1PZRA

Structure of fused docking domains from the erythromycin polyketide synthase (debs), a model for the interaction between debs2 and debs3: the b domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
ASDDELFSMLDQRFGGGEDLLMSGDNGMTEEKLRRYLKRTVTELDSVTARLREVEHRAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Erythronolide synthase
publication title The structure of docking domains in modular polyketide synthases.
pubmed doi rcsb
source organism Saccharopolyspora erythraea
molecule tags Transferase
total genus 13
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature ec 2.3.1.94: 6-deoxyerythronolide-B synthase.
pdb deposition date 2003-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.20 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1pzrA00
1PZRA
chains in the Genus database with same CATH superfamily
1EQZB 3W99D 3AZGD 1KU5A 3B6GA 4EO5C 3WAAB 5CPJA 4Z5TC 1P3LD 5AV9A 4J8VA 1R4VA 4ZUXD 1P3AD 1KX3A 4X23A 3MGRC 4DRBA 4J8UC 4CSRA 1Z2CB 1S32A 4J8WC 5B24B 3O62D 1P3PB 4KUDA 1P3KA 3MVDC 5DNMA 5AVBC 4JJND 2UWXA 5BNXA 3W96B 3LZ0A 4XUJD 2NQBB 3REJA 1HTAA 1ID3D 4HGAB 1KX5B 2F8NB 3LJAA 4M6BA 5CPIA 1F66C 3REKC 1HQ3A 3VH5A 1M1AB 3LELA 3UTAB 1JFIB 4LD9D 2HIOC 5B33D 3NQJA 2JCHA 5B40A 1KX5A 1U35D 3AZKB 3KXBB 2IO5C 4YM6B 5CPKA 1P3GB 4WU9B 3W98C 3W99B 3AZEC 3AZGB 1M18C 1ZLAB 5CHLB 3B0CT 5JRGD 5B32A 4ZUXB 5KDMA 3AZHC 1P3AB 3R45B 5E5AC 2YFVB 3O62B 2Y2LA 3WKJB 5AVCD 1P3OD 3A1KA 3MGQC 1W2EA 1P3LA 3VH6W 3WA9A 4G92B 1EQZC 1F66D 3WAAC 3UT9D 3KUYD 4WZSB 5B0ZA 3AFAA 4XUJB 1BH9A 1Q9CA 3VH5T 4H9PB 5AV8D 1ID3B 2XD1A 4Z66D 3AZID 4JJNA 5B24C 1P3PC 2NZDB 1B6WA 2RIQA 4KHAB 5GXQD 4LD9B 5B33B 2BYKB 5GT0D 1ID3A 3AV2A 1U35B 3W96C 5F99B 2G5HC 3X1TB 1M19D 2NQBC 4H9SC 4HGAC 4E44A 1KX5C 3TU4D 5JRGB 2BG1A 1H3OB 4R8PB 5B1LD 2FJ7B 1BH8B 4Z5TA 1M1AC 3AYWD 3X1SB 3UTAC 3MGRA 4H9RB 5AVCB 4J8UA 1P3OB 3MGPD 3LZ1D 4UUZA 4J8WA 5AV6B 3AZKC 3KXBC 4YM6C 1P3GC 4G91B 4WU9C 3H0LC 1TAFA 2HUEB 3W99C 3MVDA 3AZGC 3AZLD 3UT9B 3KUYB 1ZLAC 3A1IA 5AVBA 5B24D 5AV8B 4ZUXC 2F8NH 2PYOD 5B0YD 5GSUB 1P3AC 2Y2JA 4Z66B 3MNND 3A6ND 3AZIB 3O62C 3WKJC 1P3GD 1F66A 3NQUB 3KWQD 3REKA 4XZQD 5JA4B 5B32G 5GXQB 5AV5D 4JJNC 5GT0B 4G92C 2F8ND 4YS3B 3EPLA 2HIOA 3AZIA 1M19B 5FUGA 4XUJC 3UTBD 4AWLB 2XD5A 4KGCD 3X1UD 3WTPD 1ID3C 3W98A 3TU4B 2Y2HA 3AZEA 5B1LB 4H9QB 4H9NB 2F2AC 4Z2MH 5B31D 2NZDC 2W8SA 4YM6D 3AYWB 3AZHA 5E5AA 3C1BD 4LD9C 5B33C 2ZY5A 1ZLAD 3REHD 3MGPB 3LZ1B 1U35C 3AL0C 5F99C 3X1TC 3MGQA 4H9OB 3AZLB 1EQZA 5JRGC 3WKJD 3WAAA 2PYOB 5B0YB 2FJ7C 1AOID 1BFMA 3AN2D 3MNNB 3A6NB 3X1VD 2ZY4A 3X1SC 5AVCC 1P3OC 2Y2IA 3KWQB 4XZQB 5AV6C 5DNND 5B24A 1P3PA 1KX4B 5AV5B 4G91C 2HUEC 3UT9C 3KUYC 3FDDA 3AV1D 3UTBB 3AZJB 5AV8C 4KGCB 3W96A 2NZDD 3X1UB 3IP4C 3WTPB 3AZFD 4Z66C 2NQBA 5GT3D 3AZIC 4H9SA 2F8NA 5B31B 3MGSD 5F99D 3X1TD 5C3IB 5AY8D 5BT1D 5GXQC 3C1BB 1M1AA 4CAYB 5GT0C 3REHB 2Y2GA 4YS3C 3V9RB 3UTAA 1JFIA 1TZYD 1M19C 2RVQD 4R8PD 2FJ7D 3AZKA 3AZND 3KXBA 4YM6A 1P3GA 1P34D 4WU9A 3X1SD 3REID 1B67A 2YFWB 3TU4C 3B6FD 2G5IC 3W99A 3AZGA 1N1JB 1ZLAA 4J8XD 1P3ID 5B1LC 1P3BD 1AOIB 3V9RA 5AV6D 3AN2B 4NE6A 4ZUXA 3AYWC 3X1VB 1P3AA 3R45A 2Y2MA 2AROD 2LY8A 3MGPC 3LZ1C 2YFVA 5DNNB 3O62A 5BS7C 3WKJA 5GSUD 3VH6A 3AZLC 3AV1B 5B2IB 2PYOC 5B0YC 3AZFB 4XUJA 3MNNC 4H9PA 3A6NC 5GT3B 5B2JD 1P3FD 4YS3D 3MGSB 3KWQC 4DQYB 4XZQC 3AZMD 1KX4C 5AY8B 5AV5C 2NZDA 4KHAA 4LD9A 5B33A 2BYKA 1TZYB 3UTBC 3AZJC 1U35A 1WWSA 3AZNB 4KGCC 5F99A 3X1UC 3WTPC 3X1TA 1P34B 5CP6D 3REIB 4WJ3C 3B6FB 2CV5B 4J8XB 1P3IB 1P3BB 4WU8D 5B31C 1WWIA 5JRGA 5C3IC 1H3OA 5BO0B 4R8PA 3VH6T 2FJ7A 2Y2OA 3C1BC 1BH8A 2AROB 3W97D 3REHC 3X1SA 4H9RA 3B6FA 5AVCA 4NE3A 1P3OA 2F8NG 3B6GD 5AV6A 5AV9D 5G49B 4J8VD 4NFTA 1KX3D 4X23D 3UT9A 3KUYA 1AOIC 4QLCB 3AN2C 1KX4D 1PZRA 5B2JB 5AV8A 3X1VC 5B31G 1P3FB 5GSUA 4KUDD 1P3KD 4Z66A 5BNVB 3C1CB 3RELB 3AZJD 5DNNC 3AZMB 2CWEA 3KFUG 3NQUA 3LZ0D 5JA4A 2Y2KA 5GXQA 3AV1C 3REJD 2JE5A 5GT0A 5B2IC 2ZM5A 4Z2MG 4YS3A 3LJAD 5B1MB 3AZFC 1M19A 5CP6B 1HQ3D 5GT3C 4ZBJB 2BYMB 4WU8B 3TU4A 3MGSC 5B40D 5B1LA 5AY8C 5BT1C 4H9QA 4H9NA 1P3MB 3W97B 5CPKD 1F1EA 3AYWA 2L5AA 3EPKA 4NE5A 1TZYC 2RVQC 3B6GB 4R8PC 3MGPA 3LZ1A 5CPJB 3AZNC 5AV9B 4J8VB 5BS7A 1P34C 2Y2PA 3REIC 1KX3B 4X23B 4H9OA 3AZLA 3B6FC 2CV5C 4J8XC 4CSRB 1P3IC 1S32B 1P3BC 3WTPE 3B0CW 2PYOA 5B0YA 4KUDB 1P3KB 2AROC 3MNNA 3A6NA 5DNMB 3WA9D 5B2ID 5BNXB 3KWQA 5GSUC 5B0ZD 3LZ0B 4XZQA 3AFAD 1KX4A 5AV5A 3REJB 3LJAB 5CPIB 4DRAA 3UTBA 3AZJA 4QLCC 1HQ3B 5B2JC 1P3FC 4KGCA 3X1UA 3VH5W 3WTPA 3LELB 3C1CC 3NQJB 3RELC 3AZMC 5B40B 4AWLC 3AV2D 1A7WA 5B31A 5CPKB 3C1BA 2CV5D 4CAYA 3REHA 2FFFB 5B1MC 5B32B 5KDMB 5CP6C 4Z5TD 4ZBJC 4WU8C 2YFWA 3MGRD 3EG5B 4J8UD 1N1JA 1P3MC 1AOIA 4J8WD 1P3LB 3AN2A 3W97C 3X1VA 3WA9B 3MVDD 3B6GC 3B0DB 2DF4C 5B0ZB 3AFAB 5AVBD 5CPJC 1BH9B 4QLCD 5DNNA 5AV9C 4J8VC 1KX3C 4X23C 3AV1A 3C1CD 1S32C 1ULYA 3B0BA 3F6TA 5B2IA 4WNNB 4JJNB 3RELD 3REKD 4KUDC 3AZFA 1P3KC 5GT3A 5DNMC 3AV2B 3MGSA 2HIOD 3H0RC 5B1MD 3LZ0C 4WNNA 5AY8A 3REJC 2J8PA 4UPKA 3W98D 3LJAC 5CPIC 1TZYA 3AZED 1M18D 4EO5B 1P3MD 1HQ3C 4Z5TB 3AZNA 1P34A 3P5JB 3LELC 2ZY3A 3REIA 3AZHD 5E5AD 3MGRB 2CV5A 4J8UB 4J8XA 5B40C 1P3IA 5CPJD 4UUZB 1P3BA 4J8WB 2Y2QA 5CPKC 5BO0A 3MGQD 1TAFB 2AROA 3MVDB 1S32D 5AVBB 3H0MC 2JSSA 1EQZD 5B32C 3WAAD 5G49A 5DNMD 2ZY2A 1F66B 2VQRA 3REKB 4QLCA 1P3LC 1P3PD 5B2JA 1P3FA 2DQNC 3WA9C 5BNVA 5CPID 2HIOB 3B0DC 4E45A 5B0ZC 3AFAC 3C1CA 5FUGB 3RELA 3AZMA 2F8NK 3EPHA 3W96D 2IO5B 4WV4B 2NQBD 3LELD 3W98B 3AZEB 1M18B 1KX5D 3KSYA 5B1MA 5CP6A 3AZHB 5E5AB 1M1AD 2BYMA 4WU8A 3AV2C 3UTAD 5B32D 1M18A 1P3MA 3MGQB 3EPJA 3W97A 3AZKD 3KXBD 1T3UA 2Y2NA 4WU9D
chains in the Genus database with same CATH topology
1EQZB 3W99D 3AZGD 1KU5A 3B6GA 4EO5C 3WAAB 5CPJA 4Z5TC 1P3LD 5AV9A 4J8VA 1R4VA 4ZUXD 1P3AD 1KX3A 4X23A 3MGRC 4DRBA 4J8UC 4CSRA 1Z2CB 1S32A 4J8WC 5B24B 3O62D 1P3PB 4KUDA 1P3KA 3MVDC 5DNMA 5AVBC 4JJND 2UWXA 5BNXA 3W96B 3LZ0A 4XUJD 2NQBB 3REJA 1HTAA 1ID3D 4HGAB 1KX5B 2F8NB 3LJAA 4M6BA 5CPIA 1F66C 3REKC 1HQ3A 3VH5A 1M1AB 3LELA 3UTAB 1JFIB 4LD9D 2HIOC 5B33D 3NQJA 2JCHA 5B40A 1KX5A 1U35D 3AZKB 3KXBB 2IO5C 4YM6B 5CPKA 1P3GB 4WU9B 3W98C 3W99B 3AZEC 3AZGB 1M18C 1ZLAB 5CHLB 3B0CT 5JRGD 5B32A 4ZUXB 5KDMA 3AZHC 1P3AB 3R45B 5E5AC 2YFVB 3O62B 2Y2LA 3WKJB 5AVCD 1P3OD 3A1KA 3MGQC 1W2EA 1P3LA 3VH6W 3WA9A 4G92B 1EQZC 1F66D 3WAAC 3UT9D 3KUYD 4WZSB 5B0ZA 3AFAA 4XUJB 1BH9A 1Q9CA 3VH5T 4H9PB 5AV8D 1ID3B 2XD1A 4Z66D 3AZID 4JJNA 5B24C 1P3PC 2NZDB 1B6WA 2RIQA 4KHAB 5GXQD 4LD9B 5B33B 2BYKB 5GT0D 1ID3A 3AV2A 1U35B 3W96C 5F99B 2G5HC 3X1TB 1M19D 2NQBC 4H9SC 4HGAC 4E44A 1KX5C 3TU4D 5JRGB 2BG1A 1H3OB 4R8PB 5B1LD 2FJ7B 1BH8B 4Z5TA 1M1AC 3AYWD 3X1SB 3UTAC 3MGRA 4H9RB 5AVCB 4J8UA 1P3OB 3MGPD 3LZ1D 4UUZA 4J8WA 5AV6B 3AZKC 3KXBC 4YM6C 1P3GC 4G91B 4WU9C 3H0LC 1TAFA 2HUEB 3W99C 3MVDA 3AZGC 3AZLD 3UT9B 3KUYB 1ZLAC 3A1IA 5AVBA 5B24D 5AV8B 4ZUXC 2F8NH 2PYOD 5B0YD 5GSUB 1P3AC 2Y2JA 4Z66B 3MNND 3A6ND 3AZIB 3O62C 3WKJC 1P3GD 1F66A 3NQUB 3KWQD 3REKA 4XZQD 5JA4B 5B32G 5GXQB 5AV5D 4JJNC 5GT0B 4G92C 2F8ND 4YS3B 3EPLA 2HIOA 3AZIA 1M19B 5FUGA 4XUJC 3UTBD 4AWLB 2XD5A 4KGCD 3X1UD 3WTPD 1ID3C 3W98A 3TU4B 2Y2HA 3AZEA 5B1LB 4H9QB 4H9NB 2F2AC 4Z2MH 5B31D 2NZDC 2W8SA 4YM6D 3AYWB 3AZHA 5E5AA 3C1BD 4LD9C 5B33C 2ZY5A 1ZLAD 3REHD 3MGPB 3LZ1B 1U35C 3AL0C 5F99C 3X1TC 3MGQA 4H9OB 3AZLB 1EQZA 5JRGC 3WKJD 3WAAA 2PYOB 5B0YB 2FJ7C 1AOID 1BFMA 3AN2D 3MNNB 3A6NB 3X1VD 2ZY4A 3X1SC 5AVCC 1P3OC 2Y2IA 3KWQB 4XZQB 5AV6C 5DNND 5B24A 1P3PA 1KX4B 5AV5B 4G91C 2HUEC 3UT9C 3KUYC 3FDDA 3AV1D 3UTBB 3AZJB 5AV8C 4KGCB 3W96A 2NZDD 3X1UB 3IP4C 3WTPB 3AZFD 4Z66C 2NQBA 5GT3D 3AZIC 4H9SA 2F8NA 5B31B 3MGSD 5F99D 3X1TD 5C3IB 5AY8D 5BT1D 5GXQC 3C1BB 1M1AA 4CAYB 5GT0C 3REHB 2Y2GA 4YS3C 3V9RB 3UTAA 1JFIA 1TZYD 1M19C 2RVQD 4R8PD 2FJ7D 3AZKA 3AZND 3KXBA 4YM6A 1P3GA 1P34D 4WU9A 3X1SD 3REID 1B67A 2YFWB 3TU4C 3B6FD 2G5IC 3W99A 3AZGA 1N1JB 1ZLAA 4J8XD 1P3ID 5B1LC 1P3BD 1AOIB 3V9RA 5AV6D 3AN2B 4NE6A 4ZUXA 3AYWC 3X1VB 1P3AA 3R45A 2Y2MA 2AROD 2LY8A 3MGPC 3LZ1C 2YFVA 5DNNB 3O62A 5BS7C 3WKJA 5GSUD 3VH6A 3AZLC 3AV1B 5B2IB 2PYOC 5B0YC 3AZFB 4XUJA 3MNNC 4H9PA 3A6NC 5GT3B 5B2JD 1P3FD 4YS3D 3MGSB 3KWQC 4DQYB 4XZQC 3AZMD 1KX4C 5AY8B 5AV5C 2NZDA 4KHAA 4LD9A 5B33A 2BYKA 1TZYB 3UTBC 3AZJC 1U35A 1WWSA 3AZNB 4KGCC 5F99A 3X1UC 3WTPC 3X1TA 1P34B 5CP6D 3REIB 4WJ3C 3B6FB 2CV5B 4J8XB 1P3IB 1P3BB 4WU8D 5B31C 1WWIA 5JRGA 5C3IC 1H3OA 5BO0B 4R8PA 3VH6T 2FJ7A 2Y2OA 3C1BC 1BH8A 2AROB 3W97D 3REHC 3X1SA 4H9RA 3B6FA 5AVCA 4NE3A 1P3OA 2F8NG 3B6GD 5AV6A 5AV9D 5G49B 4J8VD 4NFTA 1KX3D 4X23D 3UT9A 3KUYA 1AOIC 4QLCB 3AN2C 1KX4D 1PZRA 5B2JB 5AV8A 3X1VC 5B31G 1P3FB 5GSUA 4KUDD 1P3KD 4Z66A 5BNVB 3C1CB 3RELB 3AZJD 5DNNC 3AZMB 2CWEA 3KFUG 3NQUA 3LZ0D 5JA4A 2Y2KA 5GXQA 3AV1C 3REJD 2JE5A 5GT0A 5B2IC 2ZM5A 4Z2MG 4YS3A 3LJAD 5B1MB 3AZFC 1M19A 5CP6B 1HQ3D 5GT3C 4ZBJB 2BYMB 4WU8B 3TU4A 3MGSC 5B40D 5B1LA 5AY8C 5BT1C 4H9QA 4H9NA 1P3MB 3W97B 5CPKD 1F1EA 3AYWA 2L5AA 3EPKA 4NE5A 1TZYC 2RVQC 3B6GB 4R8PC 3MGPA 3LZ1A 5CPJB 3AZNC 5AV9B 4J8VB 5BS7A 1P34C 2Y2PA 3REIC 1KX3B 4X23B 4H9OA 3AZLA 3B6FC 2CV5C 4J8XC 4CSRB 1P3IC 1S32B 1P3BC 3WTPE 3B0CW 2PYOA 5B0YA 4KUDB 1P3KB 2AROC 3MNNA 3A6NA 5DNMB 3WA9D 5B2ID 5BNXB 3KWQA 5GSUC 5B0ZD 3LZ0B 4XZQA 3AFAD 1KX4A 5AV5A 3REJB 3LJAB 5CPIB 4DRAA 3UTBA 3AZJA 4QLCC 1HQ3B 5B2JC 1P3FC 4KGCA 3X1UA 3VH5W 3WTPA 3LELB 3C1CC 3NQJB 3RELC 3AZMC 5B40B 4AWLC 3AV2D 1A7WA 5B31A 5CPKB 3C1BA 2CV5D 4CAYA 3REHA 2FFFB 5B1MC 5B32B 5KDMB 5CP6C 4Z5TD 4ZBJC 4WU8C 2YFWA 3MGRD 3EG5B 4J8UD 1N1JA 1P3MC 1AOIA 4J8WD 1P3LB 3AN2A 3W97C 3X1VA 3WA9B 3MVDD 3B6GC 3B0DB 2DF4C 5B0ZB 3AFAB 5AVBD 5CPJC 1BH9B 4QLCD 5DNNA 5AV9C 4J8VC 1KX3C 4X23C 3AV1A 3C1CD 1S32C 1ULYA 3B0BA 3F6TA 5B2IA 4WNNB 4JJNB 3RELD 3REKD 4KUDC 3AZFA 1P3KC 5GT3A 5DNMC 3AV2B 3MGSA 2HIOD 3H0RC 5B1MD 3LZ0C 4WNNA 5AY8A 3REJC 2J8PA 4UPKA 3W98D 3LJAC 5CPIC 1TZYA 3AZED 1M18D 4EO5B 1P3MD 1HQ3C 4Z5TB 3AZNA 1P34A 3P5JB 3LELC 2ZY3A 3REIA 3AZHD 5E5AD 3MGRB 2CV5A 4J8UB 4J8XA 5B40C 1P3IA 5CPJD 4UUZB 1P3BA 4J8WB 2Y2QA 5CPKC 5BO0A 3MGQD 1TAFB 2AROA 3MVDB 1S32D 5AVBB 3H0MC 2JSSA 1EQZD 5B32C 3WAAD 5G49A 5DNMD 2ZY2A 1F66B 2VQRA 3REKB 4QLCA 1P3LC 1P3PD 5B2JA 1P3FA 2DQNC 3WA9C 5BNVA 5CPID 2HIOB 3B0DC 4E45A 5B0ZC 3AFAC 3C1CA 5FUGB 3RELA 3AZMA 2F8NK 3EPHA 3W96D 2IO5B 4WV4B 2NQBD 3LELD 3W98B 3AZEB 1M18B 1KX5D 3KSYA 5B1MA 5CP6A 3AZHB 5E5AB 1M1AD 2BYMA 4WU8A 3AV2C 3UTAD 5B32D 1M18A 1P3MA 3MGQB 3EPJA 3W97A 3AZKD 3KXBD 1T3UA 2Y2NA 4WU9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PZR A; 
#chains in the Genus database with same CATH topology
 1EQZ B;  3W99 D;  3AZG D;  1KU5 A;  3B6G A;  4EO5 C;  3WAA B;  5CPJ A;  4Z5T C;  1P3L D;  5AV9 A;  4J8V A;  1R4V A;  4ZUX D;  1P3A D;  1KX3 A;  4X23 A;  3MGR C;  4DRB A;  4J8U C;  4CSR A;  1Z2C B;  1S32 A;  4J8W C;  5B24 B;  3O62 D;  1P3P B;  4KUD A;  1P3K A;  3MVD C;  5DNM A;  5AVB C;  4JJN D;  2UWX A;  5BNX A;  3W96 B;  3LZ0 A;  4XUJ D;  2NQB B;  3REJ A;  1HTA A;  1ID3 D;  4HGA B;  1KX5 B;  2F8N B;  3LJA A;  4M6B A;  5CPI A;  1F66 C;  3REK C;  1HQ3 A;  3VH5 A;  1M1A B;  3LEL A;  3UTA B;  1JFI B;  4LD9 D;  2HIO C;  5B33 D;  3NQJ A;  2JCH A;  5B40 A;  1KX5 A;  1U35 D;  3AZK B;  3KXB B;  2IO5 C;  4YM6 B;  5CPK A;  1P3G B;  4WU9 B;  3W98 C;  3W99 B;  3AZE C;  3AZG B;  1M18 C;  1ZLA B;  5CHL B;  3B0C T;  5JRG D;  5B32 A;  4ZUX B;  5KDM A;  3AZH C;  1P3A B;  3R45 B;  5E5A C;  2YFV B;  3O62 B;  2Y2L A;  3WKJ B;  5AVC D;  1P3O D;  3A1K A;  3MGQ C;  1W2E A;  1P3L A;  3VH6 W;  3WA9 A;  4G92 B;  1EQZ C;  1F66 D;  3WAA C;  3UT9 D;  3KUY D;  4WZS B;  5B0Z A;  3AFA A;  4XUJ B;  1BH9 A;  1Q9C A;  3VH5 T;  4H9P B;  5AV8 D;  1ID3 B;  2XD1 A;  4Z66 D;  3AZI D;  4JJN A;  5B24 C;  1P3P C;  2NZD B;  1B6W A;  2RIQ A;  4KHA B;  5GXQ D;  4LD9 B;  5B33 B;  2BYK B;  5GT0 D;  1ID3 A;  3AV2 A;  1U35 B;  3W96 C;  5F99 B;  2G5H C;  3X1T B;  1M19 D;  2NQB C;  4H9S C;  4HGA C;  4E44 A;  1KX5 C;  3TU4 D;  5JRG B;  2BG1 A;  1H3O B;  4R8P B;  5B1L D;  2FJ7 B;  1BH8 B;  4Z5T A;  1M1A C;  3AYW D;  3X1S B;  3UTA C;  3MGR A;  4H9R B;  5AVC B;  4J8U A;  1P3O B;  3MGP D;  3LZ1 D;  4UUZ A;  4J8W A;  5AV6 B;  3AZK C;  3KXB C;  4YM6 C;  1P3G C;  4G91 B;  4WU9 C;  3H0L C;  1TAF A;  2HUE B;  3W99 C;  3MVD A;  3AZG C;  3AZL D;  3UT9 B;  3KUY B;  1ZLA C;  3A1I A;  5AVB A;  5B24 D;  5AV8 B;  4ZUX C;  2F8N H;  2PYO D;  5B0Y D;  5GSU B;  1P3A C;  2Y2J A;  4Z66 B;  3MNN D;  3A6N D;  3AZI B;  3O62 C;  3WKJ C;  1P3G D;  1F66 A;  3NQU B;  3KWQ D;  3REK A;  4XZQ D;  5JA4 B;  5B32 G;  5GXQ B;  5AV5 D;  4JJN C;  5GT0 B;  4G92 C;  2F8N D;  4YS3 B;  3EPL A;  2HIO A;  3AZI A;  1M19 B;  5FUG A;  4XUJ C;  3UTB D;  4AWL B;  2XD5 A;  4KGC D;  3X1U D;  3WTP D;  1ID3 C;  3W98 A;  3TU4 B;  2Y2H A;  3AZE A;  5B1L B;  4H9Q B;  4H9N B;  2F2A C;  4Z2M H;  5B31 D;  2NZD C;  2W8S A;  4YM6 D;  3AYW B;  3AZH A;  5E5A A;  3C1B D;  4LD9 C;  5B33 C;  2ZY5 A;  1ZLA D;  3REH D;  3MGP B;  3LZ1 B;  1U35 C;  3AL0 C;  5F99 C;  3X1T C;  3MGQ A;  4H9O B;  3AZL B;  1EQZ A;  5JRG C;  3WKJ D;  3WAA A;  2PYO B;  5B0Y B;  2FJ7 C;  1AOI D;  1BFM A;  3AN2 D;  3MNN B;  3A6N B;  3X1V D;  2ZY4 A;  3X1S C;  5AVC C;  1P3O C;  2Y2I A;  3KWQ B;  4XZQ B;  5AV6 C;  5DNN D;  5B24 A;  1P3P A;  1KX4 B;  5AV5 B;  4G91 C;  2HUE C;  3UT9 C;  3KUY C;  3FDD A;  3AV1 D;  3UTB B;  3AZJ B;  5AV8 C;  4KGC B;  3W96 A;  2NZD D;  3X1U B;  3IP4 C;  3WTP B;  3AZF D;  4Z66 C;  2NQB A;  5GT3 D;  3AZI C;  4H9S A;  2F8N A;  5B31 B;  3MGS D;  5F99 D;  3X1T D;  5C3I B;  5AY8 D;  5BT1 D;  5GXQ C;  3C1B B;  1M1A A;  4CAY B;  5GT0 C;  3REH B;  2Y2G A;  4YS3 C;  3V9R B;  3UTA A;  1JFI A;  1TZY D;  1M19 C;  2RVQ D;  4R8P D;  2FJ7 D;  3AZK A;  3AZN D;  3KXB A;  4YM6 A;  1P3G A;  1P34 D;  4WU9 A;  3X1S D;  3REI D;  1B67 A;  2YFW B;  3TU4 C;  3B6F D;  2G5I C;  3W99 A;  3AZG A;  1N1J B;  1ZLA A;  4J8X D;  1P3I D;  5B1L C;  1P3B D;  1AOI B;  3V9R A;  5AV6 D;  3AN2 B;  4NE6 A;  4ZUX A;  3AYW C;  3X1V B;  1P3A A;  3R45 A;  2Y2M A;  2ARO D;  2LY8 A;  3MGP C;  3LZ1 C;  2YFV A;  5DNN B;  3O62 A;  5BS7 C;  3WKJ A;  5GSU D;  3VH6 A;  3AZL C;  3AV1 B;  5B2I B;  2PYO C;  5B0Y C;  3AZF B;  4XUJ A;  3MNN C;  4H9P A;  3A6N C;  5GT3 B;  5B2J D;  1P3F D;  4YS3 D;  3MGS B;  3KWQ C;  4DQY B;  4XZQ C;  3AZM D;  1KX4 C;  5AY8 B;  5AV5 C;  2NZD A;  4KHA A;  4LD9 A;  5B33 A;  2BYK A;  1TZY B;  3UTB C;  3AZJ C;  1U35 A;  1WWS A;  3AZN B;  4KGC C;  5F99 A;  3X1U C;  3WTP C;  3X1T A;  1P34 B;  5CP6 D;  3REI B;  4WJ3 C;  3B6F B;  2CV5 B;  4J8X B;  1P3I B;  1P3B B;  4WU8 D;  5B31 C;  1WWI A;  5JRG A;  5C3I C;  1H3O A;  5BO0 B;  4R8P A;  3VH6 T;  2FJ7 A;  2Y2O A;  3C1B C;  1BH8 A;  2ARO B;  3W97 D;  3REH C;  3X1S A;  4H9R A;  3B6F A;  5AVC A;  4NE3 A;  1P3O A;  2F8N G;  3B6G D;  5AV6 A;  5AV9 D;  5G49 B;  4J8V D;  4NFT A;  1KX3 D;  4X23 D;  3UT9 A;  3KUY A;  1AOI C;  4QLC B;  3AN2 C;  1KX4 D;  1PZR A;  5B2J B;  5AV8 A;  3X1V C;  5B31 G;  1P3F B;  5GSU A;  4KUD D;  1P3K D;  4Z66 A;  5BNV B;  3C1C B;  3REL B;  3AZJ D;  5DNN C;  3AZM B;  2CWE A;  3KFU G;  3NQU A;  3LZ0 D;  5JA4 A;  2Y2K A;  5GXQ A;  3AV1 C;  3REJ D;  2JE5 A;  5GT0 A;  5B2I C;  2ZM5 A;  4Z2M G;  4YS3 A;  3LJA D;  5B1M B;  3AZF C;  1M19 A;  5CP6 B;  1HQ3 D;  5GT3 C;  4ZBJ B;  2BYM B;  4WU8 B;  3TU4 A;  3MGS C;  5B40 D;  5B1L A;  5AY8 C;  5BT1 C;  4H9Q A;  4H9N A;  1P3M B;  3W97 B;  5CPK D;  1F1E A;  3AYW A;  2L5A A;  3EPK A;  4NE5 A;  1TZY C;  2RVQ C;  3B6G B;  4R8P C;  3MGP A;  3LZ1 A;  5CPJ B;  3AZN C;  5AV9 B;  4J8V B;  5BS7 A;  1P34 C;  2Y2P A;  3REI C;  1KX3 B;  4X23 B;  4H9O A;  3AZL A;  3B6F C;  2CV5 C;  4J8X C;  4CSR B;  1P3I C;  1S32 B;  1P3B C;  3WTP E;  3B0C W;  2PYO A;  5B0Y A;  4KUD B;  1P3K B;  2ARO C;  3MNN A;  3A6N A;  5DNM B;  3WA9 D;  5B2I D;  5BNX B;  3KWQ A;  5GSU C;  5B0Z D;  3LZ0 B;  4XZQ A;  3AFA D;  1KX4 A;  5AV5 A;  3REJ B;  3LJA B;  5CPI B;  4DRA A;  3UTB A;  3AZJ A;  4QLC C;  1HQ3 B;  5B2J C;  1P3F C;  4KGC A;  3X1U A;  3VH5 W;  3WTP A;  3LEL B;  3C1C C;  3NQJ B;  3REL C;  3AZM C;  5B40 B;  4AWL C;  3AV2 D;  1A7W A;  5B31 A;  5CPK B;  3C1B A;  2CV5 D;  4CAY A;  3REH A;  2FFF B;  5B1M C;  5B32 B;  5KDM B;  5CP6 C;  4Z5T D;  4ZBJ C;  4WU8 C;  2YFW A;  3MGR D;  3EG5 B;  4J8U D;  1N1J A;  1P3M C;  1AOI A;  4J8W D;  1P3L B;  3AN2 A;  3W97 C;  3X1V A;  3WA9 B;  3MVD D;  3B6G C;  3B0D B;  2DF4 C;  5B0Z B;  3AFA B;  5AVB D;  5CPJ C;  1BH9 B;  4QLC D;  5DNN A;  5AV9 C;  4J8V C;  1KX3 C;  4X23 C;  3AV1 A;  3C1C D;  1S32 C;  1ULY A;  3B0B A;  3F6T A;  5B2I A;  4WNN B;  4JJN B;  3REL D;  3REK D;  4KUD C;  3AZF A;  1P3K C;  5GT3 A;  5DNM C;  3AV2 B;  3MGS A;  2HIO D;  3H0R C;  5B1M D;  3LZ0 C;  4WNN A;  5AY8 A;  3REJ C;  2J8P A;  4UPK A;  3W98 D;  3LJA C;  5CPI C;  1TZY A;  3AZE D;  1M18 D;  4EO5 B;  1P3M D;  1HQ3 C;  4Z5T B;  3AZN A;  1P34 A;  3P5J B;  3LEL C;  2ZY3 A;  3REI A;  3AZH D;  5E5A D;  3MGR B;  2CV5 A;  4J8U B;  4J8X A;  5B40 C;  1P3I A;  5CPJ D;  4UUZ B;  1P3B A;  4J8W B;  2Y2Q A;  5CPK C;  5BO0 A;  3MGQ D;  1TAF B;  2ARO A;  3MVD B;  1S32 D;  5AVB B;  3H0M C;  2JSS A;  1EQZ D;  5B32 C;  3WAA D;  5G49 A;  5DNM D;  2ZY2 A;  1F66 B;  2VQR A;  3REK B;  4QLC A;  1P3L C;  1P3P D;  5B2J A;  1P3F A;  2DQN C;  3WA9 C;  5BNV A;  5CPI D;  2HIO B;  3B0D C;  4E45 A;  5B0Z C;  3AFA C;  3C1C A;  5FUG B;  3REL A;  3AZM A;  2F8N K;  3EPH A;  3W96 D;  2IO5 B;  4WV4 B;  2NQB D;  3LEL D;  3W98 B;  3AZE B;  1M18 B;  1KX5 D;  3KSY A;  5B1M A;  5CP6 A;  3AZH B;  5E5A B;  1M1A D;  2BYM A;  4WU8 A;  3AV2 C;  3UTA D;  5B32 D;  1M18 A;  1P3M A;  3MGQ B;  3EPJ A;  3W97 A;  3AZK D;  3KXB D;  1T3U A;  2Y2N A;  4WU9 D; 
#chains in the Genus database with same CATH homology
 1EQZ B;  3W99 D;  3AZG D;  1KU5 A;  3B6G A;  4EO5 C;  3WAA B;  5CPJ A;  4Z5T C;  1P3L D;  5AV9 A;  4J8V A;  1R4V A;  4ZUX D;  1P3A D;  1KX3 A;  4X23 A;  3MGR C;  4DRB A;  4J8U C;  4CSR A;  1Z2C B;  1S32 A;  4J8W C;  5B24 B;  3O62 D;  1P3P B;  4KUD A;  1P3K A;  3MVD C;  5DNM A;  5AVB C;  4JJN D;  2UWX A;  5BNX A;  3W96 B;  3LZ0 A;  4XUJ D;  2NQB B;  3REJ A;  1HTA A;  1ID3 D;  4HGA B;  1KX5 B;  2F8N B;  3LJA A;  4M6B A;  5CPI A;  1F66 C;  3REK C;  1HQ3 A;  3VH5 A;  1M1A B;  3LEL A;  3UTA B;  1JFI B;  4LD9 D;  2HIO C;  5B33 D;  3NQJ A;  2JCH A;  5B40 A;  1KX5 A;  1U35 D;  3AZK B;  3KXB B;  2IO5 C;  4YM6 B;  5CPK A;  1P3G B;  4WU9 B;  3W98 C;  3W99 B;  3AZE C;  3AZG B;  1M18 C;  1ZLA B;  5CHL B;  3B0C T;  5JRG D;  5B32 A;  4ZUX B;  5KDM A;  3AZH C;  1P3A B;  3R45 B;  5E5A C;  2YFV B;  3O62 B;  2Y2L A;  3WKJ B;  5AVC D;  1P3O D;  3A1K A;  3MGQ C;  1W2E A;  1P3L A;  3VH6 W;  3WA9 A;  4G92 B;  1EQZ C;  1F66 D;  3WAA C;  3UT9 D;  3KUY D;  4WZS B;  5B0Z A;  3AFA A;  4XUJ B;  1BH9 A;  1Q9C A;  3VH5 T;  4H9P B;  5AV8 D;  1ID3 B;  2XD1 A;  4Z66 D;  3AZI D;  4JJN A;  5B24 C;  1P3P C;  2NZD B;  1B6W A;  2RIQ A;  4KHA B;  5GXQ D;  4LD9 B;  5B33 B;  2BYK B;  5GT0 D;  1ID3 A;  3AV2 A;  1U35 B;  3W96 C;  5F99 B;  2G5H C;  3X1T B;  1M19 D;  2NQB C;  4H9S C;  4HGA C;  4E44 A;  1KX5 C;  3TU4 D;  5JRG B;  2BG1 A;  1H3O B;  4R8P B;  5B1L D;  2FJ7 B;  1BH8 B;  4Z5T A;  1M1A C;  3AYW D;  3X1S B;  3UTA C;  3MGR A;  4H9R B;  5AVC B;  4J8U A;  1P3O B;  3MGP D;  3LZ1 D;  4UUZ A;  4J8W A;  5AV6 B;  3AZK C;  3KXB C;  4YM6 C;  1P3G C;  4G91 B;  4WU9 C;  3H0L C;  1TAF A;  2HUE B;  3W99 C;  3MVD A;  3AZG C;  3AZL D;  3UT9 B;  3KUY B;  1ZLA C;  3A1I A;  5AVB A;  5B24 D;  5AV8 B;  4ZUX C;  2F8N H;  2PYO D;  5B0Y D;  5GSU B;  1P3A C;  2Y2J A;  4Z66 B;  3MNN D;  3A6N D;  3AZI B;  3O62 C;  3WKJ C;  1P3G D;  1F66 A;  3NQU B;  3KWQ D;  3REK A;  4XZQ D;  5JA4 B;  5B32 G;  5GXQ B;  5AV5 D;  4JJN C;  5GT0 B;  4G92 C;  2F8N D;  4YS3 B;  3EPL A;  2HIO A;  3AZI A;  1M19 B;  5FUG A;  4XUJ C;  3UTB D;  4AWL B;  2XD5 A;  4KGC D;  3X1U D;  3WTP D;  1ID3 C;  3W98 A;  3TU4 B;  2Y2H A;  3AZE A;  5B1L B;  4H9Q B;  4H9N B;  2F2A C;  4Z2M H;  5B31 D;  2NZD C;  2W8S A;  4YM6 D;  3AYW B;  3AZH A;  5E5A A;  3C1B D;  4LD9 C;  5B33 C;  2ZY5 A;  1ZLA D;  3REH D;  3MGP B;  3LZ1 B;  1U35 C;  3AL0 C;  5F99 C;  3X1T C;  3MGQ A;  4H9O B;  3AZL B;  1EQZ A;  5JRG C;  3WKJ D;  3WAA A;  2PYO B;  5B0Y B;  2FJ7 C;  1AOI D;  1BFM A;  3AN2 D;  3MNN B;  3A6N B;  3X1V D;  2ZY4 A;  3X1S C;  5AVC C;  1P3O C;  2Y2I A;  3KWQ B;  4XZQ B;  5AV6 C;  5DNN D;  5B24 A;  1P3P A;  1KX4 B;  5AV5 B;  4G91 C;  2HUE C;  3UT9 C;  3KUY C;  3FDD A;  3AV1 D;  3UTB B;  3AZJ B;  5AV8 C;  4KGC B;  3W96 A;  2NZD D;  3X1U B;  3IP4 C;  3WTP B;  3AZF D;  4Z66 C;  2NQB A;  5GT3 D;  3AZI C;  4H9S A;  2F8N A;  5B31 B;  3MGS D;  5F99 D;  3X1T D;  5C3I B;  5AY8 D;  5BT1 D;  5GXQ C;  3C1B B;  1M1A A;  4CAY B;  5GT0 C;  3REH B;  2Y2G A;  4YS3 C;  3V9R B;  3UTA A;  1JFI A;  1TZY D;  1M19 C;  2RVQ D;  4R8P D;  2FJ7 D;  3AZK A;  3AZN D;  3KXB A;  4YM6 A;  1P3G A;  1P34 D;  4WU9 A;  3X1S D;  3REI D;  1B67 A;  2YFW B;  3TU4 C;  3B6F D;  2G5I C;  3W99 A;  3AZG A;  1N1J B;  1ZLA A;  4J8X D;  1P3I D;  5B1L C;  1P3B D;  1AOI B;  3V9R A;  5AV6 D;  3AN2 B;  4NE6 A;  4ZUX A;  3AYW C;  3X1V B;  1P3A A;  3R45 A;  2Y2M A;  2ARO D;  2LY8 A;  3MGP C;  3LZ1 C;  2YFV A;  5DNN B;  3O62 A;  5BS7 C;  3WKJ A;  5GSU D;  3VH6 A;  3AZL C;  3AV1 B;  5B2I B;  2PYO C;  5B0Y C;  3AZF B;  4XUJ A;  3MNN C;  4H9P A;  3A6N C;  5GT3 B;  5B2J D;  1P3F D;  4YS3 D;  3MGS B;  3KWQ C;  4DQY B;  4XZQ C;  3AZM D;  1KX4 C;  5AY8 B;  5AV5 C;  2NZD A;  4KHA A;  4LD9 A;  5B33 A;  2BYK A;  1TZY B;  3UTB C;  3AZJ C;  1U35 A;  1WWS A;  3AZN B;  4KGC C;  5F99 A;  3X1U C;  3WTP C;  3X1T A;  1P34 B;  5CP6 D;  3REI B;  4WJ3 C;  3B6F B;  2CV5 B;  4J8X B;  1P3I B;  1P3B B;  4WU8 D;  5B31 C;  1WWI A;  5JRG A;  5C3I C;  1H3O A;  5BO0 B;  4R8P A;  3VH6 T;  2FJ7 A;  2Y2O A;  3C1B C;  1BH8 A;  2ARO B;  3W97 D;  3REH C;  3X1S A;  4H9R A;  3B6F A;  5AVC A;  4NE3 A;  1P3O A;  2F8N G;  3B6G D;  5AV6 A;  5AV9 D;  5G49 B;  4J8V D;  4NFT A;  1KX3 D;  4X23 D;  3UT9 A;  3KUY A;  1AOI C;  4QLC B;  3AN2 C;  1KX4 D;  1PZR A;  5B2J B;  5AV8 A;  3X1V C;  5B31 G;  1P3F B;  5GSU A;  4KUD D;  1P3K D;  4Z66 A;  5BNV B;  3C1C B;  3REL B;  3AZJ D;  5DNN C;  3AZM B;  2CWE A;  3KFU G;  3NQU A;  3LZ0 D;  5JA4 A;  2Y2K A;  5GXQ A;  3AV1 C;  3REJ D;  2JE5 A;  5GT0 A;  5B2I C;  2ZM5 A;  4Z2M G;  4YS3 A;  3LJA D;  5B1M B;  3AZF C;  1M19 A;  5CP6 B;  1HQ3 D;  5GT3 C;  4ZBJ B;  2BYM B;  4WU8 B;  3TU4 A;  3MGS C;  5B40 D;  5B1L A;  5AY8 C;  5BT1 C;  4H9Q A;  4H9N A;  1P3M B;  3W97 B;  5CPK D;  1F1E A;  3AYW A;  2L5A A;  3EPK A;  4NE5 A;  1TZY C;  2RVQ C;  3B6G B;  4R8P C;  3MGP A;  3LZ1 A;  5CPJ B;  3AZN C;  5AV9 B;  4J8V B;  5BS7 A;  1P34 C;  2Y2P A;  3REI C;  1KX3 B;  4X23 B;  4H9O A;  3AZL A;  3B6F C;  2CV5 C;  4J8X C;  4CSR B;  1P3I C;  1S32 B;  1P3B C;  3WTP E;  3B0C W;  2PYO A;  5B0Y A;  4KUD B;  1P3K B;  2ARO C;  3MNN A;  3A6N A;  5DNM B;  3WA9 D;  5B2I D;  5BNX B;  3KWQ A;  5GSU C;  5B0Z D;  3LZ0 B;  4XZQ A;  3AFA D;  1KX4 A;  5AV5 A;  3REJ B;  3LJA B;  5CPI B;  4DRA A;  3UTB A;  3AZJ A;  4QLC C;  1HQ3 B;  5B2J C;  1P3F C;  4KGC A;  3X1U A;  3VH5 W;  3WTP A;  3LEL B;  3C1C C;  3NQJ B;  3REL C;  3AZM C;  5B40 B;  4AWL C;  3AV2 D;  1A7W A;  5B31 A;  5CPK B;  3C1B A;  2CV5 D;  4CAY A;  3REH A;  2FFF B;  5B1M C;  5B32 B;  5KDM B;  5CP6 C;  4Z5T D;  4ZBJ C;  4WU8 C;  2YFW A;  3MGR D;  3EG5 B;  4J8U D;  1N1J A;  1P3M C;  1AOI A;  4J8W D;  1P3L B;  3AN2 A;  3W97 C;  3X1V A;  3WA9 B;  3MVD D;  3B6G C;  3B0D B;  2DF4 C;  5B0Z B;  3AFA B;  5AVB D;  5CPJ C;  1BH9 B;  4QLC D;  5DNN A;  5AV9 C;  4J8V C;  1KX3 C;  4X23 C;  3AV1 A;  3C1C D;  1S32 C;  1ULY A;  3B0B A;  3F6T A;  5B2I A;  4WNN B;  4JJN B;  3REL D;  3REK D;  4KUD C;  3AZF A;  1P3K C;  5GT3 A;  5DNM C;  3AV2 B;  3MGS A;  2HIO D;  3H0R C;  5B1M D;  3LZ0 C;  4WNN A;  5AY8 A;  3REJ C;  2J8P A;  4UPK A;  3W98 D;  3LJA C;  5CPI C;  1TZY A;  3AZE D;  1M18 D;  4EO5 B;  1P3M D;  1HQ3 C;  4Z5T B;  3AZN A;  1P34 A;  3P5J B;  3LEL C;  2ZY3 A;  3REI A;  3AZH D;  5E5A D;  3MGR B;  2CV5 A;  4J8U B;  4J8X A;  5B40 C;  1P3I A;  5CPJ D;  4UUZ B;  1P3B A;  4J8W B;  2Y2Q A;  5CPK C;  5BO0 A;  3MGQ D;  1TAF B;  2ARO A;  3MVD B;  1S32 D;  5AVB B;  3H0M C;  2JSS A;  1EQZ D;  5B32 C;  3WAA D;  5G49 A;  5DNM D;  2ZY2 A;  1F66 B;  2VQR A;  3REK B;  4QLC A;  1P3L C;  1P3P D;  5B2J A;  1P3F A;  2DQN C;  3WA9 C;  5BNV A;  5CPI D;  2HIO B;  3B0D C;  4E45 A;  5B0Z C;  3AFA C;  3C1C A;  5FUG B;  3REL A;  3AZM A;  2F8N K;  3EPH A;  3W96 D;  2IO5 B;  4WV4 B;  2NQB D;  3LEL D;  3W98 B;  3AZE B;  1M18 B;  1KX5 D;  3KSY A;  5B1M A;  5CP6 A;  3AZH B;  5E5A B;  1M1A D;  2BYM A;  4WU8 A;  3AV2 C;  3UTA D;  5B32 D;  1M18 A;  1P3M A;  3MGQ B;  3EPJ A;  3W97 A;  3AZK D;  3KXB D;  1T3U A;  2Y2N A;  4WU9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...