C B; 
#chains in the Genus database with same CATH homology
 1G6Z A;  2O4X A;  4MIU A;  2X6L A;  3BDL A;  1FNU A;  2QKI C;  2PW5 A;  3N6R A;  4KY5 A;  4C3I B;  2NTS A;  5JVG 3;  1SYE A;  1VDZ A;  4TQU S;  3PUY A;  1II3 A;  4NDX A;  5JOB A;  2R7Z B;  2F0K A;  3K58 A;  2F0N A;  4M8A A;  3R8B A;  2RSO A;  4E6I A;  4ZKC B;  2KCN A;  2CQA A;  4H7B A;  1PMR A;  1O80 A;  1TVX A;  2L55 A;  2SDF A;  1BDO A;  2JA5 B;  1H9S A;  4Q5V A;  5D3D A;  2EY1 A;  3AMU A;  2A68 D;  3C3L A;  5DM7 3;  2B2W A;  2BA1 A;  1Z47 A;  1WD1 A;  3S1Q B;  1QOH A;  3HOU B;  4ZUI A;  1HXY D;  2EE1 A;  3JAM L;  2RQX A;  2IJ0 A;  3S2D B;  1DM0 B;  1EY5 A;  4F8M A;  4HAE A;  1QJO A;  3UI2 A;  4ODG A;  1PTO F;  1J8I A;  3P20 A;  3OSO A;  4KN7 C;  1MSG A;  5ELB A;  3S16 B;  3O13 A;  2XN9 C;  3I70 A;  1ESF A;  2F0U A;  3DEP A;  1EY4 A;  4G57 A;  4FXD A;  1RKN A;  3DWQ A;  2FFK B;  3MWY W;  1JWU D;  3VR5 A;  2FJ2 A;  4OGQ C;  3I4M B;  3NTK A;  4LJZ C;  1CM9 A;  4C1N K;  2A73 B;  3MTS A;  1TS5 A;  2PZT A;  2K03 A;  5C4X B;  2R92 B;  3HOY B;  4BWG B;  4XDX A;  1JB3 A;  1MD2 D;  4IUP A;  5M5W B;  3DWP A;  1K8M A;  1PXU A;  1RCV D;  1EY8 A;  3NPP A;  2KEE A;  2E2J B;  5A2Q L;  2F0M A;  2OXP A;  3MC0 B;  1CFM A;  1H9M A;  4GZY C;  1PRT C;  1D5M C;  1EY7 A;  3M7N A;  4HSV A;  5IGG A;  4DK0 A;  4R8N A;  3K5N A;  1HUM A;  2E75 C;  1AFP A;  1SND A;  5C0X I;  4FF3 A;  1B1Z A;  4WFN 3;  5FO9 B;  4OO1 G;  1CT1 D;  3J7A F;  4K6D A;  4ZYS A;  1Q3L A;  1BCP B;  2B8G A;  2ZXO A;  3U9O A;  1OXX K;  4IFD J;  1HQM C;  5JEA G;  3GTJ B;  4IUR A;  3I90 A;  5CC4 A;  2EXZ A;  1F2M A;  3GV6 A;  3SEB A;  1Q1B A;  1KNE A;  2FMC A;  3BG3 A;  2VXW A;  3V2T A;  3GTK B;  2B63 B;  1RTN A;  4DNT B;  2AQ3 B;  1GUW A;  1KDB A;  3OMG A;  3T51 B;  1GUN A;  2Q8I B;  2XRS D;  1QB5 D;  3DMU A;  1MI2 A;  2WIN B;  2PMZ B;  4EQP A;  1SE4 A;  1SE2 A;  1PTO C;  2F0H A;  3H94 A;  2O5I C;  2B2U A;  1HHV A;  2BA0 A;  1X32 A;  4OO1 H;  1J9O A;  4TSS A;  1R4P B;  2KQ3 A;  4DFA A;  1UEA B;  3I72 A;  4LK1 C;  4B08 A;  4IUU A;  3TZU A;  5ELD A;  1EIG A;  5JEA H;  1HTP A;  1GHK A;  3AU7 A;  2K32 A;  1PFB A;  3RZO B;  1YNJ C;  1WTR A;  3HOV B;  1Y8N B;  3OMC A;  4ZKB B;  2JA6 B;  2K33 A;  4FP5 D;  3NE5 B;  3DHQ A;  1SMY C;  1BXT A;  4A3E B;  5E3F A;  1KAA A;  5C4H A;  3A7L A;  3T53 B;  3SVM A;  3NUC A;  1SNO A;  4S3S A;  1DYQ A;  2QIL A;  3N52 A;  1MSH A;  5I9O A;  1LV9 A;  3QOL A;  1TT2 A;  1M4V A;  1Q12 A;  3NP8 A;  4G7O C;  1ML0 D;  2ZXR A;  3QG1 A;  3GTQ B;  3D6C A;  1RJT A;  4CKC A;  1TS3 A;  3H6M A;  4PV1 C;  5C5M A;  3G6J B;  3QWN A;  2F0T A;  4XQQ A;  1AZP A;  2RSN A;  4A93 B;  5CV8 A;  1JIC A;  4EVO A;  3M4Y A;  3HG9 A;  1I4H A;  1STY A;  5I6W A;  3C2P A;  3A8I E;  1PLF A;  2RA4 A;  1DON A;  1BOS A;  1W6J A;  3M3Y B;  1Q8I A;  1SNM A;  3FPU B;  1S4Z A;  5LHY 1;  1KTK A;  1RDP D;  4KV6 A;  1BUV T;  1VCI A;  1OXS C;  2A6E C;  5G3L D;  1FR3 A;  5CYU A;  4QF4 A;  2BDN A;  1IL8 A;  1LTI D;  2R6G A;  1V1O A;  3T13 A;  3F2U A;  1AN8 A;  1Y1V B;  1F77 A;  1ESR A;  3CRK C;  4Q0F A;  3D4R A;  5EBC A;  2VUM B;  1D2B A;  3S1R B;  1SE3 A;  2B2V A;  1EYA A;  5CV6 A;  4PMW A;  5I2X A;  3MXU A;  4K5V A;  1WTV A;  2B2T A;  1WTP A;  1EQV A;  1JOK A;  4A3F B;  4IFD H;  1NR4 A;  3R2T A;  5COR A;  4O42 A;  1SAP A;  1SNP A;  1DJR D;  1TWC B;  2B2U C;  3D31 A;  4RKB A;  5E4X A;  1YNN C;  3P75 A;  5EBD A;  2ICI A;  1C8C A;  3S1N B;  1HFN A;  1F2L A;  3K59 A;  4V19 0;  1ZEQ X;  3EQL C;  4KKU A;  1CHQ D;  5I4D A;  1QNK A;  1A15 A;  2EOT A;  5KIX A;  5G3L F;  3T56 B;  1TY0 A;  3RD4 A;  1RF2 D;  1PFM A;  5LL6 X;  1LTS D;  4B9X A;  4KTA A;  4A3I B;  5IT9 L;  3GV3 A;  1HRJ A;  1D6E C;  2LMC B;  5IGD A;  2WP8 J;  4X3T A;  4K8I A;  4C1N I;  1OXU A;  1F2Y A;  2A69 C;  3FRP B;  1DOM A;  2A74 C;  1CZG A;  4A3K B;  3W2D A;  2M00 A;  2NN6 G;  2F0O A;  2NWG A;  4XT1 B;  1A2U A;  5C6A A;  1HPC A;  1A3V A;  2A5H A;  1EWH A;  3PMF A;  1PFN A;  2PPB C;  4DU9 A;  1OXV A;  5IOC A;  4MHE A;  5KNC A;  1I4G A;  1SYC A;  2LKV A;  3ND8 A;  1Y69 U;  3L3O C;  1TWG B;  4F7X A;  2ID0 A;  4FXK C;  3NSW A;  3J7A V;  2QF7 A;  2F0I A;  3A54 A;  1UAP A;  3WOF A;  2ZT9 C;  2NTT A;  4CJ0 B;  4DAP A;  2PZU A;  2RVL A;  4A3B B;  3WDN A;  3TDQ A;  2KCC A;  3OW7 A;  2F1M A;  1ET6 A;  1PRT D;  2KUM A;  2F0V A;  4YIJ A;  2SNS A;  2NZ1 D;  5CMD A;  2WKC A;  1KLU D;  3HRZ C;  3Q6S A;  1UNS A;  1I4R A;  3ERO A;  3BYT B;  1CHP D;  3P1H A;  1GUO A;  1F2Z A;  4ZK9 B;  2FMM A;  3GTP B;  3SR1 A;  3G7L A;  3BVG A;  1EYC A;  3H0G B;  1ONL A;  1PZJ D;  4KKS A;  2L0C A;  3KLS X;  1ET9 A;  2IW3 A;  3QIA A;  2GA4 B;  4CHT B;  3NBH A;  1WD0 A;  3C46 A;  4HTH A;  4L8J A;  2EYF A;  4F87 A;  3U9S A;  5J1Z A;  4N9T A;  5BN5 A;  2F0D A;  1PTO D;  1CA5 A;  1K83 B;  1OXT A;  3ZYY X;  3TP8 A;  2XVS A;  1PRT F;  1I4P A;  2ZXP A;  5FO7 B;  4QB4 A;  1LT4 D;  2EVB A;  3TME A;  5D14 A;  2JE6 I;  3TP7 A;  1CQV A;  2MP1 A;  4CKB A;  3QB3 A;  4XQN A;  3VYU A;  1V1P A;  2VB2 X;  4OIJ A;  1QE6 A;  2D5D A;  2AUK A;  2J4X A;  3NHH A;  5IGB A;  3V96 A;  4RFB A;  1C4Q A;  4BA1 I;  1YNJ D;  2WAC A;  2JYO A;  1V8Q A;  5JEA J;  4I65 A;  4K5W A;  2ICE C;  2QEJ C;  1O7Y A;  3SDZ A;  1H9K A;  1SMY D;  4KKT A;  3GTL B;  1JC7 A;  4CKE A;  2B2Y C;  1DZ1 A;  1JOO A;  1TS2 A;  4DA2 A;  5C0X G;  1EWC A;  3I4L A;  1HA6 A;  1CI3 M;  3ERQ A;  1L0Y B;  2PCF B;  1GOZ A;  3PUZ A;  2K05 A;  4PMC A;  2L5T A;  1H9S B;  4QMG A;  3I91 A;  4DN4 M;  3PUW A;  3SK8 A;  5C5L A;  5NUC A;  5ELF A;  2EJG C;  2BOS A;  4ZLT F;  4HN7 A;  2AWN A;  3P7J A;  3GTG B;  4DXF A;  2I07 B;  5T1I A;  5KYL A;  3MFY A;  5KND A;  2HCC A;  4KN4 C;  2XNA C;  3KK7 A;  2HDM A;  1G8Z D;  3S14 B;  1ICW A;  1A6X A;  3RMH A;  1O78 A;  2A6E D;  3M4O B;  3VR3 A;  3K5M A;  2JP1 A;  1KLG D;  3RZD B;  5A2Q E;  1LT5 D;  2QCP X;  2C9O A;  1JE4 A;  4ID6 A;  4Z9C B;  5FK9 C;  4TRD A;  2J7Z A;  1I6V C;  2NVX B;  4CJ2 C;  5KRU A;  1ZXT A;  3PO2 B;  2XSC A;  3Q22 A;  3VYT A;  2M9V A;  3OIQ A;  2X6G A;  2D9U A;  2EYO A;  1H9R A;  5J39 A;  1ZYR C;  2K01 A;  5A35 A;  2IL8 A;  4LMQ D;  2IX0 A;  4CBV A;  1PZK D;  1E0B A;  2G9D A;  4WRD A;  3TN2 A;  5HUR A;  1MBY A;  1YNN D;  3E0J A;  5EGT A;  5CV4 A;  4X3S A;  1WTQ A;  2E2D C;  1AW7 A;  5FKA C;  1BCP F;  2BE5 C;  2Z8L A;  1Y1W B;  1LTR D;  3CKI B;  1HA5 A;  2PZW A;  1I4X A;  3MEH A;  2K1B A;  2IWH A;  3PV0 A;  4RCO A;  2F03 A;  2KJX A;  1BR9 A;  2F0Q A;  2EJM A;  4KJO A;  4AYB B;  3DUZ A;  2O2L D;  1SJE D;  2SOB A;  4HED A;  3EA6 A;  2A69 D;  2N88 A;  4HSP A;  4NMZ A;  2CW0 C;  2B39 A;  3IL8 A;  3R3O A;  2HDL A;  2F0W A;  3URY A;  1JWS D;  3A7A B;  1DXM A;  5KYI A;  1EOT A;  1NR2 A;  2EJF C;  1EQT A;  4B9W A;  3T4A C;  2H4O A;  2NUC A;  4KY6 A;  2NVQ B;  2EDG A;  1FGB D;  4BBR B;  2F3V A;  3SK4 A;  1R4Q B;  4C56 C;  5K36 G;  2L4N A;  4CGY B;  2C5C A;  4U68 A;  5DNF A;  5M3F B;  1IKM A;  2KED A;  3HZX A;  2IT1 A;  5CV7 A;  3PIO 3;  2Z1C A;  4PQX A;  2BDO A;  3RUZ A;  1LTA D;  2A6H C;  5C44 B;  5JPN C;  3NXW A;  2JSO A;  2RDG A;  1IKL A;  4QUC A;  3FPP A;  5J22 A;  3FEW X;  1V43 A;  1B9N A;  1U4M A;  3LX0 A;  2HCI A;  5K36 H;  2DY8 A;  3MFG A;  2YU9 B;  5M9O A;  4H0L C;  3MAQ A;  1DD2 A;  2N55 A;  3J80 E;  3R2I A;  4XYQ A;  2JA7 B;  1SYF A;  2RDH A;  3AB9 A;  1BCP C;  1Q1E A;  2PO4 A;  2KOL A;  4H44 C;  4RA8 A;  1SEB D;  1WTO A;  5FO8 B;  2HUG A;  4ZQ3 A;  1RD9 D;  1XXG A;  1HTL D;  5EKK A;  4UAI A;  3A55 A;  1I6H B;  1EY0 A;  5DEH A;  1BF4 A;  1BBX C;  1TWF B;  3C1E A;  1I3Q B;  4RAU C;  1O7Z A;  4HR7 B;  1D5Z C;  2R93 B;  2D62 A;  3NTI A;  1Q90 A;  2FHT A;  3MZ5 A;  3D3R A;  3W3A A;  3H09 A;  2X69 A;  2J0T D;  3J81 E;  3NWS A;  3E6Z X;  4K8J A;  5EKL A;  4WOR A;  1SNQ A;  4KD4 A;  4R8I A;  4EQO A;  2K5W A;  1WTX A;  2K6A A;  5JVH 3;  5BN4 A;  3QOJ A;  1LT6 D;  2M2L A;  1B3A A;  2RKS A;  1QG7 A;  4C3H G;  4WJW A;  5JPM C;  2EY6 A;  1ILQ A;  4XXE A;  1EZ8 A;  5I2Y A;  3Q23 A;  3S15 B;  4LAA A;  5JJZ A;  3V05 A;  1B53 A;  5DM6 3;  1HCZ A;  3ND9 A;  5CV5 A;  4DAV A;  2K7V A;  3K0Y A;  4ILW A;  4OIK A;  3VR2 A;  4J6H A;  1TKW B;  1HFG A;  5FLX E;  1GJX A;  3CU7 A;  2R61 A;  4FO2 A;  3NBI A;  5ELC A;  3PUV A;  1SBB B;  1FNW A;  1AP0 A;  1T5E A;  5IIF A;  1STG A;  3GD7 A;  3K7A B;  4X3U A;  3H91 A;  3NWT A;  2XIW A;  4C2M B;  3SK5 A;  1ENC A;  1DOL A;  2IX3 A;  4IFD I;  1TS4 A;  3S9W A;  2DNC A;  5COY A;  3BVZ A;  1FYC A;  4A3D B;  3I8Z A;  1ILP A;  3NQI A;  4HMI A;  2B2Y A;  2RDF A;  4KHZ A;  2IX1 A;  2PYK A;  2WII B;  3BVM A;  1B2T A;  2NB0 A;  4C3H B;  5HGT A;  1PDQ A;  1SXT A;  3OWE B;  2NN6 H;  4DNR B;  5C0X J;  4ME5 A;  2F0G A;  4KMU C;  4JBW A;  3VA5 A;  3GP7 A;  4FF1 A;  5IGC A;  1STN A;  2EYH A;  1ZKO A;  2BCO A;  2MJ8 A;  3BDO A;  3HEJ A;  1Y8O B;  1GHJ A;  1ZYR D;  3LNN A;  4HMJ A;  1XYI A;  4JK1 C;  4ULL A;  4G7Z C;  3MXN A;  1VMP A;  4RGN A;  3EVQ A;  5T1G A;  3HOZ B;  1TY2 A;  1CA6 A;  2F3W A;  3OHX C;  5C4Z A;  4IQZ A;  3S17 B;  1XX8 A;  4K5X A;  2DNE A;  2EPB A;  5AFW A;  1RTO A;  5I9P A;  1DCZ A;  2EZV A;  3VR4 A;  4XIG S;  2BE5 D;  1B50 A;  2WB1 B;  2H1E A;  2AWO A;  3TSS A;  3TP6 A;  4IN3 A;  1IW7 C;  5E4W C;  4ZRZ A;  2L12 A;  1TWH B;  5CV9 A;  3H3V C;  1GXD C;  5FOB B;  3VYR A;  3GTM B;  1DOK A;  1AEX A;  3MVV A;  3MA2 B;  1L0X B;  2CW0 D;  4X3K A;  2PQE A;  2VB3 X;  1S5F D;  1PRT B;  5IGE A;  3S2H B;  1LTB D;  4FYD A;  5D65 A;  2QDB A;  3HP3 A;  1JOR A;  4I7Z C;  3TZD A;  3PUX A;  3JAM E;  2TMP A;  2EYL A;  2KHS A;  3OOC A;  3SK6 A;  1G2T A;  3FMC A;  4M1U B;  4K2L A;  5CBE E;  4L6T B;  2XRQ D;  1STA A;  3D4W A;  2I46 A;  5C3E B;  1QIL A;  2F0E A;  1IYV A;  1PTO H;  1V1P B;  1EU4 A;  2A6H D;  1W6K A;  1JCK B;  5I6Y A;  1F9P A;  4KY7 A;  2HQE A;  3HOW B;  1D1I A;  1GUS A;  1VMC A;  4FNF A;  5C3W A;  3PIP 3;  2SEB D;  2JEA I;  1E2W A;  4N9P A;  3BYY B;  1PTO B;  2G9H D;  1BO0 A;  5E1F A;  2WAQ B;  1B4O A;  1U4R A;  4DXG A;  3DXJ C;  4K2K A;  4CJ1 B;  1TU2 B;  5C0X H;  5CR3 A;  1BCP D;  3EFX D;  3KF8 A;  4HCE A;  3BZD B;  1EIH A;  1F9R A;  2DN8 A;  2LY7 A;  4J1M A;  2AQ1 B;  4O1N A;  1EYD A;  1Z6H A;  1EZ6 A;  2NYZ D;  1WCM B;  3EJI A;  5C4J B;  1IHZ A;  3HS0 C;  2F0S A;  4XYO A;  3R93 A;  1EEF D;  2MHV A;  2D2C C;  3SE0 A;  3OPO A;  2WKD A;  4KI0 A;  1A3U A;  3HKZ B;  1D5X C;  3S1M B;  1EL0 A;  3MXG A;  1NCV A;  3GQB A;  3NK9 A;  1S5E D;  1ENA A;  3IFT A;  3DM1 A;  3FDT A;  5DAU A;  4QUF A;  1TR5 A;  1XWE A;  2Q8R E;  3KLS A;  3KBG A;  4K14 A;  4RH6 A;  2OT2 A;  1WVL A;  2E74 C;  5KEE A;  2ENB A;  5BN3 A;  4PNY A;  1U4P A;  1STE A;  2EYM A;  5EPL A;  2XWB B;  1R9T B;  4OHJ A;  5IOD A;  5ELE A;  1EEI D;  1TQO A;  4FF4 A;  1E2Z A;  2FIN B;  1QWY A;  1LT3 D;  4L63 B;  3MXP A;  1U9R A;  3A8J E;  2R3Z A;  4MN3 A;  2TSS A;  3CQZ B;  1CTM A;  1LTT D;  5KNB A;  4QIW B;  1O7L A;  4U67 3;  2O5J C;  1SSO A;  1LTG D;  1CZW A;  2V4D A;  1E2V A;  1CK1 A;  3RLF A;  1I4Q A;  3NTH A;  2B2W C;  4A3J B;  2EYJ A;  4H13 C;  3X3M A;  4XQJ A;  2CVR A;  3CHB D;  4Y7N B;  1SFO B;  3M7G A;  2F4I A;  3Q0A A;  4A3G B;  5CGK A;  1NAP A;  4XTC S;  1STB A;  4G7H C;  4J8Q A;  4FVM A;  2LS0 1;  1XTC D;  1HUN A;  3GO5 A;  3KBX A;  3LWE A;  3X3N A;  4KJN A;  1UUP A;  1I50 B;  4G4K A;  2PNR C;  3NQT A;  1ROD A;  3K5O A;  4FF2 A;  2A68 C;  2OF1 A;  1SYG A;  4NW2 A;  5EPJ A;  5EQ0 A;  5EJW A;  3K6O A;  2Z4H A;  1H9J A;  3L9A X;  3DEO A;  1ENF A;  1PYW D;  3KUP A;  4OO1 I;  4RHS A;  2E2I B;  1X3P A;  1D1K A;  4DGZ A;  1AZQ A;  5CBA E;  4RGO S;  2JEB I;  5TSS A;  3J7Y W;  1FD7 D;  3VR6 A;  1B44 D;  3M85 A;  2L9H A;  3FVQ A;  5LL6 S;  1JOQ A;  1F9S A;  2K04 A;  1TWA B;  2DY7 A;  3PO3 B;  4IAL A;  2K5D A;  5KGU A;  2SNM A;  5D3I B;  3ONA B;  2MPM A;  3I4N B;  1X3Q A;  4IUQ A;  3KLR A;  3I3C A;  4RGM A;  2PW7 A;  4ZAI A;  1LO5 D;  4EQN A;  2JA8 B;  1VF7 A;  1IW7 D;  2EY5 A;  2F0F A;  4IFD G;  4F88 A;  3DWA A;  1WTW A;  2Q8T A;  1KNA A;  2CHB D;  1KAB A;  2F0L A;  3J80 L;  1SYB A;  2KVM A;  1OO9 B;  1A3T A;  1Y8P B;  2Z4I A;  2WV6 D;  3HOX B;  3QO2 A;  2K5Q A;  4DK1 A;  4HCS A;  3SXH A;  2MGS A;  1K8O A;  5F2D A;  3VA7 A;  1A2T A;  1S5C D;  1NSN S;  2MUY A;  2OEO A;  2Y0S B;  4EGV A;  4KD3 A;  1G29 1;  2NVY B;  2EY2 A;  5K5P A;  1JQY D;  5IT9 E;  4K6L A;  4C3J G;  3HGB A;  3VYS A;  3C1F A;  2YYZ A;  3J81 L;  4IZ8 A;  4RWS C;  1FNV A;  5M5Y B;  3K5L A;  1Z7T A;  1EY6 A;  1NUC A;  4V0B A;  2LFN A;  5ISR A;  1S5B D;  1EFI D;  4NP5 A;  4BS9 A;  1MGS A;  4RKL A;  4KHV A;  1SDF A;  1KDC A;  1STH A;  2EYP A;  1T5X D;  3L7Z C;  2AUJ D;  2AQ2 B;  1EU3 A;  4FXG C;  2JXM B;  5M3M B;  4TKO B;  2NVT B;  1G91 A;  3K57 A;  1KDA A;  2KA7 A;  1TII D;  4QCL A;  3D6W A;  3MHB A;  3ITP A;  5JAV A;  5EPK A;  3TBI B;  1JR0 D;  5FLX L;  3A56 A;  5C3X A;  1SJH D;  3IAY A;  1VF5 C;  2L1B A;  4RHR A;  4C3J B;  4ZUJ A;  2F0J A;  4NKL A;  3GTO B;  3T16 A;  2RBM A;  1SNC A;  2XWJ B;  3TP5 A;  4OL7 A;  4A3M B;  4UDU C;  4DAY A;  2VNU D;  2K28 A;  2KEC A;  1LLR D;  4IUT A;  4R9W A;  1BNZ A;  1S5D D;  1U4L A;  3OIP A;  3BS1 A;  1C48 A;  2IPK D;  1CQF A;  2F0P A;  4KK7 A;  2E76 C;  1F9Q A;  2B8F A;  1JWM D;  1PZI D;  3OWF A;  4RGT A;  4ABN A;  4C3I G;  3CRL C;  1LAB A;  3WOE A;  3D4D A;  3Q24 A;  4PMB A;  2L11 A;  1GUG A;  3E5S A;  3I73 A;  1RHP A;  2NBF A;  4BBS B;  1GUT A;  3D8G A;  1B9M A;  1QCB D;  3IKJ A;  5M5X B;  1SYD A;  4BY1 B;  3FKI B;  5EKI A;  2B2V C;  2E2H B;  1BQQ T;  4BA2 I;  2B2T C;  4RCN A;  3QJY A;  1LAC A;  2NN6 I;  4XT3 B;  1M8A A;  1HQR D;  4IUN A;  3BDC A;  5IGF A;  1G2S A;  4DF7 A;  1EY9 A;  4IUV A;  1QNU A;  4BY7 B;  1IYU A;  3A8K E;  3LWU A;  3SHL A;  3IFD A;  4P2C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...