1PZZA

Crystal structure of fgf-1, v51n mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
140
structure length
140
Chain Sequence
b'HHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESNGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Sequence swapping does not result in conformation swapping for the beta4/beta5 and beta8/beta9 beta-hairpin turns in human acidic fibroblast growth factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 38
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1pzzA00
2VUAA 1R8NA 4Q9PA 1PUUB 3OBRA 1HCDA 2X2SA 1EVTA 1DJSB 1Q1UA 1I1BA 2FFUA 3C9ZA 4I8MA 4OWLA 2GO2A 2Q3NB 3N7KA 3NBCA 4GOYA 4LO2A 4F83A 2Y9GA 3K1XA 4Q9GA 4USPA 2K43A 4TLPA 3F62B 1ILR1 1FMZA 4L4IA 4D0TA 1DQGA 2LIQA 2NZ9A 5E24E 4ISQA 4QKSA 3FJKA 3FJFA 4P0KA 4XFTA 2R9KB 3NBDA 4Z9WB 2J3PA 3BAHA 2RG9B 3BA4A 1JLXA 3FJEA 3H6SE 4QBCA 3P6IA 1EV2A 4HR6C 2D1ZA 3O4BA 3O4OA 1AXMA 3O44A 2KKIA 3OGGA 5FZYA 1Q04A 1T9FA 4KEJA 1TTUA 1XG6A 2D44A 5EC5A 1BARA 3HOMA 4OWJA 1SR4A 3S8KA 1FV2A 2Z49A 3EF2A 1AVXB 9ILBA 2D22A 5BXRA 4QD2C 4USOA 1E0OA 4ZKTB 2KI4A 1EYLA 4EKXB 2VSAA 1WD4A 4JKQA 2UUSA 2NP0A 2XOAA 4I4PA 3UDAA 1JT4A 3A07A 5FNWA 4IZXA 3Q7XA 1YBIA 1KNMA 1M16A 4HJJA 1PUMB 3H6QA 1FQ9A 1FV3A 4QD2B 3PUBA 3FJIA 3O49A 1BFCA 1RY7A 1W3AA 4I4RA 1HWOB 2FGFA 1G9CA 4IY9A 1HWNB 1ISVA 2DRYA 3KMVA 4I4YA 4GAFA 2BFHA 3CA6A 3R4SA 3O3QA 3V0BB 31BIA 3OBTA 1ISWA 4G6MA 3JUTA 2K4AB 4G9NA 4IQPA 1FGAA 4AN7B 3CA3A 2Y9WC 4LO3C 1HKNA 4PC4A 4LO1C 1NUNA 3BA5A 1PWAA 4JQ0A 4X3AA 1ISYA 1XHBA 3WINA 4IZEA 1DZCA 5D61A 4KC3A 3AZVA 5BQUA 3OJ2A 3BA7A 1W3GA 3AKHA 3S8JA 5BP5A 3N0KA 1ISXA 1V6VA 3O4AA 1TWMA 2IHOA 4II0A 5EG6C 1HCEA 1FWUA 4J23B 4LO0A 5BQUC 5F8YA 1V6UA 4JRAA 4JKXB 1K5VA 3CAHA 3VWCA 3ZC8A 2IWTB 3RTIB 3RMXA 4IY8A 3ZXDA 1QQLA 2D24A 4Q91A 3FUOA 3V0AA 1II4A 3UD9A 5F90A 4ZGRB 1HWPB 2NM1A 2E4MC 1W3FA 1Z0HA 4QKRA 1S0DA 1EPWA 3A21A 3BAOA 3POKA 3P6JA 1BASA 2LIEA 4LO2C 3QYDA 3IM5A 4LO7C 1S0CA 4I3NA 3QR5A 1S0GA 3H6RA 3HSMA 3BB2A 1OQLB 2L5XA 1JLYA 3UJ0A 3AKGA 4KEIA 4ZOTA 1J0SA 4FGFA 3FGMA 4X38A 3OJVA 2AAIB 1T4QA 4OEEA 1RG8A 2AQZA 2MC2A 3BX1C 2P39A 3FJJA 4HA2A 4LO7B 1VCLA 2F2FA 5JMCA 3LLPA 4XFUA 1BLAA 4KBBA 2VXRA 5EHAA 3CRIA 4I96A 5DVHA 3A22A 4P6AA 3BAUA 1IOBA 2WBCA 4AN6A 3F1RA 3I2XA 1DZDA 2MIBA 3VT1A 3FJDA 5DUYA 3JRRA 1JTCA 3AJ6A 1HIBA 3ILAA 2WRYA 2ZR1B 1AF9A 3FJBA 4DCKC 3VUOA 1R8OA 5FZZA 1Z4SA 5B2HA 3BTAA 2RSTA 4OUJA 2VXTI 1SR4C 3WO4A 3VSZA 3AH4A 3AZWA 3FJCA 1JT3A 1YTOA 1S0BA 3FJ9A 1F31A 1Z2VA 1IILA 2MLLB 3IIRA 3BRFA 3O4CA 2Y9FA 2FDBM 4G6JA 3SNVA 2GZBA 1ISZA 5BXPA 3IM7A 5FNXA 1S0FA 4ISRA 4J2XA 2KLLA 3FJAA 3I29B 3ZX7A 3CA4A 4P0JA 4F34A 5I1BA 4J2KA 1I1EA 1JT7A 1GGPB 4LO8B 3V79C 3CRHA 2D23A 3UJ4A 3VEQA 3W9TA 1P63A 5BXSA 1YYNA 3FJHA 4I4QA 6I1BA 2ESUA 1G9BA 3HBWA 4I37A 3HMYA 4ZFYB 4I0YA 1WD3A 2D7IA 4JP0A 2Y9XE 1DFCA 3P53A 1SZ6B 1IJTA 1V6WA 3Q7WA 3D7WB 1ONKB 1DLLA 4EFPA 3CA0A 1DIWA 1WBCA 3VSFA 3PMEA 4J2SA 4IYBA 2HWMA 4I1BA 2YUGA 3B9UA 5D62A 3WINC 41BIA 1G9AA 1IHKA 3MPPG 4D8HA 4OEGA 3AH2A 4EEEB 1JY0A 2D7RA 2K8RA 5BP5C 5D63A 2KI6B 3AKFA 3NBNA 4I4SA 4XFSA 2BEAA 1TWEA 4QC4A 1WBAA 4I4OA 2X2TA 2BEBA 4LO0C 3WMVA 4G1RA 1N4KA 5F8WA 3I2AA 4A7ZA 2HWAA 4JAWA 1S0LA 3TC2A 1G9DA 3NJ5A 4L4HA 2D20A 4DEPA 4H04A 4DENA 4QBVA 4EFQA 3AKIA 2QN4A 3IM6A 1DQOA 1A8DA 4FVVA 3N7LA 4A7KA 1RZOB 2DS0A 4OEFA 4I6IA 3BAVA 4QALA 4YOLA 3ZC9A 8I1BA 3RTJB 3ZXGA 1NZKA 1IRPA 3BADA 5DSSB 4QO3A 3V0AB 3VT0A 1QXMA 1AVUA 2RQ9A 2Z48A 5GAQA 4J2YA 3FJ8A 1ITBA 3T8SA 1K5UA 3LTQA 7I1BA 1AVAC 1RMLA 2AFGA 1IRAX 4I1EA 3RMYA 1HWMB 4ZBVB 1BLDA 3PG0A 3AJ5A 1TOOA 4ZLBB 2F2FC 3BRGC 3BAGA 3WA1A 2NYYA 3H6RB 4WBCA 1S0EA 2ET2A 5F8SA 4KEKA 1TIEA 2VU9A 3N7JA 1L2HA 1PC8B 1BFGA 4ZA3B 3RSJA 1IT0A 1V6XA 4EB2B 2D43A 4G9MA 1PZZA 4EFRA 3IAGC 4X39A 4GAIA 4OWKA 3AH1A 2KH2A 1G82A 3NBEA 1M2TB 3UD7A 5HPZA 3Q7YA 1XYFA 1QQKA 3CA5A 4R6UB 3R4UA 3V0BA 3O5WB 4ZFWB 1MC9A 1TP0A 5DZUA 1YXWA 4P0LA 1BFFA 4X37A 2NTDA 2DRZA 1D0HA 3CU1B 1Q03A 1FMMS 2AXMA 2HZ9A 3UD8A 4ENDA 4D0ZA 5BXTA 4OW4A 1YF8B 2ZQOA 3FUQA 1JQZA 3E8LC 2F8XC 3OJMA 3VT2A 1BFBA 3OGFA 3WO2A 1JT5A 1BA7A 3N7MA 2Q9XA 4LO3A 5BVPI 4LO1A 4I4VA 2P23A 4JPZA 3FFZA 3PHZA 4I4XA 3HN1A 5BOWA 3O4DA 5FZUA 4ZFUB 21BIA 2FO1A 4A7YA 5JLVA 4GOVA 2DREA 4GP3A 3WMUA 1CE7B 1FN0A 1MD6A 3HALA 2VLCA 2HW9A 4CJMA 4IONA 3WO3A 4H9WA 4I4UA 2ZQNA 3BAQA 2ERMA 5G00A 2NVHA 3CRGA 2VSEA 1XZZA 1AFCA 3BRDA 3CA1A 4XKIA 3CQAA 1FWVA 2I1BA 2M49A 4I7IA 1AVWB 1DFQA 4IHZA 2FFVA 3A23A 1CVSA 4Z8SB 3MALA 2QYIB 1UPSA 4GP0A 1ABRB 1TFMB 2E4MA 4I2SA
chains in the Genus database with same CATH superfamily
2VUAA 1R8NA 4Q9PA 1PUUB 3OBRA 1HCDA 2X2SA 1EVTA 1DJSB 1Q1UA 1I1BA 2FFUA 3C9ZA 4I8MA 4OWLA 2GO2A 2Q3NB 3N7KA 3NBCA 4GOYA 4LO2A 4F83A 2Y9GA 3K1XA 4Q9GA 4USPA 2K43A 4TLPA 3F62B 1ILR1 1FMZA 4L4IA 4D0TA 1DQGA 2LIQA 2NZ9A 5E24E 4ISQA 4QKSA 3FJKA 3FJFA 4P0KA 4XFTA 2R9KB 3NBDA 4Z9WB 2J3PA 3BAHA 2RG9B 3BA4A 1JLXA 3FJEA 3H6SE 4QBCA 3P6IA 1EV2A 4HR6C 2D1ZA 3O4BA 3O4OA 1AXMA 3O44A 2KKIA 3OGGA 5FZYA 1Q04A 1T9FA 4KEJA 1TTUA 1XG6A 2D44A 5EC5A 1BARA 3HOMA 4OWJA 1SR4A 3S8KA 1FV2A 2Z49A 3EF2A 1AVXB 9ILBA 2D22A 5BXRA 4QD2C 4USOA 1E0OA 4ZKTB 2KI4A 1EYLA 4EKXB 2VSAA 1WD4A 4JKQA 2UUSA 2NP0A 2XOAA 4I4PA 3UDAA 1JT4A 3A07A 5FNWA 4IZXA 3Q7XA 1YBIA 1KNMA 1M16A 4HJJA 1PUMB 3H6QA 1FQ9A 1FV3A 4QD2B 3PUBA 3FJIA 3O49A 1BFCA 1RY7A 1W3AA 4I4RA 1HWOB 2FGFA 1G9CA 4IY9A 1HWNB 1ISVA 2DRYA 3KMVA 4I4YA 4GAFA 2BFHA 3CA6A 3R4SA 3O3QA 3V0BB 31BIA 3OBTA 1ISWA 4G6MA 4UY4A 3JUTA 2K4AB 4G9NA 4IQPA 1FGAA 4AN7B 3CA3A 2Y9WC 4LO3C 1HKNA 4PC4A 4LO1C 1NUNA 3BA5A 1PWAA 4JQ0A 4X3AA 1ISYA 1XHBA 3WINA 4IZEA 1DZCA 5D61A 4KC3A 3AZVA 5BQUA 3OJ2A 3BA7A 1W3GA 3AKHA 3S8JA 5BP5A 3N0KA 1ISXA 1V6VA 3O4AA 1TWMA 2IHOA 4II0A 5EG6C 1HCEA 1FWUA 4J23B 4LO0A 5BQUC 5F8YA 1V6UA 4JRAA 4JKXB 1K5VA 3CAHA 3VWCA 3ZC8A 2IWTB 3RTIB 3RMXA 4IY8A 3ZXDA 1QQLA 2D24A 4Q91A 3FUOA 3V0AA 1II4A 3UD9A 5F90A 4ZGRB 1HWPB 2NM1A 2E4MC 1W3FA 1Z0HA 4QKRA 1S0DA 1EPWA 3A21A 3BAOA 3POKA 3P6JA 1BASA 2LIEA 4LO2C 3QYDA 3IM5A 4LO7C 1S0CA 4I3NA 3QR5A 1S0GA 3H6RA 3HSMA 3BB2A 1OQLB 2L5XA 1JLYA 3UJ0A 3AKGA 4KEIA 4ZOTA 1J0SA 4FGFA 3FGMA 4X38A 3OJVA 2AAIB 1T4QA 4OEEA 1RG8A 2AQZA 2MC2A 3BX1C 2P39A 3FJJA 4HA2A 4LO7B 1VCLA 2F2FA 5JMCA 3LLPA 4XFUA 1BLAA 4KBBA 2VXRA 5EHAA 3CRIA 4H75A 4I96A 5DVHA 3A22A 4P6AA 3BAUA 1IOBA 2WBCA 4AN6A 3F1RA 3I2XA 1DZDA 2MIBA 3VT1A 3FJDA 5DUYA 3JRRA 1JTCA 3AJ6A 1HIBA 3ILAA 2WRYA 2ZR1B 1AF9A 3FJBA 4DCKC 3VUOA 1R8OA 5FZZA 1Z4SA 5B2HA 3BTAA 2RSTA 4OUJA 2VXTI 1SR4C 3WO4A 3VSZA 3AH4A 3AZWA 4MZGB 3FJCA 1JT3A 1YTOA 1S0BA 3FJ9A 1F31A 1Z2VA 1IILA 2MLLB 3IIRA 3BRFA 3O4CA 2Y9FA 2FDBM 4G6JA 3SNVA 2GZBA 1ISZA 5BXPA 3IM7A 5FNXA 1S0FA 4ISRA 4J2XA 2KLLA 3FJAA 3I29B 4MZFB 3ZX7A 3CA4A 4P0JA 4F34A 5I1BA 4J2KA 1I1EA 1JT7A 1GGPB 4LO8B 3V79C 3CRHA 2D23A 3UJ4A 4MZHA 3VEQA 3W9TA 1P63A 5BXSA 1YYNA 3FJHA 4I4QA 6I1BA 2ESUA 1G9BA 3HBWA 4I37A 3HMYA 4ZFYB 4I0YA 1WD3A 2D7IA 4JP0A 2Y9XE 1DFCA 3P53A 1SZ6B 1IJTA 1V6WA 3Q7WA 3D7WB 1ONKB 1DLLA 4EFPA 3CA0A 1DIWA 1WBCA 3VSFA 3PMEA 4J2SA 4IYBA 2HWMA 4I1BA 2YUGA 3B9UA 5D62A 3WINC 41BIA 1G9AA 1IHKA 3MPPG 4D8HA 4OEGA 3AH2A 4EEEB 1JY0A 2D7RA 2K8RA 5BP5C 5D63A 2KI6B 3AKFA 3NBNA 4I4SA 4XFSA 2BEAA 1TWEA 4QC4A 1WBAA 4I4OA 2X2TA 2BEBA 4LO0C 3WMVA 4G1RA 1N4KA 5F8WA 3I2AA 4A7ZA 2HWAA 4JAWA 1S0LA 3TC2A 1G9DA 3NJ5A 4L4HA 2D20A 4DEPA 4H04A 4DENA 4QBVA 4EFQA 3AKIA 2QN4A 3IM6A 1DQOA 1A8DA 4FVVA 3N7LA 4A7KA 1RZOB 2DS0A 4OEFA 4I6IA 3BAVA 4QALA 4YOLA 3ZC9A 8I1BA 3RTJB 3ZXGA 1NZKA 1IRPA 3BADA 5DSSB 4QO3A 3V0AB 3VT0A 1QXMA 1AVUA 2RQ9A 2Z48A 5GAQA 4J2YA 3FJ8A 1ITBA 3T8SA 1K5UA 3LTQA 7I1BA 1AVAC 1RMLA 2AFGA 1IRAX 4I1EA 3RMYA 1HWMB 4ZBVB 1BLDA 3PG0A 3AJ5A 1TOOA 4ZLBB 2F2FC 3BRGC 3BAGA 3WA1A 2NYYA 3H6RB 4WBCA 1S0EA 2ET2A 5F8SA 4KEKA 1TIEA 2VU9A 3N7JA 1L2HA 1PC8B 1BFGA 4ZA3B 3RSJA 1IT0A 1V6XA 4EB2B 2D43A 4G9MA 1PZZA 4EFRA 3IAGC 4X39A 4GAIA 4OWKA 3AH1A 2KH2A 1G82A 3NBEA 1M2TB 3UD7A 5HPZA 3Q7YA 1XYFA 1QQKA 3CA5A 4R6UB 3R4UA 3V0BA 3O5WB 4ZFWB 1MC9A 1TP0A 5DZUA 1YXWA 4P0LA 1BFFA 4X37A 2NTDA 2DRZA 1D0HA 3CU1B 1Q03A 1FMMS 2AXMA 2HZ9A 3UD8A 4ENDA 4D0ZA 5BXTA 4OW4A 1YF8B 2ZQOA 3FUQA 1JQZA 3E8LC 2F8XC 3OJMA 3VT2A 1BFBA 3OGFA 3WO2A 1JT5A 1BA7A 3N7MA 2Q9XA 4LO3A 5BVPI 4LO1A 4I4VA 2P23A 4JPZA 2NS2A 3FFZA 3PHZA 4I4XA 3HN1A 5BOWA 3O4DA 5FZUA 4ZFUB 21BIA 2FO1A 4A7YA 5JLVA 4GOVA 2DREA 4GP3A 3WMUA 1CE7B 1FN0A 1MD6A 3HALA 2VLCA 2HW9A 4CJMA 4IONA 3WO3A 4H9WA 4I4UA 2ZQNA 3BAQA 2ERMA 5G00A 2NVHA 3CRGA 2VSEA 1XZZA 1AFCA 3BRDA 3CA1A 4XKIA 3CQAA 1FWVA 2I1BA 2M49A 4I7IA 1AVWB 1DFQA 4IHZA 2FFVA 3A23A 1CVSA 4Z8SB 3MALA 2QYIB 1UPSA 4GP0A 1ABRB 1TFMB 2E4MA 4I2SA
chains in the Genus database with same CATH topology
2VUAA 1R8NA 4Q9PA 1PUUB 3OBRA 1HCDA 2X2SA 1EVTA 1DJSB 1Q1UA 1I1BA 2FFUA 3C9ZA 4I8MA 4OWLA 2GO2A 2Q3NB 3N7KA 3NBCA 4GOYA 4LO2A 4F83A 2Y9GA 3K1XA 4Q9GA 4USPA 2K43A 4TLPA 3F62B 1ILR1 1FMZA 4L4IA 4D0TA 1DQGA 2LIQA 2NZ9A 5E24E 4ISQA 4QKSA 3FJKA 3FJFA 4P0KA 4XFTA 2R9KB 3NBDA 4Z9WB 2J3PA 3BAHA 2RG9B 3BA4A 1JLXA 3FJEA 3H6SE 4QBCA 3P6IA 1EV2A 4HR6C 2D1ZA 3O4BA 3O4OA 1AXMA 3O44A 2KKIA 3OGGA 5FZYA 1Q04A 1T9FA 4KEJA 1TTUA 1XG6A 2D44A 5EC5A 1BARA 3HOMA 4OWJA 1SR4A 3S8KA 1FV2A 2Z49A 3EF2A 1AVXB 9ILBA 2D22A 5BXRA 4QD2C 4USOA 1E0OA 4ZKTB 2KI4A 1EYLA 4EKXB 2VSAA 1WD4A 4JKQA 2UUSA 2NP0A 2XOAA 4I4PA 3UDAA 1JT4A 3A07A 5FNWA 4IZXA 3Q7XA 1YBIA 1KNMA 1M16A 4HJJA 1PUMB 3H6QA 1FQ9A 1FV3A 4QD2B 3PUBA 3FJIA 3O49A 1BFCA 1RY7A 1W3AA 4I4RA 1HWOB 2FGFA 1G9CA 4IY9A 1HWNB 1ISVA 2DRYA 3KMVA 4I4YA 4GAFA 2BFHA 3CA6A 3R4SA 3O3QA 3V0BB 31BIA 3OBTA 1ISWA 4G6MA 4UY4A 3JUTA 2K4AB 4G9NA 4IQPA 1FGAA 4AN7B 3CA3A 2Y9WC 4LO3C 1HKNA 4PC4A 4LO1C 1NUNA 3BA5A 1PWAA 4JQ0A 4X3AA 1ISYA 1XHBA 3WINA 4IZEA 1DZCA 5D61A 4KC3A 3AZVA 5BQUA 3OJ2A 3BA7A 1W3GA 3AKHA 3S8JA 5BP5A 3N0KA 1ISXA 1V6VA 3O4AA 1TWMA 2IHOA 4II0A 5EG6C 1HCEA 1FWUA 4J23B 4LO0A 5BQUC 5F8YA 1V6UA 4JRAA 4JKXB 1K5VA 3CAHA 3VWCA 3ZC8A 2IWTB 3RTIB 3RMXA 4IY8A 3ZXDA 1QQLA 2D24A 4Q91A 3FUOA 3V0AA 1II4A 3UD9A 5F90A 4ZGRB 1HWPB 2NM1A 2E4MC 1W3FA 1Z0HA 4QKRA 1S0DA 1EPWA 3A21A 3BAOA 3POKA 3P6JA 1BASA 2LIEA 4LO2C 3QYDA 3IM5A 4LO7C 1S0CA 4I3NA 3QR5A 1S0GA 3H6RA 3HSMA 3BB2A 1OQLB 2L5XA 1JLYA 3UJ0A 3AKGA 4KEIA 4ZOTA 1J0SA 4FGFA 3FGMA 4X38A 3OJVA 2AAIB 1T4QA 4OEEA 1RG8A 2AQZA 2MC2A 3BX1C 2P39A 3FJJA 4HA2A 4LO7B 1VCLA 2F2FA 5JMCA 3LLPA 4XFUA 1BLAA 4KBBA 2VXRA 5EHAA 3CRIA 4H75A 4I96A 5DVHA 3A22A 4P6AA 3BAUA 1IOBA 2WBCA 4AN6A 3F1RA 3I2XA 1DZDA 2MIBA 3VT1A 3FJDA 5DUYA 3JRRA 1JTCA 3AJ6A 1HIBA 3ILAA 2WRYA 2ZR1B 1AF9A 3FJBA 4DCKC 3VUOA 1R8OA 5FZZA 1Z4SA 5B2HA 3BTAA 2RSTA 4OUJA 2VXTI 1SR4C 3WO4A 3VSZA 3AH4A 3AZWA 4MZGB 3FJCA 1JT3A 1YTOA 1S0BA 3FJ9A 1F31A 1Z2VA 1IILA 2MLLB 3IIRA 3BRFA 3O4CA 2Y9FA 2FDBM 4G6JA 3SNVA 2GZBA 1ISZA 5BXPA 3IM7A 5FNXA 1S0FA 4ISRA 4J2XA 2KLLA 3FJAA 3I29B 4MZFB 3ZX7A 3CA4A 4P0JA 4F34A 5I1BA 4J2KA 1I1EA 1JT7A 1GGPB 4LO8B 3V79C 3CRHA 2D23A 3UJ4A 4MZHA 3VEQA 3W9TA 1P63A 5BXSA 1YYNA 3FJHA 4I4QA 6I1BA 2ESUA 1G9BA 3HBWA 4I37A 3HMYA 4ZFYB 4I0YA 1WD3A 2D7IA 4JP0A 2Y9XE 1DFCA 3P53A 1SZ6B 1IJTA 1V6WA 3Q7WA 3D7WB 1ONKB 1DLLA 4EFPA 3CA0A 1DIWA 1WBCA 3VSFA 3PMEA 4J2SA 4IYBA 2HWMA 4I1BA 2YUGA 3B9UA 5D62A 3WINC 41BIA 1G9AA 1IHKA 3MPPG 4D8HA 4OEGA 3AH2A 4EEEB 1JY0A 2D7RA 2K8RA 5BP5C 5D63A 2KI6B 3AKFA 3NBNA 4I4SA 4XFSA 2BEAA 1TWEA 4QC4A 1WBAA 4I4OA 2X2TA 2BEBA 4LO0C 3WMVA 4G1RA 1N4KA 5F8WA 3I2AA 4A7ZA 2HWAA 4JAWA 1S0LA 3TC2A 1G9DA 3NJ5A 4L4HA 2D20A 4DEPA 4H04A 4DENA 4QBVA 4EFQA 3AKIA 2QN4A 3IM6A 1DQOA 1A8DA 4FVVA 3N7LA 4A7KA 1RZOB 2DS0A 4OEFA 4I6IA 3BAVA 4QALA 4YOLA 3ZC9A 8I1BA 3RTJB 3ZXGA 1NZKA 1IRPA 3BADA 5DSSB 4QO3A 3V0AB 3VT0A 1QXMA 1AVUA 2RQ9A 2Z48A 5GAQA 4J2YA 3FJ8A 1ITBA 3T8SA 1K5UA 3LTQA 7I1BA 1AVAC 1RMLA 2AFGA 1IRAX 4I1EA 3RMYA 1HWMB 4ZBVB 1BLDA 3PG0A 3AJ5A 1TOOA 4ZLBB 2F2FC 3BRGC 3BAGA 3WA1A 2NYYA 3H6RB 4WBCA 1S0EA 2ET2A 5F8SA 4KEKA 1TIEA 2VU9A 3N7JA 1L2HA 1PC8B 1BFGA 4ZA3B 3RSJA 1IT0A 1V6XA 4EB2B 2D43A 4G9MA 1PZZA 4EFRA 3IAGC 4X39A 4GAIA 4OWKA 3AH1A 2KH2A 1G82A 3NBEA 1M2TB 3UD7A 5HPZA 3Q7YA 1XYFA 1QQKA 3CA5A 4R6UB 3R4UA 3V0BA 3O5WB 4ZFWB 1MC9A 1TP0A 5DZUA 1YXWA 4P0LA 1BFFA 4X37A 2NTDA 2DRZA 1D0HA 3CU1B 1Q03A 1FMMS 2AXMA 2HZ9A 3UD8A 4ENDA 4D0ZA 5BXTA 4OW4A 1YF8B 2ZQOA 3FUQA 1JQZA 3E8LC 2F8XC 3OJMA 3VT2A 1BFBA 3OGFA 3WO2A 1JT5A 1BA7A 3N7MA 2Q9XA 4LO3A 5BVPI 4LO1A 4I4VA 2P23A 4JPZA 2NS2A 3FFZA 3PHZA 4I4XA 3HN1A 5BOWA 3O4DA 5FZUA 4ZFUB 21BIA 2FO1A 4A7YA 5JLVA 4GOVA 2DREA 4GP3A 3WMUA 1CE7B 1FN0A 1MD6A 3HALA 2VLCA 2HW9A 4CJMA 4IONA 3WO3A 4H9WA 4I4UA 2ZQNA 3BAQA 2ERMA 5G00A 2NVHA 3CRGA 2VSEA 1XZZA 1AFCA 3BRDA 3CA1A 4XKIA 3CQAA 1FWVA 2I1BA 2M49A 4I7IA 1AVWB 1DFQA 4IHZA 2FFVA 3A23A 1CVSA 4Z8SB 3MALA 2QYIB 1UPSA 4GP0A 1ABRB 1TFMB 2E4MA 4I2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUA A;  1R8N A;  4Q9P A;  1PUU B;  3OBR A;  1HCD A;  2X2S A;  1EVT A;  1DJS B;  1Q1U A;  1I1B A;  2FFU A;  3C9Z A;  4I8M A;  4OWL A;  2GO2 A;  2Q3N B;  3N7K A;  3NBC A;  4GOY A;  4LO2 A;  4F83 A;  2Y9G A;  3K1X A;  4Q9G A;  4USP A;  2K43 A;  4TLP A;  3F62 B;  1ILR 1;  1FMZ A;  4L4I A;  4D0T A;  1DQG A;  2LIQ A;  2NZ9 A;  5E24 E;  4ISQ A;  4QKS A;  3FJK A;  3FJF A;  4P0K A;  4XFT A;  2R9K B;  3NBD A;  4Z9W B;  2J3P A;  3BAH A;  2RG9 B;  3BA4 A;  1JLX A;  3FJE A;  3H6S E;  4QBC A;  3P6I A;  1EV2 A;  4HR6 C;  2D1Z A;  3O4B A;  3O4O A;  1AXM A;  3O44 A;  2KKI A;  3OGG A;  5FZY A;  1Q04 A;  1T9F A;  4KEJ A;  1TTU A;  1XG6 A;  2D44 A;  5EC5 A;  1BAR A;  3HOM A;  4OWJ A;  1SR4 A;  3S8K A;  1FV2 A;  2Z49 A;  3EF2 A;  1AVX B;  9ILB A;  2D22 A;  5BXR A;  4QD2 C;  4USO A;  1E0O A;  4ZKT B;  2KI4 A;  1EYL A;  4EKX B;  2VSA A;  1WD4 A;  4JKQ A;  2UUS A;  2NP0 A;  2XOA A;  4I4P A;  3UDA A;  1JT4 A;  3A07 A;  5FNW A;  4IZX A;  3Q7X A;  1YBI A;  1KNM A;  1M16 A;  4HJJ A;  1PUM B;  3H6Q A;  1FQ9 A;  1FV3 A;  4QD2 B;  3PUB A;  3FJI A;  3O49 A;  1BFC A;  1RY7 A;  1W3A A;  4I4R A;  1HWO B;  2FGF A;  1G9C A;  4IY9 A;  1HWN B;  1ISV A;  2DRY A;  3KMV A;  4I4Y A;  4GAF A;  2BFH A;  3CA6 A;  3R4S A;  3O3Q A;  3V0B B;  31BI A;  3OBT A;  1ISW A;  4G6M A;  3JUT A;  2K4A B;  4G9N A;  4IQP A;  1FGA A;  4AN7 B;  3CA3 A;  2Y9W C;  4LO3 C;  1HKN A;  4PC4 A;  4LO1 C;  1NUN A;  3BA5 A;  1PWA A;  4JQ0 A;  4X3A A;  1ISY A;  1XHB A;  3WIN A;  4IZE A;  1DZC A;  5D61 A;  4KC3 A;  3AZV A;  5BQU A;  3OJ2 A;  3BA7 A;  1W3G A;  3AKH A;  3S8J A;  5BP5 A;  3N0K A;  1ISX A;  1V6V A;  3O4A A;  1TWM A;  2IHO A;  4II0 A;  5EG6 C;  1HCE A;  1FWU A;  4J23 B;  4LO0 A;  5BQU C;  5F8Y A;  1V6U A;  4JRA A;  4JKX B;  1K5V A;  3CAH A;  3VWC A;  3ZC8 A;  2IWT B;  3RTI B;  3RMX A;  4IY8 A;  3ZXD A;  1QQL A;  2D24 A;  4Q91 A;  3FUO A;  3V0A A;  1II4 A;  3UD9 A;  5F90 A;  4ZGR B;  1HWP B;  2NM1 A;  2E4M C;  1W3F A;  1Z0H A;  4QKR A;  1S0D A;  1EPW A;  3A21 A;  3BAO A;  3POK A;  3P6J A;  1BAS A;  2LIE A;  4LO2 C;  3QYD A;  3IM5 A;  4LO7 C;  1S0C A;  4I3N A;  3QR5 A;  1S0G A;  3H6R A;  3HSM A;  3BB2 A;  1OQL B;  2L5X A;  1JLY A;  3UJ0 A;  3AKG A;  4KEI A;  4ZOT A;  1J0S A;  4FGF A;  3FGM A;  4X38 A;  3OJV A;  2AAI B;  1T4Q A;  4OEE A;  1RG8 A;  2AQZ A;  2MC2 A;  3BX1 C;  2P39 A;  3FJJ A;  4HA2 A;  4LO7 B;  1VCL A;  2F2F A;  5JMC A;  3LLP A;  4XFU A;  1BLA A;  4KBB A;  2VXR A;  5EHA A;  3CRI A;  4I96 A;  5DVH A;  3A22 A;  4P6A A;  3BAU A;  1IOB A;  2WBC A;  4AN6 A;  3F1R A;  3I2X A;  1DZD A;  2MIB A;  3VT1 A;  3FJD A;  5DUY A;  3JRR A;  1JTC A;  3AJ6 A;  1HIB A;  3ILA A;  2WRY A;  2ZR1 B;  1AF9 A;  3FJB A;  4DCK C;  3VUO A;  1R8O A;  5FZZ A;  1Z4S A;  5B2H A;  3BTA A;  2RST A;  4OUJ A;  2VXT I;  1SR4 C;  3WO4 A;  3VSZ A;  3AH4 A;  3AZW A;  3FJC A;  1JT3 A;  1YTO A;  1S0B A;  3FJ9 A;  1F31 A;  1Z2V A;  1IIL A;  2MLL B;  3IIR A;  3BRF A;  3O4C A;  2Y9F A;  2FDB M;  4G6J A;  3SNV A;  2GZB A;  1ISZ A;  5BXP A;  3IM7 A;  5FNX A;  1S0F A;  4ISR A;  4J2X A;  2KLL A;  3FJA A;  3I29 B;  3ZX7 A;  3CA4 A;  4P0J A;  4F34 A;  5I1B A;  4J2K A;  1I1E A;  1JT7 A;  1GGP B;  4LO8 B;  3V79 C;  3CRH A;  2D23 A;  3UJ4 A;  3VEQ A;  3W9T A;  1P63 A;  5BXS A;  1YYN A;  3FJH A;  4I4Q A;  6I1B A;  2ESU A;  1G9B A;  3HBW A;  4I37 A;  3HMY A;  4ZFY B;  4I0Y A;  1WD3 A;  2D7I A;  4JP0 A;  2Y9X E;  1DFC A;  3P53 A;  1SZ6 B;  1IJT A;  1V6W A;  3Q7W A;  3D7W B;  1ONK B;  1DLL A;  4EFP A;  3CA0 A;  1DIW A;  1WBC A;  3VSF A;  3PME A;  4J2S A;  4IYB A;  2HWM A;  4I1B A;  2YUG A;  3B9U A;  5D62 A;  3WIN C;  41BI A;  1G9A A;  1IHK A;  3MPP G;  4D8H A;  4OEG A;  3AH2 A;  4EEE B;  1JY0 A;  2D7R A;  2K8R A;  5BP5 C;  5D63 A;  2KI6 B;  3AKF A;  3NBN A;  4I4S A;  4XFS A;  2BEA A;  1TWE A;  4QC4 A;  1WBA A;  4I4O A;  2X2T A;  2BEB A;  4LO0 C;  3WMV A;  4G1R A;  1N4K A;  5F8W A;  3I2A A;  4A7Z A;  2HWA A;  4JAW A;  1S0L A;  3TC2 A;  1G9D A;  3NJ5 A;  4L4H A;  2D20 A;  4DEP A;  4H04 A;  4DEN A;  4QBV A;  4EFQ A;  3AKI A;  2QN4 A;  3IM6 A;  1DQO A;  1A8D A;  4FVV A;  3N7L A;  4A7K A;  1RZO B;  2DS0 A;  4OEF A;  4I6I A;  3BAV A;  4QAL A;  4YOL A;  3ZC9 A;  8I1B A;  3RTJ B;  3ZXG A;  1NZK A;  1IRP A;  3BAD A;  5DSS B;  4QO3 A;  3V0A B;  3VT0 A;  1QXM A;  1AVU A;  2RQ9 A;  2Z48 A;  5GAQ A;  4J2Y A;  3FJ8 A;  1ITB A;  3T8S A;  1K5U A;  3LTQ A;  7I1B A;  1AVA C;  1RML A;  2AFG A;  1IRA X;  4I1E A;  3RMY A;  1HWM B;  4ZBV B;  1BLD A;  3PG0 A;  3AJ5 A;  1TOO A;  4ZLB B;  2F2F C;  3BRG C;  3BAG A;  3WA1 A;  2NYY A;  3H6R B;  4WBC A;  1S0E A;  2ET2 A;  5F8S A;  4KEK A;  1TIE A;  2VU9 A;  3N7J A;  1L2H A;  1PC8 B;  1BFG A;  4ZA3 B;  3RSJ A;  1IT0 A;  1V6X A;  4EB2 B;  2D43 A;  4G9M A;  1PZZ A;  4EFR A;  3IAG C;  4X39 A;  4GAI A;  4OWK A;  3AH1 A;  2KH2 A;  1G82 A;  3NBE A;  1M2T B;  3UD7 A;  5HPZ A;  3Q7Y A;  1XYF A;  1QQK A;  3CA5 A;  4R6U B;  3R4U A;  3V0B A;  3O5W B;  4ZFW B;  1MC9 A;  1TP0 A;  5DZU A;  1YXW A;  4P0L A;  1BFF A;  4X37 A;  2NTD A;  2DRZ A;  1D0H A;  3CU1 B;  1Q03 A;  1FMM S;  2AXM A;  2HZ9 A;  3UD8 A;  4END A;  4D0Z A;  5BXT A;  4OW4 A;  1YF8 B;  2ZQO A;  3FUQ A;  1JQZ A;  3E8L C;  2F8X C;  3OJM A;  3VT2 A;  1BFB A;  3OGF A;  3WO2 A;  1JT5 A;  1BA7 A;  3N7M A;  2Q9X A;  4LO3 A;  5BVP I;  4LO1 A;  4I4V A;  2P23 A;  4JPZ A;  3FFZ A;  3PHZ A;  4I4X A;  3HN1 A;  5BOW A;  3O4D A;  5FZU A;  4ZFU B;  21BI A;  2FO1 A;  4A7Y A;  5JLV A;  4GOV A;  2DRE A;  4GP3 A;  3WMU A;  1CE7 B;  1FN0 A;  1MD6 A;  3HAL A;  2VLC A;  2HW9 A;  4CJM A;  4ION A;  3WO3 A;  4H9W A;  4I4U A;  2ZQN A;  3BAQ A;  2ERM A;  5G00 A;  2NVH A;  3CRG A;  2VSE A;  1XZZ A;  1AFC A;  3BRD A;  3CA1 A;  4XKI A;  3CQA A;  1FWV A;  2I1B A;  2M49 A;  4I7I A;  1AVW B;  1DFQ A;  4IHZ A;  2FFV A;  3A23 A;  1CVS A;  4Z8S B;  3MAL A;  2QYI B;  1UPS A;  4GP0 A;  1ABR B;  1TFM B;  2E4M A;  4I2S A; 
#chains in the Genus database with same CATH topology
 2VUA A;  1R8N A;  4Q9P A;  1PUU B;  3OBR A;  1HCD A;  2X2S A;  1EVT A;  1DJS B;  1Q1U A;  1I1B A;  2FFU A;  3C9Z A;  4I8M A;  4OWL A;  2GO2 A;  2Q3N B;  3N7K A;  3NBC A;  4GOY A;  4LO2 A;  4F83 A;  2Y9G A;  3K1X A;  4Q9G A;  4USP A;  2K43 A;  4TLP A;  3F62 B;  1ILR 1;  1FMZ A;  4L4I A;  4D0T A;  1DQG A;  2LIQ A;  2NZ9 A;  5E24 E;  4ISQ A;  4QKS A;  3FJK A;  3FJF A;  4P0K A;  4XFT A;  2R9K B;  3NBD A;  4Z9W B;  2J3P A;  3BAH A;  2RG9 B;  3BA4 A;  1JLX A;  3FJE A;  3H6S E;  4QBC A;  3P6I A;  1EV2 A;  4HR6 C;  2D1Z A;  3O4B A;  3O4O A;  1AXM A;  3O44 A;  2KKI A;  3OGG A;  5FZY A;  1Q04 A;  1T9F A;  4KEJ A;  1TTU A;  1XG6 A;  2D44 A;  5EC5 A;  1BAR A;  3HOM A;  4OWJ A;  1SR4 A;  3S8K A;  1FV2 A;  2Z49 A;  3EF2 A;  1AVX B;  9ILB A;  2D22 A;  5BXR A;  4QD2 C;  4USO A;  1E0O A;  4ZKT B;  2KI4 A;  1EYL A;  4EKX B;  2VSA A;  1WD4 A;  4JKQ A;  2UUS A;  2NP0 A;  2XOA A;  4I4P A;  3UDA A;  1JT4 A;  3A07 A;  5FNW A;  4IZX A;  3Q7X A;  1YBI A;  1KNM A;  1M16 A;  4HJJ A;  1PUM B;  3H6Q A;  1FQ9 A;  1FV3 A;  4QD2 B;  3PUB A;  3FJI A;  3O49 A;  1BFC A;  1RY7 A;  1W3A A;  4I4R A;  1HWO B;  2FGF A;  1G9C A;  4IY9 A;  1HWN B;  1ISV A;  2DRY A;  3KMV A;  4I4Y A;  4GAF A;  2BFH A;  3CA6 A;  3R4S A;  3O3Q A;  3V0B B;  31BI A;  3OBT A;  1ISW A;  4G6M A;  4UY4 A;  3JUT A;  2K4A B;  4G9N A;  4IQP A;  1FGA A;  4AN7 B;  3CA3 A;  2Y9W C;  4LO3 C;  1HKN A;  4PC4 A;  4LO1 C;  1NUN A;  3BA5 A;  1PWA A;  4JQ0 A;  4X3A A;  1ISY A;  1XHB A;  3WIN A;  4IZE A;  1DZC A;  5D61 A;  4KC3 A;  3AZV A;  5BQU A;  3OJ2 A;  3BA7 A;  1W3G A;  3AKH A;  3S8J A;  5BP5 A;  3N0K A;  1ISX A;  1V6V A;  3O4A A;  1TWM A;  2IHO A;  4II0 A;  5EG6 C;  1HCE A;  1FWU A;  4J23 B;  4LO0 A;  5BQU C;  5F8Y A;  1V6U A;  4JRA A;  4JKX B;  1K5V A;  3CAH A;  3VWC A;  3ZC8 A;  2IWT B;  3RTI B;  3RMX A;  4IY8 A;  3ZXD A;  1QQL A;  2D24 A;  4Q91 A;  3FUO A;  3V0A A;  1II4 A;  3UD9 A;  5F90 A;  4ZGR B;  1HWP B;  2NM1 A;  2E4M C;  1W3F A;  1Z0H A;  4QKR A;  1S0D A;  1EPW A;  3A21 A;  3BAO A;  3POK A;  3P6J A;  1BAS A;  2LIE A;  4LO2 C;  3QYD A;  3IM5 A;  4LO7 C;  1S0C A;  4I3N A;  3QR5 A;  1S0G A;  3H6R A;  3HSM A;  3BB2 A;  1OQL B;  2L5X A;  1JLY A;  3UJ0 A;  3AKG A;  4KEI A;  4ZOT A;  1J0S A;  4FGF A;  3FGM A;  4X38 A;  3OJV A;  2AAI B;  1T4Q A;  4OEE A;  1RG8 A;  2AQZ A;  2MC2 A;  3BX1 C;  2P39 A;  3FJJ A;  4HA2 A;  4LO7 B;  1VCL A;  2F2F A;  5JMC A;  3LLP A;  4XFU A;  1BLA A;  4KBB A;  2VXR A;  5EHA A;  3CRI A;  4H75 A;  4I96 A;  5DVH A;  3A22 A;  4P6A A;  3BAU A;  1IOB A;  2WBC A;  4AN6 A;  3F1R A;  3I2X A;  1DZD A;  2MIB A;  3VT1 A;  3FJD A;  5DUY A;  3JRR A;  1JTC A;  3AJ6 A;  1HIB A;  3ILA A;  2WRY A;  2ZR1 B;  1AF9 A;  3FJB A;  4DCK C;  3VUO A;  1R8O A;  5FZZ A;  1Z4S A;  5B2H A;  3BTA A;  2RST A;  4OUJ A;  2VXT I;  1SR4 C;  3WO4 A;  3VSZ A;  3AH4 A;  3AZW A;  4MZG B;  3FJC A;  1JT3 A;  1YTO A;  1S0B A;  3FJ9 A;  1F31 A;  1Z2V A;  1IIL A;  2MLL B;  3IIR A;  3BRF A;  3O4C A;  2Y9F A;  2FDB M;  4G6J A;  3SNV A;  2GZB A;  1ISZ A;  5BXP A;  3IM7 A;  5FNX A;  1S0F A;  4ISR A;  4J2X A;  2KLL A;  3FJA A;  3I29 B;  4MZF B;  3ZX7 A;  3CA4 A;  4P0J A;  4F34 A;  5I1B A;  4J2K A;  1I1E A;  1JT7 A;  1GGP B;  4LO8 B;  3V79 C;  3CRH A;  2D23 A;  3UJ4 A;  4MZH A;  3VEQ A;  3W9T A;  1P63 A;  5BXS A;  1YYN A;  3FJH A;  4I4Q A;  6I1B A;  2ESU A;  1G9B A;  3HBW A;  4I37 A;  3HMY A;  4ZFY B;  4I0Y A;  1WD3 A;  2D7I A;  4JP0 A;  2Y9X E;  1DFC A;  3P53 A;  1SZ6 B;  1IJT A;  1V6W A;  3Q7W A;  3D7W B;  1ONK B;  1DLL A;  4EFP A;  3CA0 A;  1DIW A;  1WBC A;  3VSF A;  3PME A;  4J2S A;  4IYB A;  2HWM A;  4I1B A;  2YUG A;  3B9U A;  5D62 A;  3WIN C;  41BI A;  1G9A A;  1IHK A;  3MPP G;  4D8H A;  4OEG A;  3AH2 A;  4EEE B;  1JY0 A;  2D7R A;  2K8R A;  5BP5 C;  5D63 A;  2KI6 B;  3AKF A;  3NBN A;  4I4S A;  4XFS A;  2BEA A;  1TWE A;  4QC4 A;  1WBA A;  4I4O A;  2X2T A;  2BEB A;  4LO0 C;  3WMV A;  4G1R A;  1N4K A;  5F8W A;  3I2A A;  4A7Z A;  2HWA A;  4JAW A;  1S0L A;  3TC2 A;  1G9D A;  3NJ5 A;  4L4H A;  2D20 A;  4DEP A;  4H04 A;  4DEN A;  4QBV A;  4EFQ A;  3AKI A;  2QN4 A;  3IM6 A;  1DQO A;  1A8D A;  4FVV A;  3N7L A;  4A7K A;  1RZO B;  2DS0 A;  4OEF A;  4I6I A;  3BAV A;  4QAL A;  4YOL A;  3ZC9 A;  8I1B A;  3RTJ B;  3ZXG A;  1NZK A;  1IRP A;  3BAD A;  5DSS B;  4QO3 A;  3V0A B;  3VT0 A;  1QXM A;  1AVU A;  2RQ9 A;  2Z48 A;  5GAQ A;  4J2Y A;  3FJ8 A;  1ITB A;  3T8S A;  1K5U A;  3LTQ A;  7I1B A;  1AVA C;  1RML A;  2AFG A;  1IRA X;  4I1E A;  3RMY A;  1HWM B;  4ZBV B;  1BLD A;  3PG0 A;  3AJ5 A;  1TOO A;  4ZLB B;  2F2F C;  3BRG C;  3BAG A;  3WA1 A;  2NYY A;  3H6R B;  4WBC A;  1S0E A;  2ET2 A;  5F8S A;  4KEK A;  1TIE A;  2VU9 A;  3N7J A;  1L2H A;  1PC8 B;  1BFG A;  4ZA3 B;  3RSJ A;  1IT0 A;  1V6X A;  4EB2 B;  2D43 A;  4G9M A;  1PZZ A;  4EFR A;  3IAG C;  4X39 A;  4GAI A;  4OWK A;  3AH1 A;  2KH2 A;  1G82 A;  3NBE A;  1M2T B;  3UD7 A;  5HPZ A;  3Q7Y A;  1XYF A;  1QQK A;  3CA5 A;  4R6U B;  3R4U A;  3V0B A;  3O5W B;  4ZFW B;  1MC9 A;  1TP0 A;  5DZU A;  1YXW A;  4P0L A;  1BFF A;  4X37 A;  2NTD A;  2DRZ A;  1D0H A;  3CU1 B;  1Q03 A;  1FMM S;  2AXM A;  2HZ9 A;  3UD8 A;  4END A;  4D0Z A;  5BXT A;  4OW4 A;  1YF8 B;  2ZQO A;  3FUQ A;  1JQZ A;  3E8L C;  2F8X C;  3OJM A;  3VT2 A;  1BFB A;  3OGF A;  3WO2 A;  1JT5 A;  1BA7 A;  3N7M A;  2Q9X A;  4LO3 A;  5BVP I;  4LO1 A;  4I4V A;  2P23 A;  4JPZ A;  2NS2 A;  3FFZ A;  3PHZ A;  4I4X A;  3HN1 A;  5BOW A;  3O4D A;  5FZU A;  4ZFU B;  21BI A;  2FO1 A;  4A7Y A;  5JLV A;  4GOV A;  2DRE A;  4GP3 A;  3WMU A;  1CE7 B;  1FN0 A;  1MD6 A;  3HAL A;  2VLC A;  2HW9 A;  4CJM A;  4ION A;  3WO3 A;  4H9W A;  4I4U A;  2ZQN A;  3BAQ A;  2ERM A;  5G00 A;  2NVH A;  3CRG A;  2VSE A;  1XZZ A;  1AFC A;  3BRD A;  3CA1 A;  4XKI A;  3CQA A;  1FWV A;  2I1B A;  2M49 A;  4I7I A;  1AVW B;  1DFQ A;  4IHZ A;  2FFV A;  3A23 A;  1CVS A;  4Z8S B;  3MAL A;  2QYI B;  1UPS A;  4GP0 A;  1ABR B;  1TFM B;  2E4M A;  4I2S A; 
#chains in the Genus database with same CATH homology
 2VUA A;  1R8N A;  4Q9P A;  1PUU B;  3OBR A;  1HCD A;  2X2S A;  1EVT A;  1DJS B;  1Q1U A;  1I1B A;  2FFU A;  3C9Z A;  4I8M A;  4OWL A;  2GO2 A;  2Q3N B;  3N7K A;  3NBC A;  4GOY A;  4LO2 A;  4F83 A;  2Y9G A;  3K1X A;  4Q9G A;  4USP A;  2K43 A;  4TLP A;  3F62 B;  1ILR 1;  1FMZ A;  4L4I A;  4D0T A;  1DQG A;  2LIQ A;  2NZ9 A;  5E24 E;  4ISQ A;  4QKS A;  3FJK A;  3FJF A;  4P0K A;  4XFT A;  2R9K B;  3NBD A;  4Z9W B;  2J3P A;  3BAH A;  2RG9 B;  3BA4 A;  1JLX A;  3FJE A;  3H6S E;  4QBC A;  3P6I A;  1EV2 A;  4HR6 C;  2D1Z A;  3O4B A;  3O4O A;  1AXM A;  3O44 A;  2KKI A;  3OGG A;  5FZY A;  1Q04 A;  1T9F A;  4KEJ A;  1TTU A;  1XG6 A;  2D44 A;  5EC5 A;  1BAR A;  3HOM A;  4OWJ A;  1SR4 A;  3S8K A;  1FV2 A;  2Z49 A;  3EF2 A;  1AVX B;  9ILB A;  2D22 A;  5BXR A;  4QD2 C;  4USO A;  1E0O A;  4ZKT B;  2KI4 A;  1EYL A;  4EKX B;  2VSA A;  1WD4 A;  4JKQ A;  2UUS A;  2NP0 A;  2XOA A;  4I4P A;  3UDA A;  1JT4 A;  3A07 A;  5FNW A;  4IZX A;  3Q7X A;  1YBI A;  1KNM A;  1M16 A;  4HJJ A;  1PUM B;  3H6Q A;  1FQ9 A;  1FV3 A;  4QD2 B;  3PUB A;  3FJI A;  3O49 A;  1BFC A;  1RY7 A;  1W3A A;  4I4R A;  1HWO B;  2FGF A;  1G9C A;  4IY9 A;  1HWN B;  1ISV A;  2DRY A;  3KMV A;  4I4Y A;  4GAF A;  2BFH A;  3CA6 A;  3R4S A;  3O3Q A;  3V0B B;  31BI A;  3OBT A;  1ISW A;  4G6M A;  4UY4 A;  3JUT A;  2K4A B;  4G9N A;  4IQP A;  1FGA A;  4AN7 B;  3CA3 A;  2Y9W C;  4LO3 C;  1HKN A;  4PC4 A;  4LO1 C;  1NUN A;  3BA5 A;  1PWA A;  4JQ0 A;  4X3A A;  1ISY A;  1XHB A;  3WIN A;  4IZE A;  1DZC A;  5D61 A;  4KC3 A;  3AZV A;  5BQU A;  3OJ2 A;  3BA7 A;  1W3G A;  3AKH A;  3S8J A;  5BP5 A;  3N0K A;  1ISX A;  1V6V A;  3O4A A;  1TWM A;  2IHO A;  4II0 A;  5EG6 C;  1HCE A;  1FWU A;  4J23 B;  4LO0 A;  5BQU C;  5F8Y A;  1V6U A;  4JRA A;  4JKX B;  1K5V A;  3CAH A;  3VWC A;  3ZC8 A;  2IWT B;  3RTI B;  3RMX A;  4IY8 A;  3ZXD A;  1QQL A;  2D24 A;  4Q91 A;  3FUO A;  3V0A A;  1II4 A;  3UD9 A;  5F90 A;  4ZGR B;  1HWP B;  2NM1 A;  2E4M C;  1W3F A;  1Z0H A;  4QKR A;  1S0D A;  1EPW A;  3A21 A;  3BAO A;  3POK A;  3P6J A;  1BAS A;  2LIE A;  4LO2 C;  3QYD A;  3IM5 A;  4LO7 C;  1S0C A;  4I3N A;  3QR5 A;  1S0G A;  3H6R A;  3HSM A;  3BB2 A;  1OQL B;  2L5X A;  1JLY A;  3UJ0 A;  3AKG A;  4KEI A;  4ZOT A;  1J0S A;  4FGF A;  3FGM A;  4X38 A;  3OJV A;  2AAI B;  1T4Q A;  4OEE A;  1RG8 A;  2AQZ A;  2MC2 A;  3BX1 C;  2P39 A;  3FJJ A;  4HA2 A;  4LO7 B;  1VCL A;  2F2F A;  5JMC A;  3LLP A;  4XFU A;  1BLA A;  4KBB A;  2VXR A;  5EHA A;  3CRI A;  4H75 A;  4I96 A;  5DVH A;  3A22 A;  4P6A A;  3BAU A;  1IOB A;  2WBC A;  4AN6 A;  3F1R A;  3I2X A;  1DZD A;  2MIB A;  3VT1 A;  3FJD A;  5DUY A;  3JRR A;  1JTC A;  3AJ6 A;  1HIB A;  3ILA A;  2WRY A;  2ZR1 B;  1AF9 A;  3FJB A;  4DCK C;  3VUO A;  1R8O A;  5FZZ A;  1Z4S A;  5B2H A;  3BTA A;  2RST A;  4OUJ A;  2VXT I;  1SR4 C;  3WO4 A;  3VSZ A;  3AH4 A;  3AZW A;  4MZG B;  3FJC A;  1JT3 A;  1YTO A;  1S0B A;  3FJ9 A;  1F31 A;  1Z2V A;  1IIL A;  2MLL B;  3IIR A;  3BRF A;  3O4C A;  2Y9F A;  2FDB M;  4G6J A;  3SNV A;  2GZB A;  1ISZ A;  5BXP A;  3IM7 A;  5FNX A;  1S0F A;  4ISR A;  4J2X A;  2KLL A;  3FJA A;  3I29 B;  4MZF B;  3ZX7 A;  3CA4 A;  4P0J A;  4F34 A;  5I1B A;  4J2K A;  1I1E A;  1JT7 A;  1GGP B;  4LO8 B;  3V79 C;  3CRH A;  2D23 A;  3UJ4 A;  4MZH A;  3VEQ A;  3W9T A;  1P63 A;  5BXS A;  1YYN A;  3FJH A;  4I4Q A;  6I1B A;  2ESU A;  1G9B A;  3HBW A;  4I37 A;  3HMY A;  4ZFY B;  4I0Y A;  1WD3 A;  2D7I A;  4JP0 A;  2Y9X E;  1DFC A;  3P53 A;  1SZ6 B;  1IJT A;  1V6W A;  3Q7W A;  3D7W B;  1ONK B;  1DLL A;  4EFP A;  3CA0 A;  1DIW A;  1WBC A;  3VSF A;  3PME A;  4J2S A;  4IYB A;  2HWM A;  4I1B A;  2YUG A;  3B9U A;  5D62 A;  3WIN C;  41BI A;  1G9A A;  1IHK A;  3MPP G;  4D8H A;  4OEG A;  3AH2 A;  4EEE B;  1JY0 A;  2D7R A;  2K8R A;  5BP5 C;  5D63 A;  2KI6 B;  3AKF A;  3NBN A;  4I4S A;  4XFS A;  2BEA A;  1TWE A;  4QC4 A;  1WBA A;  4I4O A;  2X2T A;  2BEB A;  4LO0 C;  3WMV A;  4G1R A;  1N4K A;  5F8W A;  3I2A A;  4A7Z A;  2HWA A;  4JAW A;  1S0L A;  3TC2 A;  1G9D A;  3NJ5 A;  4L4H A;  2D20 A;  4DEP A;  4H04 A;  4DEN A;  4QBV A;  4EFQ A;  3AKI A;  2QN4 A;  3IM6 A;  1DQO A;  1A8D A;  4FVV A;  3N7L A;  4A7K A;  1RZO B;  2DS0 A;  4OEF A;  4I6I A;  3BAV A;  4QAL A;  4YOL A;  3ZC9 A;  8I1B A;  3RTJ B;  3ZXG A;  1NZK A;  1IRP A;  3BAD A;  5DSS B;  4QO3 A;  3V0A B;  3VT0 A;  1QXM A;  1AVU A;  2RQ9 A;  2Z48 A;  5GAQ A;  4J2Y A;  3FJ8 A;  1ITB A;  3T8S A;  1K5U A;  3LTQ A;  7I1B A;  1AVA C;  1RML A;  2AFG A;  1IRA X;  4I1E A;  3RMY A;  1HWM B;  4ZBV B;  1BLD A;  3PG0 A;  3AJ5 A;  1TOO A;  4ZLB B;  2F2F C;  3BRG C;  3BAG A;  3WA1 A;  2NYY A;  3H6R B;  4WBC A;  1S0E A;  2ET2 A;  5F8S A;  4KEK A;  1TIE A;  2VU9 A;  3N7J A;  1L2H A;  1PC8 B;  1BFG A;  4ZA3 B;  3RSJ A;  1IT0 A;  1V6X A;  4EB2 B;  2D43 A;  4G9M A;  1PZZ A;  4EFR A;  3IAG C;  4X39 A;  4GAI A;  4OWK A;  3AH1 A;  2KH2 A;  1G82 A;  3NBE A;  1M2T B;  3UD7 A;  5HPZ A;  3Q7Y A;  1XYF A;  1QQK A;  3CA5 A;  4R6U B;  3R4U A;  3V0B A;  3O5W B;  4ZFW B;  1MC9 A;  1TP0 A;  5DZU A;  1YXW A;  4P0L A;  1BFF A;  4X37 A;  2NTD A;  2DRZ A;  1D0H A;  3CU1 B;  1Q03 A;  1FMM S;  2AXM A;  2HZ9 A;  3UD8 A;  4END A;  4D0Z A;  5BXT A;  4OW4 A;  1YF8 B;  2ZQO A;  3FUQ A;  1JQZ A;  3E8L C;  2F8X C;  3OJM A;  3VT2 A;  1BFB A;  3OGF A;  3WO2 A;  1JT5 A;  1BA7 A;  3N7M A;  2Q9X A;  4LO3 A;  5BVP I;  4LO1 A;  4I4V A;  2P23 A;  4JPZ A;  2NS2 A;  3FFZ A;  3PHZ A;  4I4X A;  3HN1 A;  5BOW A;  3O4D A;  5FZU A;  4ZFU B;  21BI A;  2FO1 A;  4A7Y A;  5JLV A;  4GOV A;  2DRE A;  4GP3 A;  3WMU A;  1CE7 B;  1FN0 A;  1MD6 A;  3HAL A;  2VLC A;  2HW9 A;  4CJM A;  4ION A;  3WO3 A;  4H9W A;  4I4U A;  2ZQN A;  3BAQ A;  2ERM A;  5G00 A;  2NVH A;  3CRG A;  2VSE A;  1XZZ A;  1AFC A;  3BRD A;  3CA1 A;  4XKI A;  3CQA A;  1FWV A;  2I1B A;  2M49 A;  4I7I A;  1AVW B;  1DFQ A;  4IHZ A;  2FFV A;  3A23 A;  1CVS A;  4Z8S B;  3MAL A;  2QYI B;  1UPS A;  4GP0 A;  1ABR B;  1TFM B;  2E4M A;  4I2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...