1Q0RA

Crystal structure of aclacinomycin methylesterase (rdmc) with bound product analogue, 10-decarboxymethylaclacinomycin t (dcmat)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
297
structure length
297
Chain Sequence
b'SERIVPSGDVELWSDDFGDPADPALLLVMGGNLSALGWPDEFARRLADGGLHVIRYDHRDTGRSTTRDFAAHPYGFGELAADAVAVLDGWGVDRAHVVGLSMGATITQVIALDHHDRLSSLTMLLGGGLDIDFDANIERVMRGEPTLDGLPGPQQPFLDALALMNQPAEGRAAEVAKRVSKWRILSGTGVPFDDAEYARWEERAIDHAGGVLAEPYAHYSLTLPPPSRAAELREVTVPTLVIQAEHDPIAPAPHGKHLAGLIPTARLAEIPGMGHALPSSVHGPLAEVILAHTRSAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aclacinomycin methylesterase
molecule tags Hydrolase
source organism Streptomyces purpurascens
publication title Crystal structure of aclacinomycin methylesterase with bound product analogues: implications for anthracycline recognition and mechanism.
pubmed doi rcsb
total genus 105
structure length 297
sequence length 297
ec nomenclature ec 3.1.1.95: Aclacinomycin methylesterase.
pdb deposition date 2003-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1q0rA00
4QDUA 4MQLA 5CH5A 3ESAA 1DX4A 2OCIA 5JD5A 1WPRA 2GZSA 1PJAA 1NX9A 3V1MA 1P0QA 1ZIXA 2ONCA 3H18A 4LYEA 4B0OA 3DQZA 4QLOA 1GKLA 2PU7A 1R9NA 2XLCA 2V9ZA 1S8OA 1DQZA 1XLWA 3G8YA 3HZOA 1P0MA 3B3QA 1QO7A 1BROA 5IVHA 5EIHA 4GECA 4DNPA 1XQYA 3AFIA 4ZV9A 4FTWA 2IX9A 2JGIA 1W75A 3JWEA 1XKLA 3T4UA 3SWWA 1XZLA 1TKRA 1NU6A 3ICWA 3NOXA 3HRHA 3WJ2A 2PSEA 1TIBA 1HDEA 3STVA 4ZRDA 1MX1A 2HA7A 1VE6A 5AI4A 1EK1A 1YR2A 3A2NA 4X6YA 2G63A 1FSSA 5HK8A 4H77A 1YAJA 4NMWA 1B41A 5EIEA 1YA4A 4AN1A 1K8QA 2ZJ7A 4J0IA 1T4MA 3LIPA 1QFMA 4E46A 1H22A 4C4ZA 3RARA 5BOVA 4BYMA 1EINA 2JEZA 4QWMA 4Y2JA 1QIEA 1IUPA 2Z8XA 3L1IA 4ZREA 5JARA 2BGRA 3OPMA 4X6XA 1LZKA 3AJAA 4G9GA 2VSQA 1RP1A 3QMWA 3QYJA 3C6ZA 5AHXA 4KEAA 1GZ7A 4UBJA 2OG1A 3C5VA 3GBSA 3JYHA 1WPXA 1JJFA 1W4LA 5HKBA 4P08A 1NU8A 1ACJA 3PE6A 3IA2A 3HJUA 1O6FA 1ORWA 2XUOA 4EBBA 1XRLA 1XZEA 2K2QB 1PV1A 5CT5A 4RGYA 3H2IA 4G5XA 2BUAA 3L1JA 4OYYA 1AKNA 4Q3LA 2WIDA 1DQYA 1ZICA 2AJCA 1U8EA 1A8UA 5A7GA 1CV2A 1MO2A 3IDAA 2DHEA 4G8DA 5DTJA 1CUIA 5LZ4A 5JAPA 2PSDA 2DHCA 5AK5A 2OQVA 4Q05A 3WIBA 1SCKA 1ZD3A 2RONA 2WILA 5AKYA 1G66A 1E66A 1G4HA 1E8NA 4CCYB 3TRDA 4J0DA 1XZMA 1E5TA 1DWOA 4X93A 1WHTA 1CUSA 3FVRA 3V9AA 2WU4A 5ALZA 1DX6A 2JIDA 4XVCA 3DKKA 3VVMA 1Y7HA 2XUKA 1ODCA 2PUHA 5E4TA 2WFLB 3KDAA 4DMFA 4Q82A 4TGLA 1U65A 3BIXA 2Y2UA 4EY8A 5ALGA 1VOTA 3R3ZA 2QUAA 5ALSA 1BCSA 2I03A 3E4DA 2C7BA 1M33A 3EF3A 3DOIA 2C0QA 2JGMA 1N8SA 2VJDA 3G9UA 4BCBA 4X71A 2DHDA 4LYDA 2VTVA 2WIJA 5AOCA 2WG1A 1MN6A 3W06A 3I28A 2IIVA 5ALJA 3WLAA 1XRRA 5AOAA 2IITA 1XZGA 4HRXA 5D6OA 4DLNA 3QBJA 1TQHA 2XQKA 1AQLA 2WTMA 3I2FA 1L7QA 2XI4A 4HVTA 1CUFA 5HF5A 5C7YA 5ALHA 4QDOA 3DL7A 5AKZA 1H2XA 3BF8A 2AJLI 2Z3WA 2V96A 1QTRA 2WIKA 5DNWA 1J2EA 4BE9A 2VEOA 2J4FA 1TK3A 4S0XA 4ZWNA 4QZVA 3DCNA 3K2IA 2ZSIA 4NS4A 1MT3A 2XMGA 2QRUA 1E8MA 2QM0A 4UHDA 5JAHA 1KEZA 2DFPA 3BF7A 5ALOA 3BXPA 2WG2A 4INZA 4Y7DA 1EXWA 3WMRA 2WG0A 4G1FA 3AIKA 4FFWA 4KRXA 3FYUA 2H7YA 1CEXA 3M83A 1H2YA 1WB4A 3GUUA 1LPNA 3BE8A 2I3DA 4BAZA 2CMFA 5D3ZA 3DJYA 1GPKA 4GEGA 1QIJA 4DTCA 2V97A 4MYSA 2ZYIA 2VAXA 4NVRA 5BWBA 4HZGA 1JT2A 3LCRA 1LPMA 4OSEA 4X3CA 1AURA 3DNMA 2PSJA 4DMHA 4MWTA 1VKHA 5JYCA 2QR5A 3WWPA 1HPLA 5AKJA 3FBWA 5A6VA 4PF1A 3KD2A 5ESRA 5DNUA 3G0CA 4JNCA 1WHSA 1MX9A 4F5ZA 3RKSA 5AI6A 1SOMA 2HHAA 4XJVA 1MAAA 4DMKA 1EDEA 2VF2A 2CBGA 1WB5A 2HFJA 1Q0ZA 4BTVA 4DNFA 1RYYA 2HRQA 3V1LA 2BUCA 3IBTA 1CUYA 4J03A 3W05A 1UOQA 4C4XA 3PI6A 4CG3A 3QMVA 1E3QA 4MXDA 3PF9A 3IUMA 5JZ9A 4J0CA 3I1YA 5SYNA 3UUFA 2ACEA 4F60A 4LXIA 4MQMA 3ZWQA 2OGTA 3ZI7A 3R0VA 4OCZA 2OLEA 1IUNA 3UUEA 1GGVA 1XFDA 1ZGBA 1BEZA 1CUDA 3KOOA 2PL5A 5CT4A 1W6RA 3C6BA 3EQ7A 3VJKA 1B6GA 1VZ2A 3WL7A 4U2EA 3V48A 3W9BA 4D9JA 2R8BA 4WY5A 2GBGA 2QJWA 2XUPA 3DYIA 5AM1A 1K4YA 3VDXA 5LZ2A 4X94A 1VXOA 4GBGA 2HL6A 4B0PA 1JMKC 2AXEA 2YH2A 3STYA 1QE3A 4AMYA 3WWEA 2HA2A 3HEAA 1DT3A 5A2GA 4L0CA 1WOMA 4JEIA 4WJLA 3N0TA 2BCEA 3Q0TA 2HADA 3DKRA 3GFFA 5IH7A 1Y7IA 1HBJA 3NUZA 4G8BA 2PKYX 3QPCA 2HA5A 2XUAA 4AO6A 5JATA 2WUGA 5AK4A 3FWHA 5AP9A 3VKFA 5JALA 4KE7A 1AX9A 2HIHA 4Y2TA 1H2ZA 3DD5A 1HQDA 3FCXA 4Q3KA 4W63A 2CKMA 3I2JA 4K6GA 5LZ5A 1XRPA 2H7CA 3PUIA 5HQ3A 3H2JA 3WK5A 2H9YA 1JFRA 2XMCA 3F67A 5JIBA 4B6GA 4B84A 3FVTA 1WB6A 3C45A 3F98A 2XUFA 1EB9A 1GXSA 1LPOA 2XQFA 4FLFA 4KACA 3H2GA 4UBOA 4Y9SA 3KSRA 2DQYA 3IUNA 4FKBA 2FUKA 3STTA 3CXUA 3VISA 5AKHA 6YASA 2ZYSA 4CIAA 3W2TA 4WCVA 1AZWA 1SCIA 1UKBA 2FJ0A 3I2HA 4H35A 3R3XA 4YASA 3DS8A 2BKLA 2CEKA 4UHHA 1BE0A 5ISMA 2HA0A 3IUQA 2Q0XA 4H7IA 3SC2A 2VJCA 5JAOA 5A7HA 3A6ZA 3BDVA 5D3KA 3H17A 1CUCA 5D7BA 1CQZA 4AZ0A 1LLFA 3OM8A 4PSCA 2VJBA 3PUHA 1CUBA 2OCKA 3I1IA 2O2GA 2WLSA 3ESBA 5LZ8A 4CIBA 2X5XA 3ANTA 1N5RA 2B9VA 4XX1A 3G9TA 1XZAA 4WDRA 5HKAA 1QIGA 1UK7A 5K3AA 5AK6A 2BJHA 3U0VA 3WQHA 4GDMA 4F21A 2XMRA 3HYSA 1EVQA 4DNOA 4QDZA 2HA6A 2XQJA 1O6GA 4L9AA 4C01A 4DIUA 1CFJA 3G0DA 4MWSA 1QIHA 2WUFA 3HC7A 3DEAA 2Y6UA 3WZLA 2I3ZA 1XZKA 4AN0A 5F4ZA 1GQSA 4H7HA 2GBFA 3HSSA 4N8SA 4PV7A 1QGED 5DTIA 1VZ3A 4TPKA 4DYHA 1QONA 1EDBA 2EEPA 5EI5A 3STXA 3R3YA 5AICA 4QDXA 1X2BA 4Q34A 1W52X 4FLEA 4PSUA 4U2CA 4BZWA 1OILA 2QJRA 4KE6A 5CH8A 1H2WA 4LXHA 4LHEA 3A2MA 3WWDA 4ROTA 3R40A 1A7UA 1GPLA 1ZIYA 3F97A 3HI4A 1QO9A 2JGKA 5CT9A 3F9CA 2ZYHA 3I6MA 3SX4A 2D0DA 5DYTA 5AO9A 4BRZA 2QVBA 2OGZA 1SCQA 5AH0A 4J0JA 4H0CA 5JAUA 2PX6A 1MPXA 4G4IA 5ALXA 4FMPA 2HFKA 5LP1A 4UHEA 1MX5A 1HLGA 4BP9A 1PFQA 4N5HX 4B83A 3PICA 5AI5A 4Y2QA 2CZQA 3G7NA 2YASA 3WKCA 1QIIA 2WUDA 2GBIA 2RHTA 4G9EA 3ESDA 2XE4A 3WK8A 5ALTA 5T4BA 4EY7A 3TEJA 2O2HA 2FJPA 2QT9A 5EHQA 5ALPA 3AINA 4H7JA 3RK4A 1XROA 5ALNA 1VA4A 5DJ5A 3V1KA 4K2AA 2WUEA 3ILSA 4MEAA 1CVLA 5T4FA 4B7ZA 2ACKA 3HXKA 2EDCA 4NZZA 4EUSA 2PSHA 1ZJ5A 3C6XA 3IVMA 5ALRA 3LP5A 3E1GA 5T4EA 3HLKA 4FLMA 4L72A 1Q0RA 1XLUA 1EH5A 4HTAA 3AZPA 1CUJA 4J3JA 5AKXA 1L7RA 4BP8A 2QXUA 2B20A 2OCGA 4XWGA 2CUTA 5FP0A 1QFSA 5AIBA 1TCCA 4HAIA 2ZSHA 5H3HA 4EB0A 4FOLA 4ZI5A 4IH9A 2WFMA 1K5PA 2GYWA 2WIFA 5LIPA 3C87A 3O0DA 4OD0A 2BGNA 4BAGA 4GHWA 4TVKA 1CUEA 3ESCA 5C8ZA 4AO7A 3GZJA 1FFEA 2XMBA 5YASA 3ED1A 4I4CA 4X91A 2GYVA 2JGFA 4AB1A 1QTIA 1R50A 4UBIA 4U2DA 1G5FA 3R41A 4A23A 3WZMA 3BDIA 3BL8A 2PU5A 3WK6A 4BCDA 1A8QA 4IO0A 4HS9A 4EHBA 2B61A 3U1TA 5K3FB 4FBLA 1BEEA 2WM2A 3DYVA 1K6EA 5FOQA 2RHWA 4P92A 2W22A 4DSAA 3FLBA 2D5LA 2ZJ6A 4BDTA 3WKEA 5ALQA 1ETHA 4B80A 1Q83A 1DT5A 3MVEA 1YSCA 2XMDA 2B4KA 3FLEA 4UBNA 4GWLA 3WK4A 2WHQA 5CRIA 4BVKA 3GROA 5FRDA 4PNZA 4WDQA 2XDWA 1EI9A 2Z5GA 2BFNA 4AX4A 5A7FA 4FNMA 2VAVA 1GT6A 4FHZA 4ARAA 5BV7A 3K6KA 4RNCA 2JGJA 4BB0A 3TJMA 4MJ3A 3H19A 3D2BA 1BS9A 2QUBA 4O08A 5C8VA 4Y2YA 1XLVA 1YAHA 4V2IA 4H7KA 3FYTA 5AKKA 2I78A 1L7AA 2HRRA 1E89A 2ES4A 3OC0A 4QLAA 5CW2A 4UPDA 4HRYA 4X90A 3EQ8A 4I19A 4YK7A 2QTBA 3DDUA 3LLCA 2ORYA 3VJMA 1JJIA 2GYUA 2PPLA 1XKTA 4KAFA 4X97A 5A71A 3QPDA 4QDTA 1A88A 1Y37A 1YS2X 1XQXA 1IVYA 1CPYA 4Y2RA 3FAKA 1ACLA 1CUZA 2VQ6A 1LPBB 3WL5A 4GLBA 4KRYA 3WIOA 3D2CA 4CG1A 3G9XA 3O4IA 3UMJA 5AKEA 1EK2A 2OCLA 4EY4A 1F8UA 4OPMA 4L3WA 1ZI8A 4RE5A 5KWJA 1A8SA 1VJ5A 2G5TA 5BWCA 1X70A 1BCRA 4IH1A 1TAHA 3AIMA 2DQZA 4EY6A 1UZAA 1OCEA 3R3VA 4PQEA 5ALEA 3FSGD 3O9MA 1XZFA 1MNAA 4ARBA 2WFZA 1J1IA 1AGYA 3LIIA 5IVKA 4CFSA 2AJBA 4UFNA 4W1RA 4X85A 2RAUA 4MYDA 2WJ6A 3I6YA 3WK7A 2HU7A 4FBMA 1DU4A 4HXEB 2H7XA 3F8SA 5ALVA 1XZIA 5JZSA 5HF8A 3B5EA 3T52A 4GXNA 1VA5A 3Q8WA 3C70A 4JYMA 2AJ8A 4ZGBA 2ECFA 2JBWA 4N5IX 5ALIA 3ZPXA 3V1NA 3M82A 5JADA 1JMYA 4HXFB 2PVSA 2HU8A 4BVLA 2C58A 2WU3A 4CCYA 5JD4A 4W1PA 2UZ0A 2FX5A 4ZXFA 4E15A 3D3NA 5DYYA 5IKXA 1LNSA 2XB6A 2QOEA 4OYLA 5EHZA 1YS1X 1CUGA 3MUOA 1DWPA 4M0MA 4A16A 3GELA 4Z49A 4W1QA 2HU5A 5HF9A 2C4HA 1CUWA 4BDSA 5KREA 2ZVDA 4FNGA 5C8XA 1UXOA 2H1IA 4AMZA 2ZYRA 4KAJA 5LKRA 5EGNA 1R4ZA 4F0JA 2PBLA 4KJXA 2QZPA 1U2EA 3I2IA 5AI9A 3M3DA 2LIPA 4IHAA 1FFBA 5LKAA 1DINA 1Z68A 5K5EA 4UUQA 4B9AA 4CI9A 5AM2A 1MJ5A 3FSGA 1XRNA 2V98A 3G0BA 2XQGA 3O4JA 3WI7A 2XMQA 5AKLA 2W6CX 3QH4A 1LPPA 1Q84A 1XZJA 3QZUA 5AOBA 4DMCA 1QIMA 3ANSA 3MUNA 1TCBA 4FWBA 3FYUC 3D7RA 1FJ2A 2VT6A 4K6KA 4OUKX 5ALUA 4UFOA 1USWA 5J3JA 4OB6A 5AKIA 1QIKA 3QM1A 4DGQA 4MEBA 4GI1A 5CH3A 1CUHA 2XMSA 5K3FA 1UKAA 1THGA 1TRHA 2HA4A 1VXRA 4P9NA 5K3DA 2BUBA 1C7IA 4BCCA 1DTEA 1WCYA 4QWWA 5LZ9A 1CIJA 3SK0A 3D5EA 3WK9A 5E4JA 3H2HA 1YB7A 3AUKA 3CN9A 4M0FA 3H04A 5DYWA 3OURA 4DNQA 1VE7A 3KXPA 1JI3A 5AKGA 4ETWA 2NW6A 3O95A 3WYDA 3CCBA 5K3EA 3WWCA 3G0IA 3ZLTA 2QS9A 1CUAA 2ZJFA 1XZBA 3N2ZB 3G9ZA 1ZD2P 1UT6A 4LXGA 5IVDA 4WFIA 1EHYA 3WJ1A 1HKHA 2DR0A 1ZD5A 3QPAA 3A70A 2J4CA 4J0KA 4KE8A 3WKAA 1JJBA 1SFRA 1JU4A 2PUJA 2XMZA 2X76A 1JKMA 1N5MA 5CURA 3R3UA 2HA3A 3MGAA 5JANA 2BAGA 5DWDA 3RLIA 4DSZA 1E8DA 4K5QA 2Y1KA 4U2GA 5DLPA 4C88A 3WYNA 2XUJA 5AK3A 4QE3A 3O4HA 2ROQA 1VLQA 4P93A 1MTZA 1IZ8A 2O7VA 3IUJA 2CJPA 3S8YA 4AO8A 3W04A 1CR6A 3BIWA 2WHRA 4AZ3A 1LPAB 3ICVA 2C5FA 5HCUA 2Y6VA 4IH4A 5AM0A 3WWOA 4FDMA 1W76A 4EZIA 1MU0A 4XIIA 5AI8A 4BC0A 3ZV7A 3I2KA 1CUXA 2OPHA 5EHXA 1YASA 2VA9A 5ALKA 2PM8A 1N1MA 2G5PA 2WFLA 3OOSA 3QITA 2YYSA 2J3QA 1I6WA 5FLKA 1DWQA 4U2FA 4CCWA 3AZOA 2XLBA 2VJAA 1AUOA 3G0GA 5E4YA 3FOBA 5CMLA 5HZGA 4BE4A 2O7RA 1QLWA 5I8PA 2RI6A 3VJLA 3C8DA 4C4YA 4UHBA 5FPQA 4X6UA 4BC1A 2GZRA 5SYMA 3RM3A 4RE6A 4UBLA 3LS2A 2R11A 4JUIA 4X92A 1YA8A 1H23A 1EX9A 4U2BA 1KU6A 3X3HA 4UFPA 1YCDA 1R9MA 2DSNA 4KR0A 1UKCA 5E2IA 3IIIA 5AIAA 1X2EA 2O2IA 4G8CA 4LIPD 1XQWA 1UOOA 5CXUA 2CB9A 2RIPA 5ALMA 1AMNA 2YXPX 3KWFA 3EQ9A 1UK9A 4BRSA 3I2GA 4J0GA 2OQIA 4Q1VA 1SC9A 4I3FA 4OB7A 1QJ4A 2VT7A 3C5WP 1ODSA 5JZBA 5FKJA 4UBKA 4BAUA 3VXKA 2OXEA 1HL7A 4BTLA 4CG2A 1J07A 1R1DA 5HF6A 2WTNA 5I7UA 4Y2UA 5HK9A 3PFCA 4WY8A 2WJ4A 1CQWA 3WA7A 1BN6A 4IQ4A 3PFBA 1IZ7A 1CUVA 1F0NA 2WQZA 1CUUA 1MNQA 1P0IA 2OAEA 3WL8A 2JF0A 3TGLA 3FNBA 4BATA 3E0XA 4X7BA 3R3WA 2WIGA 3C8HA 1XQVA 1BN7A 3H1AA 1ZOIA 1QOZA 3OG9A 1FFDA 2XUHA 4J7AA 5C81A 3E3AA 3H0CA 4ITVA 4EA6A 3IB3A 3KWJA 4BVJA 1R88A 2XUIA 3AZQA 2XUQA 1MAHA 4KAAA 1ODTC 3AILA 5DNVA 3DLTA 1G42A 1IMJA 2HM7A 4E14A 1FFAA 1ORVA 1D07A 4YX9A 1XZCA 5AM4A 4QEKA 1QIDA 1YB6A 2X8BA 1UOPA 4Y2PA 3CCCA 7YASA 3HABA 2DCMA 2QMQA 2JGLA 2E3JA 5IVIA 4X95A 4C6HA 4HXGA 2GBCA 5ALFA 5EHNA 5AJHA 5CTAA 5ALYA 3ZLVA 1C7JA 1GKKA 4Q3OA 3P2MA 5FUMA 4Y2SA 2VATA 4FFVA 4OB8A 4BBZA 4PW0A 3FYUB 3CN7A 5JASA 3S2ZA 5LYYA 5LZ7A 3OTQA 2G4LA 3DL4A 4H7EA 1ZI6A 4B82A 4QA9A 3NWOA 1T2NA 3D4LA 4DM7A 4YPVA 1U4NA 3C6YA 3F96A 2AJDA 3BJRA 4OU4A 4J0HA 4RPCA 1XZDA 3WKBA 1W1IA 4UHCA 2QXTA 4W9RA 1XZHA 4M0EA 1ZI9A 3K9BA 3IURA 5FPPA 5KBYA 1IUOA 4E11A 4GW3A 5FV4A 1GPNA 2EDAA 4N8EA 1EDDA 3G02A 3H2KA 2QKYA 1XRQA 1GQRA 1TCAA 1P0PA 1UWCA 1BU8A 3JW8A 2C0PA 4C87A 3M81A 1LPSA 1CLEA 3NGMA 3QMMA 2WJ3A 5AM5A 3L1HA 4W1SA 3FLAA 5ALDA 4QNNA 1WM1A 4AXBA 4B81A 1LGYA 3C43A 3D0KA 3WKDA 3STUA 4OU5A 5EFZA 3VVLA 5I9IA 3BWXA 5EIAA 1KU0A 2P8SA 3PF8A 1JU3A 2PSFA 2JEYA 1J06A 4Y2XA 4LKOA 4WFJA 2WSLA 4BZZA 3B12A 4ZV7A 2HDWA 4UBMA 1QIFA 2Z3ZA 3STWA 1AC5A 4B9EA 5FXMA 5K3BA 1FFCA 2Z8ZA 5AM3A 4JH0A 5LLSA 4UHFA 5ALLA 4G4GA 3BJMA 2WHPA 3QVMA 2C5GA 5CXXA 1UK8A 2JGEA 1EA5A 1C4XA 1QZ3A 3EBLA 4PO3X 3ZLUA 5HQ3B 1R3DA 2WKWA 1LBSA 1EB8A 4KE9A 5T4HA 1THTA 5AI0A 3WL6A 3O9VA 1F0PA 3DOHA 4X00A 1ZGCA 1UFOA 3D59A 3HACA 3H1BA 1BRTA 1RWQA 2RGUA 3IULA 2OAGA 4H7DA 3EIOA 2J3DA 3D2AA 5FDFA 1XRMA 5HFAA 4K6HA 2XUDA 2Y2VA 5A62A 1LZLA 5KWIA 2XUGA 1K63A 1LBTA 1ISPA 4B85A 5ALWA 5CBKA 3I6ZA 4KYVA 1OXMA 5CT6A 1ZD4A 2XQIA 3YASA 4WFKA 2XT0A 1UK6A 4JYPA 3GA7A 1ZJ4A 3AIOA 4A5SA 2WHPB 3FCYA 4AQDA 3W9UA 3PDCA 1F6WA 1EVEA 5HFNA 4C89A 4PSDA 4EY5A 1CRLA 2OGSA 4H18A 4Y2VA 4G4JA 4H7FA 5CT8A 3A2LA 4N8DA 3O4GA 5JD6A 3WA6A 5K3CA
chains in the Genus database with same CATH superfamily
3T9CA 2ZITA 4C78A 2Q0QA 4MQLA 4RVUA 3RRJA 4B34A 1IBMB 2EQ5A 4GC9A 2J09A 1JPNA 1JJ7A 2C4VA 1NPYA 3BQNB 4R2XA 4PZLA 4ROSA 1RI1A 2G3YA 4URFA 3H5TA 4NOLA 4DA6A 3UBMA 4W5OA 4O4HF 4IF6A 3GFOA 4HJRA 2FR0A 2QVGA 3V1MA 1RDFA 2JD0A 2ILTA 4ONEA 3OZDA 1N6RA 1A2OA 4K26A 5REQA 5A03A 3C5EA 4Q4JA 1O4WA 2HUPA 1QO0A 4DDUA 4CQLB 4IXWA 1MBZA 1GKLA 2CL7X 2C5AA 4ABYA 3MJSA 1SU7A 2LRHA 2V9ZA 1XLWA 3HZOA 3NWBA 1FCJA 1HZZC 1P0MA 3R6DA 4FSXA 2PV7A 3RBXA 3AB3A 2A9JA 1YZNA 3DTVA 4AF7A 5EIHA 4GECA 4H4DA 4K88A 2A5GA 3OJOA 3EBPA 3OU7A 1XQYA 3SU8A 5AW5A 5J2UA 3RSCA 2ZGVA 3CC8A 3H6HA 1GGFA 1NVVQ 3DE4X 3R6TA 3O1HB 3QVJA 4FTWA 3HBFA 3AKYA 4HB0A 1SUSA 1I32A 1SHZA 3JQEA 5LJLA 1XEXB 4GOMD 3UT5A 2RAFA 3T4UA 3V4VB 2CCKA 1H5NA 4JYCA 1W8DA 2Y0BA 1WG8A 5BPFA 1W47A 2BP7A 2H1LA 3OPVA 4LTDA 2IS1A 1RXSA 3ICWA 3JQBC 4Y18A 3HRHA 2YWFA 1O9GA 3BX1A 1WZNA 3DQPA 3RTCA 1ZRMA 4EY3A 4PAGA 4FMDF 4MLZA 5FLXA 3HGQA 3NBUA 2GAFA 3I30X 2DETA 3R7FA 3IOCA 2WQ6A 5AI4A 3L4SO 1D0VA 4X6YA 1KY5A 1R0BA 3ZGNA 4PC2A 3HCNA 5HS6A 5AK0A 3ZXUB 2EARA 5AR1A 3AJRA 2G63A 4HEA6 1KRXA 1C9EA 1UMKA 2W93A 3BMCB 1PWEA 3HJNA 2WUVA 4NOKA 2XB4A 3DGEC 3A3YA 1UXGA 4XLTA 1CRZA 4RH1A 4CL0A 5A6SB 3EGXA 5FD8A 1IRXA 4MR9A 1B41A 3LAWA 5DV9A 2WVAA 3BIOA 3DV9A 3IR6A 4EJ0A 5BV0A 1YA4A 1K8QA 4WGFA 1U0JA 3AEUB 4N1AA 1T3LA 5ULLA 1DQPA 2IEBA 2VAMA 4MVJH 4C7XA 2H5JA 4E46A 1E3MA 1XJQA 1A7AA 2HGZA 2A86A 4ZI2A 1QVAA 1XPJA 2WSSD 1EINA 3EZLA 1UBMS 5JHGB 1YHZA 5EE0A 2OUKA 4HL6A 4Y2JA 3NUQA 2Q07A 3L0DA 3BYZA 2FFJA 4GM4A 4LZPA 4DSNA 4FI3F 3F5MA 3OUTA 5KHAA 4LK3A 1PFUA 3O26A 4P4UA 4ZREA 3LNTA 4CTNA 5A2QA 1IDOA 4V02A 4X60A 4P3KA 3T7RA 1ZN9A 3DNFA 4QPDA 4ZAYA 3OPMA 3THXA 1MQ9A 2QYHA 5AW0A 1L7BA 1JBEA 4GO1A 3TXYA 4ZPJA 1FDIA 3DEFA 1QZZA 3OD1A 4G9GA 1WVGA 3SYMA 2E55A 3HZHA 1BH2A 4ALKA 4C7VA 3BB3A 3SM3A 3KJEA 1ZUNA 4YMGA 1P91A 3NVAA 4IICA 5TARA 5LDHA 3U44B 2FEMA 1M6VA 1FP2A 4OJNA 2VO1A 1ZM4A 3EGDB 3RV4A 3OHSX 4BS9A 2JL1A 4YUVA 4KEAA 2V0GA 3L7NA 1P5RA 2OG1A 2RSLA 1PJ2A 1ZMTA 2C99A 3EZ7A 3M5CA 4NNJA 2BI8A 2JGRA 2PX8A 1NMSA 3PGA1 4WNAB 4BGDA 1W4LA 4RV4A 1YR7A 1DWUA 4XLZA 4W8OA 3STHA 3DZJA 3E8SA 4ETMA 4ZV4A 1UFVA 2QW0X 5ESWA 1UXJA 2B5OA 4DV6B 5DNCA 1EESA 1ZQ1A 1ACJA 1NYRA 2REQB 2WJZB 3LBIA 5HS4A 1I1QB 2J48A 1VKRA 2ZFUA 4IXMA 3SEFA 4LGVA 3V8RA 1OX4B 2CV1A 3DFIA 1L4MA 5F1OA 1QB8A 2XMPA 5A5DA 1BVHA 1QH8B 4HFRA 1R37A 4OHVA 1INLA 2XVMA 1X14A 2XUOA 1PF7E 3DJFA 4FR0A 2Y4OA 4KIFA 1FUYB 3VAAA 5BYBA 1XRLA 1JS1X 5CLQA 1PV1A 1PJQA 1GR1A 2A4MA 1ULAA 4RGYA 4GYWA 4LHWA 4BKPA 3H2IA 2F64A 2O1SA 1WMDA 1L1FA 2D1QA 3A1VA 5I7FA 3K6SB 1DJNA 3KQHA 2GUWA 3ADPA 1R74A 1KPIA 1R6BX 1VLMA 2BTQB 2J3EA 3MA0A 4QBIA 1GVNB 2VYVA 4OYYA 5EWJB 2FR1A 2B4AA 5BYAA 5LQUA 1G3QA 3RUEA 2QNIA 3NAMA 3ETHA 4WKBA 2NV2B 1HC7A 1OASA 4MTCA 4BWVA 4HVLA 3TPFA 3OQ1A 4Q3LA 3PFKA 5AVTA 4C7OB 3BQMB 1XJ0A 3QVUA 5IU6A 2UZ1A 4CL3A 4F6CA 1DEHA 2V0CA 4R6WA 5CFRA 1NE2A 3LGAA 5BXQC 1MAWA 1X9GA 2VYND 2AJCA 1BSVA 2RGEA 3PWTA 1UBRS 4HAZA 4RQUA 5GVSA 2J0UB 4QELA 2GAOA 3G1UA 5G4KA 3IDAA 4X7MA 1JHQA 4G0VA 1AF7A 1AD2A 3V7YA 2A9OA 2C5BA 3ZLBA 3PEVA 3CVXA 2VZ8A 3F78A 5DTJA 1CUIA 4MWEA 1P1CA 1DXQA 1GPBA 3SDSA 1L5RA 1NN1A 1JDBC 1CB0A 4DXHA 1NQVA 1J90A 3E4CA 3QEJA 4NCAA 1D4AA 4KWIA 4PO9A 4PN7A 4HI0E 1BEUB 2NP6A 4WGGA 1E5DA 4A8TA 1IN6A 1XPUA 2J59A 4C30A 5MDHA 3QG5A 1JXQA 5KU7A 1SCKA 2R5NA 4D74A 1RBYA 4D6YA 5IC4A 3RODA 3EFOB 1Z3CA 4KW7A 1G8YA 4JV5B 5AKYA 3X1JA 1VIMA 1G66A 1P73A 4BIIA 1E66A 4Y98A 2ENWA 5T67A 4RVDA 1E4OA 1E64A 2HEIA 1COWD 4MW9A 2C2GA 2DWQA 5B55A 1E8NA 1XXLA 4ZARA 4GR5A 4WQMA 1YUMA 2VHXA 3FDFA 3UOAB 3VKVA 2XNHA 4AWBA 2NAPA 1M10A 4WWHA 5DI3A 3VNBA 3WB9A 1TJYA 3K2EA 3FXAA 2Q6TA 4MWBA 3UT0A 1E0JA 4EKIA 3LHIA 1E5TA 1SM4A 2H51A 4B17A 3U61B 4KMMA 1JLMA 1DO2A 1RTTA 2HO4A 4JNKA 3V4FA 3DBHA 1AUPA 4Y1RB 1WMFA 3I6BA 1ECGA 3FPJA 3JQRA 2B4TO 3TQTA 4AJ2A 1NQWA 1JDZA 1LC0A 1EDZA 2WU4A 3OOHA 3OU6A 5J43A 2X9GA 3LW7A 4Q4CA 4O02B 4V38A 3RNOA 3OKPA 2ZUFA 2QY6A 4JXJA 5MN4A 3IDZA 3ZWAA 2QT0A 3KDAA 2FSUA 5KTMA 1ORIA 4LYHA 4R7TA 1QG4A 5LQCA 4WH0A 1IJKA 4NIMA 5HRCA 2IZ6A 1SCUA 4ISCA 5LQSA 4ZVPA 3RS7A 4F92B 2XB8A 1V37A 1V25A 3L7BA 2YVUA 4LK2A 1EUCA 1VKZA 3JQFA 5EL0A 1Y3CE 4CLEA 4EY8A 3OX3A 2Y0DA 1KJNA 5ALGA 4DLZA 5F64A 2M98A 4IXTA 4NCKA 7GPBA 4DUZB 1VOTA 3R3ZA 4HRAA 3S0JA 3THOA 3MQFA 2C29D 4IDGA 2I03A 3DHVA 5BOSA 1CS0B 1Q11A 4AJ4A 5JDIC 5KNLA 4MRNA 3K92A 4F3KA 2HMYB 3TIIA 1ZIPA 1DVRA 2ZYAA 3EF3A 1A2QA 3PFWO 2IODA 1VQ1A 2ZROA 3DOIA 1EGMB 4PZPA 1M2HA 3KKLA 4WY2A 1XDBA 1XHFA 5LD2B 3CLRC 4YP9A 5JAZA 4D26A 2GEBA 2PRZA 2AYXA 3CVVA 1TE2A 4UDYX 1XTVA 4X71A 1OBCA 1N4DA 3IC5A 5GZ1A 1J24A 5DHRA 4LE2A 2IX3A 1NSFA 3RRNA 4P35A 5TPWB 1NDQA 1YRHA 1N57A 2UUCB 4MLPA 3EWAA 5FTLA 1Y4AE 3VI3B 1N33B 3U16A 3Q8XB 2ZI5A 1F6BA 5H82A 1MP0A 2ZIZA 3U81A 3J7TA 2FUCA 2GZAA 1CC1S 1SQ0A 5TQ2A 2VYVD 1SA0B 2P5UA 3Q6NA 1I36A 4BOYA 3ZZTA 3RTEA 1PK9A 2BMWA 2X58A 3Q2IA 3ZDZB 1QP4A 1PYGA 3ZW8A 5JE8A 1IG0A 1A9OA 4HNSA 5AOAA 3ACDA 2Q46A 1Z9BA 2AI1A 3N05A 1C1HA 2GK4A 4P38A 2DR3A 1Q1EA 4DLNA 3QBJA 3BTOA 4HCJA 4YJ3F 4WXHA 2P2DA 4JLWA 1KJ8A 3D43A 4YV7A 4OH7A 3VGJA 4EZBA 1TK9A 5DGDA 1MOPA 1V7ZA 3R9KA 2J85A 3H6KA 2VF7A 1KZ9A 1V9LA 4G5GA 4X44A 1JHMA 2YV3A 5EERA 4I4TB 3S55A 4KBYA 5BV1A 4UQOA 3Q9UA 4HDMA 5L8VA 4EFDA 4QDOA 1PGOA 3KLBA 5JYEA 2P2GA 3GLHE 3TM5A 1HE8B 2PWZA 5AKZA 4OK3A 2BSAA 2W6ZA 2ZJZA 3SX0A 1IQ0A 4O33A 4YGYA 1Y4SA 1NBEA 4YIHA 4E70A 2EFYA 1QTRA 4OEHA 4LS3A 4TTQA 2IEZA 2G77B 2CHVA 3M2PA 4WN9A 2J4FA 1NLUA 2PK3A 1QYDA 1TK3A 5IK2A 5HIKA 1RPJA 3WOVA 4IY1A 1YZVA 4M1ZA 4CIYA 3L4JA 1PS0A 1PT8A 1X80B 1YS4A 1ZW1A 4LDAA 3RK0A 1E3JA 4C0AC 1CJBA 4GXTA 4LSWA 1BFDA 2AW3A 4NHOA 1JTEA 2B3TA 4C0KA 4IIGA 1RXEA 2N1BA 2QRUA 1E8MA 3U4CA 2VZEA 5B3JC 4FWTA 1F7VA 2QLBA 3A9VA 3KYCB 4RZSA 4AROA 1KI9A 4MDHA 3KTAB 4BO1A 2C7RA 2XVYA 4D42A 2DFPA 2WA2A 4QBFA 3M33A 1ZISA 2GPTA 4QXQA 2PUVA 1WDWB 2G67A 5L3SB 4PANA 4RPGA 4HH0A 4KR7A 3JR7A 3I37X 4IZHA 3AV3A 1AUQA 2B1QA 2QPOA 1JKJA 4LWQA 5ALOA 1NR5A 1NNEA 3BXPA 4OBWA 2WG2A 1G21A 2H00A 4B44A 1ML4A 3FCAA 3JQCA 4JZKA 4NFYA 2GNAA 4RKEA 4FHEA 3UYLA 4B3FX 3UAGA 5EKXA 3TZBA 5CLJA 5B58T 1OAAA 4Q4HB 4KRXA 1UC4B 4C0LA 3FPFA 1S4QA 3CF6R 3T9EA 1JQBA 3FYUA 3LX4A 4ZT4A 3OZWA 1C2YA 3HRKA 3V5NA 1H2YA 2IPMA 4V3BA 4HDRA 2IHZA 1QLHA 1JKJB 3EGEA 4E1VA 5TMPA 2IYXA 1T9KA 2V7BA 3BE8A 2EKZA 2I3DA 2F4NA 3DONA 1H9AA 3NAGA 3VR6D 1NVAA 1YR1A 2IPNA 3BWMA 3JWIA 5LBIA 4UD2A 3DJYA 3RR2A 1FPQA 4FGJA 4QGBA 2ZRQA 1GPKA 3WAJA 1DMRA 1QIJA 4KIGA 4NBLA 4JOQA 1E2JA 2GEDA 2V97A 4JOSA 4KQHA 5IDVA 4PLPA 2YC4C 1FP4A 3TDMA 3KUXA 4LFBB 4DKJA 4IR7A 4NOMA 1FQWA 2QVLA 4P5DA 1E2DA 4TOIA 2OZEA 2Z58A 1TD1A 5GOZA 5ITZA 3MGBA 4EQ6A 2FF5A 3U6BA 5C51B 3LCRA 3UFXB 3U80A 2XECA 1ID8A 3WGGA 3ZWXA 2P11A 4X3CA 1VSQA 2PSJA 4TM7A 4WZZA 4DMMA 4JLDA 2CSUA 3MSCA 4MWTA 5T3YA 5JYCA 3WWPA 1CY6A 3LQQA 4A8PA 1AZTA 2DU8A 3EAFA 3HFJA 1H6BA 3ONDA 2OBMA 4II2A 4OKSA 3T1HB 2I91A 4HUQB 2QM7A 1NVFA 4OM8A 1Z0FA 3IP8A 1N3IA 4TLLB 3PYXA 4N3BA 4ACAA 5ENVA 4F06A 1F2UA 4C4OA 4E2YA 3K2BA 3KD2A 4JKOA 2GXSA 5B7PA 4GZLA 4OFBA 4A8JA 4JNCA 3CUSA 1MX9A 1OHHA 3UVEA 5EJGA 2H1RA 3NPAA 5AI6A 3ZD6A 3EVEA 1EWTA 3FPKA 4DLYA 2QTVB 1J9GA 5L40A 2F17A 5AUPB 5FOTA 4GPEA 1NXOA 4XIGS 1WB5A 2HFJA 1FLVA 2VSFA 5EJ6A 4DNFA 4F85A 1GL9B 4ERXA 4E5YA 4EG7A 1OH6A 2C9CA 4G41A 2G76A 2QYSA 3L9WA 1BOOA 4U39A 4LDNA 3D3KA 3BICA 4UAVA 3RC3A 3IBTA 7ABPA 1CUYA 1F17A 4J03A 3H8VA 3TW0A 3DE1X 1L8LA 1I4LD 3SQMA 3A26A 3VYTB 1UPFA 5H02A 3DO8A 3AVWA 2O0HA 2BE7A 4CG3A 4E07A 1G291 4KGXA 2W4QA 1OV6A 2OAQ1 5AQEA 3LJKA 1OAOC 1V4VA 1YQ9A 2Q4BA 3ZXYA 3JRXA 3UUFA 1MABA 2HJ9A 3U62A 4FBGA 4K7JA 3RW9A 3DBRB 1PR6A 1VJCA 4RKYA 4FN4A 1GTMA 3ZHOA 4F60A 2JLUA 4URHA 3HCBA 2RHGB 1B16A 4JBIA 4MQMA 4KSYA 1HG1A 1UBUS 2O48X 3KAKA 4I1VA 5I5GA 3JS5A 3HU2A 3DMTA 1DQSA 2TECE 2YJ5A 4P54A 1CEQA 5AJTA 2OLEA 4HC4A 5SY6A 5HTOA 3DXXA 4JJKA 3V2GA 1FQKA 1J0CA 1QNLA 1ULHA 3PB3A 4RTMA 1B8NA 3C6KA 4YAGA 3C6BA 3EQ7A 3Q8MA 2YVLA 4AIRA 1P1RA 5DRYA 3VJKA 1ESEA 1ZCBA 3B53X 2FZGA 4QXPA 3KJXA 1B6GA 1YFKA 4MV9A 4UREA 3BFJA 1VZ2A 1X7HA 3K0FA 4TZTA 3TTWA 4DB4A 4MI9A 5A02A 3QMPA 2DJIA 2W6ID 3GO4A 1RJGA 4R3NA 4OBBA 5JO9A 4D9JA 1Z47A 5HMMA 5IS2A 3UK0A 1D2CA 5EQJB 2P3SA 2GBGA 3SD7A 1GUBA 2HWXA 4FFBA 4LE1A 2HO5A 4KPYA 1CZOA 2QJWA 1O2DA 2XUPA 1IXZA 3IOMA 4M1QA 5ANRB 4ZRMA 3PRKE 1YVUA 5JG7A 5JSYA 4OI1A 3IE0A 3H4MA 3PC6A 3SNHA 4BJHB 1X74A 2XDQB 5KQRA 1W0KA 4G8JA 1YS7A 1YD7A 2RGDA 2V6MA 4TSRA 3DAFA 3FPHA 4EMSA 4DUGA 2VL7A 2HMSA 5JCJA 3RC7A 3PFGA 3OLVA 1W88A 1YBHA 4OI4A 3T3GA 1VXOA 1BE6A 2WJJA 2FNAA 1WY7A 4AXXA 2HL6A 4B0PA 1G6HA 1M2JA 3BD9A 4K2HA 4BQPA 2JZCA 5KOHB 2VJMB 1P0CA 5JRZA 1VPVA 2JFXA 3QVGB 3SC4A 4HPJB 3PXUA 3N7TA 5H59A 5K1ZA 4BNXA 2PCLA 4HNQA 3JQPA 4ZDKA 1Q3KA 4J0EA 2XA1A 2FCRA 3Q7SA 1EXMA 1V1MB 4E12A 3IXQA 3WDKA 4B35A 5C52B 3F7MA 2PLAA 4Q1DA 1ZN7A 4B6OA 1TKAA 3VZSA 3QE4A 6LDHA 2Q49A 3F3YA 5FBLB 1QZUA 5A2GA 1BMDA 2OCBA 2PWYA 4MV1A 3ETCA 4CMCA 4L0CA 2E82A 3RQSA 3H11B 1L5FA 1MT0A 1WOMA 2P0AA 3M1AA 4GOJA 2Z2XA 5DM2A 2X0FA 3S99A 2BCEA 1L4LA 3P0RA 4GP6A 3WB2A 4MPJA 2XA9A 1IM5A 1KDTA 2FWNA 2AOUB 1X1SA 4PYIA 1KNXA 3CKMA 4H3HB 1VBFA 4K9NA 3RSHA 1APBA 1AQNA 1HBJA 5BXYA 1QNFA 3NUZA 1QP0A 5HZMA 1YQGA 2JFFA 5GV8A 3NHUA 1W88B 2X77A 2ZR0A 2HR1A 4HGOA 1E9EA 4AW9A 5CYGA 2H4YA 4TWIA 5DYNA 1ZU4A 4LOJA 1JBQA 2HA5A 3H4TA 1Q92A 2R86A 3FRJA 4LCBA 4LVUA 5B37A 2WTEA 3E23A 3HCWA 5J47A 2JGDA 1ZMOA 2C5EA 1F14A 5T5QA 3U7QB 3KS9A 4LDPA 5JCOA 3R3JA 3ZXIA 2DC1A 5C4MA 2Z95A 3GP3A 3VUEA 2MT9A 4CE6A 5JALA 1TPZA 4KE7A 1O96A 3O73A 1MQAA 2CDAA 4L3OA 3PD1A 2EKBA 2GWRA 3IODA 4R1MA 2PR2A 1HQDA 2RBGA 1NULA 1W94A 4HBGA 1GNTA 2OV8A 4Q3KA 1O5TA 4CTMA 5C4IA 1W73A 1T9GR 1XRPA 2DE0X 2WB4A 2H4WA 1QVRA 3FWZA 3V6MA 4BNUA 4D8VA 4EW1A 5BSWA 1GG2A 2CHQA 3ZD9A 2P2SA 2PX0A 3H2JA 4XR4A 4YP6A 5AVYA 1E1CB 4U7TB 1LF0A 3UHOA 2H9YA 1JEYB 4R2HA 3FHOA 1PL6A 4NK4A 2NXJA 1Y3FE 1JA1A 5E38A 3L6DA 4BKMA 2YV4A 1T5HX 1EP3B 3W5JA 4JELA 2P3OA 2IW1A 4R8LA 1Y42X 4B09A 1OZGA 4M21A 1TVMA 2XUFA 2WZBA 1BS2A 4QOHA 5IYZF 1GXSA 4LJ4A 1Y5LA 2OP1A 2P65A 3MWEB 4JUAA 2JBHA 1BWSA 2Q4EA 1T2UA 4Y2GA 4EJFA 2XQFA 3KT3A 1G2QA 2PH7A 1HO3A 1PJTA 2PX5A 4KACA 5CPFA 3RAPR 1WR8A 5C7OO 2K5UA 2QJTA 1B1AA 4CEHB 3EVAA 4UBOA 1LNQA 1XTRA 3U4IA 2FMHA 1CE8A 2DQYA 3A4TA 1O95C 2G5CA 2FUKA 3IUNA 3DMHA 4G0MA 3STTA 4EABA 3V4PB 4JT9A 4KU4A 1YQDA 5CVJA 4AJKA 4G0QA 1C2TA 3VTAA 3FTNA 6YASA 4PO1A 4OLBA 2ZYSA 4UHHA 4X1KA 5E7MA 3W2TA 2WSYB 1YO6A 4WCVA 5K20A 3MJRA 1SCIA 2ZE7A 3BMXA 3ZX4A 4B7AA 2MR5A 2AG8A 1PKXA 2RFLA 4KO8A 5JD3A 1Y6GA 2OK7A 3DBRA 4KFCA 5I7VA 4E09A 1RBZA 2EFEB 2IV3A 3LLSA 5CLIA 4G97A 3RCBA 1DJLA 2IYWA 2VJLA 2VDNB 3PFIA 2BTOA 1VI5A 1UIMA 1JFFA 1ZXLA 1DNPA 1Z7EA 2W4IA 3C98A 2UZAA 3CNEA 3GAAA 3QLTA 4RHYA 2ZOSA 3VYRB 1N6OA 4IJVA 1BDBA 2H4JA 3E9EA 1V47A 2CB0A 5DHSA 1II9A 1OLSB 1GGJA 1M34B 3A1TA 4RLHA 1IBKB 1Z4IA 3FDXA 2VJCA 3OTWA 3ONWA 5ARDA 2ZPAA 2WB2A 2OXIA 1KO4A 2R60A 4ZCQA 3BDVA 3FX2A 2QA5A 4WXRA 1RS0A 3H17A 3JSAA 1CUCA 3RYTC 3AONB 1NM5A 3L8CA 1DBVO 1YZLA 3ER9A 4J2TA 5LOVF 1OUMA 3CMMA 2ZCUA 2HPAA 5DTRA 5LOVA 1U9JA 3LOQA 1N36B 3LV8A 3QTBA 1BDMA 1OD6A 3GPDG 2EWVA 5CYPA 3QVVA 2FN7A 5KTRA 3FOEC 3P2IA 4Z9FA 2HQRA 4OHBA 2Q1YA 1DEAA 2DKNA 3SYKA 3I1IA 2WLSA 10MHA 2VHUA 1KPGA 3KO8A 2GKSA 3ASUA 4I1SA 1ADBA 1OTXA 5EJ4A 3L0PA 2X5XA 4O4LB 3I8SA 2HN9A 5IJ0A 4GX2A 1HOXA 1SEPA 1QKJA 3GPCA 3M7IA 3AHIA 3BGOS 3ML1A 4HN4B 2WR8A 1T36B 1JG2A 1ZUIA 3IPYA 3TLEA 3UAZA 3WICA 4DRYA 3IEVA 3V3TA 2VJOA 6CHYA 3PIIA 1ES9A 3HYTA 1FYDA 1QIGA 1UK7A 4PXAA 5K3AA 2CE7A 2VF8A 1OYVA 1UWLA 4C3VA 2QI9F 5JXWA 2YFKA 1NY5A 1GHTA 1CT9A 3VR4H 3ZKWA 3K7EA 3U0VA 1NSYA 2F48A 2G82A 5BNIA 4CT4B 1T0PA 1G3MA 4K6FA 1BXRB 2XQJA 3H0EA 5JBIA 4PFSA 1JN0A 3EFOA 2RGAA 3BSYA 2JJYA 1N2XA 4QBHA 1COZA 1NW7A 2B4RO 4L74A 1FRVA 4MJ7A 1QIHA 3OX4A 1A7KA 2Q6KA 3UW1A 4ECAA 4IQ0A 1FYVA 1FTWA 5E95A 4DVJA 4LMPA 4QLBA 4NKRA 4MWGA 4AS1A 4LCEA 1XZKA 3QU2A 1DKUA 1I8TA 2D0IA 4OY3A 5GVRA 4PGGA 1HFWA 4LDJA 3T3EA 3T4XA 1SXPA 3U60B 1NVDA 3PVSA 5EKSA 3N76A 5TR9A 1JYFA 3GVCA 1P2FA 2WMOB 2ZCJA 3P27A 4QUHA 4PLVA 4P0PB 1WETA 1G6Q1 1ENZA 3FZGA 3ITNA 3IYLW 1OXBB 5JSZB 1NBAA 2JFYA 3ILHA 2K7ZA 4CKEA 2QX7A 2GLXA 5JCOC 5DN6A 3P0HA 4OVKA 2ADMA 3DHNA 3GG2A 4PV7A 5GM2A 5IKEA 1MEOA 3M6WA 1ENOA 2P35A 4KWTA 2FW0A 5DASA 5BN5B 3R74A 2YVQA 5A5GA 3LCUA 3KCQA 4TPKA 2WTUA 3UMCA 4LECA 1I7NA 1FYWA 1V2HE 3O2JA 2QAIA 1DIRA 3B7PA 2C03A 4FKZA 3AR9A 4Y9UA 3E9QA 3NHYA 5EI5A 3UYKA 3M5DA 1DMSA 4YCDA 2CLHB 5EAIA 1VBKA 3R3YA 1C3LA 1VRCA 4MKXA 4QDXA 1G7TA 1X2BA 1C9MA 5LP6A 4HDMB 3MWDB 1SIOA 4FLEA 2OEPA 4QTTB 4JLKA 1KH2A 4WN9B 1RJEA 5KYXA 3E9MA 1ENYA 2ZB2A 2QJRA 1O1YA 3PTZA 4B6FA 4EYGA 2JLZA 5IDYA 4JP8A 2QSZA 2ZJ3A 2MJLA 1TC2A 4G5SA 4ME6A 3WLSA 2QTZA 1CVRA 4HSEA 3ZDQA 3JALA 3QPVA 1JSCA 4QBGB 4C0SA 4K8RB 2EQBA 5KYGA 1PR9A 2FW6A 1ILWA 4EG5A 3CRRA 2BTEA 4DLUA 1G20A 4IHJB 2B35A 2EEZA 2FY8A 3REGA 4PX5A 4G89A 1QDUA 1GPLA 2RGRA 5E3HA 3F97A 4BPBA 2RGXA 3D4PA 3MSXA 3HI4A 3NOQA 1T29A 4HTFA 4XM0A 4YUWA 2ETXA 3AL2A 2CUNA 3H1FA 3L4KA 2C2MA 3OJEA 1PFKA 4TV8B 4YN3A 1VDMA 3F9CA 2CVQA 1P6XA 2I29A 1I1NA 4MV3A 3V8NA 2O06A 4I55F 3ADBA 4IDCA 4QTYA 1E3EA 1B14A 2H85A 3SX4A 2D0DA 1DAGA 3VR4D 5CJPA 1NRIA 1JGTA 3PT5A 1Y8QB 5SZHB 3L40A 4CV3A 3QWBA 2Z4SA 1DOHA 1M2FA 2IPOA 2JLQA 3NASA 3TRIA 4YRAA 2FXIA 4RV5A 1M7HA 4YPFA 4WLEA 1SHTX 4RLQA 1VLLA 4G5FA 4GMDA 4DPKA 2AKAB 2DFVA 1J8DA 4DHWA 4YRKA 1I94B 5AH0A 1ORTA 3EVDA 3NTRA 1ZBDA 5EC8A 1H8HA 4NENA 3BM5A 3LQFA 1L4GA 4EX7A 5IMSA 3EDYA 4UULA 3PP8A 2YW2A 4H0CA 5JQGB 3WLQA 5KAMA 4D96A 3WAGA 4G4IA 3EXHA 1KOFA 1OLOA 1Z33A 3PHBE 3AP1A 3AUJB 4M8SA 1XDDA 3WLLA 4F97A 1BJRE 1RLUA 3OWXA 4HAOA 1RWOA 5BN4B 2E37A 2AK3A 3TXXA 3NM4A 1XD9A 3H9QA 3AF3A 1YJQA 2ZIWB 1MX5A 2B6HA 2L2QA 4KFSA 4AZWA 1JPUA 1Y5NA 2J3LA 3F5DA 3U4MA 2Q28A 4J4HA 2O8DB 3B3GA 1GZ5A 1F12A 3OZ7A 4BP9A 4O4IA 1NJ6A 4EJSA 1UBNA 4TLEA 4BBJA 2OB1A 1ZNQO 1ODIA 3MCWA 3UKOA 1SBCA 1LB1B 4MQ4A 1Q0SA 1GZUA 3ZIAD 4RM3A 3OCVA 1RXWA 2XRMA 1I24A 3AU8A 4M6WA 1EQAA 3G7NA 1V8FA 7MHTA 3ZYZA 5G1PA 3B9QA 1DFGA 1Z4MA 3ITKA 2QJFA 3CX8A 4WA8A 3TTSA 3QYFA 4A0HA 4KR6A 3L0ZA 1NAIA 1E7QA 2Q7XA 1PSDA 3OWOA 2C8KA 2XE4A 3CQ9A 4NCBA 2UVPA 3C7KA 5E7QA 3AKZA 1QRUA 3VI4B 4DBVO 3VDRA 3ZWMA 2QAGC 4C76A 3TEJA 2FJPA 1I6KA 5EZYA 1R5BA 3L0OA 4BNZA 4OSPA 3RK4A 1XX6A 3LCJA 3HKBA 4ZA2A 4A8JC 1BQEA 3K9NA 1VA4A 1ISIA 3SYNA 2RK4A 2ASEA 4E5PA 4RHXA 3BEOA 3F4LA 2HMWA 3M0EA 3IQDB 5IN5A 4WBNA 1QGUB 4L51A 1CHDA 4MV5A 1YTLA 4B7ZA 3W90A 3DR3A 1FFWA 4Y6QA 3G7SA 3IT1A 4NZZA 3UWMA 4EUSA 3K1TA 4JGIA 1DOZA 2JA2A 1ZJ5A 1V9SA 3LPLA 1HQKA 1QFXA 2PUTA 1XZNA 5LQKA 5HW0A 3IVMA 3WGLA 1DIBA 4GS5A 3GVIA 5ALRA 1QCCA 4M7OA 5FWXA 3IPCA 3LP5A 2QGFA 3A32A 3MT8A 1F5SA 4PWYA 3R5TA 1ZGHA 2DH5A 2WYIA 4GR9A 2UVPB 5JW6A 3JQAA 2Q2QA 3AM3A 3BUSA 4JXKA 4DDTA 2HJSA 3HADA 1H93A 3RBAA 4DPMA 5KNCA 4HTAA 3THSA 3O8DA 3P7MA 3PEYA 1F9AA 1HH4A 2ODTX 2V0NA 3K9GA 4RDCA 3UG6A 1X94A 1L7RA 1EIWA 1DP4A 2O19A 1GYRA 1RI3A 1TVKA 2NXCA 3GDFA 5KTSA 4RHEA 1FDVA 4YLYA 4B74A 4RGQA 2IL1A 3ND7A 5BV8A 2B9EA 1KKMA 4QGAA 3RC1A 2G09A 1H65A 4EHAA 1LTHR 4R4JA 1A9ZA 2HQOA 2W7TA 3AHGA 4JJFA 4L5IA 5FP0A 3NEJA 4QG3A 1US8B 2GA8A 1QFSA 3GJTA 4GGMX 1WXDA 1TEVA 4NYJR 5JFTA 2QDXA 2RHMA 4R8VA 3P8ZA 3A3NA 1PJSA 4US0R 2X41A 3DKPA 2YRWA 2ZSHA 3D8SA 3H5RA 2DWPA 1G1AA 4KGDA 4S1TA 5H9WA 1MRSA 3QFTA 1L5MA 1JHRA 1K6MA 1KIAA 3B70A 3GJ6A 4UW9A 5C37A 1USIA 1M83A 3CBGA 5BSVA 2QSYA 3Q0EA 3L1UA 1PJLA 1Q12A 2MINA 4FFDA 4IH9A 2UYCA 4JVOA 2R8YA 4P4SB 4C4TA 1HMPA 3PQEA 1EG2A 2WRZA 3VX3A 4NMXB 2CVHA 3QA9A 4G07A 4OF4A 2WUWE 1RHKA 4UNRA 3JQ8A 3O0DA 5IBPA 5FBZA 4C0QC 2M6RA 2QTCA 4X7PA 2V7EA 4OD0A 4IYJA 1NASA 2JZOA 1LDGA 4B4UA 4EITA 4FX5A 2XBMA 2XXBA 2O2CA 2GTPA 1MD9A 4DM3A 2V45A 3KKOA 2YXBA 1X8JA 4E22A 2YYYA 2VJNA 4Q9AA 3ZVLA 4AO7A 2H65A 1R0WA 2C2ZA 3ISJA 2P4EA 3WGVA 1U1DA 1U0NA 4P7FA 4X91A 3CNBA 3MCAA 2GS9A 2LE0A 2O8VA 3TAUA 1FNSA 2II6A 2JGFA 3FWPA 4AB1A 3FMOB 4IW3B 1EJ0A 3IJPA 1GPYA 3C4VA 1CWUA 2JS7A 4K03A 5AJVB 5AJXA 2P9FA 3U39A 2R6FA 3N6XA 4E21A 3TQOA 1I2MA 4QNMA 3GIWA 3I9FA 5I4CA 1XL0A 1BFUA 1GU7A 3F74A 4IO0A 3W6UA 1SVMA 2ZR8A 3H83A 4B2PA 1BYIA 2WBLC 4MV8A 4QUBA 2ISQA 3NWPA 4L8YA 5K3FB 3U1TA 4K8OA 5AXDA 5CCDA 4BLUA 1E1RD 3MERA 2ZIAA 4NZ9A 4C05A 5HKOA 2D62A 2ODNA 5FOQA 2A7QA 1F2UB 2H5LA 4M36A 1KVUA 2R7MA 1P9NA 1QF9A 4P92A 4RVHA 3V1YA 2W22A 1A8IA 4K86A 2D5LA 1C3OB 5HGXA 1Z29A 2ZSAA 3OU2A 1NTRA 4WZBE 5HXAA 4KQCA 2B4YA 3OQIB 4JT8A 2AA3A 5ALQA 4B80A 1KH1A 3OFND 2RGGA 5TLSA 3ZDDA 3OESA 2AX4A 2YY5A 3QX8A 4P7JA 1WSAA 4TTPA 5K8VA 4ECEA 4R01A 2DKFA 3UWDA 2X1MA 4R81A 2B4KA 2EZ9A 2WKRA 3CSSA 3KQWA 4O2BF 2ZT8A 2WHQA 2XZTA 5CRIA 2WHYA 1D03A 3OQNA 3FPSA 2ILVA 2I0FA 2G36A 3THWB 2OCPA 1ZMBA 4ZO9A 1Z88A 4Q6BA 1XPRA 4FGUA 1PD1A 4BUCA 4PNZA 1JDSA 5CB0A 1L5HB 3E9YA 3OSZA 5B2ZA 4EG3A 2Q3MA 3ES9A 2Q3LA 2PT5A 2WWHA 4RQBA 4Y7CA 4DBZA 3W5AA 5A7FA 2VP5A 4FNMA 1FS4A 3CLUC 4YRQA 5BSKA 2V3CC 1SQGA 2V6FA 5HKLA 2HX1A 1OIWA 3UWSA 4MV7A 2WAMA 1AHIA 4FHZA 4Q3EA 3BKWA 5IJWA 3THYA 1I7DA 2X9QA 3K6KA 2W58A 2JGJA 4H6VA 1PK7A 3IAS1 3PNBA 4YRIA 2EVWX 5ADHA 3D8NA 4MJ3A 2X3YA 4N47A 4IDPA 3PXCX 4EKEA 3D2BA 4RF2A 1A69A 3UJ6A 3DLAA 3Q7TA 4QJ3A 5J4KA 1U0TA 1PGQA 2Q9AA 4EG6A 5HDBB 4PQRA 1TM7E 3N5KA 4FFOA 1RM3A 4J07A 1XLVA 1FZTA 3BGWA 4CQLA 2Q3JA 2QROA 3GAZA 3FYTA 1P77A 3CJRA 1AGNA 1GSAA 4GI7A 1EBFA 4Z9BA 3JWJA 1LW6E 1X87A 1QQTA 1C4WA 1E89A 1FFGA 2MDTA 3MWKA 4F6RA 1OXVA 1T9CA 3GLGA 4QM6A 5E9JA 2LDXA 3RVKA 5EJAA 4NMMA 1NI4B 3EZFA 3TNLA 4DCPA 3TKAA 3EVGA 4TTJA 4X90A 3P0IA 2PNJA 4CMEA 4F5EA 1PQ4A 1RYNA 1EDOA 2QTBA 1JHUA 1FS5A 1N6HA 2BFAA 3IQEA 5E6UB 4CIDA 3LLCA 4RS4A 1G55A 3UY4A 1BDJA 1P7WA 4EJMA 2WWYA 3LCMA 3RABA 2FETA 2YHUA 3RT1A 3ZUGA 4FYIA 5EP1A 3QF4A 1SVNA 2WU8A 2GYUA 1GG9A 2PPLA 2W6IA 3MPOA 3P2OA 4P1ZA 5B3JA 4JI5B 4DR2B 3M4NA 1V9CA 3MJ4A 1TTTA 1HTBA 1ORDA 5GONF 4BEJA 4UNQA 1Z5VA 3OLWA 3K0CC 4F4IA 2WINI 1QDLB 5GQSA 1ZEJA 4PN3A 5ECGC 2FKAA 1SIUA 1IVYA 1CPYA 1OI2A 2ERYA 3IA7A 3PC8C 521PA 2HIAA 4Y2RA 4NCXA 4N40A 2DFNA 3GXBA 4WE3A 4WZBB 5JTUA 1ACLA 1UDCA 2VPWA 4LOKA 2VQ6A 1Y8CA 3RS0A 3TD2A 4CHGA 1S5PA 5JUWA 3F6BX 2Y1WA 2DPYA 3DVRX 3UMJA 1SWWA 4D6XA 3IUSA 4I0WB 3CNHA 4POOA 2XITA 2D0PB 1N25A 2O8CB 4EY4A 4M55A 4L57A 2CKDA 1J7KA 1ID1A 3QSYA 1LDEA 5F3RA 4RIEA 2G5TA 2PFGA 4JOBA 5TQVA 3KALA 4MRAA 1R9GA 2HAEA 3T9DA 1LWNA 2IHTA 1SXJE 2SCUA 4HQOA 1YWGO 1XWFA 1IBCA 2EL9A 1MUUA 3GVHA 4PPFA 3QX9A 4QULA 5FTMA 3GFBA 1MOQA 1P2BA 1X8XA 2QUHA 1CNEA 4PQEA 1H85A 1N1DA 1X77A 3QEMB 4Q7LA 3JVDA 1R4MB 1KVQA 2LCIA 2VPIA 2REOA 3HZZA 3VC2A 5A0FA 1J5EB 1KDYA 3PQ4A 3WQRA 1M8FA 1J1IA 4B6RA 4BLPA 2REXB 3L0BA 1KDVA 3ZZ1A 3O2SB 2J5QA 2R8PA 1E2GA 1Z28A 2COUA 3CU5A 5HCNA 2JCBA 3FTPA 1RKVA 3V1TC 3IJRA 3OZBA 5AJWA 2I22A 5GINE 3HFGA 4KLRA 1U8AA 1L4HA 2PXHA 2PXAA 1M2NA 4PIMA 5F9MA 4W1RA 4RZUA 5DHUA 3ZQJA 2YN4A 2WJ6A 3GLUA 3KBOA 2MYTA 3PQDA 4MYDA 5DH9A 4DG8A 1ONPA 1VGQA 3I6YA 4OGLA 4RZ2A 5CLFA 3J81k 1BQ3A 1Y81A 2FQYA 1IULA 5FEUA 4WVLA 5CUQA 2FE4A 4KNWA 4FBMA 5I9NA 3GCWA 1NUAA 2FPGB 2H7XA 2JH3A 1L4FA 1PEYA 3BE6A 2I6FA 2X2EA 4G84A 3EXG2 3F8SA 4JJGA 4LRTB 5ALVA 5JH7F 5DHTA 2CVOA 1C8LA 2PUDA 3VPXA 3IESA 3B5EA 3T52A 1T8YA 4GXNA 3TVYA 4DY4A 2AMLA 1S9HA 2IXFA 1NJ8A 4ALJA 1B00A 1T25A 3PRHA 3N5CA 5I4KA 4JYMA 1E2BA 1FRNA 3A04A 3MWJA 3T9FA 2CNOA 2FPGA 4HFMA 4EHIA 1EFDN 2QG4A 5TGDA 2JBWA 4UNNA 5JI3E 2ASVA 3D7MA 3I6QA 1M34E 3SFVA 4KREA 4UD6A 4F8YA 3V1NA 2Y0PA 4LF4B 3M82A 1DUVG 3F3SA 5JADA 4NESA 3TKYA 1H1TA 4M0UA 3VPSA 4KR2A 1MO5A 3RSSA 3FIUA 4HXFB 2QIPA 5HGJA 3ENZA 3ZCPA 4UXJA 4XCXA 4KIUA 5K4HA 2PS0A 3INNA 4ADSG 4DSUA 3CVWA 2JI8A 4HUJA 1W34A 2V6GA 2ORVA 2O1WA 1AQIA 5HBRA 2NZXA 1DIAA 1G9SA 3R7WA 3PZBA 4BEVA 4EKNB 1CY7A 4OAPA 3QF7A 4PAWA 5JD4A 3C7TA 2G25A 1I3KA 1UJMA 2WM8A 4R7ZA 4X54A 3SXUB 2XPCA 5A4JA 4ZXFA 3FMIA 3DVLA 3I9NA 4HAWA 4AX8A 3WNZA 4XASA 4B3MB 3ORRA 1WHTB 3N2NA 2AG5A 4IDOA 4GMFA 3AHFA 3TE7A 3QIVA 1UFKA 3MT0A 2MCFA 4BVEA 1SBIA 3NBYC 3G1WA 1LNSA 1Q7EA 3RUCA 2PYZA 1BGWA 4B2LA 3ZJ5A 1OWNA 4OXNA 4E94A 1C14A 3C24A 4Z8XA 3KQLA 3Q1KA 3PDHA 3ELUA 1DSSG 4M0MA 1Z16A 1JIVA 1FXSA 1MX3A 1D09A 2BRUC 2OHXA 1BA3A 2E1RA 2FE1A 1MHPA 3DF7A 3GRYA 4W1QA 3TIGA 5HF9A 2JFQA 4BDSA 1CUWA 1T26A 1T91A 5DF1A 2YY6A 1FA9A 4ZOLB 3EXHC 3RTBA 2RG1A 5CNIA 2IH5A 2E2WA 3ICOA 1WO8A 2ZVDA 3ITDA 1C3JA 4REQB 2Y1DA 4OATA 2VTEA 4KAJA 5PNTA 1WZUA 4Q9NA 1R4ZA 2GN8A 1FNCA 4MS4A 2ZRLA 4WFQA 2RC5A 3CNOA 4XDGA 2QLTA 3BWYA 3ZDEA 4D0LB 2NVUA 2A5FA 4KJXA 2QZPA 3I2IA 2X8JB 5D6NA 2X9NA 5DO9A 2LIPA 4Z0HO 3LKBA 1YDHA 3AI2A 5DB4A 1FFBA 3W7BA 1U8FO 3IVCA 1Z68A 2MSKA 2EHJA 5DOZA 2NX2A 1U98A 1DC4A 2PFKA 4RDXA 5AM2A 5MFZA 3DPSA 2E49A 4A91A 4UVGA 1MJ5A 3FSGA 4HYQA 1XRNA 5EEHA 4D92A 3AFGA 2HT1A 3R0QA 4CNBA 2BKUA 2BEVB 2QI9C 1IHUA 2QMYA 5KB3A 4TZ0A 1IVNA 1XALA 4PAQA 4BLOA 2FFQA 3QH4A 2QTLA 1V6SA 4IDNA 2GHIA 2MU1A 5H1YA 4EJSB 4PZAA 5D5HA 3QZUA 4HKTA 4Q18A 2FRDC 4RVSA 1ZOOA 2ZTSA 3MPUA 1VRVA 2DZDA 3RIMA 3ODGA 4MZXA 2R1UA 4DMCA 2PE5A 1BMTA 4MUGA 3BTUA 4UU8A 2DT5A 5F7JA 4EVIA 3MUNA 2YR0A 4DQLA 3LPMA 2KHZA 1TCBA 2AN1A 2D74A 1BMFD 2IU4A 2M2IA 4KQ9A 4CL2A 5BWMA 5LQAA 1RWNA 4UM9D 5FAXA 4ZCSA 2CLMB 4Z4CA 4UFOA 1USWA 2Q2OA 4X8MA 1S3IA 5EP3A 3L0IB 4RV9A 4X5OA 3RYHB 2CDCA 1F4PA 2QX4A 4JEUA 3TB4A 2Q5QA 1LC3A 2E4XA 3LBYA 3NAZA 2J4DA 2Q3EA 5KKNB 4HD8A 3TR5A 3CG4A 3EF1A 4UNIA 1QIKA 3QM1A 1CY4A 3DV2A 1X39A 3ETLA 1PT9A 3NBZC 2Q3CA 1K5DA 5TJHA 1BKSB 1GA4A 1Z6YA 3MBOA 5EWMB 3E1SA 3RASA 1Y8QA 4RTPA 4MHOA 3SC6A 1NF2A 1UKAA 1N9ZA 1XRSB 2C2BA 2MHCA 2QL5A 2GZDA 3QE2A 4UTOA 1B8PA 3SHQA 2I8LA 1E92A 3JQDA 4W82A 2BUBA 5EIOA 5K3DA 3WYEA 1X1RA 4ARSA 4HT3B 5BPHA 1N0IA 3S2YA 4TXNA 5LZ9A 3CF4A 3K8YA 3KQUA 3PUVA 4MS3B 2IOYA 4ASUD 2FMTA 2PKCA 2J0SA 2QL7A 1CIJA 3K5WA 2Y99A 4IGEA 3IO3A 3D5EA 4XKJA 2GM9A 5TPWA 4I1UA 3AI1A 1TKBA 3HA5A 3K16A 3ZWBA 4NABA 1N9GA 2R9VA 3TCXB 4EMUA 5IT4A 2PQMA 4L1KA 3W4KA 1T9DA 2H1OA 2PL9A 2VTDA 1U3VA 5DYWA 1VE7A 3DMGA 2B78A 1ZJZA 2A3NA 1T2DA 1SIWA 2EV9A 4WSOA 3B2NA 2UUOA 2XKJE 2VUUA 3DQQA 3EG9B 1QGOA 1PSWA 1U9ZA 1KQOA 1L5YA 2NW6A 2O3SA 4NZOA 1JG6A 1U7OA 3CCBA 4JJ7A 5TC4A 2AOTA 3WWCA 1M1ZA 1QVZA 2EJCA 3AI7A 1DG9A 5FWDA 3K5HA 1QRTA 4HYYA 1GPMA 4ZQHA 5CLHA 4ZD6A 5AVRA 1GNRA 1XZBA 2D2IA 3IPAA 4MCAA 1R16A 4YV1A 3B89A 3G9ZA 3SVTA 1UT6A 2QW1A 3JYQA 3LUJA 1KMQA 3BCHA 4B4DA 3NYQA 4U7HA 4WFIA 1EHYA 1FEZA 2D5IA 4L5AA 2H16A 2RH9B 4UOEA 5BNFA 1JR4A 1SC3A 1HKHA 3IHWA 4MZDA 4ZOEA 2B69A 1XLTC 2H1FA 4X8OA 3S2IA 1F0YA 2CLFB 3BMCA 3C3JA 4KE8A 1KA9H 1TYCA 3EBOA 2WDZA 3ILYA 4RZXA 2XMZA 3EISA 5EJEA 3ZU2A 4AJ9A 5J4YA 2XTMA 3I6IA 1JKMA 3R3UA 3U3JA 2H8GA 1REQB 4YAKA 5EMHA 2B2CA 3MGKA 4NG4A 2QVCA 5JS6A 1SHKA 2FLWA 4MDFA 1RP7A 4KGVA 2WJWA 2BAGA 4WK0B 3W2GA 5K9ZA 3QXSA 3QYAA 3E5MA 2O2EA 2W6MA 4CEJB 3TEMA 3UMBA 1G2PA 3OT4A 3N2GA 3UATA 3W6ZA 8MHTA 1KIFA 3K3PA 2Y1KA 1U2GA 4QVKA 4C88A 1Y5IA 5JO0A 4FHDA 1HI9A 4AJ1A 4FNAA 4QU8A 3FSRA 2WV9A 1RQRA 3DEKA 4FINA 1W5TA 1SOWA 5E0KB 2GJSA 5CA1A 3IEUA 4EF5A 2W2KB 2EYUA 1WD7A 4QE3A 3WGZA 2XF2A 3MJVA 1GGKA 1ODFA 2X23A 4NBUA 1GAEO 3IUJA 1CR0A 1KI6B 4QICA 3AR2A 4BYGA 2E4YA 3S8YA 2Q4RA 1RYFA 4UXHA 4OMDA 1RZUA 3BDAA 2BC9A 4FXPA 2GD0A 2FZCA 4LHYA 2BEWA 3V97A 4E30A 1GSHA 1Z0KA 4GX5A 3DXYA 2J6BA 2YZ2A 2KBFA 5EFOA 3N2KB 5J1SB 2YYAA 3UAVA 4QTXA 1JG1A 1N5KA 2V4ZA 4NBNA 5H0IA 3DM9B 3JZFA 5HCUA 2WWXA 2AV6A 4H3SA 4WXPA 3NV9A 1EFPA 1KJ9A 2FQWA 2IVFA 3LO8A 1QB7A 3M1IA 4C7BA 1RVDA 2FQ1A 2OPHA 2PL1A 2K6GA 1OXSC 3HYNA 5ADWA 3NTUA 4UCQA 3MBIA 4M0CA 5EJ2A 2H63A 2Y76A 2V7TA 4X24A 3C3AA 5K0CA 2OPBA 3JQGA 4W7IA 3U7RA 2UAGA 4BNKA 1XT6A 3KZMA 2FZEA 1JA0A 2CMGA 2GN1A 4KK3A 3I9V1 3QITA 5ENZA 4DDWA 2DEUA 2PX4A 4WNYA 1I6WA 2JI7A 4Z53A 4KXVA 5KTNA 3ZIAA 4ZEVA 1E3LA 2A35A 3LXXA 2ZIEA 4RSRA 1TUEA 3R8XA 5BYKA 1WF6A 4NBVA 2JB9A 3ZDRA 2O8FA 5HZGA 3QF4B 4U0JA 5GOTA 4YMHA 1O8CA 3KZOA 3NRBA 4BKOA 1AQYA 1E3WB 2RI6A 2Y93A 2JA1A 2VNJA 4AKTA 3RS4A 2BFCA 2PVPA 4BVHA 2CWDA 3AW9A 4C4YA 1RAEA 5KOJB 3LECA 4DV7B 3GG9A 3ZKAA 1ODKA 4MB2A 3DR5A 3ER6A 5FTJA 2JIOA 2XADA 1IHDA 1I6LA 1JEQB 1QH0A 2PIDA 3HJBA 3N3BC 4HXYA 4QRHA 4UTXA 4BRUA 1W2WB 2Z0MA 1KYTA 2D59A 3NBMA 4OHUA 1ML3A 3KEOA 1P8AA 4Z9XA 3BS4A 2QP9X 3MINB 5KYYB 1S4MA 1UUFA 4R1TA 1V1RB 2FFRA 1AN0A 1HDXA 2HIMA 4LQCA 2R11A 4RCVA 3K9WA 4DT1B 5K4AA 1BC5A 2SKCA 3OZIA 6REQA 3KQKA 3NO4A 2COEA 4XI9A 5G4LA 1XF1A 2Z2JA 3LWDA 3BMNA 4FZ3A 4IDEA 4C3ZA 3BN3A 1C41A 1OWPA 2C94A 2PXCA 3K72B 2HRCA 4NV0A 3LUCA 1E99A 2W2KA 1BS1A 1CF9A 3A1FA 1U90A 1T0BA 3DFKA 3ABZA 4RJJA 1EJ6A 4UEOA 4XUGB 5WRFA 3URMA 5CB4A 1R9MA 4DRXA 2DSNA 2OLKA 1ORRA 5DLQC 2P0EA 5H3LA 2HJRA 2EZ4A 4ZVMA 7REQB 3GLHB 5JZMA 4MV6A 5EIXA 3IIIA 1F2DA 1X2EA 2O2IA 2YHAA 3SJCA 3WYGA 3HCFA 1V39A 4N7JA 1PVOA 4FOTA 4QUGA 1I6MA 1UR5A 1ZY2A 3K5PA 2OMEA 5GV7A 4YJKA 2BSQA 3KTFA 5KYUB 3I9KA 1J0XO 1NT2A 5DBEX 2ZQYA 4AJEA 2RIPA 4D8YA 1NBOA 3ESXA 4FYYA 1TJPB 1W85A 4GOOD 1ZVMA 2B21A 1Q91A 3EQ9A 1AUVA 1UK9A 1PGPA 2HHJA 3EA4A 2NV6A 4K28A 3ZVRA 5JVDA 3E5HA 4O4HB 4EI2A 4Q1VA 3PPYA 4IL5A 1NLZA 4IX1A 3VOSA 1QJ4A 1L4KA 1T8SA 2DUMA 3UGJA 2A5DA 4YHBA 4YRMA 3QHAA 3KAQA 3CUVA 2I66A 4RF3A 5K09A 1UP4A 4YP5A 5FKJA 2CLLB 3E9CA 3HLTA 3O0TA 4M99A 1M7BA 1TIPA 5SY9A 3AUYA 1E5VA 4RZIA 4BAUA 4DLBA 1XZPA 1SXGA 2HBZA 1GA6A 1E69A 4D0NA 5B12A 5SY4A 1MLDA 2GB4A 3C97A 1RHJA 1UM8A 5CVTA 1HL7A 121PA 1CJSA 1MAUA 2BGKA 5DWVA 1K97A 1KEPA 2D5CA 2PLRA 3PDIA 1RHMA 2BHRA 4CG2A 4I50A 4TL7A 3EC2A 1J07A 2J9GA 1IHXA 2QZ4A 1T8WA 2VP6A 4XEHA 4CM4B 2FP3A 4XIJA 2FHPA 3R23A 3BZUA 3WS7A 1R1DA 1ZSVA 2WTNA 5HF6A 2CXHA 5DHPA 4Y2UA 4RPLA 1GL6A 4H6PA 1XMJA 4CF3A 2AMYA 4QIHA 2ZWAA 5HZKA 2LXNA 1IYZA 1UAAA 1ZR4A 1NOJA 3WA7A 4N49A 1FTQA 4XM2A 1C4OA 3U56A 2EKDA 3PFBA 1IZ7A 3M6AA 5K0ZA 3TX2A 3EZ6A 1MNQA 3QEMA 1UP6A 1S1MA 2YOGA 2X86A 3ER8A 1GUAA 2VS1A 3PA8A 4F86A 1PZNA 2BLNA 1VE5A 2CC2A 4JLVA 5DWQA 1QRRA 1EG7A 1ZCZA 2QLNA 3LOUA 3TGLA 2AZMA 1RMQA 1Z6TA 2HLDA 3PXXA 1UBJS 3OCZA 2RB5A 2ZWVA 3MINA 2OYSA 2DJ5A 4OK5A 1E1YA 4ND3A 5GMOA 4W5QA 2VUHB 2ZS7A 3CM0A 1I2ZA 3ZDAA 5E0OA 2DHRA 3LPDA 2GCOA 1R66A 1SHLA 4QGSA 4CR6A 3BHJA 2VSYA 4K9RA 1V8ZA 9GPBA 2WF5A 3OSUA 1VHTA 4JROA 1QOZA 3BBPA 3D8HA 4D81A 3C1OA 4ZVNA 1YOVA 2XUHA 2IT1A 3GRRA 3B1YA 1KSHA 3GJRA 1G21B 1XR3A 2O8BB 3F5SA 1ITZA 2YWJA 4ZT5A 4RTOA 1U6IA 3AFHA 3TTXA 3WZ2A 4ITVA 4LX8A 1QAOA 1FX1A 4HZIA 8GPBA 4JZYA 5KX5B 1NIPA 1E6WA 1R88A 2PGNA 3A1NA 1DG3A 4KQGA 3GD5A 3IERA 3P9SA 4Q9IA 1S2LA 4GL4A 1MAHA 5HJ2A 3AOGA 3LRPA 3PPWA 1HE5A 4JLUA 4KAAA 1VPLA 1EFVB 2BHNA 1Z12A 2IF0A 1ULSA 4AECA 3K1JA 5DNVA 1YFZA 1Y1TA 4JSTA 5JNRA 4AUKA 1IMJA 4E14A 3TVDA 2IYTA 4JJZA 1EVIA 1KYWA 1TXGA 4G65A 3IBGA 1VL5A 1YE3A 3LUHA 3NETA 1DLIA 5HEKA 1QQ7A 1G60A 1D07A 5K0EA 1TTHA 1QIDA 1YB6A 1Z6ZA 1OTHA 3HU5A 4Y2PA 3AX6A 1SVWA 3PNQA 5H7XA 3F6SA 1JHXA 4URZR 5KNDD 4MCJA 1HDGO 1S1CA 2X0IA 1ZONA 1TU0A 3A3PA 1NC1A 3E7FA 3KFLA 4XCVA 4ILEA 3R9XB 2X0KA 5IVIA 4C6HA 4HXGA 3G5LA 1TM2A 2GPJA 5EHNA 5A5VA 1I0ZA 3OAAD 2Y77A 4P7GA 5AJHA 5I9SA 1CR4A 4Y2SA 4GMXA 2VATA 1Z5GA 1FOEB 1SUEA 1WMEA 4YAFA 3U3KA 4QX6A 4EATA 2GETA 2W6JA 2BMFA 4Y67A 5LYYA 3V00A 2AWOA 3EFEA 3H9GA 1D2NA 1Z7GA 3FB4A 5TXGA 5K4GA 1QH1A 1OX5A 2PMEA 4D9EA 4EJSC 1ZI6A 4JXXA 2XOKA 3C3CA 1NZFA 4HJXA 5HIMA 4XX0A 1Y1RA 1D04A 3NWOA 5JAIA 1XXHB 2NMVA 3RKUA 1QYWA 1GG5A 3AESA 1C8VB 3C6YA 3F96A 1JAIA 2IIQA 3KX2A 3QK7A 4J0HA 1AK1A 5B2FA 4RPCA 1M54A 4HX2A 4PC3A 3ZWKA 1R8YA 1NR1A 3BRSA 1W1IA 3SF8B 1QS0B 3SZGA 3P9QA 1BVUA 4NF2A 5A1TA 1F1BA 2JI6A 4ER5A 5FBQB 1ZI9A 3GDHA 3ZK7A 3REFA 4S2UA 3M3PA 5JMWA 1WDMA 2W0SA 3CZQA 1U7WA 3CE6A 2H18A 2I4LA 1IHYA 3DB2A 1USGA 2XD4A 5FHQA 1DCTA 3TR0A 1PBNA 4F1WA 4GW3A 1J9ZA 4ZT2A 1UJNA 2C96A 4OJTA 3F46A 1NXWA 1O8BA 2WAYA 2J41A 3H2KA 4DSOA 2QKYA 1OHHD 5JJIA 2O0KA 1QUFA 3FAZA 5AJYA 3OPYI 1EYZA 3DEYX 4JP3A 4M8NE 4LY9A 4MP8A 4QEZA 2D2XA 4YVFA 4H1TA 1W4CA 1HNWB 3JQAD 4C87A 4LTNA 5EQTA 4ZHSA 5ECWA 1I3CA 1LPSA 4JI7B 1CIVA 1GV1A 3L6OO 5FHRA 1SZPA 3UGQA 4GLFA 3U6KA 4I4LA 1MB2A 2D1SA 2P2NA 2AWNA 3LNCA 3MW8A 6ABPA 2EP8A 3L8HA 1MB0A 3L1HA 5KNDH 1JWAB 3GCDA 5ALDA 4AXBA 2R8RA 4B3HA 3KXDA 2OP0A 4JMLA 4CTKA 2HTFA 2FEPA 1E2NA 1PQPA 1YI0A 2QXYA 3PR1A 1CQIB 4WBXC 4AP5A 2CBXA 3NHMA 2PRYA 3PEFA 4CF4A 2AEMA 4XE5A 4F9EA 2GLUA 2CHUA 3NOOA 1QG2A 1KU0A 2I2AA 3DZDA 4NQRA 1B0ZA 3KQMA 1Z39A 4EGAA 1JU3A 1OGJA 2PSSA 2PJRA 4X1KB 3LD9A 2JEYA 2WJAA 2NO1A 2ZU0C 1WAMA 3F2IA 4U02A 2GSDA 2QNRA 4LKOA 4TTVA 3O9ZA 3MRSA 4URYR 2OAP1 4XVUA 3BD6A 3MAGA 2NPFA 5IEJA 1DADA 4UBMA 2NZ8A 3OM0A 2NYUA 1VDZA 1H0KA 2CD9A 1SC6A 1FX0A 3O1JC 3GOQA 5LLSA 2XVXA 4DRXB 4OLFA 4UE6A 1YMUA 1E1KA 2PX3A 2YZNA 4TV8A 4IDAA 4UHFA 1RZ3A 1WMAA 3AVUA 3E70C 5CXXA 1NW5A 5A3VA 4FWIB 3QU9A 4ZOLA 2EXXA 2JFHA 2X7XA 4JLMA 1IN1A 1JSRA 3NTXA 1W5AA 5SICE 4NYIR 3PL1A 2EZ8A 4ZAGA 3RAEC 1WTCA 3RVLA 1XNJA 3PG5A 5KCZA 5KYYA 3O31A 4BMPB 2BF4A 4NCHA 1MG0A 5FYDA 2E7ZA 3SLGA 1U81A 1E5QA 5DM60 1NUUA 3FYCA 3NBAA 5FOUA 3LLMA 3H5OA 2QD1A 3SS7X 1ND5A 2IYSA 2ESRA 3QKUA 5IXJA 2WKWA 4XPIB 5DT9A 1EB8A 2PG3A 3GBPA 4I66A 3T38A 1JQAA 1NPDA 5TV2A 3OTIA 1THTA 1YRYE 3PUYA 5AI0A 5EG5A 2BHLA 1U31A 5G4KB 3ACBA 3O9VA 4ID9A 1NVGA 3D7KA 3BRCA 2F8TA 1RLIA 3DOHA 5TS2A 4BNLA 1ZL0A 1YVPA 3W1WA 1PIWA 2O3QA 4N18A 4NZPA 5HJ5A 2C5LA 3HBNA 4HDCA 2B6NA 2NU9A 5AJZA 2FSVC 5A3RA 1TEZA 3VR5D 3G2HA 2QR2A 1HA3A 2V7PA 2RGUA 3OO0A 1LK0A 1ZM7A 1GA1A 2OAGA 4M1EA 4H7DA 2JARA 1N5IA 4BO2A 1V4BA 1FRZA 4HDOB 1CNFA 2JPDA 2LWIA 2FDXA 1KY4A 3PKIA 4YXFA 1PR0A 1VKJA 5FWXB 5EWJA 4B32A 3TF5A 5J59A 4HWSA 2KB0A 5A62A 1KFJB 1M8JA 1KJIA 3BT7A 2XNCA 4WLUA 5JC8A 2XUGA 4O4IF 2O8DA 3LTNC 2R4TA 3FBTA 2AQHA 3E58A 4FK8A 4TXJA 5F33A 4G5HA 4UTRA 1UBFA 4PVCA 4EFKA 1L8XA 2UUBB 1NJ1A 3N6VA 1XTJA 5L53A 1IEVA 3L9XA 3F73A 4DLVA 1HYEA 1LBTA 3IRVA 1D2AA 1KXJA 3CF4G 3SXPA 1EA7A 4FE4A 4LF9B 2C1EA 1XRJA 1JQ3A 4UOZA 5CBKA 2QN7A 4ZHQB 4Q7MB 1K2WA 4R8KA 4F5WA 1THMA 3OBIA 4HATA 4Z86A 3T1VA 1XMOB 4PR0A 2AC7A 4NG5A 4RK7A 5E1BA 4RWZA