1PZZA

Crystal structure of fgf-1, v51n mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
140
structure length
140
Chain Sequence
HHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESNGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Sequence swapping does not result in conformation swapping for the beta4/beta5 and beta8/beta9 beta-hairpin turns in human acidic fibroblast growth factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 38
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1pzzA00
3O44A 4OW4A 4ZLBB 1WBCA 1IHKA 3T8SA 2BFHA 4IY8A 4A7YA 1JY0A 3FFZA 2NM1A 1DQOA 3VT1A 3ZXDA 4I1BA 1HIBA 3UDAA 3CA1A 3AKFA 4P0JA 3CAHA 4USOA 1CE7B 3S8KA 2X2SA 3HMYA 4KEKA 3TC2A 3FJDA 3I2AA 3OGGA 2D1ZA 2ESUA 2HWMA 2WBCA 1ITBA 1T9FA 4JRAA 1S0LA 2VUAA 4ZFWB 3IM5A 4AN6A 4I4PA 5DVHA 1N4KA 4IHZA 5BQUA 1WD4A 2D43A 5BXSA 5BXTA 1JT5A 4OWLA 4G6JA 4L4IA 5D62A 2KH2A 3BA4A 3I29B 2J3PA 2Y9GA 3WMVA 1TOOA 1HWNB 8I1BA 4G9NA 2D24A 9ILBA 4EB2B 3JUTA 4LO1C 1W3GA 4OWJA 1RY7A 3IIRA 2D23A 4IONA 1GGPB 1V6UA 2K4AB 3MALA 1AF9A 1ISVA 1G82A 4I8MA 4J2YA 4Z8SB 3CU1B 1Z4SA 1TWEA 3BADA 3BA5A 3MPPG 4ISRA 4QD2C 3B9UA 4OEFA 1ILR1 1JTCA 3FJBA 5BXPA 3FJKA 4ZFUB 4KBBA 4LO2A 4Q9PA 4LO0A 1ISXA 3FJIA 3ZC8A 4IZXA 5FZYA 4KEJA 2LIQA 1IRPA 4IQPA 1DFQA 1SZ6B 1S0FA 4QKSA 1XYFA 3V0AA 3HOMA 3OBTA 1PZZA 4ISQA 2WRYA 4I2SA 2FFVA 2GZBA 1I1EA 3AZWA 1AXMA 1JT7A 3NBCA 2VXRA 4J2KA 3E8LC 4H04A 3VT0A 1QXMA 1HWOB 5F8WA 3RTIB 5FNXA 3IM7A 3F62B 4AN7B 4ZBVB 2VSEA 3AZVA 2HWAA 1Q04A 5B2HA 3HALA 2KI4A 4LO0C 4P0KA 4G9MA 2KLLA 3BAOA 3ZXGA 3N7JA 4D0ZA 3CRGA 4OEEA 4D0TA 1NZKA 3K1XA 5D61A 4YOLA 3BRFA 4QO3A 4I4SA 1TWMA 2ET2A 1HCEA 2HW9A 4KC3A 3W9TA 2Q9XA 3VT2A 4HJJA 3UJ0A 1FQ9A 3POKA 1TIEA 4JQ0A 4P6AA 1P63A 4I4OA 4OWKA 1EV2A 2K8RA 4GAIA 4HR6C 4I7IA 1OQLB 1YF8B 1Q03A 2P23A 2ZR1B 3O4AA 3FJ9A 4KEIA 4PC4A 4DENA 4GP3A 1Z2VA 2Y9XE 3QR5A 4FGFA 2RG9B 4LO8B 6I1BA 3IAGC 4I1EA 2E4MC 1HWMB 3N0KA 3AJ6A 4GP0A 4X39A 4LO1A 4GOYA 5F8SA 2ZQOA 2DRYA 1XHBA 2QN4A 2IHOA 5G00A 1M16A 1UPSA 4EFRA 2IWTB 5HPZA 4F34A 1YYNA 1FN0A 4LO3C 3LLPA 1TTUA 4A7ZA 4XFSA 4ZGRB 5DZUA 5BXRA 2ERMA 1DQGA 4G6MA 4XKIA 4EFPA 2NP0A 4I96A 2AAIB 1R8NA 2DREA 3A22A 1II4A 1BFGA 1YBIA 1BFCA 4LO7C 2MC2A 4QC4A 3V0AB 1AVWB 3C9ZA 1TP0A 4EFQA 3RSJA 1DFCA 3UD9A 1EYLA 5E24E 3Q7YA 3BAHA 4OEGA 1BLAA 2NZ9A 3OGFA 3WINC 3VUOA 2Z49A 2Y9WC 4ZFYB 2Z48A 4I37A 4D8HA 3FJAA 3PMEA 4JPZA 3H6SE 2RSTA 3PG0A 1YXWA 3HN1A 2LIEA 4X38A 2AXMA 4GOVA 1FMMS 3AKGA 1ISZA 3V79C 1EVTA 1I1BA 2Q3NB 4J23B 3P6JA 1BA7A 1CVSA 3KMVA 1DJSB 1PUMB 3PHZA 3HBWA 3UJ4A 4OUJA 4X3AA 2HZ9A 3O3QA 3V0BB 4USPA 3WO4A 2D7IA 3RMXA 3ZC9A 1S0DA 1Z0HA 1JQZA 3A21A 1W3FA 5DSSB 3EF2A 1VCLA 2BEAA 2R9KB 1AFCA 2F2FA 1AVXB 4I4RA 1WD3A 1HKNA 1T4QA 2MLLB 1S0GA 1J0SA 4GAFA 1G9DA 2VXTI 4I4QA 5EC5A 1SR4A 1JLXA 1DZDA 1BLDA 1DZCA 4Q9GA 3BA7A 2E4MA 3BAQA 3CRIA 2L5XA 4I4XA 4G1RA 3CA4A 5BOWA 2D7RA 1BASA 4R6UB 2XOAA 3BAGA 5JLVA 4LO7B 3R4UA 3O4DA 3N7KA 1ONKB 1D0HA 3F1RA 3O4BA 3IM6A 2KI6B 1L2HA 3O4OA 3ZX7A 2FO1A 4LO3A 5BP5C 3BAUA 4QD2B 3VEQA 1A8DA 1JLYA 2F2FC 3WO3A 4QBVA 3P6IA 5F90A 1EPWA 1BARA 1V6VA 3H6QA 5JMCA 1BFFA 5BVPI 1SR4C 3NBDA 3SNVA 1S0EA 21BIA 2DS0A 4J2SA 2UUSA 2RQ9A 1JT3A 4I4UA 3D7WB 2X2TA 4QKRA 5FZUA 3WMUA 3WA1A 1IOBA 4EEEB 5I1BA 1XZZA 4XFUA 1FWVA 3BAVA 4TLPA 3RTJB 1FMZA 2DRZA 1NUNA 4F83A 3LTQA 2FGFA 3AH1A 3PUBA 3FJHA 3WINA 2FFUA 1MC9A 3CA0A 4EKXB 4ZKTB 1G9AA 4HA2A 4JKQA 3H6RA 3AH4A 3N7MA 1ISWA 1F31A 3FJFA 3N7LA 1W3AA 2FDBM 4Z9WB 1XG6A 2D44A 3NBEA 3WO2A 2AQZA 1RZOB 3FUOA 3CA3A 3BRGC 3OJVA 2D20A 4JP0A 3Q7WA 5EG6C 5D63A 2I1BA 2NTDA 2VSAA 3P53A 3CA6A 3UD8A 3JRRA 1G9BA 3CA5A 1HWPB 1FWUA 4II0A 3BB2A 1K5VA 2VU9A 3VSFA 3VSZA 4Q91A 2M49A 1WBAA 5FZZA 3OBRA 3AH2A 5GAQA 4I6IA 2NYYA 1FV3A 1S0CA 4WBCA 2AFGA 1G9CA 1QQLA 1M2TB 1KNMA 4IYBA 1PUUB 3Q7XA 3FJCA 3FJEA 3FUQA 2ZQNA 3I2XA 3CRHA 3O49A 3CQAA 4DEPA 4I4VA 2F8XC 5BQUC 2KKIA 4L4HA 4CJMA 1V6WA 3BRDA 1PC8B 4DCKC 4XFTA 1ISYA 4QBCA 1HCDA 1RMLA 4ZOTA 4ZA3B 1ABRB 1IILA 3OJ2A 1JT4A 2BEBA 2NVHA 5DUYA 5BP5A 3ILAA 7I1BA 1BFBA 1IJTA 4I0YA 1IRAX 2GO2A 4QALA 1V6XA 41BIA 3QYDA 1PWAA 3VWCA 3A07A 1IT0A 4FVVA 2K43A 4IY9A 1RG8A 2QYIB 4J2XA 31BIA 5F8YA 2D22A 3AJ5A 3FJ8A 3R4SA 3O4CA 1DIWA 1Q1UA 3NBNA 3HSMA 2YUGA 1E0OA 1R8OA 4ENDA 4A7KA 1MD6A 4H9WA 1S0BA 1AVUA 1DLLA 1AVAC 3A23A 3FGMA 4I4YA 3NJ5A 1FV2A 4LO2C 4P0LA 3BX1C 5FNWA 3S8JA 4JKXB 3UD7A 3O5WB 3BTAA 4I3NA 4JAWA 2VLCA 3FJJA 3AKIA 3OJMA 3H6RB 1YTOA 4X37A 3V0BA 4IZEA 1TFMB 2Y9FA 5EHAA 3RMYA 3AKHA 1FGAA 1K5UA 2P39A 1QQKA 2MIBA
chains in the Genus database with same CATH superfamily
3O44A 4OW4A 4ZLBB 1WBCA 1IHKA 3T8SA 2BFHA 4IY8A 4A7YA 1JY0A 3FFZA 2NM1A 1DQOA 3VT1A 3ZXDA 4I1BA 1HIBA 3UDAA 3CA1A 3AKFA 4P0JA 3CAHA 4USOA 1CE7B 3S8KA 2X2SA 3HMYA 4KEKA 3TC2A 3FJDA 3I2AA 3OGGA 2D1ZA 2ESUA 2HWMA 2WBCA 1ITBA 1T9FA 4JRAA 1S0LA 2VUAA 4ZFWB 3IM5A 4AN6A 4I4PA 5DVHA 1N4KA 4IHZA 5BQUA 1WD4A 2D43A 5BXSA 5BXTA 1JT5A 4OWLA 4G6JA 4L4IA 5D62A 2KH2A 3BA4A 3I29B 2J3PA 2Y9GA 3WMVA 1TOOA 1HWNB 8I1BA 4G9NA 2D24A 9ILBA 4EB2B 3JUTA 4LO1C 1W3GA 4OWJA 1RY7A 3IIRA 2D23A 4IONA 1GGPB 1V6UA 2K4AB 3MALA 1AF9A 1ISVA 1G82A 4I8MA 4J2YA 4Z8SB 3CU1B 1Z4SA 1TWEA 3BADA 3BA5A 3MPPG 4ISRA 4QD2C 3B9UA 4OEFA 1ILR1 1JTCA 3FJBA 5BXPA 3FJKA 4ZFUB 4H75A 4KBBA 4LO2A 4Q9PA 4LO0A 1ISXA 3FJIA 3ZC8A 4IZXA 5FZYA 4KEJA 2LIQA 1IRPA 4IQPA 1DFQA 1SZ6B 1S0FA 4QKSA 1XYFA 3V0AA 3HOMA 3OBTA 1PZZA 4ISQA 2WRYA 4I2SA 2FFVA 2GZBA 1I1EA 3AZWA 1AXMA 1JT7A 3NBCA 2VXRA 4J2KA 3E8LC 4H04A 3VT0A 1QXMA 2NS2A 1HWOB 5F8WA 3RTIB 5FNXA 3IM7A 3F62B 4AN7B 4ZBVB 2VSEA 3AZVA 2HWAA 1Q04A 5B2HA 3HALA 2KI4A 4LO0C 4P0KA 4G9MA 2KLLA 3BAOA 3ZXGA 3N7JA 4D0ZA 3CRGA 4OEEA 4D0TA 1NZKA 3K1XA 5D61A 4YOLA 3BRFA 4QO3A 4I4SA 1TWMA 2ET2A 1HCEA 2HW9A 4KC3A 3W9TA 2Q9XA 3VT2A 4HJJA 3UJ0A 1FQ9A 3POKA 1TIEA 4JQ0A 4P6AA 1P63A 4I4OA 4OWKA 1EV2A 2K8RA 4GAIA 4HR6C 4I7IA 1OQLB 1YF8B 1Q03A 2P23A 2ZR1B 3O4AA 3FJ9A 4KEIA 4PC4A 4DENA 4GP3A 1Z2VA 2Y9XE 3QR5A 4FGFA 2RG9B 4LO8B 6I1BA 3IAGC 4I1EA 2E4MC 1HWMB 3N0KA 3AJ6A 4GP0A 4X39A 4LO1A 4GOYA 5F8SA 2ZQOA 2DRYA 1XHBA 2QN4A 2IHOA 5G00A 1M16A 1UPSA 4EFRA 2IWTB 5HPZA 4F34A 1YYNA 1FN0A 4LO3C 3LLPA 1TTUA 4A7ZA 4XFSA 4ZGRB 5DZUA 5BXRA 2ERMA 1DQGA 4G6MA 4XKIA 4EFPA 2NP0A 4I96A 2AAIB 1R8NA 2DREA 3A22A 1II4A 1BFGA 1YBIA 1BFCA 4LO7C 2MC2A 4QC4A 3V0AB 1AVWB 3C9ZA 1TP0A 4EFQA 3RSJA 1DFCA 3UD9A 1EYLA 4UY4A 3Q7YA 5E24E 3BAHA 4OEGA 1BLAA 2NZ9A 3OGFA 3WINC 3VUOA 2Z49A 2Y9WC 4ZFYB 2Z48A 4I37A 4D8HA 3FJAA 3PMEA 4JPZA 3H6SE 2RSTA 3PG0A 1YXWA 3HN1A 2LIEA 4X38A 2AXMA 4GOVA 1FMMS 3AKGA 1ISZA 3V79C 1EVTA 1I1BA 2Q3NB 4J23B 3P6JA 1BA7A 1CVSA 3KMVA 1DJSB 1PUMB 3PHZA 3HBWA 3UJ4A 4OUJA 4X3AA 2HZ9A 3O3QA 3V0BB 4USPA 3WO4A 2D7IA 3RMXA 3ZC9A 1S0DA 1Z0HA 1JQZA 3A21A 1W3FA 5DSSB 3EF2A 1VCLA 2BEAA 2R9KB 1AFCA 4MZHA 2F2FA 1AVXB 4I4RA 1WD3A 1HKNA 1T4QA 2MLLB 1S0GA 1J0SA 4GAFA 1G9DA 2VXTI 4I4QA 5EC5A 1SR4A 1JLXA 1DZDA 1BLDA 1DZCA 4Q9GA 3BA7A 2E4MA 3BAQA 3CRIA 2L5XA 4I4XA 4G1RA 3CA4A 5BOWA 2D7RA 1BASA 4R6UB 2XOAA 3BAGA 5JLVA 4LO7B 3R4UA 3O4DA 3N7KA 1ONKB 1D0HA 3F1RA 3O4BA 3IM6A 2KI6B 1L2HA 3O4OA 3ZX7A 2FO1A 4LO3A 5BP5C 3BAUA 4QD2B 3VEQA 1A8DA 1JLYA 2F2FC 3WO3A 4QBVA 3P6IA 5F90A 1EPWA 1BARA 1V6VA 3H6QA 5JMCA 1BFFA 5BVPI 1SR4C 3NBDA 3SNVA 1S0EA 21BIA 2DS0A 4J2SA 2UUSA 4MZGB 2RQ9A 1JT3A 4I4UA 3D7WB 2X2TA 4QKRA 5FZUA 3WMUA 3WA1A 1IOBA 4EEEB 5I1BA 1XZZA 4XFUA 1FWVA 3BAVA 4TLPA 3RTJB 1FMZA 2DRZA 1NUNA 4F83A 3LTQA 2FGFA 3AH1A 3PUBA 3FJHA 3WINA 2FFUA 1MC9A 3CA0A 4EKXB 4ZKTB 1G9AA 4HA2A 4JKQA 3H6RA 3AH4A 3N7MA 1ISWA 1F31A 3FJFA 3N7LA 1W3AA 2FDBM 4Z9WB 1XG6A 2D44A 3NBEA 3WO2A 2AQZA 1RZOB 3FUOA 3CA3A 3BRGC 3OJVA 2D20A 4JP0A 3Q7WA 5EG6C 5D63A 2I1BA 2NTDA 2VSAA 3P53A 3CA6A 3UD8A 3JRRA 1G9BA 3CA5A 1HWPB 1FWUA 4II0A 3BB2A 1K5VA 2VU9A 3VSFA 3VSZA 4Q91A 2M49A 1WBAA 5FZZA 3OBRA 3AH2A 5GAQA 4I6IA 2NYYA 1FV3A 1S0CA 4WBCA 2AFGA 1G9CA 1QQLA 1M2TB 1KNMA 4IYBA 1PUUB 3Q7XA 3FJCA 3FJEA 3FUQA 2ZQNA 3I2XA 3CRHA 3O49A 3CQAA 4DEPA 4I4VA 2F8XC 5BQUC 2KKIA 4L4HA 4CJMA 1V6WA 3BRDA 1PC8B 4DCKC 4XFTA 1ISYA 4QBCA 1HCDA 1RMLA 4ZOTA 4ZA3B 1ABRB 1IILA 3OJ2A 1JT4A 2BEBA 2NVHA 5DUYA 5BP5A 3ILAA 7I1BA 1BFBA 1IJTA 4I0YA 1IRAX 2GO2A 4QALA 1V6XA 41BIA 3QYDA 1PWAA 3VWCA 3A07A 1IT0A 4FVVA 2K43A 4IY9A 1RG8A 2QYIB 4J2XA 31BIA 5F8YA 2D22A 3AJ5A 3FJ8A 3R4SA 3O4CA 1DIWA 1Q1UA 3NBNA 3HSMA 2YUGA 1E0OA 1R8OA 4ENDA 4A7KA 1MD6A 4MZFB 4H9WA 1S0BA 1AVUA 1DLLA 1AVAC 3A23A 3FGMA 4I4YA 3NJ5A 1FV2A 4LO2C 4P0LA 3BX1C 5FNWA 3S8JA 4JKXB 3UD7A 3O5WB 3BTAA 4I3NA 4JAWA 2VLCA 3FJJA 3AKIA 3OJMA 3H6RB 1YTOA 4X37A 3V0BA 4IZEA 1TFMB 2Y9FA 5EHAA 3RMYA 3AKHA 1FGAA 1K5UA 2P39A 1QQKA 2MIBA
chains in the Genus database with same CATH topology
3O44A 4OW4A 4ZLBB 1WBCA 1IHKA 3T8SA 2BFHA 4IY8A 4A7YA 1JY0A 3FFZA 2NM1A 1DQOA 3VT1A 3ZXDA 4I1BA 1HIBA 3UDAA 3CA1A 3AKFA 4P0JA 3CAHA 4USOA 1CE7B 3S8KA 2X2SA 3HMYA 4KEKA 3TC2A 3FJDA 3I2AA 3OGGA 2D1ZA 2ESUA 2HWMA 2WBCA 1ITBA 1T9FA 4JRAA 1S0LA 2VUAA 4ZFWB 3IM5A 4AN6A 4I4PA 5DVHA 1N4KA 4IHZA 5BQUA 1WD4A 2D43A 5BXSA 5BXTA 1JT5A 4OWLA 4G6JA 4L4IA 5D62A 2KH2A 3BA4A 3I29B 2J3PA 2Y9GA 3WMVA 1TOOA 1HWNB 8I1BA 4G9NA 2D24A 9ILBA 4EB2B 3JUTA 4LO1C 1W3GA 4OWJA 1RY7A 3IIRA 2D23A 4IONA 1GGPB 1V6UA 2K4AB 3MALA 1AF9A 1ISVA 1G82A 4I8MA 4J2YA 4Z8SB 3CU1B 1Z4SA 1TWEA 3BADA 3BA5A 3MPPG 4ISRA 4QD2C 3B9UA 4OEFA 1ILR1 1JTCA 3FJBA 5BXPA 3FJKA 4ZFUB 4H75A 4KBBA 4LO2A 4Q9PA 4LO0A 1ISXA 3FJIA 3ZC8A 4IZXA 5FZYA 4KEJA 2LIQA 1IRPA 4IQPA 1DFQA 1SZ6B 1S0FA 4QKSA 1XYFA 3V0AA 3HOMA 3OBTA 1PZZA 4ISQA 2WRYA 4I2SA 2FFVA 2GZBA 1I1EA 3AZWA 1AXMA 1JT7A 3NBCA 2VXRA 4J2KA 3E8LC 4H04A 3VT0A 1QXMA 2NS2A 1HWOB 5F8WA 3RTIB 5FNXA 3IM7A 3F62B 4AN7B 4ZBVB 2VSEA 3AZVA 2HWAA 1Q04A 5B2HA 3HALA 2KI4A 4LO0C 4P0KA 4G9MA 2KLLA 3BAOA 3ZXGA 3N7JA 4D0ZA 3CRGA 4OEEA 4D0TA 1NZKA 3K1XA 5D61A 4YOLA 3BRFA 4QO3A 4I4SA 1TWMA 2ET2A 1HCEA 2HW9A 4KC3A 3W9TA 2Q9XA 3VT2A 4HJJA 3UJ0A 1FQ9A 3POKA 1TIEA 4JQ0A 4P6AA 1P63A 4I4OA 4OWKA 1EV2A 2K8RA 4GAIA 4HR6C 4I7IA 1OQLB 1YF8B 1Q03A 2P23A 2ZR1B 3O4AA 3FJ9A 4KEIA 4PC4A 4DENA 4GP3A 1Z2VA 2Y9XE 3QR5A 4FGFA 2RG9B 4LO8B 6I1BA 3IAGC 4I1EA 2E4MC 1HWMB 3N0KA 3AJ6A 4GP0A 4X39A 4LO1A 4GOYA 5F8SA 2ZQOA 2DRYA 1XHBA 2QN4A 2IHOA 5G00A 1M16A 1UPSA 4EFRA 2IWTB 5HPZA 4F34A 1YYNA 1FN0A 4LO3C 3LLPA 1TTUA 4A7ZA 4XFSA 4ZGRB 5DZUA 5BXRA 2ERMA 1DQGA 4G6MA 4XKIA 4EFPA 2NP0A 4I96A 2AAIB 1R8NA 2DREA 3A22A 1II4A 1BFGA 1YBIA 1BFCA 4LO7C 2MC2A 4QC4A 3V0AB 1AVWB 3C9ZA 1TP0A 4EFQA 3RSJA 1DFCA 3UD9A 1EYLA 4UY4A 3Q7YA 5E24E 3BAHA 4OEGA 1BLAA 2NZ9A 3OGFA 3WINC 3VUOA 2Z49A 2Y9WC 4ZFYB 2Z48A 4I37A 4D8HA 3FJAA 3PMEA 4JPZA 3H6SE 2RSTA 3PG0A 1YXWA 3HN1A 2LIEA 4X38A 2AXMA 4GOVA 1FMMS 3AKGA 1ISZA 3V79C 1EVTA 1I1BA 2Q3NB 4J23B 3P6JA 1BA7A 1CVSA 3KMVA 1DJSB 1PUMB 3PHZA 3HBWA 3UJ4A 4OUJA 4X3AA 2HZ9A 3O3QA 3V0BB 4USPA 3WO4A 2D7IA 3RMXA 3ZC9A 1S0DA 1Z0HA 1JQZA 3A21A 1W3FA 5DSSB 3EF2A 1VCLA 2BEAA 2R9KB 1AFCA 4MZHA 2F2FA 1AVXB 4I4RA 1WD3A 1HKNA 1T4QA 2MLLB 1S0GA 1J0SA 4GAFA 1G9DA 2VXTI 4I4QA 5EC5A 1SR4A 1JLXA 1DZDA 1BLDA 1DZCA 4Q9GA 3BA7A 2E4MA 3BAQA 3CRIA 2L5XA 4I4XA 4G1RA 3CA4A 5BOWA 2D7RA 1BASA 4R6UB 2XOAA 3BAGA 5JLVA 4LO7B 3R4UA 3O4DA 3N7KA 1ONKB 1D0HA 3F1RA 3O4BA 3IM6A 2KI6B 1L2HA 3O4OA 3ZX7A 2FO1A 4LO3A 5BP5C 3BAUA 4QD2B 3VEQA 1A8DA 1JLYA 2F2FC 3WO3A 4QBVA 3P6IA 5F90A 1EPWA 1BARA 1V6VA 3H6QA 5JMCA 1BFFA 5BVPI 1SR4C 3NBDA 3SNVA 1S0EA 21BIA 2DS0A 4J2SA 2UUSA 4MZGB 2RQ9A 1JT3A 4I4UA 3D7WB 2X2TA 4QKRA 5FZUA 3WMUA 3WA1A 1IOBA 4EEEB 5I1BA 1XZZA 4XFUA 1FWVA 3BAVA 4TLPA 3RTJB 1FMZA 2DRZA 1NUNA 4F83A 3LTQA 2FGFA 3AH1A 3PUBA 3FJHA 3WINA 2FFUA 1MC9A 3CA0A 4EKXB 4ZKTB 1G9AA 4HA2A 4JKQA 3H6RA 3AH4A 3N7MA 1ISWA 1F31A 3FJFA 3N7LA 1W3AA 2FDBM 4Z9WB 1XG6A 2D44A 3NBEA 3WO2A 2AQZA 1RZOB 3FUOA 3CA3A 3BRGC 3OJVA 2D20A 4JP0A 3Q7WA 5EG6C 5D63A 2I1BA 2NTDA 2VSAA 3P53A 3CA6A 3UD8A 3JRRA 1G9BA 3CA5A 1HWPB 1FWUA 4II0A 3BB2A 1K5VA 2VU9A 3VSFA 3VSZA 4Q91A 2M49A 1WBAA 5FZZA 3OBRA 3AH2A 5GAQA 4I6IA 2NYYA 1FV3A 1S0CA 4WBCA 2AFGA 1G9CA 1QQLA 1M2TB 1KNMA 4IYBA 1PUUB 3Q7XA 3FJCA 3FJEA 3FUQA 2ZQNA 3I2XA 3CRHA 3O49A 3CQAA 4DEPA 4I4VA 2F8XC 5BQUC 2KKIA 4L4HA 4CJMA 1V6WA 3BRDA 1PC8B 4DCKC 4XFTA 1ISYA 4QBCA 1HCDA 1RMLA 4ZOTA 4ZA3B 1ABRB 1IILA 3OJ2A 1JT4A 2BEBA 2NVHA 5DUYA 5BP5A 3ILAA 7I1BA 1BFBA 1IJTA 4I0YA 1IRAX 2GO2A 4QALA 1V6XA 41BIA 3QYDA 1PWAA 3VWCA 3A07A 1IT0A 4FVVA 2K43A 4IY9A 1RG8A 2QYIB 4J2XA 31BIA 5F8YA 2D22A 3AJ5A 3FJ8A 3R4SA 3O4CA 1DIWA 1Q1UA 3NBNA 3HSMA 2YUGA 1E0OA 1R8OA 4ENDA 4A7KA 1MD6A 4MZFB 4H9WA 1S0BA 1AVUA 1DLLA 1AVAC 3A23A 3FGMA 4I4YA 3NJ5A 1FV2A 4LO2C 4P0LA 3BX1C 5FNWA 3S8JA 4JKXB 3UD7A 3O5WB 3BTAA 4I3NA 4JAWA 2VLCA 3FJJA 3AKIA 3OJMA 3H6RB 1YTOA 4X37A 3V0BA 4IZEA 1TFMB 2Y9FA 5EHAA 3RMYA 3AKHA 1FGAA 1K5UA 2P39A 1QQKA 2MIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O44 A;  4OW4 A;  4ZLB B;  1WBC A;  1IHK A;  3T8S A;  2BFH A;  4IY8 A;  4A7Y A;  1JY0 A;  3FFZ A;  2NM1 A;  1DQO A;  3VT1 A;  3ZXD A;  4I1B A;  1HIB A;  3UDA A;  3CA1 A;  3AKF A;  4P0J A;  3CAH A;  4USO A;  1CE7 B;  3S8K A;  2X2S A;  3HMY A;  4KEK A;  3TC2 A;  3FJD A;  3I2A A;  3OGG A;  2D1Z A;  2ESU A;  2HWM A;  2WBC A;  1ITB A;  1T9F A;  4JRA A;  1S0L A;  2VUA A;  4ZFW B;  3IM5 A;  4AN6 A;  4I4P A;  5DVH A;  1N4K A;  4IHZ A;  5BQU A;  1WD4 A;  2D43 A;  5BXS A;  5BXT A;  1JT5 A;  4OWL A;  4G6J A;  4L4I A;  5D62 A;  2KH2 A;  3BA4 A;  3I29 B;  2J3P A;  2Y9G A;  3WMV A;  1TOO A;  1HWN B;  8I1B A;  4G9N A;  2D24 A;  9ILB A;  4EB2 B;  3JUT A;  4LO1 C;  1W3G A;  4OWJ A;  1RY7 A;  3IIR A;  2D23 A;  4ION A;  1GGP B;  1V6U A;  2K4A B;  3MAL A;  1AF9 A;  1ISV A;  1G82 A;  4I8M A;  4J2Y A;  4Z8S B;  3CU1 B;  1Z4S A;  1TWE A;  3BAD A;  3BA5 A;  3MPP G;  4ISR A;  4QD2 C;  3B9U A;  4OEF A;  1ILR 1;  1JTC A;  3FJB A;  5BXP A;  3FJK A;  4ZFU B;  4KBB A;  4LO2 A;  4Q9P A;  4LO0 A;  1ISX A;  3FJI A;  3ZC8 A;  4IZX A;  5FZY A;  4KEJ A;  2LIQ A;  1IRP A;  4IQP A;  1DFQ A;  1SZ6 B;  1S0F A;  4QKS A;  1XYF A;  3V0A A;  3HOM A;  3OBT A;  1PZZ A;  4ISQ A;  2WRY A;  4I2S A;  2FFV A;  2GZB A;  1I1E A;  3AZW A;  1AXM A;  1JT7 A;  3NBC A;  2VXR A;  4J2K A;  3E8L C;  4H04 A;  3VT0 A;  1QXM A;  1HWO B;  5F8W A;  3RTI B;  5FNX A;  3IM7 A;  3F62 B;  4AN7 B;  4ZBV B;  2VSE A;  3AZV A;  2HWA A;  1Q04 A;  5B2H A;  3HAL A;  2KI4 A;  4LO0 C;  4P0K A;  4G9M A;  2KLL A;  3BAO A;  3ZXG A;  3N7J A;  4D0Z A;  3CRG A;  4OEE A;  4D0T A;  1NZK A;  3K1X A;  5D61 A;  4YOL A;  3BRF A;  4QO3 A;  4I4S A;  1TWM A;  2ET2 A;  1HCE A;  2HW9 A;  4KC3 A;  3W9T A;  2Q9X A;  3VT2 A;  4HJJ A;  3UJ0 A;  1FQ9 A;  3POK A;  1TIE A;  4JQ0 A;  4P6A A;  1P63 A;  4I4O A;  4OWK A;  1EV2 A;  2K8R A;  4GAI A;  4HR6 C;  4I7I A;  1OQL B;  1YF8 B;  1Q03 A;  2P23 A;  2ZR1 B;  3O4A A;  3FJ9 A;  4KEI A;  4PC4 A;  4DEN A;  4GP3 A;  1Z2V A;  2Y9X E;  3QR5 A;  4FGF A;  2RG9 B;  4LO8 B;  6I1B A;  3IAG C;  4I1E A;  2E4M C;  1HWM B;  3N0K A;  3AJ6 A;  4GP0 A;  4X39 A;  4LO1 A;  4GOY A;  5F8S A;  2ZQO A;  2DRY A;  1XHB A;  2QN4 A;  2IHO A;  5G00 A;  1M16 A;  1UPS A;  4EFR A;  2IWT B;  5HPZ A;  4F34 A;  1YYN A;  1FN0 A;  4LO3 C;  3LLP A;  1TTU A;  4A7Z A;  4XFS A;  4ZGR B;  5DZU A;  5BXR A;  2ERM A;  1DQG A;  4G6M A;  4XKI A;  4EFP A;  2NP0 A;  4I96 A;  2AAI B;  1R8N A;  2DRE A;  3A22 A;  1II4 A;  1BFG A;  1YBI A;  1BFC A;  4LO7 C;  2MC2 A;  4QC4 A;  3V0A B;  1AVW B;  3C9Z A;  1TP0 A;  4EFQ A;  3RSJ A;  1DFC A;  3UD9 A;  1EYL A;  5E24 E;  3Q7Y A;  3BAH A;  4OEG A;  1BLA A;  2NZ9 A;  3OGF A;  3WIN C;  3VUO A;  2Z49 A;  2Y9W C;  4ZFY B;  2Z48 A;  4I37 A;  4D8H A;  3FJA A;  3PME A;  4JPZ A;  3H6S E;  2RST A;  3PG0 A;  1YXW A;  3HN1 A;  2LIE A;  4X38 A;  2AXM A;  4GOV A;  1FMM S;  3AKG A;  1ISZ A;  3V79 C;  1EVT A;  1I1B A;  2Q3N B;  4J23 B;  3P6J A;  1BA7 A;  1CVS A;  3KMV A;  1DJS B;  1PUM B;  3PHZ A;  3HBW A;  3UJ4 A;  4OUJ A;  4X3A A;  2HZ9 A;  3O3Q A;  3V0B B;  4USP A;  3WO4 A;  2D7I A;  3RMX A;  3ZC9 A;  1S0D A;  1Z0H A;  1JQZ A;  3A21 A;  1W3F A;  5DSS B;  3EF2 A;  1VCL A;  2BEA A;  2R9K B;  1AFC A;  2F2F A;  1AVX B;  4I4R A;  1WD3 A;  1HKN A;  1T4Q A;  2MLL B;  1S0G A;  1J0S A;  4GAF A;  1G9D A;  2VXT I;  4I4Q A;  5EC5 A;  1SR4 A;  1JLX A;  1DZD A;  1BLD A;  1DZC A;  4Q9G A;  3BA7 A;  2E4M A;  3BAQ A;  3CRI A;  2L5X A;  4I4X A;  4G1R A;  3CA4 A;  5BOW A;  2D7R A;  1BAS A;  4R6U B;  2XOA A;  3BAG A;  5JLV A;  4LO7 B;  3R4U A;  3O4D A;  3N7K A;  1ONK B;  1D0H A;  3F1R A;  3O4B A;  3IM6 A;  2KI6 B;  1L2H A;  3O4O A;  3ZX7 A;  2FO1 A;  4LO3 A;  5BP5 C;  3BAU A;  4QD2 B;  3VEQ A;  1A8D A;  1JLY A;  2F2F C;  3WO3 A;  4QBV A;  3P6I A;  5F90 A;  1EPW A;  1BAR A;  1V6V A;  3H6Q A;  5JMC A;  1BFF A;  5BVP I;  1SR4 C;  3NBD A;  3SNV A;  1S0E A;  21BI A;  2DS0 A;  4J2S A;  2UUS A;  2RQ9 A;  1JT3 A;  4I4U A;  3D7W B;  2X2T A;  4QKR A;  5FZU A;  3WMU A;  3WA1 A;  1IOB A;  4EEE B;  5I1B A;  1XZZ A;  4XFU A;  1FWV A;  3BAV A;  4TLP A;  3RTJ B;  1FMZ A;  2DRZ A;  1NUN A;  4F83 A;  3LTQ A;  2FGF A;  3AH1 A;  3PUB A;  3FJH A;  3WIN A;  2FFU A;  1MC9 A;  3CA0 A;  4EKX B;  4ZKT B;  1G9A A;  4HA2 A;  4JKQ A;  3H6R A;  3AH4 A;  3N7M A;  1ISW A;  1F31 A;  3FJF A;  3N7L A;  1W3A A;  2FDB M;  4Z9W B;  1XG6 A;  2D44 A;  3NBE A;  3WO2 A;  2AQZ A;  1RZO B;  3FUO A;  3CA3 A;  3BRG C;  3OJV A;  2D20 A;  4JP0 A;  3Q7W A;  5EG6 C;  5D63 A;  2I1B A;  2NTD A;  2VSA A;  3P53 A;  3CA6 A;  3UD8 A;  3JRR A;  1G9B A;  3CA5 A;  1HWP B;  1FWU A;  4II0 A;  3BB2 A;  1K5V A;  2VU9 A;  3VSF A;  3VSZ A;  4Q91 A;  2M49 A;  1WBA A;  5FZZ A;  3OBR A;  3AH2 A;  5GAQ A;  4I6I A;  2NYY A;  1FV3 A;  1S0C A;  4WBC A;  2AFG A;  1G9C A;  1QQL A;  1M2T B;  1KNM A;  4IYB A;  1PUU B;  3Q7X A;  3FJC A;  3FJE A;  3FUQ A;  2ZQN A;  3I2X A;  3CRH A;  3O49 A;  3CQA A;  4DEP A;  4I4V A;  2F8X C;  5BQU C;  2KKI A;  4L4H A;  4CJM A;  1V6W A;  3BRD A;  1PC8 B;  4DCK C;  4XFT A;  1ISY A;  4QBC A;  1HCD A;  1RML A;  4ZOT A;  4ZA3 B;  1ABR B;  1IIL A;  3OJ2 A;  1JT4 A;  2BEB A;  2NVH A;  5DUY A;  5BP5 A;  3ILA A;  7I1B A;  1BFB A;  1IJT A;  4I0Y A;  1IRA X;  2GO2 A;  4QAL A;  1V6X A;  41BI A;  3QYD A;  1PWA A;  3VWC A;  3A07 A;  1IT0 A;  4FVV A;  2K43 A;  4IY9 A;  1RG8 A;  2QYI B;  4J2X A;  31BI A;  5F8Y A;  2D22 A;  3AJ5 A;  3FJ8 A;  3R4S A;  3O4C A;  1DIW A;  1Q1U A;  3NBN A;  3HSM A;  2YUG A;  1E0O A;  1R8O A;  4END A;  4A7K A;  1MD6 A;  4H9W A;  1S0B A;  1AVU A;  1DLL A;  1AVA C;  3A23 A;  3FGM A;  4I4Y A;  3NJ5 A;  1FV2 A;  4LO2 C;  4P0L A;  3BX1 C;  5FNW A;  3S8J A;  4JKX B;  3UD7 A;  3O5W B;  3BTA A;  4I3N A;  4JAW A;  2VLC A;  3FJJ A;  3AKI A;  3OJM A;  3H6R B;  1YTO A;  4X37 A;  3V0B A;  4IZE A;  1TFM B;  2Y9F A;  5EHA A;  3RMY A;  3AKH A;  1FGA A;  1K5U A;  2P39 A;  1QQK A;  2MIB A; 
#chains in the Genus database with same CATH topology
 3O44 A;  4OW4 A;  4ZLB B;  1WBC A;  1IHK A;  3T8S A;  2BFH A;  4IY8 A;  4A7Y A;  1JY0 A;  3FFZ A;  2NM1 A;  1DQO A;  3VT1 A;  3ZXD A;  4I1B A;  1HIB A;  3UDA A;  3CA1 A;  3AKF A;  4P0J A;  3CAH A;  4USO A;  1CE7 B;  3S8K A;  2X2S A;  3HMY A;  4KEK A;  3TC2 A;  3FJD A;  3I2A A;  3OGG A;  2D1Z A;  2ESU A;  2HWM A;  2WBC A;  1ITB A;  1T9F A;  4JRA A;  1S0L A;  2VUA A;  4ZFW B;  3IM5 A;  4AN6 A;  4I4P A;  5DVH A;  1N4K A;  4IHZ A;  5BQU A;  1WD4 A;  2D43 A;  5BXS A;  5BXT A;  1JT5 A;  4OWL A;  4G6J A;  4L4I A;  5D62 A;  2KH2 A;  3BA4 A;  3I29 B;  2J3P A;  2Y9G A;  3WMV A;  1TOO A;  1HWN B;  8I1B A;  4G9N A;  2D24 A;  9ILB A;  4EB2 B;  3JUT A;  4LO1 C;  1W3G A;  4OWJ A;  1RY7 A;  3IIR A;  2D23 A;  4ION A;  1GGP B;  1V6U A;  2K4A B;  3MAL A;  1AF9 A;  1ISV A;  1G82 A;  4I8M A;  4J2Y A;  4Z8S B;  3CU1 B;  1Z4S A;  1TWE A;  3BAD A;  3BA5 A;  3MPP G;  4ISR A;  4QD2 C;  3B9U A;  4OEF A;  1ILR 1;  1JTC A;  3FJB A;  5BXP A;  3FJK A;  4ZFU B;  4H75 A;  4KBB A;  4LO2 A;  4Q9P A;  4LO0 A;  1ISX A;  3FJI A;  3ZC8 A;  4IZX A;  5FZY A;  4KEJ A;  2LIQ A;  1IRP A;  4IQP A;  1DFQ A;  1SZ6 B;  1S0F A;  4QKS A;  1XYF A;  3V0A A;  3HOM A;  3OBT A;  1PZZ A;  4ISQ A;  2WRY A;  4I2S A;  2FFV A;  2GZB A;  1I1E A;  3AZW A;  1AXM A;  1JT7 A;  3NBC A;  2VXR A;  4J2K A;  3E8L C;  4H04 A;  3VT0 A;  1QXM A;  2NS2 A;  1HWO B;  5F8W A;  3RTI B;  5FNX A;  3IM7 A;  3F62 B;  4AN7 B;  4ZBV B;  2VSE A;  3AZV A;  2HWA A;  1Q04 A;  5B2H A;  3HAL A;  2KI4 A;  4LO0 C;  4P0K A;  4G9M A;  2KLL A;  3BAO A;  3ZXG A;  3N7J A;  4D0Z A;  3CRG A;  4OEE A;  4D0T A;  1NZK A;  3K1X A;  5D61 A;  4YOL A;  3BRF A;  4QO3 A;  4I4S A;  1TWM A;  2ET2 A;  1HCE A;  2HW9 A;  4KC3 A;  3W9T A;  2Q9X A;  3VT2 A;  4HJJ A;  3UJ0 A;  1FQ9 A;  3POK A;  1TIE A;  4JQ0 A;  4P6A A;  1P63 A;  4I4O A;  4OWK A;  1EV2 A;  2K8R A;  4GAI A;  4HR6 C;  4I7I A;  1OQL B;  1YF8 B;  1Q03 A;  2P23 A;  2ZR1 B;  3O4A A;  3FJ9 A;  4KEI A;  4PC4 A;  4DEN A;  4GP3 A;  1Z2V A;  2Y9X E;  3QR5 A;  4FGF A;  2RG9 B;  4LO8 B;  6I1B A;  3IAG C;  4I1E A;  2E4M C;  1HWM B;  3N0K A;  3AJ6 A;  4GP0 A;  4X39 A;  4LO1 A;  4GOY A;  5F8S A;  2ZQO A;  2DRY A;  1XHB A;  2QN4 A;  2IHO A;  5G00 A;  1M16 A;  1UPS A;  4EFR A;  2IWT B;  5HPZ A;  4F34 A;  1YYN A;  1FN0 A;  4LO3 C;  3LLP A;  1TTU A;  4A7Z A;  4XFS A;  4ZGR B;  5DZU A;  5BXR A;  2ERM A;  1DQG A;  4G6M A;  4XKI A;  4EFP A;  2NP0 A;  4I96 A;  2AAI B;  1R8N A;  2DRE A;  3A22 A;  1II4 A;  1BFG A;  1YBI A;  1BFC A;  4LO7 C;  2MC2 A;  4QC4 A;  3V0A B;  1AVW B;  3C9Z A;  1TP0 A;  4EFQ A;  3RSJ A;  1DFC A;  3UD9 A;  1EYL A;  4UY4 A;  3Q7Y A;  5E24 E;  3BAH A;  4OEG A;  1BLA A;  2NZ9 A;  3OGF A;  3WIN C;  3VUO A;  2Z49 A;  2Y9W C;  4ZFY B;  2Z48 A;  4I37 A;  4D8H A;  3FJA A;  3PME A;  4JPZ A;  3H6S E;  2RST A;  3PG0 A;  1YXW A;  3HN1 A;  2LIE A;  4X38 A;  2AXM A;  4GOV A;  1FMM S;  3AKG A;  1ISZ A;  3V79 C;  1EVT A;  1I1B A;  2Q3N B;  4J23 B;  3P6J A;  1BA7 A;  1CVS A;  3KMV A;  1DJS B;  1PUM B;  3PHZ A;  3HBW A;  3UJ4 A;  4OUJ A;  4X3A A;  2HZ9 A;  3O3Q A;  3V0B B;  4USP A;  3WO4 A;  2D7I A;  3RMX A;  3ZC9 A;  1S0D A;  1Z0H A;  1JQZ A;  3A21 A;  1W3F A;  5DSS B;  3EF2 A;  1VCL A;  2BEA A;  2R9K B;  1AFC A;  4MZH A;  2F2F A;  1AVX B;  4I4R A;  1WD3 A;  1HKN A;  1T4Q A;  2MLL B;  1S0G A;  1J0S A;  4GAF A;  1G9D A;  2VXT I;  4I4Q A;  5EC5 A;  1SR4 A;  1JLX A;  1DZD A;  1BLD A;  1DZC A;  4Q9G A;  3BA7 A;  2E4M A;  3BAQ A;  3CRI A;  2L5X A;  4I4X A;  4G1R A;  3CA4 A;  5BOW A;  2D7R A;  1BAS A;  4R6U B;  2XOA A;  3BAG A;  5JLV A;  4LO7 B;  3R4U A;  3O4D A;  3N7K A;  1ONK B;  1D0H A;  3F1R A;  3O4B A;  3IM6 A;  2KI6 B;  1L2H A;  3O4O A;  3ZX7 A;  2FO1 A;  4LO3 A;  5BP5 C;  3BAU A;  4QD2 B;  3VEQ A;  1A8D A;  1JLY A;  2F2F C;  3WO3 A;  4QBV A;  3P6I A;  5F90 A;  1EPW A;  1BAR A;  1V6V A;  3H6Q A;  5JMC A;  1BFF A;  5BVP I;  1SR4 C;  3NBD A;  3SNV A;  1S0E A;  21BI A;  2DS0 A;  4J2S A;  2UUS A;  4MZG B;  2RQ9 A;  1JT3 A;  4I4U A;  3D7W B;  2X2T A;  4QKR A;  5FZU A;  3WMU A;  3WA1 A;  1IOB A;  4EEE B;  5I1B A;  1XZZ A;  4XFU A;  1FWV A;  3BAV A;  4TLP A;  3RTJ B;  1FMZ A;  2DRZ A;  1NUN A;  4F83 A;  3LTQ A;  2FGF A;  3AH1 A;  3PUB A;  3FJH A;  3WIN A;  2FFU A;  1MC9 A;  3CA0 A;  4EKX B;  4ZKT B;  1G9A A;  4HA2 A;  4JKQ A;  3H6R A;  3AH4 A;  3N7M A;  1ISW A;  1F31 A;  3FJF A;  3N7L A;  1W3A A;  2FDB M;  4Z9W B;  1XG6 A;  2D44 A;  3NBE A;  3WO2 A;  2AQZ A;  1RZO B;  3FUO A;  3CA3 A;  3BRG C;  3OJV A;  2D20 A;  4JP0 A;  3Q7W A;  5EG6 C;  5D63 A;  2I1B A;  2NTD A;  2VSA A;  3P53 A;  3CA6 A;  3UD8 A;  3JRR A;  1G9B A;  3CA5 A;  1HWP B;  1FWU A;  4II0 A;  3BB2 A;  1K5V A;  2VU9 A;  3VSF A;  3VSZ A;  4Q91 A;  2M49 A;  1WBA A;  5FZZ A;  3OBR A;  3AH2 A;  5GAQ A;  4I6I A;  2NYY A;  1FV3 A;  1S0C A;  4WBC A;  2AFG A;  1G9C A;  1QQL A;  1M2T B;  1KNM A;  4IYB A;  1PUU B;  3Q7X A;  3FJC A;  3FJE A;  3FUQ A;  2ZQN A;  3I2X A;  3CRH A;  3O49 A;  3CQA A;  4DEP A;  4I4V A;  2F8X C;  5BQU C;  2KKI A;  4L4H A;  4CJM A;  1V6W A;  3BRD A;  1PC8 B;  4DCK C;  4XFT A;  1ISY A;  4QBC A;  1HCD A;  1RML A;  4ZOT A;  4ZA3 B;  1ABR B;  1IIL A;  3OJ2 A;  1JT4 A;  2BEB A;  2NVH A;  5DUY A;  5BP5 A;  3ILA A;  7I1B A;  1BFB A;  1IJT A;  4I0Y A;  1IRA X;  2GO2 A;  4QAL A;  1V6X A;  41BI A;  3QYD A;  1PWA A;  3VWC A;  3A07 A;  1IT0 A;  4FVV A;  2K43 A;  4IY9 A;  1RG8 A;  2QYI B;  4J2X A;  31BI A;  5F8Y A;  2D22 A;  3AJ5 A;  3FJ8 A;  3R4S A;  3O4C A;  1DIW A;  1Q1U A;  3NBN A;  3HSM A;  2YUG A;  1E0O A;  1R8O A;  4END A;  4A7K A;  1MD6 A;  4MZF B;  4H9W A;  1S0B A;  1AVU A;  1DLL A;  1AVA C;  3A23 A;  3FGM A;  4I4Y A;  3NJ5 A;  1FV2 A;  4LO2 C;  4P0L A;  3BX1 C;  5FNW A;  3S8J A;  4JKX B;  3UD7 A;  3O5W B;  3BTA A;  4I3N A;  4JAW A;  2VLC A;  3FJJ A;  3AKI A;  3OJM A;  3H6R B;  1YTO A;  4X37 A;  3V0B A;  4IZE A;  1TFM B;  2Y9F A;  5EHA A;  3RMY A;  3AKH A;  1FGA A;  1K5U A;  2P39 A;  1QQK A;  2MIB A; 
#chains in the Genus database with same CATH homology
 3O44 A;  4OW4 A;  4ZLB B;  1WBC A;  1IHK A;  3T8S A;  2BFH A;  4IY8 A;  4A7Y A;  1JY0 A;  3FFZ A;  2NM1 A;  1DQO A;  3VT1 A;  3ZXD A;  4I1B A;  1HIB A;  3UDA A;  3CA1 A;  3AKF A;  4P0J A;  3CAH A;  4USO A;  1CE7 B;  3S8K A;  2X2S A;  3HMY A;  4KEK A;  3TC2 A;  3FJD A;  3I2A A;  3OGG A;  2D1Z A;  2ESU A;  2HWM A;  2WBC A;  1ITB A;  1T9F A;  4JRA A;  1S0L A;  2VUA A;  4ZFW B;  3IM5 A;  4AN6 A;  4I4P A;  5DVH A;  1N4K A;  4IHZ A;  5BQU A;  1WD4 A;  2D43 A;  5BXS A;  5BXT A;  1JT5 A;  4OWL A;  4G6J A;  4L4I A;  5D62 A;  2KH2 A;  3BA4 A;  3I29 B;  2J3P A;  2Y9G A;  3WMV A;  1TOO A;  1HWN B;  8I1B A;  4G9N A;  2D24 A;  9ILB A;  4EB2 B;  3JUT A;  4LO1 C;  1W3G A;  4OWJ A;  1RY7 A;  3IIR A;  2D23 A;  4ION A;  1GGP B;  1V6U A;  2K4A B;  3MAL A;  1AF9 A;  1ISV A;  1G82 A;  4I8M A;  4J2Y A;  4Z8S B;  3CU1 B;  1Z4S A;  1TWE A;  3BAD A;  3BA5 A;  3MPP G;  4ISR A;  4QD2 C;  3B9U A;  4OEF A;  1ILR 1;  1JTC A;  3FJB A;  5BXP A;  3FJK A;  4ZFU B;  4H75 A;  4KBB A;  4LO2 A;  4Q9P A;  4LO0 A;  1ISX A;  3FJI A;  3ZC8 A;  4IZX A;  5FZY A;  4KEJ A;  2LIQ A;  1IRP A;  4IQP A;  1DFQ A;  1SZ6 B;  1S0F A;  4QKS A;  1XYF A;  3V0A A;  3HOM A;  3OBT A;  1PZZ A;  4ISQ A;  2WRY A;  4I2S A;  2FFV A;  2GZB A;  1I1E A;  3AZW A;  1AXM A;  1JT7 A;  3NBC A;  2VXR A;  4J2K A;  3E8L C;  4H04 A;  3VT0 A;  1QXM A;  2NS2 A;  1HWO B;  5F8W A;  3RTI B;  5FNX A;  3IM7 A;  3F62 B;  4AN7 B;  4ZBV B;  2VSE A;  3AZV A;  2HWA A;  1Q04 A;  5B2H A;  3HAL A;  2KI4 A;  4LO0 C;  4P0K A;  4G9M A;  2KLL A;  3BAO A;  3ZXG A;  3N7J A;  4D0Z A;  3CRG A;  4OEE A;  4D0T A;  1NZK A;  3K1X A;  5D61 A;  4YOL A;  3BRF A;  4QO3 A;  4I4S A;  1TWM A;  2ET2 A;  1HCE A;  2HW9 A;  4KC3 A;  3W9T A;  2Q9X A;  3VT2 A;  4HJJ A;  3UJ0 A;  1FQ9 A;  3POK A;  1TIE A;  4JQ0 A;  4P6A A;  1P63 A;  4I4O A;  4OWK A;  1EV2 A;  2K8R A;  4GAI A;  4HR6 C;  4I7I A;  1OQL B;  1YF8 B;  1Q03 A;  2P23 A;  2ZR1 B;  3O4A A;  3FJ9 A;  4KEI A;  4PC4 A;  4DEN A;  4GP3 A;  1Z2V A;  2Y9X E;  3QR5 A;  4FGF A;  2RG9 B;  4LO8 B;  6I1B A;  3IAG C;  4I1E A;  2E4M C;  1HWM B;  3N0K A;  3AJ6 A;  4GP0 A;  4X39 A;  4LO1 A;  4GOY A;  5F8S A;  2ZQO A;  2DRY A;  1XHB A;  2QN4 A;  2IHO A;  5G00 A;  1M16 A;  1UPS A;  4EFR A;  2IWT B;  5HPZ A;  4F34 A;  1YYN A;  1FN0 A;  4LO3 C;  3LLP A;  1TTU A;  4A7Z A;  4XFS A;  4ZGR B;  5DZU A;  5BXR A;  2ERM A;  1DQG A;  4G6M A;  4XKI A;  4EFP A;  2NP0 A;  4I96 A;  2AAI B;  1R8N A;  2DRE A;  3A22 A;  1II4 A;  1BFG A;  1YBI A;  1BFC A;  4LO7 C;  2MC2 A;  4QC4 A;  3V0A B;  1AVW B;  3C9Z A;  1TP0 A;  4EFQ A;  3RSJ A;  1DFC A;  3UD9 A;  1EYL A;  4UY4 A;  3Q7Y A;  5E24 E;  3BAH A;  4OEG A;  1BLA A;  2NZ9 A;  3OGF A;  3WIN C;  3VUO A;  2Z49 A;  2Y9W C;  4ZFY B;  2Z48 A;  4I37 A;  4D8H A;  3FJA A;  3PME A;  4JPZ A;  3H6S E;  2RST A;  3PG0 A;  1YXW A;  3HN1 A;  2LIE A;  4X38 A;  2AXM A;  4GOV A;  1FMM S;  3AKG A;  1ISZ A;  3V79 C;  1EVT A;  1I1B A;  2Q3N B;  4J23 B;  3P6J A;  1BA7 A;  1CVS A;  3KMV A;  1DJS B;  1PUM B;  3PHZ A;  3HBW A;  3UJ4 A;  4OUJ A;  4X3A A;  2HZ9 A;  3O3Q A;  3V0B B;  4USP A;  3WO4 A;  2D7I A;  3RMX A;  3ZC9 A;  1S0D A;  1Z0H A;  1JQZ A;  3A21 A;  1W3F A;  5DSS B;  3EF2 A;  1VCL A;  2BEA A;  2R9K B;  1AFC A;  4MZH A;  2F2F A;  1AVX B;  4I4R A;  1WD3 A;  1HKN A;  1T4Q A;  2MLL B;  1S0G A;  1J0S A;  4GAF A;  1G9D A;  2VXT I;  4I4Q A;  5EC5 A;  1SR4 A;  1JLX A;  1DZD A;  1BLD A;  1DZC A;  4Q9G A;  3BA7 A;  2E4M A;  3BAQ A;  3CRI A;  2L5X A;  4I4X A;  4G1R A;  3CA4 A;  5BOW A;  2D7R A;  1BAS A;  4R6U B;  2XOA A;  3BAG A;  5JLV A;  4LO7 B;  3R4U A;  3O4D A;  3N7K A;  1ONK B;  1D0H A;  3F1R A;  3O4B A;  3IM6 A;  2KI6 B;  1L2H A;  3O4O A;  3ZX7 A;  2FO1 A;  4LO3 A;  5BP5 C;  3BAU A;  4QD2 B;  3VEQ A;  1A8D A;  1JLY A;  2F2F C;  3WO3 A;  4QBV A;  3P6I A;  5F90 A;  1EPW A;  1BAR A;  1V6V A;  3H6Q A;  5JMC A;  1BFF A;  5BVP I;  1SR4 C;  3NBD A;  3SNV A;  1S0E A;  21BI A;  2DS0 A;  4J2S A;  2UUS A;  4MZG B;  2RQ9 A;  1JT3 A;  4I4U A;  3D7W B;  2X2T A;  4QKR A;  5FZU A;  3WMU A;  3WA1 A;  1IOB A;  4EEE B;  5I1B A;  1XZZ A;  4XFU A;  1FWV A;  3BAV A;  4TLP A;  3RTJ B;  1FMZ A;  2DRZ A;  1NUN A;  4F83 A;  3LTQ A;  2FGF A;  3AH1 A;  3PUB A;  3FJH A;  3WIN A;  2FFU A;  1MC9 A;  3CA0 A;  4EKX B;  4ZKT B;  1G9A A;  4HA2 A;  4JKQ A;  3H6R A;  3AH4 A;  3N7M A;  1ISW A;  1F31 A;  3FJF A;  3N7L A;  1W3A A;  2FDB M;  4Z9W B;  1XG6 A;  2D44 A;  3NBE A;  3WO2 A;  2AQZ A;  1RZO B;  3FUO A;  3CA3 A;  3BRG C;  3OJV A;  2D20 A;  4JP0 A;  3Q7W A;  5EG6 C;  5D63 A;  2I1B A;  2NTD A;  2VSA A;  3P53 A;  3CA6 A;  3UD8 A;  3JRR A;  1G9B A;  3CA5 A;  1HWP B;  1FWU A;  4II0 A;  3BB2 A;  1K5V A;  2VU9 A;  3VSF A;  3VSZ A;  4Q91 A;  2M49 A;  1WBA A;  5FZZ A;  3OBR A;  3AH2 A;  5GAQ A;  4I6I A;  2NYY A;  1FV3 A;  1S0C A;  4WBC A;  2AFG A;  1G9C A;  1QQL A;  1M2T B;  1KNM A;  4IYB A;  1PUU B;  3Q7X A;  3FJC A;  3FJE A;  3FUQ A;  2ZQN A;  3I2X A;  3CRH A;  3O49 A;  3CQA A;  4DEP A;  4I4V A;  2F8X C;  5BQU C;  2KKI A;  4L4H A;  4CJM A;  1V6W A;  3BRD A;  1PC8 B;  4DCK C;  4XFT A;  1ISY A;  4QBC A;  1HCD A;  1RML A;  4ZOT A;  4ZA3 B;  1ABR B;  1IIL A;  3OJ2 A;  1JT4 A;  2BEB A;  2NVH A;  5DUY A;  5BP5 A;  3ILA A;  7I1B A;  1BFB A;  1IJT A;  4I0Y A;  1IRA X;  2GO2 A;  4QAL A;  1V6X A;  41BI A;  3QYD A;  1PWA A;  3VWC A;  3A07 A;  1IT0 A;  4FVV A;  2K43 A;  4IY9 A;  1RG8 A;  2QYI B;  4J2X A;  31BI A;  5F8Y A;  2D22 A;  3AJ5 A;  3FJ8 A;  3R4S A;  3O4C A;  1DIW A;  1Q1U A;  3NBN A;  3HSM A;  2YUG A;  1E0O A;  1R8O A;  4END A;  4A7K A;  1MD6 A;  4MZF B;  4H9W A;  1S0B A;  1AVU A;  1DLL A;  1AVA C;  3A23 A;  3FGM A;  4I4Y A;  3NJ5 A;  1FV2 A;  4LO2 C;  4P0L A;  3BX1 C;  5FNW A;  3S8J A;  4JKX B;  3UD7 A;  3O5W B;  3BTA A;  4I3N A;  4JAW A;  2VLC A;  3FJJ A;  3AKI A;  3OJM A;  3H6R B;  1YTO A;  4X37 A;  3V0B A;  4IZE A;  1TFM B;  2Y9F A;  5EHA A;  3RMY A;  3AKH A;  1FGA A;  1K5U A;  2P39 A;  1QQK A;  2MIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...