1PZRA

Structure of fused docking domains from the erythromycin polyketide synthase (debs), a model for the interaction between debs2 and debs3: the b domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
ASDDELFSMLDQRFGGGEDLLMSGDNGMTEEKLRRYLKRTVTELDSVTARLREVEHRAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Erythronolide synthase
publication title The structure of docking domains in modular polyketide synthases.
pubmed doi rcsb
source organism Saccharopolyspora erythraea
molecule tags Transferase
total genus 13
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature ec 2.3.1.94: 6-deoxyerythronolide-B synthase.
pdb deposition date 2003-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.20 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1pzrA00
1PZRA
chains in the Genus database with same CATH superfamily
2Y2MA 3WA9B 1Q9CA 3EPHA 2CV5D 5CPJB 4J8XD 5B24D 1P3LC 4J8UC 4J8UA 1P3LA 1P34D 1U35C 1U35A 4DRBA 2Y2KA 5B2JD 4YM6C 4YM6A 3WAAD 1TAFA 5DNNA 3X1UD 3MGRD 4LD9C 3AZHB 3VH5W 5DNMC 5DNMA 3EG5B 5AV9B 1F66B 3REIC 3AZJC 3AZJA 1WWIA 3C1BB 5CP6C 3FDDA 5CP6A 4EO5B 3WTPD 1KX4B 5BS7C 5BS7A 1P3ID 5AV8B 4UPKA 2PYOB 5AV5A 1P3KD 5B0YB 4KGCA 3REKB 5GT0D 5JRGB 3B6GB 5B40D 1ZLAB 3AN2D 1KX3C 1KX3A 1W2EA 3A6ND 1BH8B 2NQBC 2NQBA 2YFWB 3LELD 2AROC 2AROA 4AWLB 4KUDD 3NQJA 5E5AB 2F8NH 2CWEA 3MGQD 5AV6B 3AZFC 2RIQA 3KUYD 1M18C 5B32B 3LZ0A 3LZ0C 1M18A 5C3IB 2JE5A 2XD5A 2HIOB 3REIB 3MGPB 2JSSA 3AV1D 1ID3C 1ID3A 5GT3D 4ZUXD 3W98A 3X1SD 3KWQC 3KWQA 4J8UB 3W97D 5B1LC 1U35B 5AVBD 3TU4A 3TU4C 4H9PB 3LJAC 3LJAA 4YM6B 5AVCB 2BG1A 5DNNB 5B0ZD 5DNMB 1M1AD 3AFAD 3KXBD 3AV2A 3AV2C 3AZJB 5B2ID 5CP6B 3O62D 3MGSD 2UWXA 1PZRA 4H9QA 5BT1C 4WU8C 4WU8A 3AZLD 4XUJC 4XUJA 2NZDA 5AV5B 2NZDC 5B33D 4KGCB 3REJC 3REJA 1P3GD 1S32A 1KX3B 3R45A 5B24C 5B1MD 1P3PA 2NQBB 5B31D 3WTPE 3UTBA 2Y2LA 2AROB 5FUGA 3AZNA 1TZYD 3NQUA 3NQJB 3WAAC 3WAAA 3X1UC 3X1UA 3MGRC 3MGRA 3B0CT 2XD1A 1P3MD 5F99D 1M18B 3LZ0B 1T3UA 2Y2HA 1P3OD 1HQ3C 1HQ3A 3EPKA 3WTPC 3WTPA 3AZGD 1ID3B 1JFIA 5B31G 1H3OA 3W98B 2L5AA 3KWQB 4Z5TA 5JA4A 2YFVA 1KX5D 1AOIA 3TU4B 2F8NK 1P3BC 3LJAB 1P3BA 5CPID 4G92B 2FJ7B 4KUDC 5GSUA 3B0CW 3AV2B 4KUDA 3AZID 3MGQC 3MGQA 4H9QB 2DQNC 3KUYC 1P3AD 2F8NB 4XUJB 2NZDB 3AL0C 2ZY2A 3AV1C 3AV1A 2BYMA 3REJB 1F66D 5CPKD 2DF4C 5GT3C 5GT3A 4Z66C 4Z66A 1S32B 4J8VD 5BNXA 3X1SA 3X1SC 3R45B 3C1CD 4LD9A 1P3PB 5CPJD 4NE6A 3W97C 4ZBJC 3UTBB 5FUGB 5AVBC 5AVBA 3AZNB 3NQUB 4JJND 3AZMD 3WAAB 2G5HC 3X1VC 3X1VA 3B6FD 4WNNA 4XZQC 4XZQA 2JCHA 1M1AC 1M19B 3AFAC 4CSRA 3KXBC 3KXBA 3AFAA 2BYKA 4H9SC 4H9SA 5B2IC 5B2IA 3AZHD 1N1JA 4HGAB 5AV9D 3MGSC 3MGSA 1HQ3B 3KSYA 1JFIB 5AY8C 2Y2IA 1H3OB 5AY8A 3C1BD 3AZLC 3MVDD 5B33C 3AZKC 3AZKA 2Y2OA 4Z5TB 1KX4D 5JA4B 5G49A 3UTAD 4WU9B 3B0BA 1AOIB 2ZM5A 5JRGD 3AZEA 3AZEC 1P3BB 3WKJC 3REHD 3WKJA 3B6GD 3VH6A 1ZLAD 3AZFA 2VQRA 3W99D 1P3FC 1P3FA 1TZYC 1TZYA 2IO5C 5GSUB 4KUDB 5BO0A 4UUZA 1P3MC 3MGQB 4H9RA 1P3MA 4NE3A 4E44A 5AV6D 3LZ1D 3RELD 1P3LB 1P3OC 2BYMB 4DRAA 5B1LA 5B32D 2HIOD 3REID 2Y2QA 3MGPD 3AZGC 5GT3B 3VH6T 4Z66B 2Y2JA 5BNXB 1TAFB 3X1SB 4LD9B 1KX5C 1KX5A 4J8WD 3H0RC 1EQZD 5AVBB 3B0DC 4J8UD 3AYWC 3AYWA 1ULYA 3X1VB 5BNVA 4WNNB 4XZQB 5AVCD 5B32G 5DNND 4G91C 4CSRB 3AFAB 3KXBB 1P3GC 2BYKB 3F6TA 1P3GA 5B2IB 2W8SA 3MGSB 2CV5C 2CV5A 4R8PD 5AY8B 5CP6D 4J8XC 4QLCD 4J8XA 5B24A 3P5JB 3AZKB 1P34C 1P34A 5G49B 3VH6W 5AV5D 5CPKC 4KGCD 5B2JC 5B2JA 3X1TD 3V9RA 3AZEB 5KDMA 4J8VC 4J8VA 3WKJB 3C1CC 3C1CA 5CHLB 3AZFB 2G5IC 1P3FB 2NQBD 2IO5B 4JJNC 4JJNA 3AZMA 5BO0B 3AZMC 1BFMA 2AROD 2HIOA 4UUZB 1P3MB 4H9RB 1P3IC 1P3IA 3B6FC 3B6FA 1R4VA 1P3KC 1P3KA 3AZHC 5GT0C 5GT0A 5B1LB 5AV9C 3LZ0D 2HUEC 4X23D 5B40C 5B40A 3C1BC 4KHAA 3AN2C 3AN2A 3MVDC 3MVDA 3A6NC 3A6NA 4EO5C 1BH9A 2RVQD 4YS3D 1KX4A 1KX4C 1B6WA 3W96D 3W98D 3UTAC 3UTAA 3LELC 3LELA 1KX5B 3KWQD 3UT9D 5GXQD 5JRGC 3AYWB 3REHC 3REHA 3B6GC 3TU4D 1ZLAC 5BNVB 3LJAD 3W99C 4WU8B 3KUYA 3W99A 4G91B 2FJ7D 1P3GB 2CV5B 3MNND 3AV2D 3WA9D 4ZUXC 4ZUXA 3KFUG 4J8XB 2Y2GA 5AV6C 3LZ1C 5BT1D 5B24B 3LZ1A 3RELC 3RELA 4Z2MH 5B32C 3W97A 1P34B 1A7WA 5CPKB 2F8ND 5B2JB 3V9RB 5KDMB 4J8VB 3REJD 4NE5A 2LY8A 3X1UB 3MGRB 3C1CB 5B0ZC 5B0ZA 1S32D 4J8WC 4J8WA 1M1AA 1EQZC 1EQZA 1P3PD 4JJNB 3UTBD 2J8PA 3AZMB 3O62C 3O62A 3AZND 4H9PA 3WTPB 1P3IB 3B6FB 5AVCC 5AVCA 5DNNC 3AZLA 2F8NG 1P3KB 5B33A 5AV8D 2YFVB 5GT0B 1M19D 2PYOD 2HUEB 4R8PC 5B0YD 4R8PA 3REKD 5B40B 4KHAB 3AN2B 1Z2CB 1HQ3D 4QLCC 4QLCA 3MVDB 3A6NB 1BH9B 5B1MC 5B1MA 5B31C 5B31A 1B67A 3UTAB 5AV5C 3LELB 4M6BA 4KGCC 4Z5TD 4H9OA 3X1TC 1F1EA 3X1TA 3A1IA 4WU9D 3REHB 4CAYA 1AOID 5F99C 5F99A 2ZY3A 3A1KA 1P3BD 5E5AD 3KUYB 3W99B 3H0MC 3AV1B 1P3OA 5GSUD 3AZGA 2Y2NA 4ZUXB 1KU5A 4DQYB 3LZ1B 3REIA 4WV4B 3RELB 3W97B 4ZBJB 4H9NA 4X23C 4X23A 1P3LD 4WZSB 1U35D 5CPIC 5CPIA 2RVQC 4YS3C 4YS3A 5B0ZB 3W96C 3W96A 4YM6D 4Z66D 3W98C 1M1AB 4J8WB 3UT9C 2ZY4A 5GXQC 5GXQA 3UT9A 1EQZB 4LD9D 5DNMD 1N1JB 3AZIC 3AZIA 3O62B 3AZJD 3EPLA 1P3AC 1P3AA 4WJ3C 3AZLB 2Y2PA 3X1VD 5B33B 4G92C 2FJ7A 2FJ7C 4XZQD 1F66C 1F66A 4R8PB 3MNNC 3MNNA 5CPKA 3WA9C 3WA9A 4QLCB 5B1MB 2F2AC 5AY8D 5B31B 5CPJA 5CPJC 1KX3D 2F8NA 1WWSA 3AZKD 1TZYB 4H9OB 3X1TB 4CAYB 5F99B 1S32C 3AZED 3WKJD 1P3PC 3AZFD 3AZHA 3UTBC 1P3OB 5AV9A 1M18D 1P3FD 3AZNC 3AZGB 3C1BA 3VH5A 4NFTA 3MGPC 1ID3D 2FFFB 5AV8C 5AV8A 3EPJA 1M19C 4H9NB 1M19A 2PYOC 2PYOA 5B0YC 5B0YA 4X23B 3REKC 3REKA 3B0DB 4HGAC 5B1LD 5JRGA 5CPIB 3B6GA 4YS3B 1ZLAA 3W96B 1BH8A 1HTAA 4Z5TC 3UT9B 2YFWA 5GXQB 4Z2MG 2ZY5A 4WU9C 4AWLC 3AZIB 4WU9A 1AOIC 3VH5T 3AYWD 5E5AC 5E5AA 1P3AB 5AV6A 4WU8D 3IP4C 5B32A 3H0LC 5C3IC 4XUJD 2NZDD 2HIOC 5GSUC 3MNNB 3MGPA 4E45A
chains in the Genus database with same CATH topology
2Y2MA 3WA9B 1Q9CA 3EPHA 2CV5D 5CPJB 4J8XD 5B24D 1P3LC 4J8UC 4J8UA 1P3LA 1P34D 1U35C 1U35A 4DRBA 2Y2KA 5B2JD 4YM6C 4YM6A 3WAAD 1TAFA 5DNNA 3X1UD 3MGRD 4LD9C 3AZHB 3VH5W 5DNMC 5DNMA 3EG5B 5AV9B 1F66B 3REIC 3AZJC 3AZJA 1WWIA 3C1BB 5CP6C 3FDDA 5CP6A 4EO5B 3WTPD 1KX4B 5BS7C 5BS7A 1P3ID 5AV8B 4UPKA 2PYOB 5AV5A 1P3KD 5B0YB 4KGCA 3REKB 5GT0D 5JRGB 3B6GB 5B40D 1ZLAB 3AN2D 1KX3C 1KX3A 1W2EA 3A6ND 1BH8B 2NQBC 2NQBA 2YFWB 3LELD 2AROC 2AROA 4AWLB 4KUDD 3NQJA 5E5AB 2F8NH 2CWEA 3MGQD 5AV6B 3AZFC 2RIQA 3KUYD 1M18C 5B32B 3LZ0A 3LZ0C 1M18A 5C3IB 2JE5A 2XD5A 2HIOB 3REIB 3MGPB 2JSSA 3AV1D 1ID3C 1ID3A 5GT3D 4ZUXD 3W98A 3X1SD 3KWQC 3KWQA 4J8UB 3W97D 5B1LC 1U35B 5AVBD 3TU4A 3TU4C 4H9PB 3LJAC 3LJAA 4YM6B 5AVCB 2BG1A 5DNNB 5B0ZD 5DNMB 1M1AD 3AFAD 3KXBD 3AV2A 3AV2C 3AZJB 5B2ID 5CP6B 3O62D 3MGSD 2UWXA 1PZRA 4H9QA 5BT1C 4WU8C 4WU8A 3AZLD 4XUJC 4XUJA 2NZDA 5AV5B 2NZDC 5B33D 4KGCB 3REJC 3REJA 1P3GD 1S32A 1KX3B 3R45A 5B24C 5B1MD 1P3PA 2NQBB 5B31D 3WTPE 3UTBA 2Y2LA 2AROB 5FUGA 3AZNA 1TZYD 3NQUA 3NQJB 3WAAC 3WAAA 3X1UC 3X1UA 3MGRC 3MGRA 3B0CT 2XD1A 1P3MD 5F99D 1M18B 3LZ0B 1T3UA 2Y2HA 1P3OD 1HQ3C 1HQ3A 3EPKA 3WTPC 3WTPA 3AZGD 1ID3B 1JFIA 5B31G 1H3OA 3W98B 2L5AA 3KWQB 4Z5TA 5JA4A 2YFVA 1KX5D 1AOIA 3TU4B 2F8NK 1P3BC 3LJAB 1P3BA 5CPID 4G92B 2FJ7B 4KUDC 5GSUA 3B0CW 3AV2B 4KUDA 3AZID 3MGQC 3MGQA 4H9QB 2DQNC 3KUYC 1P3AD 2F8NB 4XUJB 2NZDB 3AL0C 2ZY2A 3AV1C 3AV1A 2BYMA 3REJB 1F66D 5CPKD 2DF4C 5GT3C 5GT3A 4Z66C 4Z66A 1S32B 4J8VD 5BNXA 3X1SA 3X1SC 3R45B 3C1CD 4LD9A 1P3PB 5CPJD 4NE6A 3W97C 4ZBJC 3UTBB 5FUGB 5AVBC 5AVBA 3AZNB 3NQUB 4JJND 3AZMD 3WAAB 2G5HC 3X1VC 3X1VA 3B6FD 4WNNA 4XZQC 4XZQA 2JCHA 1M1AC 1M19B 3AFAC 4CSRA 3KXBC 3KXBA 3AFAA 2BYKA 4H9SC 4H9SA 5B2IC 5B2IA 3AZHD 1N1JA 4HGAB 5AV9D 3MGSC 3MGSA 1HQ3B 3KSYA 1JFIB 5AY8C 2Y2IA 1H3OB 5AY8A 3C1BD 3AZLC 3MVDD 5B33C 3AZKC 3AZKA 2Y2OA 4Z5TB 1KX4D 5JA4B 5G49A 3UTAD 4WU9B 3B0BA 1AOIB 2ZM5A 5JRGD 3AZEA 3AZEC 1P3BB 3WKJC 3REHD 3WKJA 3B6GD 3VH6A 1ZLAD 3AZFA 2VQRA 3W99D 1P3FC 1P3FA 1TZYC 1TZYA 2IO5C 5GSUB 4KUDB 5BO0A 4UUZA 1P3MC 3MGQB 4H9RA 1P3MA 4NE3A 4E44A 5AV6D 3LZ1D 3RELD 1P3LB 1P3OC 2BYMB 4DRAA 5B1LA 5B32D 2HIOD 3REID 2Y2QA 3MGPD 3AZGC 5GT3B 3VH6T 4Z66B 2Y2JA 5BNXB 1TAFB 3X1SB 4LD9B 1KX5C 1KX5A 4J8WD 3H0RC 1EQZD 5AVBB 3B0DC 4J8UD 3AYWC 3AYWA 1ULYA 3X1VB 5BNVA 4WNNB 4XZQB 5AVCD 5B32G 5DNND 4G91C 4CSRB 3AFAB 3KXBB 1P3GC 2BYKB 3F6TA 1P3GA 5B2IB 2W8SA 3MGSB 2CV5C 2CV5A 4R8PD 5AY8B 5CP6D 4J8XC 4QLCD 4J8XA 5B24A 3P5JB 3AZKB 1P34C 1P34A 5G49B 3VH6W 5AV5D 5CPKC 4KGCD 5B2JC 5B2JA 3X1TD 3V9RA 3AZEB 5KDMA 4J8VC 4J8VA 3WKJB 3C1CC 3C1CA 5CHLB 3AZFB 2G5IC 1P3FB 2NQBD 2IO5B 4JJNC 4JJNA 3AZMA 5BO0B 3AZMC 1BFMA 2AROD 2HIOA 4UUZB 1P3MB 4H9RB 1P3IC 1P3IA 3B6FC 3B6FA 1R4VA 1P3KC 1P3KA 3AZHC 5GT0C 5GT0A 5B1LB 5AV9C 3LZ0D 2HUEC 4X23D 5B40C 5B40A 3C1BC 4KHAA 3AN2C 3AN2A 3MVDC 3MVDA 3A6NC 3A6NA 4EO5C 1BH9A 2RVQD 4YS3D 1KX4A 1KX4C 1B6WA 3W96D 3W98D 3UTAC 3UTAA 3LELC 3LELA 1KX5B 3KWQD 3UT9D 5GXQD 5JRGC 3AYWB 3REHC 3REHA 3B6GC 3TU4D 1ZLAC 5BNVB 3LJAD 3W99C 4WU8B 3KUYA 3W99A 4G91B 2FJ7D 1P3GB 2CV5B 3MNND 3AV2D 3WA9D 4ZUXC 4ZUXA 3KFUG 4J8XB 2Y2GA 5AV6C 3LZ1C 5BT1D 5B24B 3LZ1A 3RELC 3RELA 4Z2MH 5B32C 3W97A 1P34B 1A7WA 5CPKB 2F8ND 5B2JB 3V9RB 5KDMB 4J8VB 3REJD 4NE5A 2LY8A 3X1UB 3MGRB 3C1CB 5B0ZC 5B0ZA 1S32D 4J8WC 4J8WA 1M1AA 1EQZC 1EQZA 1P3PD 4JJNB 3UTBD 2J8PA 3AZMB 3O62C 3O62A 3AZND 4H9PA 3WTPB 1P3IB 3B6FB 5AVCC 5AVCA 5DNNC 3AZLA 2F8NG 1P3KB 5B33A 5AV8D 2YFVB 5GT0B 1M19D 2PYOD 2HUEB 4R8PC 5B0YD 4R8PA 3REKD 5B40B 4KHAB 3AN2B 1Z2CB 1HQ3D 4QLCC 4QLCA 3MVDB 3A6NB 1BH9B 5B1MC 5B1MA 5B31C 5B31A 1B67A 3UTAB 5AV5C 3LELB 4M6BA 4KGCC 4Z5TD 4H9OA 3X1TC 1F1EA 3X1TA 3A1IA 4WU9D 3REHB 4CAYA 1AOID 5F99C 5F99A 2ZY3A 3A1KA 1P3BD 5E5AD 3KUYB 3W99B 3H0MC 3AV1B 1P3OA 5GSUD 3AZGA 2Y2NA 4ZUXB 1KU5A 4DQYB 3LZ1B 3REIA 4WV4B 3RELB 3W97B 4ZBJB 4H9NA 4X23C 4X23A 1P3LD 4WZSB 1U35D 5CPIC 5CPIA 2RVQC 4YS3C 4YS3A 5B0ZB 3W96C 3W96A 4YM6D 4Z66D 3W98C 1M1AB 4J8WB 3UT9C 2ZY4A 5GXQC 5GXQA 3UT9A 1EQZB 4LD9D 5DNMD 1N1JB 3AZIC 3AZIA 3O62B 3AZJD 3EPLA 1P3AC 1P3AA 4WJ3C 3AZLB 2Y2PA 3X1VD 5B33B 4G92C 2FJ7A 2FJ7C 4XZQD 1F66C 1F66A 4R8PB 3MNNC 3MNNA 5CPKA 3WA9C 3WA9A 4QLCB 5B1MB 2F2AC 5AY8D 5B31B 5CPJA 5CPJC 1KX3D 2F8NA 1WWSA 3AZKD 1TZYB 4H9OB 3X1TB 4CAYB 5F99B 1S32C 3AZED 3WKJD 1P3PC 3AZFD 3AZHA 3UTBC 1P3OB 5AV9A 1M18D 1P3FD 3AZNC 3AZGB 3C1BA 3VH5A 4NFTA 3MGPC 1ID3D 2FFFB 5AV8C 5AV8A 3EPJA 1M19C 4H9NB 1M19A 2PYOC 2PYOA 5B0YC 5B0YA 4X23B 3REKC 3REKA 3B0DB 4HGAC 5B1LD 5JRGA 5CPIB 3B6GA 4YS3B 1ZLAA 3W96B 1BH8A 1HTAA 4Z5TC 3UT9B 2YFWA 5GXQB 4Z2MG 2ZY5A 4WU9C 4AWLC 3AZIB 4WU9A 1AOIC 3VH5T 3AYWD 5E5AC 5E5AA 1P3AB 5AV6A 4WU8D 3IP4C 5B32A 3H0LC 5C3IC 4XUJD 2NZDD 2HIOC 5GSUC 3MNNB 3MGPA 4E45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PZR A; 
#chains in the Genus database with same CATH topology
 2Y2M A;  3WA9 B;  1Q9C A;  3EPH A;  2CV5 D;  5CPJ B;  4J8X D;  5B24 D;  1P3L C;  4J8U C;  4J8U A;  1P3L A;  1P34 D;  1U35 C;  1U35 A;  4DRB A;  2Y2K A;  5B2J D;  4YM6 C;  4YM6 A;  3WAA D;  1TAF A;  5DNN A;  3X1U D;  3MGR D;  4LD9 C;  3AZH B;  3VH5 W;  5DNM C;  5DNM A;  3EG5 B;  5AV9 B;  1F66 B;  3REI C;  3AZJ C;  3AZJ A;  1WWI A;  3C1B B;  5CP6 C;  3FDD A;  5CP6 A;  4EO5 B;  3WTP D;  1KX4 B;  5BS7 C;  5BS7 A;  1P3I D;  5AV8 B;  4UPK A;  2PYO B;  5AV5 A;  1P3K D;  5B0Y B;  4KGC A;  3REK B;  5GT0 D;  5JRG B;  3B6G B;  5B40 D;  1ZLA B;  3AN2 D;  1KX3 C;  1KX3 A;  1W2E A;  3A6N D;  1BH8 B;  2NQB C;  2NQB A;  2YFW B;  3LEL D;  2ARO C;  2ARO A;  4AWL B;  4KUD D;  3NQJ A;  5E5A B;  2F8N H;  2CWE A;  3MGQ D;  5AV6 B;  3AZF C;  2RIQ A;  3KUY D;  1M18 C;  5B32 B;  3LZ0 A;  3LZ0 C;  1M18 A;  5C3I B;  2JE5 A;  2XD5 A;  2HIO B;  3REI B;  3MGP B;  2JSS A;  3AV1 D;  1ID3 C;  1ID3 A;  5GT3 D;  4ZUX D;  3W98 A;  3X1S D;  3KWQ C;  3KWQ A;  4J8U B;  3W97 D;  5B1L C;  1U35 B;  5AVB D;  3TU4 A;  3TU4 C;  4H9P B;  3LJA C;  3LJA A;  4YM6 B;  5AVC B;  2BG1 A;  5DNN B;  5B0Z D;  5DNM B;  1M1A D;  3AFA D;  3KXB D;  3AV2 A;  3AV2 C;  3AZJ B;  5B2I D;  5CP6 B;  3O62 D;  3MGS D;  2UWX A;  1PZR A;  4H9Q A;  5BT1 C;  4WU8 C;  4WU8 A;  3AZL D;  4XUJ C;  4XUJ A;  2NZD A;  5AV5 B;  2NZD C;  5B33 D;  4KGC B;  3REJ C;  3REJ A;  1P3G D;  1S32 A;  1KX3 B;  3R45 A;  5B24 C;  5B1M D;  1P3P A;  2NQB B;  5B31 D;  3WTP E;  3UTB A;  2Y2L A;  2ARO B;  5FUG A;  3AZN A;  1TZY D;  3NQU A;  3NQJ B;  3WAA C;  3WAA A;  3X1U C;  3X1U A;  3MGR C;  3MGR A;  3B0C T;  2XD1 A;  1P3M D;  5F99 D;  1M18 B;  3LZ0 B;  1T3U A;  2Y2H A;  1P3O D;  1HQ3 C;  1HQ3 A;  3EPK A;  3WTP C;  3WTP A;  3AZG D;  1ID3 B;  1JFI A;  5B31 G;  1H3O A;  3W98 B;  2L5A A;  3KWQ B;  4Z5T A;  5JA4 A;  2YFV A;  1KX5 D;  1AOI A;  3TU4 B;  2F8N K;  1P3B C;  3LJA B;  1P3B A;  5CPI D;  4G92 B;  2FJ7 B;  4KUD C;  5GSU A;  3B0C W;  3AV2 B;  4KUD A;  3AZI D;  3MGQ C;  3MGQ A;  4H9Q B;  2DQN C;  3KUY C;  1P3A D;  2F8N B;  4XUJ B;  2NZD B;  3AL0 C;  2ZY2 A;  3AV1 C;  3AV1 A;  2BYM A;  3REJ B;  1F66 D;  5CPK D;  2DF4 C;  5GT3 C;  5GT3 A;  4Z66 C;  4Z66 A;  1S32 B;  4J8V D;  5BNX A;  3X1S A;  3X1S C;  3R45 B;  3C1C D;  4LD9 A;  1P3P B;  5CPJ D;  4NE6 A;  3W97 C;  4ZBJ C;  3UTB B;  5FUG B;  5AVB C;  5AVB A;  3AZN B;  3NQU B;  4JJN D;  3AZM D;  3WAA B;  2G5H C;  3X1V C;  3X1V A;  3B6F D;  4WNN A;  4XZQ C;  4XZQ A;  2JCH A;  1M1A C;  1M19 B;  3AFA C;  4CSR A;  3KXB C;  3KXB A;  3AFA A;  2BYK A;  4H9S C;  4H9S A;  5B2I C;  5B2I A;  3AZH D;  1N1J A;  4HGA B;  5AV9 D;  3MGS C;  3MGS A;  1HQ3 B;  3KSY A;  1JFI B;  5AY8 C;  2Y2I A;  1H3O B;  5AY8 A;  3C1B D;  3AZL C;  3MVD D;  5B33 C;  3AZK C;  3AZK A;  2Y2O A;  4Z5T B;  1KX4 D;  5JA4 B;  5G49 A;  3UTA D;  4WU9 B;  3B0B A;  1AOI B;  2ZM5 A;  5JRG D;  3AZE A;  3AZE C;  1P3B B;  3WKJ C;  3REH D;  3WKJ A;  3B6G D;  3VH6 A;  1ZLA D;  3AZF A;  2VQR A;  3W99 D;  1P3F C;  1P3F A;  1TZY C;  1TZY A;  2IO5 C;  5GSU B;  4KUD B;  5BO0 A;  4UUZ A;  1P3M C;  3MGQ B;  4H9R A;  1P3M A;  4NE3 A;  4E44 A;  5AV6 D;  3LZ1 D;  3REL D;  1P3L B;  1P3O C;  2BYM B;  4DRA A;  5B1L A;  5B32 D;  2HIO D;  3REI D;  2Y2Q A;  3MGP D;  3AZG C;  5GT3 B;  3VH6 T;  4Z66 B;  2Y2J A;  5BNX B;  1TAF B;  3X1S B;  4LD9 B;  1KX5 C;  1KX5 A;  4J8W D;  3H0R C;  1EQZ D;  5AVB B;  3B0D C;  4J8U D;  3AYW C;  3AYW A;  1ULY A;  3X1V B;  5BNV A;  4WNN B;  4XZQ B;  5AVC D;  5B32 G;  5DNN D;  4G91 C;  4CSR B;  3AFA B;  3KXB B;  1P3G C;  2BYK B;  3F6T A;  1P3G A;  5B2I B;  2W8S A;  3MGS B;  2CV5 C;  2CV5 A;  4R8P D;  5AY8 B;  5CP6 D;  4J8X C;  4QLC D;  4J8X A;  5B24 A;  3P5J B;  3AZK B;  1P34 C;  1P34 A;  5G49 B;  3VH6 W;  5AV5 D;  5CPK C;  4KGC D;  5B2J C;  5B2J A;  3X1T D;  3V9R A;  3AZE B;  5KDM A;  4J8V C;  4J8V A;  3WKJ B;  3C1C C;  3C1C A;  5CHL B;  3AZF B;  2G5I C;  1P3F B;  2NQB D;  2IO5 B;  4JJN C;  4JJN A;  3AZM A;  5BO0 B;  3AZM C;  1BFM A;  2ARO D;  2HIO A;  4UUZ B;  1P3M B;  4H9R B;  1P3I C;  1P3I A;  3B6F C;  3B6F A;  1R4V A;  1P3K C;  1P3K A;  3AZH C;  5GT0 C;  5GT0 A;  5B1L B;  5AV9 C;  3LZ0 D;  2HUE C;  4X23 D;  5B40 C;  5B40 A;  3C1B C;  4KHA A;  3AN2 C;  3AN2 A;  3MVD C;  3MVD A;  3A6N C;  3A6N A;  4EO5 C;  1BH9 A;  2RVQ D;  4YS3 D;  1KX4 A;  1KX4 C;  1B6W A;  3W96 D;  3W98 D;  3UTA C;  3UTA A;  3LEL C;  3LEL A;  1KX5 B;  3KWQ D;  3UT9 D;  5GXQ D;  5JRG C;  3AYW B;  3REH C;  3REH A;  3B6G C;  3TU4 D;  1ZLA C;  5BNV B;  3LJA D;  3W99 C;  4WU8 B;  3KUY A;  3W99 A;  4G91 B;  2FJ7 D;  1P3G B;  2CV5 B;  3MNN D;  3AV2 D;  3WA9 D;  4ZUX C;  4ZUX A;  3KFU G;  4J8X B;  2Y2G A;  5AV6 C;  3LZ1 C;  5BT1 D;  5B24 B;  3LZ1 A;  3REL C;  3REL A;  4Z2M H;  5B32 C;  3W97 A;  1P34 B;  1A7W A;  5CPK B;  2F8N D;  5B2J B;  3V9R B;  5KDM B;  4J8V B;  3REJ D;  4NE5 A;  2LY8 A;  3X1U B;  3MGR B;  3C1C B;  5B0Z C;  5B0Z A;  1S32 D;  4J8W C;  4J8W A;  1M1A A;  1EQZ C;  1EQZ A;  1P3P D;  4JJN B;  3UTB D;  2J8P A;  3AZM B;  3O62 C;  3O62 A;  3AZN D;  4H9P A;  3WTP B;  1P3I B;  3B6F B;  5AVC C;  5AVC A;  5DNN C;  3AZL A;  2F8N G;  1P3K B;  5B33 A;  5AV8 D;  2YFV B;  5GT0 B;  1M19 D;  2PYO D;  2HUE B;  4R8P C;  5B0Y D;  4R8P A;  3REK D;  5B40 B;  4KHA B;  3AN2 B;  1Z2C B;  1HQ3 D;  4QLC C;  4QLC A;  3MVD B;  3A6N B;  1BH9 B;  5B1M C;  5B1M A;  5B31 C;  5B31 A;  1B67 A;  3UTA B;  5AV5 C;  3LEL B;  4M6B A;  4KGC C;  4Z5T D;  4H9O A;  3X1T C;  1F1E A;  3X1T A;  3A1I A;  4WU9 D;  3REH B;  4CAY A;  1AOI D;  5F99 C;  5F99 A;  2ZY3 A;  3A1K A;  1P3B D;  5E5A D;  3KUY B;  3W99 B;  3H0M C;  3AV1 B;  1P3O A;  5GSU D;  3AZG A;  2Y2N A;  4ZUX B;  1KU5 A;  4DQY B;  3LZ1 B;  3REI A;  4WV4 B;  3REL B;  3W97 B;  4ZBJ B;  4H9N A;  4X23 C;  4X23 A;  1P3L D;  4WZS B;  1U35 D;  5CPI C;  5CPI A;  2RVQ C;  4YS3 C;  4YS3 A;  5B0Z B;  3W96 C;  3W96 A;  4YM6 D;  4Z66 D;  3W98 C;  1M1A B;  4J8W B;  3UT9 C;  2ZY4 A;  5GXQ C;  5GXQ A;  3UT9 A;  1EQZ B;  4LD9 D;  5DNM D;  1N1J B;  3AZI C;  3AZI A;  3O62 B;  3AZJ D;  3EPL A;  1P3A C;  1P3A A;  4WJ3 C;  3AZL B;  2Y2P A;  3X1V D;  5B33 B;  4G92 C;  2FJ7 A;  2FJ7 C;  4XZQ D;  1F66 C;  1F66 A;  4R8P B;  3MNN C;  3MNN A;  5CPK A;  3WA9 C;  3WA9 A;  4QLC B;  5B1M B;  2F2A C;  5AY8 D;  5B31 B;  5CPJ A;  5CPJ C;  1KX3 D;  2F8N A;  1WWS A;  3AZK D;  1TZY B;  4H9O B;  3X1T B;  4CAY B;  5F99 B;  1S32 C;  3AZE D;  3WKJ D;  1P3P C;  3AZF D;  3AZH A;  3UTB C;  1P3O B;  5AV9 A;  1M18 D;  1P3F D;  3AZN C;  3AZG B;  3C1B A;  3VH5 A;  4NFT A;  3MGP C;  1ID3 D;  2FFF B;  5AV8 C;  5AV8 A;  3EPJ A;  1M19 C;  4H9N B;  1M19 A;  2PYO C;  2PYO A;  5B0Y C;  5B0Y A;  4X23 B;  3REK C;  3REK A;  3B0D B;  4HGA C;  5B1L D;  5JRG A;  5CPI B;  3B6G A;  4YS3 B;  1ZLA A;  3W96 B;  1BH8 A;  1HTA A;  4Z5T C;  3UT9 B;  2YFW A;  5GXQ B;  4Z2M G;  2ZY5 A;  4WU9 C;  4AWL C;  3AZI B;  4WU9 A;  1AOI C;  3VH5 T;  3AYW D;  5E5A C;  5E5A A;  1P3A B;  5AV6 A;  4WU8 D;  3IP4 C;  5B32 A;  3H0L C;  5C3I C;  4XUJ D;  2NZD D;  2HIO C;  5GSU C;  3MNN B;  3MGP A;  4E45 A; 
#chains in the Genus database with same CATH homology
 2Y2M A;  3WA9 B;  1Q9C A;  3EPH A;  2CV5 D;  5CPJ B;  4J8X D;  5B24 D;  1P3L C;  4J8U C;  4J8U A;  1P3L A;  1P34 D;  1U35 C;  1U35 A;  4DRB A;  2Y2K A;  5B2J D;  4YM6 C;  4YM6 A;  3WAA D;  1TAF A;  5DNN A;  3X1U D;  3MGR D;  4LD9 C;  3AZH B;  3VH5 W;  5DNM C;  5DNM A;  3EG5 B;  5AV9 B;  1F66 B;  3REI C;  3AZJ C;  3AZJ A;  1WWI A;  3C1B B;  5CP6 C;  3FDD A;  5CP6 A;  4EO5 B;  3WTP D;  1KX4 B;  5BS7 C;  5BS7 A;  1P3I D;  5AV8 B;  4UPK A;  2PYO B;  5AV5 A;  1P3K D;  5B0Y B;  4KGC A;  3REK B;  5GT0 D;  5JRG B;  3B6G B;  5B40 D;  1ZLA B;  3AN2 D;  1KX3 C;  1KX3 A;  1W2E A;  3A6N D;  1BH8 B;  2NQB C;  2NQB A;  2YFW B;  3LEL D;  2ARO C;  2ARO A;  4AWL B;  4KUD D;  3NQJ A;  5E5A B;  2F8N H;  2CWE A;  3MGQ D;  5AV6 B;  3AZF C;  2RIQ A;  3KUY D;  1M18 C;  5B32 B;  3LZ0 A;  3LZ0 C;  1M18 A;  5C3I B;  2JE5 A;  2XD5 A;  2HIO B;  3REI B;  3MGP B;  2JSS A;  3AV1 D;  1ID3 C;  1ID3 A;  5GT3 D;  4ZUX D;  3W98 A;  3X1S D;  3KWQ C;  3KWQ A;  4J8U B;  3W97 D;  5B1L C;  1U35 B;  5AVB D;  3TU4 A;  3TU4 C;  4H9P B;  3LJA C;  3LJA A;  4YM6 B;  5AVC B;  2BG1 A;  5DNN B;  5B0Z D;  5DNM B;  1M1A D;  3AFA D;  3KXB D;  3AV2 A;  3AV2 C;  3AZJ B;  5B2I D;  5CP6 B;  3O62 D;  3MGS D;  2UWX A;  1PZR A;  4H9Q A;  5BT1 C;  4WU8 C;  4WU8 A;  3AZL D;  4XUJ C;  4XUJ A;  2NZD A;  5AV5 B;  2NZD C;  5B33 D;  4KGC B;  3REJ C;  3REJ A;  1P3G D;  1S32 A;  1KX3 B;  3R45 A;  5B24 C;  5B1M D;  1P3P A;  2NQB B;  5B31 D;  3WTP E;  3UTB A;  2Y2L A;  2ARO B;  5FUG A;  3AZN A;  1TZY D;  3NQU A;  3NQJ B;  3WAA C;  3WAA A;  3X1U C;  3X1U A;  3MGR C;  3MGR A;  3B0C T;  2XD1 A;  1P3M D;  5F99 D;  1M18 B;  3LZ0 B;  1T3U A;  2Y2H A;  1P3O D;  1HQ3 C;  1HQ3 A;  3EPK A;  3WTP C;  3WTP A;  3AZG D;  1ID3 B;  1JFI A;  5B31 G;  1H3O A;  3W98 B;  2L5A A;  3KWQ B;  4Z5T A;  5JA4 A;  2YFV A;  1KX5 D;  1AOI A;  3TU4 B;  2F8N K;  1P3B C;  3LJA B;  1P3B A;  5CPI D;  4G92 B;  2FJ7 B;  4KUD C;  5GSU A;  3B0C W;  3AV2 B;  4KUD A;  3AZI D;  3MGQ C;  3MGQ A;  4H9Q B;  2DQN C;  3KUY C;  1P3A D;  2F8N B;  4XUJ B;  2NZD B;  3AL0 C;  2ZY2 A;  3AV1 C;  3AV1 A;  2BYM A;  3REJ B;  1F66 D;  5CPK D;  2DF4 C;  5GT3 C;  5GT3 A;  4Z66 C;  4Z66 A;  1S32 B;  4J8V D;  5BNX A;  3X1S A;  3X1S C;  3R45 B;  3C1C D;  4LD9 A;  1P3P B;  5CPJ D;  4NE6 A;  3W97 C;  4ZBJ C;  3UTB B;  5FUG B;  5AVB C;  5AVB A;  3AZN B;  3NQU B;  4JJN D;  3AZM D;  3WAA B;  2G5H C;  3X1V C;  3X1V A;  3B6F D;  4WNN A;  4XZQ C;  4XZQ A;  2JCH A;  1M1A C;  1M19 B;  3AFA C;  4CSR A;  3KXB C;  3KXB A;  3AFA A;  2BYK A;  4H9S C;  4H9S A;  5B2I C;  5B2I A;  3AZH D;  1N1J A;  4HGA B;  5AV9 D;  3MGS C;  3MGS A;  1HQ3 B;  3KSY A;  1JFI B;  5AY8 C;  2Y2I A;  1H3O B;  5AY8 A;  3C1B D;  3AZL C;  3MVD D;  5B33 C;  3AZK C;  3AZK A;  2Y2O A;  4Z5T B;  1KX4 D;  5JA4 B;  5G49 A;  3UTA D;  4WU9 B;  3B0B A;  1AOI B;  2ZM5 A;  5JRG D;  3AZE A;  3AZE C;  1P3B B;  3WKJ C;  3REH D;  3WKJ A;  3B6G D;  3VH6 A;  1ZLA D;  3AZF A;  2VQR A;  3W99 D;  1P3F C;  1P3F A;  1TZY C;  1TZY A;  2IO5 C;  5GSU B;  4KUD B;  5BO0 A;  4UUZ A;  1P3M C;  3MGQ B;  4H9R A;  1P3M A;  4NE3 A;  4E44 A;  5AV6 D;  3LZ1 D;  3REL D;  1P3L B;  1P3O C;  2BYM B;  4DRA A;  5B1L A;  5B32 D;  2HIO D;  3REI D;  2Y2Q A;  3MGP D;  3AZG C;  5GT3 B;  3VH6 T;  4Z66 B;  2Y2J A;  5BNX B;  1TAF B;  3X1S B;  4LD9 B;  1KX5 C;  1KX5 A;  4J8W D;  3H0R C;  1EQZ D;  5AVB B;  3B0D C;  4J8U D;  3AYW C;  3AYW A;  1ULY A;  3X1V B;  5BNV A;  4WNN B;  4XZQ B;  5AVC D;  5B32 G;  5DNN D;  4G91 C;  4CSR B;  3AFA B;  3KXB B;  1P3G C;  2BYK B;  3F6T A;  1P3G A;  5B2I B;  2W8S A;  3MGS B;  2CV5 C;  2CV5 A;  4R8P D;  5AY8 B;  5CP6 D;  4J8X C;  4QLC D;  4J8X A;  5B24 A;  3P5J B;  3AZK B;  1P34 C;  1P34 A;  5G49 B;  3VH6 W;  5AV5 D;  5CPK C;  4KGC D;  5B2J C;  5B2J A;  3X1T D;  3V9R A;  3AZE B;  5KDM A;  4J8V C;  4J8V A;  3WKJ B;  3C1C C;  3C1C A;  5CHL B;  3AZF B;  2G5I C;  1P3F B;  2NQB D;  2IO5 B;  4JJN C;  4JJN A;  3AZM A;  5BO0 B;  3AZM C;  1BFM A;  2ARO D;  2HIO A;  4UUZ B;  1P3M B;  4H9R B;  1P3I C;  1P3I A;  3B6F C;  3B6F A;  1R4V A;  1P3K C;  1P3K A;  3AZH C;  5GT0 C;  5GT0 A;  5B1L B;  5AV9 C;  3LZ0 D;  2HUE C;  4X23 D;  5B40 C;  5B40 A;  3C1B C;  4KHA A;  3AN2 C;  3AN2 A;  3MVD C;  3MVD A;  3A6N C;  3A6N A;  4EO5 C;  1BH9 A;  2RVQ D;  4YS3 D;  1KX4 A;  1KX4 C;  1B6W A;  3W96 D;  3W98 D;  3UTA C;  3UTA A;  3LEL C;  3LEL A;  1KX5 B;  3KWQ D;  3UT9 D;  5GXQ D;  5JRG C;  3AYW B;  3REH C;  3REH A;  3B6G C;  3TU4 D;  1ZLA C;  5BNV B;  3LJA D;  3W99 C;  4WU8 B;  3KUY A;  3W99 A;  4G91 B;  2FJ7 D;  1P3G B;  2CV5 B;  3MNN D;  3AV2 D;  3WA9 D;  4ZUX C;  4ZUX A;  3KFU G;  4J8X B;  2Y2G A;  5AV6 C;  3LZ1 C;  5BT1 D;  5B24 B;  3LZ1 A;  3REL C;  3REL A;  4Z2M H;  5B32 C;  3W97 A;  1P34 B;  1A7W A;  5CPK B;  2F8N D;  5B2J B;  3V9R B;  5KDM B;  4J8V B;  3REJ D;  4NE5 A;  2LY8 A;  3X1U B;  3MGR B;  3C1C B;  5B0Z C;  5B0Z A;  1S32 D;  4J8W C;  4J8W A;  1M1A A;  1EQZ C;  1EQZ A;  1P3P D;  4JJN B;  3UTB D;  2J8P A;  3AZM B;  3O62 C;  3O62 A;  3AZN D;  4H9P A;  3WTP B;  1P3I B;  3B6F B;  5AVC C;  5AVC A;  5DNN C;  3AZL A;  2F8N G;  1P3K B;  5B33 A;  5AV8 D;  2YFV B;  5GT0 B;  1M19 D;  2PYO D;  2HUE B;  4R8P C;  5B0Y D;  4R8P A;  3REK D;  5B40 B;  4KHA B;  3AN2 B;  1Z2C B;  1HQ3 D;  4QLC C;  4QLC A;  3MVD B;  3A6N B;  1BH9 B;  5B1M C;  5B1M A;  5B31 C;  5B31 A;  1B67 A;  3UTA B;  5AV5 C;  3LEL B;  4M6B A;  4KGC C;  4Z5T D;  4H9O A;  3X1T C;  1F1E A;  3X1T A;  3A1I A;  4WU9 D;  3REH B;  4CAY A;  1AOI D;  5F99 C;  5F99 A;  2ZY3 A;  3A1K A;  1P3B D;  5E5A D;  3KUY B;  3W99 B;  3H0M C;  3AV1 B;  1P3O A;  5GSU D;  3AZG A;  2Y2N A;  4ZUX B;  1KU5 A;  4DQY B;  3LZ1 B;  3REI A;  4WV4 B;  3REL B;  3W97 B;  4ZBJ B;  4H9N A;  4X23 C;  4X23 A;  1P3L D;  4WZS B;  1U35 D;  5CPI C;  5CPI A;  2RVQ C;  4YS3 C;  4YS3 A;  5B0Z B;  3W96 C;  3W96 A;  4YM6 D;  4Z66 D;  3W98 C;  1M1A B;  4J8W B;  3UT9 C;  2ZY4 A;  5GXQ C;  5GXQ A;  3UT9 A;  1EQZ B;  4LD9 D;  5DNM D;  1N1J B;  3AZI C;  3AZI A;  3O62 B;  3AZJ D;  3EPL A;  1P3A C;  1P3A A;  4WJ3 C;  3AZL B;  2Y2P A;  3X1V D;  5B33 B;  4G92 C;  2FJ7 A;  2FJ7 C;  4XZQ D;  1F66 C;  1F66 A;  4R8P B;  3MNN C;  3MNN A;  5CPK A;  3WA9 C;  3WA9 A;  4QLC B;  5B1M B;  2F2A C;  5AY8 D;  5B31 B;  5CPJ A;  5CPJ C;  1KX3 D;  2F8N A;  1WWS A;  3AZK D;  1TZY B;  4H9O B;  3X1T B;  4CAY B;  5F99 B;  1S32 C;  3AZE D;  3WKJ D;  1P3P C;  3AZF D;  3AZH A;  3UTB C;  1P3O B;  5AV9 A;  1M18 D;  1P3F D;  3AZN C;  3AZG B;  3C1B A;  3VH5 A;  4NFT A;  3MGP C;  1ID3 D;  2FFF B;  5AV8 C;  5AV8 A;  3EPJ A;  1M19 C;  4H9N B;  1M19 A;  2PYO C;  2PYO A;  5B0Y C;  5B0Y A;  4X23 B;  3REK C;  3REK A;  3B0D B;  4HGA C;  5B1L D;  5JRG A;  5CPI B;  3B6G A;  4YS3 B;  1ZLA A;  3W96 B;  1BH8 A;  1HTA A;  4Z5T C;  3UT9 B;  2YFW A;  5GXQ B;  4Z2M G;  2ZY5 A;  4WU9 C;  4AWL C;  3AZI B;  4WU9 A;  1AOI C;  3VH5 T;  3AYW D;  5E5A C;  5E5A A;  1P3A B;  5AV6 A;  4WU8 D;  3IP4 C;  5B32 A;  3H0L C;  5C3I C;  4XUJ D;  2NZD D;  2HIO C;  5GSU C;  3MNN B;  3MGP A;  4E45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...