1Q0RA

Crystal structure of aclacinomycin methylesterase (rdmc) with bound product analogue, 10-decarboxymethylaclacinomycin t (dcmat)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
297
structure length
297
Chain Sequence
SERIVPSGDVELWSDDFGDPADPALLLVMGGNLSALGWPDEFARRLADGGLHVIRYDHRDTGRSTTRDFAAHPYGFGELAADAVAVLDGWGVDRAHVVGLSMGATITQVIALDHHDRLSSLTMLLGGGLDIDFDANIERVMRGEPTLDGLPGPQQPFLDALALMNQPAEGRAAEVAKRVSKWRILSGTGVPFDDAEYARWEERAIDHAGGVLAEPYAHYSLTLPPPSRAAELREVTVPTLVIQAEHDPIAPAPHGKHLAGLIPTARLAEIPGMGHALPSSVHGPLAEVILAHTRSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aclacinomycin methylesterase
publication title Crystal structure of aclacinomycin methylesterase with bound product analogues: implications for anthracycline recognition and mechanism.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Hydrolase
total genus 105
structure length 297
sequence length 297
ec nomenclature ec 3.1.1.95: Aclacinomycin methylesterase.
pdb deposition date 2003-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1q0rA00
3OG9A 1MNQA 4BYMA 5HF8A 3LIIA 1XZAA 4BZZA 1QGED 3GELA 1M33A 3I6MA 5AIAA 4XJVA 1GXSA 3FLBA 4AZ0A 3R41A 1DQYA 3EQ9A 4HXEB 1UFOA 3DYIA 5HKBA 2OGTA 5FKJA 2Z3WA 3WA7A 4QE3A 2JEZA 2WFLB 1ODSA 4BAUA 5K3AA 2Y2VA 4GHWA 4WDRA 1XZFA 1QIFA 4DMCA 1XLWA 1T4MA 1ZJ4A 4M0MA 4QLAA 1OXMA 4I3FA 3KWJA 4GI1A 4GBGA 1LPNA 3BIXA 2XQGA 3F67A 1BN6A 1G5FA 2ROQA 3N2ZB 2W22A 4I4CA 3BDIA 4MWTA 4AN0A 3H17A 3IUMA 1U8EA 4X6XA 3H04A 4LYDA 1U65A 3O9MA 3QMWA 4UHCA 1CEXA 2HU5A 1TIBA 4FBLA 2OPHA 4TGLA 2XMSA 4QEKA 4KAAA 1SOMA 1T2NA 5K3DA 2BJHA 1EX9A 3KOOA 1KEZA 1CUVA 1OCEA 3I2JA 5K3BA 1QTRA 2PL5A 4FWBA 3D4LA 3K6KA 3G0DA 2O2IA 4MEAA 2XDWA 3C87A 2CMFA 3AUKA 4J7AA 3DOHA 2XQIA 3STYA 5HF5A 3ZLVA 3L1IA 4OUKX 3IUQA 4GECA 5K5EA 3O4JA 3V1MA 3H18A 1XRMA 1ZD5A 1XRRA 4GLBA 5CBKA 1WCYA 4C4XA 4DLNA 1CUUA 3I2GA 3HABA 2HFJA 3WKAA 5HFAA 4BTLA 1UKCA 1QIGA 1ZJ5A 1G42A 3C8HA 4G8BA 3W06A 3D7RA 1E66A 5JD6A 4EHBA 5ALUA 4B84A 3IULA 4F5ZA 3OOSA 2H7CA 3H2GA 4U2FA 3WZMA 2BFNA 5BWCA 3UUFA 3WA6A 1CFJA 5JADA 3OM8A 2CEKA 1VJ5A 3H1BA 2GBIA 1JMYA 1UK9A 2XE4A 3GUUA 1WB6A 1DT5A 2BUCA 1AGYA 3DEAA 3ANSA 4XIIA 4AX4A 5IVDA 4DNFA 2WLSA 1E89A 3STWA 1YS1X 5CXXA 3WI7A 2CJPA 1NU8A 3HZOA 4FFWA 2XQFA 1CV2A 3RK4A 3U0VA 3WWOA 5HK8A 1MNAA 3GA7A 3OURA 1F6WA 1R9MA 2GYVA 2Z3ZA 4HXGA 5AKGA 1XZHA 3CCBA 4ZV7A 2QVBA 4LIPD 2HL6A 4EY7A 4BE9A 4KE8A 1LBTA 4GDMA 4EA6A 1CR6A 4J0KA 1VZ3A 1EDBA 2QXUA 1R3DA 4B83A 1QIIA 4LKOA 4OPMA 4B80A 3CN7A 1GQRA 4G9GA 3F98A 2OCLA 3WKEA 5AI0A 5IKXA 4MJ3A 4BRZA 2WTNA 3VISA 2YXPX 4WDQA 4P9NA 4BAZA 3ZWQA 3HEAA 3HJUA 4PSDA 5HF6A 2WUEA 5A62A 5AH0A 1USWA 3C6ZA 4Y2PA 3LS2A 5AKZA 2J4CA 3I1YA 3WYDA 4N8EA 4J0JA 2WQZA 5LKRA 1VLQA 4OB8A 4UHHA 5FP0A 3DOIA 4WCVA 5ALXA 3E1GA 3H2KA 7YASA 1O6GA 2XMCA 5JYCA 3M83A 3ZI7A 2XT0A 3O4HA 2HA0A 5LYYA 2WG0A 1IZ8A 2WU4A 3TJMA 4HVTA 2WFZA 2QXTA 3E4DA 4TVKA 5JALA 4ZRDA 2QTBA 1XZBA 2JEYA 4W1PA 1N5RA 3V9AA 1JJIA 1ETHA 5C81A 2Y2UA 2XMGA 1CUWA 2OQIA 1N1MA 5EFZA 3DNMA 3F9CA 4GXNA 3BF7A 3NUZA 3WKCA 2PU5A 4N8DA 3S8YA 4UHEA 1MTZA 4BCDA 5JATA 2WIKA 5ALOA 1F0NA 5HK9A 4AN1A 1E8NA 3AIMA 4L0CA 1XZLA 4BC1A 2OCKA 4Y2JA 3C45A 1J1IA 4J0GA 5A7HA 4INZA 2ACEA 4C6HA 4PV7A 4X97A 1W1IA 4QDZA 2XMRA 1THGA 3IBTA 1XQXA 4EY8A 1SC9A 3VDXA 2JGEA 1LPSA 2NW6A 4UFOA 4DTCA 1Y7HA 4G8CA 3W9UA 1CUSA 1DWPA 2B61A 4CG3A 3E0XA 3AZPA 4UFPA 1WB5A 1ZD4A 5FV4A 1J2EA 1GGVA 1HQDA 1XZGA 5D3ZA 2CKMA 5DNWA 1GZ7A 3M81A 1FSSA 3C6YA 4PNZA 5ALMA 2WHPA 3MGAA 5EIAA 4ZWNA 5ISMA 1HL7A 5C8ZA 2RIPA 4FDMA 3DCNA 4HS9A 2FJPA 3QPAA 1QONA 1TKRA 4NMWA 1RYYA 1EDEA 1YSCA 4RPCA 4Y2SA 1TK3A 1X2EA 4OU4A 2O2GA 4U2EA 1WPRA 3BF8A 2ZYIA 2GYWA 1MJ5A 1TCCA 2C0PA 5AI5A 1RWQA 4FBMA 2HFKA 1BRTA 2VAXA 4KJXA 4H77A 5DYTA 4FOLA 1JJFA 5HZGA 5T4BA 4H7FA 5JAPA 3L1JA 4FLMA 2RONA 3BIWA 4H7KA 5T4FA 1MX5A 1LLFA 4M0EA 2B20A 4BE4A 3NOXA 5DNUA 5C7YA 4RGYA 5HQ3A 4EY5A 1YS2X 2WHRA 1AZWA 3AILA 4IH1A 1ACLA 2C0QA 2XUAA 1TQHA 5I8PA 4H7EA 1VOTA 1H2YA 4JH0A 3DJYA 5FLKA 4H7IA 4EZIA 5FRDA 2QUAA 4MYDA 1MN6A 3L1HA 1YB6A 4A23A 5JZBA 4QZVA 3O0DA 5ALZA 3DKRA 5CRIA 3C5WP 3F8SA 3W05A 3D5EA 5AIBA 1GT6A 5LP1A 3F96A 4Z49A 4E11A 4H35A 4OSEA 4B6GA 2RI6A 4Y2VA 1JFRA 5AICA 5YASA 2QUBA 1ISPA 1LGYA 1VA5A 2XUDA 1QTIA 4EB0A 1MAHA 4QDOA 4CCYA 3QITA 4L72A 1ORWA 1YAJA 2RAUA 4UPDA 3Q8WA 4RE6A 3B12A 2HADA 3EBLA 3FCXA 4QNNA 2WIDA 2O7VA 3QPDA 3UUEA 2W6CX 4G4GA 4HRYA 1X70A 3WK7A 1ZOIA 1DT3A 1U4NA 4CIBA 3C6XA 3WWEA 1BN7A 5AK3A 3RKSA 2G5TA 4K6KA 2QM0A 2QZPA 5A7GA 2JBWA 2XUQA 5KWJA 5AM0A 1ZGCA 1CUGA 2V98A 1H2WA 5CXUA 1UOPA 4PQEA 1W6RA 1IVYA 1CUYA 5CMLA 4MQMA 4BVKA 2ZYSA 5FDFA 4HRXA 1GQSA 1LZLA 4EY4A 4PF1A 5AOCA 3PICA 4WY8A 5DJ5A 3CXUA 1ODTC 2HU8A 4PO3X 5AKXA 2JF0A 1IUNA 4B0PA 4H7JA 3JW8A 1GPKA 4N5IX 5CT6A 1WHTA 1EB9A 3BWXA 3Q0TA 2GZRA 2HIHA 1YR2A 4GEGA 5FUMA 1ZD2P 4BDTA 3ILSA 2PSJA 2Z8ZA 3ED1A 3QYJA 6YASA 2H1IA 4N8SA 2AJDA 4UUQA 1EHYA 1JU4A 4UFNA 1GKLA 5ALRA 2UZ0A 2X5XA 3M82A 2WUDA 2VT7A 1XZJA 3I1IA 3LLCA 1AURA 2Z8XA 3C5VA 4UBKA 1P0IA 4KEAA 3QPCA 5ALFA 1UK8A 3R40A 4BVLA 5JAUA 5ALJA 4W1SA 4MXDA 3G9XA 1EINA 3STXA 2IITA 1AX9A 4DMKA 4UBNA 1QE3A 4KAJA 4UBMA 5ALSA 2OLEA 3WJ1A 5AK4A 4WY5A 3ESBA 2VJAA 2B9VA 4ARAA 2HM7A 2OG1A 1XRQA 4FLFA 4LHEA 4AO7A 2DCMA 4HTAA 5JAHA 3FYTA 4DNOA 3FYUA 5AK6A 1IUPA 3LCRA 5LZ4A 1QO9A 5AI6A 2WHQA 1XKTA 2ORYA 3IUJA 5CT4A 5C8XA 2AJCA 5ALEA 5FXMA 2EEPA 1VXRA 3DD5A 1Y37A 2VA9A 2VJDA 4FTWA 4CG2A 4BBZA 4AO8A 2QR5A 1VXOA 4G9EA 5LZ2A 2JGKA 2Q0XA 1MO2A 2PUJA 4QLOA 1BEEA 5ALGA 4X6UA 1H2XA 1EB8A 1QIKA 3T52A 2QS9A 2HRRA 4CG1A 1SCKA 2PUHA 4WFJA 3R0VA 3ZV7A 2OXEA 5AKHA 3DL4A 4QDUA 5DTIA 2C7BA 3SC2A 1R9NA 2WUFA 1ODCA 1BE0A 1THTA 1JU3A 1H22A 2JGLA 3IDAA 4ZGBA 1HLGA 1TRHA 4P93A 2V9ZA 2FX5A 3HLKA 1E8DA 2WKWA 2V97A 5F4ZA 2WTMA 5KWIA 1SFRA 3FYUC 4U2BA 5AO9A 5A6VA 1QJ4A 1VZ2A 3KDAA 4ETWA 1N8SA 3I28A 4IHAA 3WIOA 4AQDA 3VJMA 2VATA 4BVJA 4UHFA 4ARBA 3A6ZA 3PUIA 1EXWA 2ZJ6A 2HRQA 4J0DA 1HPLA 4A5SA 4DMFA 1EA5A 5LZ8A 2DHEA 3FOBA 1ZIYA 4X71A 1E3QA 4GW3A 3WYNA 2ZYRA 4E46A 4MQLA 4DM7A 5AOAA 2OGSA 4HXFB 5T4HA 4B82A 3N0TA 2Y6UA 5EGNA 1B6GA 2ZSIA 5K3EA 4MYSA 3V1KA 2XLCA 1XQWA 2DHCA 4AMYA 1DQZA 1E5TA 5ALVA 1ZI9A 1F0PA 2G63A 4QWMA 2QT9A 2WJ4A 5AKIA 1ZI6A 2CB9A 4X6YA 5CTAA 3WMRA 1XKLA 3IB3A 4Y7DA 4K6GA 5FOQA 4G8DA 5EHNA 3K2IA 1CRLA 4ZI5A 3BE8A 2JGMA 3WIBA 5HKAA 2EDCA 2WJ6A 1ORVA 1IUOA 2XUHA 1QLWA 3T4UA 4UBIA 1A8QA 3OTQA 3X3HA 2XUOA 3WK5A 5AK5A 1XZIA 5AOBA 1PJAA 2VAVA 3STTA 4DNQA 1C7JA 3WJ2A 1X2BA 2VQ6A 3BXPA 4C88A 3DQZA 2H9YA 3FSGA 2I78A 1XRPA 4AXBA 1LPOA 3LIPA 4FKBA 5ALLA 3AZOA 4Y2XA 3EQ8A 2XQKA 2XMZA 4V2IA 3FCYA 2Y1KA 1RP1A 2XMQA 4QWWA 5KBYA 2OQVA 5ALPA 1LPBB 1VKHA 1QIHA 3B5EA 4N5HX 5BOVA 3LP5A 5ALKA 4K5QA 1AUOA 2HA7A 1QIDA 2R8BA 3PDCA 2AJ8A 3ICWA 4H7DA 5E4TA 3RM3A 5A71A 4Q1VA 4X94A 2XLBA 2ZVDA 4Y2UA 4Y2TA 2I3ZA 2IIVA 1UOOA 3YASA 1L7AA 3KD2A 3R3YA 2RHWA 3DKKA 1ZGBA 4X00A 5D7BA 3S2ZA 2CBGA 3O4GA 2K2QB 2WIJA 3WL7A 1NX9A 4W1RA 5DNVA 4W1QA 1W52X 4OYYA 4X90A 2PSHA 5AP9A 5D3KA 1CUHA 4NZZA 4FMPA 1JKMA 5ALYA 3U1TA 1CPYA 2O2HA 2D0DA 3JYHA 3R3VA 4OU5A 1EK1A 2CUTA 5SYNA 2J4FA 5ALWA 2XMBA 4U2DA 4BDSA 4G4JA 5LIPA 4MWSA 1QFSA 4PW0A 5EI5A 5BWBA 1W75A 3P2MA 5CURA 4CCYB 3D2AA 4Q3KA 3I2KA 5CT9A 3G9ZA 2PVSA 5JD5A 1XFDA 2QJRA 3FAKA 2BCEA 2PM8A 2QMQA 1P0MA 1UWCA 4P08A 1Q0RA 4S0XA 4Q3OA 2OAEA 3DLTA 3E3AA 2ACKA 5LLSA 1XLVA 5ALQA 4F60A 2X8BA 3EQ7A 2OCGA 3PF8A 1XROA 3HYSA 1EH5A 2HA5A 1P0PA 1ZICA 3SWWA 2Z5GA 4QA9A 3I6ZA 1R4ZA 3WLAA 3V48A 2HU7A 3H1AA 2JGFA 3GBSA 1K4YA 3R3UA 1CUFA 3IIIA 1H23A 1JI3A 2ZYHA 3FSGD 1UKAA 4ROTA 1W4LA 3FNBA 1KU0A 1DWOA 4JYMA 1E8MA 5EIHA 4Y2QA 3SK0A 2VT6A 1CIJA 5AI8A 3W04A 3WK6A 5E4YA 4UBLA 1K6EA 2HA4A 1K8QA 5AHXA 3JWEA 3HXKA 4OB7A 3WK4A 5JIBA 3ANTA 2E3JA 3W2TA 2WG2A 1IMJA 4JNCA 2C5GA 2HA2A 4FLEA 4H18A 4KAFA 4ZV9A 1LBSA 3C6BA 4YPVA 2HDWA 4P92A 4Q3LA 1YAHA 1XRNA 4BB0A 2YH2A 5FPPA 5H3HA 2WU3A 3VJLA 5AI4A 5JARA 3GROA 3RLIA 1DINA 1G4HA 5LZ7A 5EHQA 1CUBA 2DQZA 5AKJA 2JGIA 4O08A 3ESAA 3O95A 1Z68A 3G9UA 3GFFA 5HF9A 4D9JA 1Q84A 4H7HA 2DSNA 5ALHA 1QO7A 1O6FA 3HSSA 3R3WA 1A8UA 1EVEA 5K3FA 4BP8A 3FYUB 1UZAA 4K6HA 5AM4A 4YK7A 2GBCA 3G02A 1GPLA 1DWQA 5FPQA 4CCWA 3A2NA 4NS4A 2GZSA 2EDAA 2JGJA 4KE6A 4TPKA 3K9BA 3BL8A 4LYEA 2DHDA 2V96A 1CLEA 4J3JA 2C58A 1BCRA 1FFEA 3WL8A 4J0HA 5CT5A 4KRYA 5JAOA 3FVRA 3WQHA 1N5MA 2OGZA 4LXGA 4B85A 4LXHA 2C4HA 1DX4A 5LZ9A 4X85A 4KYVA 4FHZA 1WOMA 2IX9A 2HHAA 2WILA 4L3WA 1FFCA 3QMVA 2GBGA 3A2LA 2BAGA 4KE7A 3W9BA 4G4IA 2JIDA 5A2GA 1MPXA 1ZD3A 5ALTA 4C4YA 3D3NA 5AKEA 4U2GA 3WK9A 1MX9A 3H2JA 1BEZA 1BS9A 2O7RA 5C8VA 1TCBA 1AMNA 1J07A 2PX6A 3O4IA 4Q34A 3IUNA 1IZ7A 2PKYX 3C70A 3IURA 3R3XA 4LXIA 3G0IA 3NGMA 2FUKA 1Q83A 3EIOA 1CUAA 1YA4A 3HRHA 3G8YA 1LPAB 2C5FA 4B7ZA 4AMZA 4GWLA 3D2BA 5JASA 3KXPA 1A7UA 3O9VA 3MUOA 5J3JA 2P8SA 1L7RA 4JUIA 4DMHA 4JYPA 4EUSA 1YASA 2J3QA 3MUNA 2HA6A 4Y9SA 3SX4A 1HDEA 1DU4A 5AJHA 5JD4A 4Y2YA 5ALNA 2VTVA 2WFLA 1YB7A 3D0KA 4U2CA 1R1DA 2WIFA 4DNPA 1CUDA 1QIJA 1K63A 1SCIA 1UOQA 4WFIA 1HBJA 1S8OA 4FFVA 3PF9A 4ZXFA 5IVHA 4M0FA 1XZDA 3STUA 1GPNA 3VVLA 4QDXA 3QZUA 4E14A 1CUIA 3WWDA 5DYYA 4UHDA 4BZWA 4C4ZA 4NVRA 4L9AA 3R3ZA 5T4EA 2QRUA 2B4KA 1I6WA 3BJRA 3QVMA 3IVMA 1VE6A 2PU7A 4HZGA 2OAGA 4XWGA 2VSQA 3FVTA 4IO0A 4FNMA 5AKYA 1XQVA 1CQZA 2CZQA 1Y7IA 1WHSA 1YCDA 3G0BA 1H2ZA 5I7UA 4UBOA 4WJLA 4DYHA 2PSFA 4UHBA 4PSUA 4G5XA 5LZ5A 3PFCA 1L7QA 1ZIXA 5AI9A 5DWDA 4JEIA 3PUHA 3WWCA 2AJBA 1HKHA 1VE7A 4OYLA 1WM1A 5I9IA 1LZKA 3ICVA 4J03A 4BTVA 1XLUA 3UMJA 2XUFA 2WJ3A 3EF3A 2Y6VA 5CT8A 4RE5A 1R50A 1U2EA 2G4LA 4IH9A 1XZEA 5ESRA 3CCCA 2HA3A 2DFPA 1CUCA 3GZJA 3IA2A 2XUJA 1FJ2A 2FJ0A 5AKKA 4XX1A 1BROA 3I2IA 1R88A 3QBJA 3KWFA 4X95A 1JMKC 2OCIA 2YYSA 2D5LA 3FWHA 4J0CA 3WZLA 1AQLA 3FBWA 2RHTA 1EDDA 3G7NA 3NWOA 2VJCA 2XUPA 1MX1A 5JZ9A 3I2HA 4BCCA 2BGRA 5SYMA 4HAIA 4DSAA 1WPXA 3C8DA 2WUGA 3AJAA 5HFNA 2BKLA 4F0JA 2XUIA 2PSEA 2VJBA 5E2IA 2WHPB 2ONCA 2QJWA 1LNSA 3DYVA 2BUAA 2WIGA 4C01A 3WL5A 3FLEA 2G5PA 2ZJ7A 3WKDA 1BU8A 3BJMA 5D6OA 1EI9A 2I03A 4QDTA 1A8SA 5K3CA 3CN9A 1D07A 3VVMA 5BV7A 3VJKA 1A88A 2PPLA 4BAGA 4RNCA 5AM2A 1QIEA 4BATA 1G66A 3PFBA 4OCZA 5KREA 4H0CA 5DYWA 2J3DA 5EHXA 4K2AA 1PV1A 2QKYA 5EIEA 1DTEA 4PSCA 5HCUA 3H2HA 2VEOA 4MEBA 3OPMA 5HQ3B 4X92A 2RGUA 1SCQA 1JJBA 1P0QA 3D59A 3HI4A 4XVCA 1ACJA 5ALIA 5AM1A 2ZSHA 3WK8A 2R11A 1CUZA 1F8UA 4AZ3A 1XQYA 3I2FA 5EHZA 4DIUA 5A7FA 5CH3A 1EK2A 1UK7A 3HACA 1UKBA 5DTJA 2BUBA 2XMDA 1TAHA 1FFAA 1VA4A 3STVA 1C4XA 4BCBA 1WB4A 4UBJA 4CFSA 3BDVA 4YASA 1C7IA 1MU0A 3AIKA 3G0CA 3DS8A 3ZLUA 5IH7A 4Q05A 1XRLA 3OC0A 4KACA 4EY6A 2WSLA 4CIAA 1CQWA 4DGQA 3WKBA 3PE6A 3VXKA 3TGLA 1FFDA 4X7BA 3TEJA 3DL7A 4W9RA 4BP9A 2I3DA 3A70A 1MAAA 2AXEA 2PSDA 1FFBA 4X3CA 5CW2A 1QOZA 4IH4A 3QM1A 3ZLTA 1NU6A 5AKLA 5E4JA 2BGNA 3F97A 1J06A 2WFMA 2X76A 1QFMA 3G9TA 1MT3A 4B0OA 5JANA 3H19A 5DLPA 4I19A 4AO6A 2XQJA 4WFKA 4B9AA 4KRXA 5AM3A 5JZSA 3C43A 4A16A 1CUEA 5CH8A 1KU6A 3B3QA 3MVEA 4OD0A 3QH4A 1JT2A 1PFQA 4EBBA 1OILA 1GKKA 3V1LA 5IVKA 2GBFA 5K3FB 1LPMA 1UK6A 5AM5A 2DQYA 2H7YA 3KSRA 4Y2RA 3WL6A 4X91A 2AJLI 2VF2A 3ZPXA 1XZKA 2XB6A 3ESDA 3RARA 5IVIA 4J0IA 1TCAA 4DSZA 1BCSA 4E15A 3HC7A 2WM2A 1QIMA 1QZ3A 3AIOA 2PBLA 4OB6A 3TRDA 1AKNA 4C87A 5CH5A 1CUJA 1DX6A 4FNGA 2ES4A 4IQ4A 2ECFA 4B81A 4Q82A 4KE9A 3G0GA 3A2MA 5ALDA 3AZQA 4BC0A 1AC5A 4BRSA 4G1FA 3ESCA 4W63A 3M3DA 2LIPA 2XUKA 1XZMA 3AFIA 1EVQA 2YASA 3AINA 1W76A 4YX9A 4AB1A 5LKAA 2H7XA 3DDUA 3QMMA 2DR0A 1UT6A 4X93A 3FLAA 3VKFA 3PI6A 2WG1A 2XI4A 1CVLA 2ZJFA 4KR0A 3H0CA 3H2IA 1B41A 4F21A 3I6YA 1LPPA 4C89A 3D2CA 2GYUA 4CI9A 4ZREA 4B9EA 1UXOA 1YA8A 4ITVA 3V1NA 1CUXA 3WWPA 1Q0ZA 1K5PA 1ZI8A 1XZCA 2XUGA 2QOEA
chains in the Genus database with same CATH superfamily
2GSWA 1X80A 4BJ3A 4NJMB 4S12A 4YT5A 5IKEA 5HF8A 1OFUA 4EOGA 3VSCA 3RTCA 2CHGA 3C3KA 2FPIA 1KMIY 3JX9A 5FLXA 2OBLA 2E7ZA 3Q3GE 4URVR 1ZY2A 2A5YB 2GJSA 2PKRA 4XR4A 1NMSA 1F7VA 2XAAA 2PWPA 4NECA 2Y76A 2WM9B 2IPXA 2PJUA 2V1UA 2FG5A 4NMHA 1EJ0A 4Q93A 4UMEA 4ENRA 4OJNA 5AJYA 3MB5A 1HNZB 3FLBA 1KVUA 4FHEA 4NS1A 4LDPA 4RVDA 5IJZA 3NVDA 4CGZA 1P5FA 3GAMA 5LOVB 1SK9A 2HTEA 1PJ8A 5FOVA 1KVSA 2FWJA 3P9SA 1BA3A 5GM2A 1UFOA 4H3HB 3E84A 3WMEA 2X6RA 5HKBA 1GG5A 2OGTA 1Q3HA 4CMIB 1OFUX 3OM1A 1RHUA 2HI0A 1SXIA 1DIGA 2VH5R 16PKA 3Q85A 1T26A 4XDYA 4IJ5A 1RM0A 4Y6QA 3A9CA 5EUCA 1RLTA 4JB8A 1E61A 3NASA 1R8YA 4IFIA 5AHRA 2F4VB 4FKMA 3T6KA 2WFLB 1NBME 2HJHA 4OL0A 1GFZA 3ND8A 2R2AA 1UFQA 1CX9B 4JDUA 1J8QA 4PZUA 4XM0A 4BAUA 4D3YA 1JEQB 3IAS6 2Y2VA 2NTYC 1V1MA 3JR3A 4LJ6A 1LBEA 2BEKA 1EFVA 1FFXA 2OFFA 2DY0A 4DMCA 2ZE8A 1L5HB 1FNBA 3R7FA 1GRQA 1T3SA 1T36B 3JQQA 3WAGA 1CZLA 3EOBI 1Z0JA 1Q57A 1P9WA 3HY6A 4EB3A 4LX8A 1OH7A 1XVVA 1XTRA 2H1WA 1SKAA 2YNMD 3P4XA 4JQSA 4JT9A 4QLAA 1WXFA 4ZALA 3T9AA 1RYZA 3VBEA 1BC5A 5CM2Z 1UZUA 3T5DA 3ZBQA 4DRXA 3URKA 2QTTA 3KWJA 4GI1A 4M7OA 1C3VA 5EC8A 5JMPA 1D1QA 5KVQA 1I1OA 1QUFA 2XQGA 3F67A 3PB3A 2JA2A 4EKDA 3ZHRA 1F9EA 4S05A 1G5FA 4CMBA 3CLSC 3LL4A 3T99A 4MYRA 4WZAA 1QUEA 3KUXA 4B6EA 3KYJB 5ILQA 3KALA 3N2ZB 4BV3A 5JO9A 4I4CA 3ZWWA 2DERA 1KMCA 3IEMA 2HMUA 4QDJA 3U4MA 4AG3A 1VMIA 3H17A 2GAOA 4X6XA 3VYRB 2WQ7A 4B79A 4AL4A 4UDYX 3GPBA 3O3CA 1NL3A 1O0BA 1U5BA 1BFUA 2ZU6A 1JXAA 4O2BF 3T3EA 3USCS 3NO4A 4QUKA 5EWLA 4KLZA 4L73A 2HF9A 1CEXA 4BB5A 3BGSA 1U6IA 4X45A 5DGXA 4BLOA 3TZQA 4F96A 1JF8A 5K2OA 4FU0A 2A9RA 3GMTA 3B6JA 4OQDA 3G5TA 3T7KA 1EVZA 3FFWA 4YJDA 1P7PA 4C4TA 421PA 1VJ0A 5JWRA 3GDGA 1SOMA 4KAAA 3CEHA 4L1KA 3EVEA 2GETA 3C8ZA 4OM8A 4UKDA 4LISA 1AG9A 1TJNA 2BJHA 3AW9A 3F49S 3IJPA 3JYNA 4FE7A 1TC2A 4AJ9A 3IO5A 4DLRA 2FR0A 4FFMA 4G0ZA 3WL3A 3EZXA 4Q9LA 1KEZA 2DVMA 1SIWA 4QARA 3V2IA 4RY2A 5D01A 3GLHB 2HX1A 5HJ2A 1AKUA 4DV6B 4CVNA 4FGUA 2P8JA 4FJ1A 1AS3A 2D1TA 2QPOA 1XZPA 4GOXA 3AGQA 1G7SA 1OT3A 3DWGA 1LX6A 1XELA 3C87A 1FSGA 5TT0A 1FP4B 4C0QC 4ZZ1A 2UUAB 4B44A 3AUKA 4J7AA 3O4FA 3EXG2 1E5VA 1QGAA 1HQCA 2DUUA 3OE7A 3STYA 3VHXA 2AVDA 4BVEA 1SXJB 4YLYA 1XAJA 3MLBA 5HF5A 4CN8A 2GA9A 2O6LA 2QLTA 3I9KA 3UFXA 1PJCA 1ZM3A 3P27A 2QJOA 2PT5A 1SWWA 4WZBE 4E5MA 4HJRA 2YOFA 3QELB 3H18A 3UA4A 3VRHA 3DLPX 4XWKA 3QKUA 4W5WA 4XDZA 3A1UA 5CBKA 3PNMA 4C4XA 2LPMA 1X1AA 2VHEA 2YDYA 2VDUE 4AIRA 1TLFA 1ZCZA 4L22A 4FGLA 3RCBA 3A2KA 2JGRA 1O3YA 1TM4E 1OLXA 3QNWA 1NVKA 5G0VA 4DJDC 1DOHA 1MX3A 3CUUA 2QRVB 2JJ2A 2X7XA 3BQMB 1P0FA 2ISQA 1S2GA 3CT6A 4IVRA 5DOVA 1JG3A 1KI6B 2ODAA 3ETCA 4MROA 4UZFA 3LC2O 4BMVA 2JZNA 4HTFA 1S1MA 2W6OA 3TSOA 2AUNA 1ZJ5A 2PEYA 4YRRA 4B2LA 4ZJYA 1K6MA 2GPJA 1NGSA 3LX8A 5DYIA 3WYAA 4JI7B 2Z04A 3RC1A 2F9MA 2QQEA 2OG2A 3ZU2A 5JD6A 4RDCA 4EHBA 4KWCA 3ZNQA 1M1ZA 2NPOA 1AB6A 5CA0A 1IHXA 4RVSA 4EX6A 4F5ZA 1VPEA 4HAUA 3OOSA 3OH8A 4ERXA 2BFNA 2XE8A 4HZIA 4F6RB 3WA6A 2QGNA 4QG3A 1FTGA 2Z9DA 3ZZNA 4HPWA 1KK1A 2VZ0A 5K8LA 3V9AA 1W44A 4HEQA 1UP7A 2R1UA 1E9EA 1E7MA 2PUTA 1P7YA 1WPGA 3FG9A 3OZTA 4X7PA 3TPZA 1O9HA 1ST3A 3JQ9C 2IYWA 3VPSA 1LSJA 3DCJA 5CYPA 1M2WA 3HKCB 5KEIA 5FTLA 1JMYA 1KZYC 4C30A 3VTKA 1UK9A 4A0GA 2ZT7A 1GA4A 1FBTA 1OX6A 1W5SA 2AK2A 1DT5A 2D2FA 1H8ED 5FL7D 4AYWA 2DR2A 2ZUBA 2P2DA 2FPWA 1NZJA 4I4IA 3QKRA 2ZR8A 3UH0A 2BBSA 3IXQA 3ACDA 4YDSA 1YOBA 1USUA 3UZUA 3QEKA 1RIFA 2B2NA 1EVKA 4I66A 3JS5A 2Q2OA 1Q7BA 4AX4A 1Q0UA 5HRAA 4QGSA 4DNFA 3BDAA 3Q9UA 5TDHA 4ZC1A 1KP2A 2BGIA 2PLRA 2XBUA 3DBVO 5LNK1 1GGKA 3IDFA 3Q2OA 1E89A 3STWA 3AI7A 5JPDA 3KFLA 5CXXA 4BFCA 1BSVA 2WM8A 5A3SA 4RVHA 2Y0DA 4P4NA 4Y9RA 5TE9A 5FBWB 4KTVE 3VA7A 2OK7A 5IUJC 1P1KA 1O1YA 4M0DA 1BRMA 1P29A 2D59A 2LV8A 2W6IA 3HZOA 3LPCA 4NYIR 1RI3A 3QHAA 3PFWO 2DBYA 1L5GB 2YC2C 4HDRB 1RCTE 2C00A 2CNWD 4RGQA 4XTRA 3TXYA 3U0VA 5FJJA 4KRGA 3WWOA 4CV2A 2H59A 4O59O 1MNAA 2QV7A 3D5TA 3ZHTA 1F6WA 2CLEB 3CIOA 4OY3A 1R18A 4D4MA 1E7WA 1N2CA 1PS0A 2QLFA 3R6GA 3MFYA 2B6HA 1TZJA 3H87A 3UK1A 1N6RA 2PGDA 4LJ5A 4JX8A 3ZBUA 1V37A 2FNAA 3M6IA 2VF5X 4UAVA 3ZHVA 2Q6VA 2QVBA 4GOKA 1IZZA 1FX1A 4QAJA 3OIFA 3B3JA 1J8FA 4RMNA 4ZQBA 5JXWA 3TDKA 1ZDMA 4FQ7A 4FYVA 4RFSA 3PR1A 1LLQA 4QOFA 4EA6A 1ABBA 2Y71A 4UDXX 3CX6A 4D0SA 1VZ3A 1EDBA 2QXUA 3BH0A 3CLVA 4C4RA 4DMUB 1QVVA 4WEOA 3OESA 2KLHA 5B4UA 1FS6A 3A9RA 1T8RA 4DWWA 3CN7A 4G9GA 3F98A 3NDRA 3NR2A 3KQNA 1JYFA 4ADSG 1ML4A 1DOAA 1U9ZA 5JRZA 4I6JA 3RS7A 4MJ3A 3URMA 4IDCA 1U3GA 4FFBA 3L9XA 4LQLA 1FUEA 4MIOA 5KNDD 4ND4A 4XOUA 3DZHA 3BMNA 4W5OA 2DMRA 1POWA 2I34A 4AXXA 3OX2A 1MV8A 1GUZA 1SG9A 4HCJA 5TGDA 1NFQA 2WUEA 4M8NE 3WYBA 4N03A 4MZDA 4B48A 5L95A 1YCGA 1MC8A 1ZVKA 1MABA 4OI4A 4C22A 2P91A 4ZEVA 1B8VA 3W4IA 3CLRC 4LWOA 4AZ3B 2HRZA 3T9CA 4E09A 1DKOA 2RGYA 4I6GA 4EYEA 5T5QA 3RVQA 4YUWA 2BN4A 1E6EA 2D3WA 1DS6A 1S8FA 4N8EA 4PAWA 2ODWA 4DEYA 1U4OA 3M5DA 4REOA 5WRFA 4ZDJA 2XKKA 1HT2E 4KVAA 5GTDA 5IN4A 2GKSA 5JS7A 1CY8A 1NBOA 4OB8A 4M7WA 1ULTA 3C3BA 3TO5A 5FP0A 2EIXA 2P69A 3Q98A 2H8KA 3LUHA 4X1KA 4BNVA 3WLOA 8AT1A 2WYHA 4D4JA 4M6WA 2OMEA 4UTVA 4LC9A 4N9WA 3E1GA 2DLDA 2GBLC 2QD2A 4BX9A 1B42A 5B55A 7YASA 4B6FA 5JH7F 4LJYA 3F3MA 1IN8A 2I9KA 4B3MB 1EEHA 1J9GA 3VR3D 1NBMD 3GLIA 3ND9A 2FSHA 4OHUA 3TD9A 3BCSA 1JVBA 1RJWA 1XXLA 3D64A 3HBJA 3ZI7A 4DJEC 1UC8A 4ALJA 5BVGB 5KDOA 1KI2A 3FDJA 3MTEA 2YWCA 1IZ8A 2A35A 2PUWA 1JEJA 3H65A 4XDGA 1RKBA 2BLLA 3ZHQA 2QXTA 3P20A 5JRJA 5B6PA 1F7UA 3EVAA 3ZLBA 4B8WA 4WXHA 4ZRDA 1Y0BA 3ZS8A 3KQUA 1OI4A 2QTBA 1C8KA 5TIIA 1L5FA 1J0XO 4LCBA 1GWNA 4W1PA 4ZCMA 1N5RA 3PRHA 1OTXA 2SCUB 3L6OO 4HWTA 4LBWA 5A4KA 3TFQA 2FP3A 4Q4AB 4U4AA 4C29A 5C81A 2OILA 3N7AA 1EE9A 1MAVA 1ZJYA 2QIOA 2HPAA 4UJ3A 4CR7A 3ZIAD 3BMOA 3DYBA 1ZIOA 1QZZA 5EFZA 3DNMA 3HYRA 2BFEB 1U1CA 4Z4FA 3KV3O 4G86A 4XFDA 4FYKA 2JB9A 1XHLA 4EKNB 4BBJA 4GXNA 3P32A 1TQ6A 2I2BA 4K9DA 4QOHA 2BKEA 4NCKA 4BJ1A 3JV7A 3GJ6A 4HUQA 2OBXA 4IDGA 1R7RA 4MPDA 5JU6A 1KWGA 5U4XA 2R00C 3LPMA 1GARA 1Z6ZA 2ZSJA 4HDKA 4JJ7A 4O4LB 4TWRA 4JXZA 4YIHA 2Y8EA 1D1SA 1LUAA 2QD1A 3LVQE 1EUCA 4F12A 4MUEA 2JK0A 1K6XA 4UEOA 4PICA 1JPNA 1IC6A 2RCYA 3VC3A 1WX1A 1Y9EA 2G9QA 4IBOA 5HK9A 4AN1A 1P72A 1E8NA 4EA7A 4A6EA 4F85A 4QXRA 2TS1A 4ARVA 5J59A 1S2OA 3V5NA 3LT0A 2EJUA 4QXQA 2A1TS 5A7HA 3SMVA 4C6HA 1BXRA 4KZPA 4PV7A 3BHMA 1UQUA 1NI5A 1W1IA 1BWQA 1L0BA 2ZIXB 1THGA 2OEPA 3CUEF 3OA0A 1NBIA 1V2HE 2AMFA 3F6RA 4EY8A 2LKCA 3KQTA 1GU7A 3K1AB 1ML3A 2PMCA 3VDXA 4YRSA 2Q3MA 4R7ZA 1N0WA 4UFOA 2LNDA 2X1LA 3W9UA 2CWDA 1BS1A 1CUSA 1G4UR 2HLNA 2HWKA 3ESXA 3NAZA 4QXAA 5CJ2A 1RC0A 1Y7LA 3VMMA 5EWMA 1DWPA 2B61A 2UYCA 3ZU4A 3GVPA 3AR5A 5HNKA 3KVNA 1GVHA 3I5YA 1XA0A 3CMCO 2MSDB 1ECPA 4IDPA 3CSSA 3GGPA 4GPEA 2XWQA 5H3LA 3QEMA 5AR1A 1HKUA 5D3ZA 4WMLA 3MZ0A 1X9GA 2AQIA 2X23A 3MRTA 2A78A 4FFLA 2CKMA 4DCNA 1G59A 1QV9A 1SBCA 1JDBC 2X6TA 3L8ZA 1TTPB 3R1IA 4I1VA 3M81A 4DA0A 1YZHA 4MRAA 4WHMA 5EIAA 1N2XA 5FBLB 2GN8A 4ZWNA 1YB1A 2NO6A 1HL7A 3O84A 2WJPA 2VTBA 1IG3A 1S96A 3C14C 4FCVA 5CNIA 3L7NA 3R3HA 5JSQA 3MD0A 2A0XA 1T6YA 1R9GA 1CNEA 1O03A 2A1UA 1BCSB 3H5TA 4JCCA 5HTKA 4BKPA 4JVNA 1P0CA 3Q0IA 4TWBA 4XOIA 1KY5A 3RH0A 3TUZC 2XD9A 3A3NA 1GSOA 3QPAA 7MHTA 5A9RA 2I2WA 2PYDA 1Y42X 2AE2A 2FRDC 2I6GA 3Q7TA 4OF4A 4PRZA 1E6CA 2GHQA 2PWZA 1XCBA 3P2YA 1PFVA 1TYDE 2PT9A 4NMWA 4XAQA 4F4UA 2WD7A 2WJHA 3IHKA 1ZJWA 5K0BA 4OBWA 3BTSA 1ZG3A 1H9AA 3OIWA 4ZCSA 3U5ZB 2O8FA 1NVAA 4FNOA 4UVEA 3ANLA 1WPRA 2P2YA 2HREA 3L93A 5DT9A 3TF5A 1MJ5A 3B6ZA 3OZSA 3MWEA 5KZMB 1ND6A 3IOCA 3JRNA 3A28A 2I54A 4H16A 3JD3A 3ABIA 3CF2A 2DHQA 3SSAA 4MS1B 5K0GA 1T2FA 1GADO 1F20A 1RWQA 3MTAA 4CDGA 1A69A 2IZ6A 4EHJA 2B5WA 1DZ3A 3HU3A 3CKKA 3AF0A 4KJXA 1W5TA 5JS2A 3EMDA 5I7SA 1QF6A 1UAYA 3FI9A 5T4BA 5CGZA 3IPRA 3FA2A 4DSTA 3CGWA 3LX5A 2QL9A 1S5PA 2P9HA 2AOTB 3TE7A 4C0BA 2JC3A 4JAVC 4UU7A 4V0QA 5DE3A 4YECA 3L8MA 3AYZB 3EGIA 4MMYB 3P4YA 1XTTA 2CNKA 3LUBA 2B82A 4JOCA 1MX5A 1LBQA 1LKZA 1G20B 2B20A 3CPHA 4D6YA 5BN3B 1JTFA 2FOIA 4YQFA 3NOXA 3JASA 2HV9A 4NJOA 5DNUA 4NATA 3IQEA 4DWVA 1HDYA 4C6TA 4CLHA 1I7LA 2VRWA 2UZAA 3Q7IA 3DE1X 1ACLA 4K9MA 5DX8A 3QLVA 4ESHA 2HYDA 4GKKB 1SD1A 5I8PA 3GUYA 4AJ2A 1VOTA 1FA9A 1H2YA 2Q3HA 3C3EA 4KJZA 4CEIB 1SNYA 3QOYA 3DJYA 3NBZC 4EO9A 2CDNA 4KTTE 4EZIA 2EKLA 3REQB 3HS3A 3CJQA 5FRDA 4E88A 4EFDA 2BGUA 2ERXA 4YACA 5FBRB 3L1HA 3V8VA 1ZGGA 3RFFA 1AT1A 2JD2A 3TLZA 3Q8MA 5TB5A 1Q2UA 5AVTA 4MV8A 5FD8A 3U3KA 4AECA 3QUCA 1IXRC 3DFIA 3KHUA 3O0DA 3PXAA 3QLUC 3CF4A 5E6SB 5EIBC 4B73A 1T3ZA 1IU9A 2QBYA 4AKIA 4TKVB 2ENWA 5CRIA 3C5WP 3ONWA 4HKTA 2ZAOA 3C15C 3F8SA 3OETA 4IS3A 4OHFA 2GF9A 2PH7A 4MCJA 4X3PA 1GXSB 1UMDB 1SULA 4O3MA 1PE0A 5TQ2B 5LP1A 1B0ZA 1SU4A 4DMLA 4XWAA 4E11A 2CFCA 1ZMBA 5TC4A 1DBRA 2PZKA 3IP6A 2F8LA 3ET5A 5YASA 4QDKA 1J22A 1ISPA 3QPWA 1CR4A 1YZFA 4NCHA 1YZGA 1I2CA 2LXNA 1MIHA 1OYYA 3CPSA 1TA9A 3EWIA 1QTIA 2RSLA 3L6EA 1QH1B 1ANKA 4DADA 1CYEA 1MAHA 1WD5A 4CCYA 1JIUA 2Z5FA 3QITA 3RIHA 4M53A 3JARA 4M7RA 4UPDA 4C03A 4RE6A 3EXHA 2HADA 1YRAA 1ENOA 3EBLA 5JAMA 2HF2A 4ZRMA 3OHMA 1Z17A 3ENZA 3AUXA 1AA6A 1ID8A 2NACA 3R0XA 4B5LA 1KH2A 1QOPB 2C4NA 3JYPA 3K4PA 1RTTA 4KQ2A 2ZYDA 2JLYA 3RSSA 1KJNA 2W6CX 5M04A 2OKCA 1Y1QA 3WK7A 2QPAA 4R3NA 4HAOA 4YQEA 2Z2YA 1I3LA 5JAIA 5C1IA 4AJPA 2ZRCA 1KQPA 1UPFA 2REQB 2CBXA 3B2QA 2GN2A 2J5RA 3IMEA 3NCHA 3QVVA 4TTRA 4BBAA 3NTQA 1S3SA 4AMGA 2FP4A 1LI5A 1U11A 2Y1FA 3ADPA 1U0TA 3ZVKA 3KQOA 4IJKA 3RKSA 5NULA 4EI8A 2O8BA 5D6NA 2G5TA 2JFWA 3GRPA 3JPYA 3MEQA 5JWOA 3ENVA 1MZPA 4LZZA 3F2VA 3HB0A 2QM0A 1CB7A 3O6VA 5A7GA 3KZNA 1ZN2A 4HQLA 3FHTA 4JBWA 1J56A 3B20A 3NHJA 1T35A 1ZRMA 1I3NA 1QLHA 1C3JA 3A37A 3OX1A 4JOQA 2FR8C 5AM0A 2BCJQ 1D03A 4BQNA 3LCVB 3MPOA 5ABPA 4E1AA 1ESCA 3KJEA 1T8PA 4RELA 1C7FA 4ER5A 2QX7A 2I1QA 3FJ1A 3HJGA 4D46A 3L4JA 2BONA 3TRKA 1W6RA 1TA0A 1PHRA 1V96A 4OVKA 2RARA 5E3JA 1EBUA 3WLTA 4BVKA 5A5DA 2M6KA 3UJDA 1GQSA 1V9LA 1AMUA 2AEEA 1P8AA 2PMFA 1U3DA 2NQTA 2HHCA 3LQ1A 4PF1A 4OHMA 1V5WA 2BP7B 4MGKR 1OUMA 1KDTA 3G2QA 2IGBA 1EG2A 2XYGA 2LDBA 3I73A 3TXXA 3DW3X 3HRKA 3K0EA 1TU0A 3CXUA 4Y9UA 1EK5A 4PO3X 2XD4A 3JZDA 3PGMA 3QLJA 1PT6A 3KOUA 5THQA 4RO0A 5L4NA 4R54A 1CWUA 1EXNA 1EGHA 3JW8A 2HF7A 1TVCA 4UM8B 1C2TA 5JG7A 3TQRA 4ZAWA 3ZV5A 3TL2A 4CNQA 3ESQA 4EWLA 5JJKA 4MVJI 2YVAA 3EZGA 1EB9A 2CV1A 4YALA 3ZHOA 4BV9A 4MQEA 5TLSA 2HJ9A 2GZRA 2ZITA 3ZZUA 3OU2A 4R1SA 1JG7A 1FEZA 1YR2A 4GEGA 3VR4H 4L15A 2J9FB 2NUPA 1WE2A 1IULA 4MPJA 1AUXA 1IEQA 4P54A 4RHEA 2Q49A 2BZ1A 2OHXA 2Z8ZA 4J7UA 3ED1A 1ATZA 4AJJA 1E6LA 3IAHA 2PRZA 1P2BA 2CHEA 4MKGA 5BUZA 2ORVA 3ON5A 4LJ8A 5BNTA 2VCYA 1JU4A 4UFNA 1TM2A 3HU5A 1RM4A 3WMWA 2WSMA 1G0OA 4U00A 3RBXA 4FIZA 2YV5A 1QZXA 4MQ5A 4BX8A 1A9SA 4LSZA 3NXSA 4OQZA 1T5TA 4C21A 2PS3A 2FFHA 1PS8A 2VT7A 2Y99A 1W73A 1R37A 1PV2A 4IOJA 1DKMA 4GPD1 4F1KA 2N47A 4IUDS 1XEXA 1AURA 2Z1MA 2HPVA 3C5VA 3SQNA 3BRWA 2P5YA 3DDCA 3T7SA 4AN4A 1REQA 1C0EA 3OJOA 4WLNA 1IOZA 2BMAA 1BQEA 3WFJA 4IMRA 2INGX 1RBYA 1YCHA 2NZXA 5EKUA 3ISTA 3R40A 4HEA6 4WXYB 2UUPA 2ZZKA 3DB2A 1TUBB 3IBSA 2PX2A 3L1UA 4BO9A 5JAUA 2AR7A 3WGNA 1CE8A 2ZBDA 3EDCA 2IBSA 2OR3A 1ZITA 1ZHOA 3TFOA 3I12A 3P9PA 2R5NA 1IRXA 1COWA 1XX6A 1Z82A 2JLBA 4A9AA 3NGXA 4HDSB 3PFKA 3OKFA 2D6FA 1ECGA 1QE3A 3CRW1 3QG1A 3OBBA 5I8ZA 4KMMA 5KC9A 1C9EA 2R8EA 2IV3A 2VYVA 2BHSA 3OPYA 5ALSA 4YAKA 1HDRA 2VXOA 5BSVA 1U5CA 4YCJA 4AY5A 1BE1A 4YROA 4RKQA 2FRVA 1N3IA 3RUDA 2IHTA 1X7XA 5DMXA 4XB1A 2VJQA 5JBNA 3ZDAA 3W6UA 4L3OA 3FJOA 3VR6H 5JCJD 3CVVA 5FEUA 4ARAA 2V5VA 4QOIA 1Z5VA 4Q1EA 1OC2A 2FPXA 3CZRA 3NTUA 4XDHA 2HK9A 3LOUA 2XV1A 3C98A 3QTTA 1EIZA 3OOEA 2CKDA 5CJJA 1XRQA 4L51A 3DT8A 2J7KA 3BWBA 4FGKA 1X13A 3AB7A 3DAFA 2PAFA 1K66A 3L0SA 3MC1A 4EKYA 1AMOA 5TV2A 4NLLA 3UM9A 4AYXA 1JG1A 1JTEA 1D8TA 3GLUA 3FYTA 1SUCA 2H16A 2IZZA 2CLFB 2FSGA 3D8RA 3IVRA 2KB0A 2XCIA 3BQ9A 4J6FA 5DCLA 5A9SA 1FC0A 3T1TA 1C14A 5BYKA 4M37A 4TRMA 1IUPA 2Z09A 4PYRA 3HU1A 2HT6A 4QHSA 5JYEA 4BXOB 5AI6A 3O93A 4POAA 1X38A 5KQGA 4X1IB 2ORYA 2ZJOA 2EJWA 2R79A 4BNWA 2GUWA 1T24A 4ZPXA 5BURA 1NVXQ 5G4KB 3L6CA 3OJWA 3VPFA 3OZVA 2EU8A 1PR3A 1XP5A 2XODA 4OQYA 4WNYA 2CK3A 1W8DA 3UXEA 3KSZO 1YI0A 3OTOB 3TZHA 3UJ7A 3L3BA 4FTWA 4ML3A 4UD2A 2CUNA 1E9VA 4D3XA 4DHEA 4NCNA 1FYEA 4C9BA 5BN5A 1Y8CA 3DR3A 2RAFA 4MUGA 4P81A 4JYZA 3HVIA 1XMXA 2UZ1A 2W2XA 4IHQA 1ZM9A 1O0SA 1YWGO 3RS2A 1M2VB 3VZSA 1RI4A 4O4HA 2VTEA 3QOWA 4G9EA 1MD9A 3SLRA 5LZ2A 5GADl 1LSUA 3BC1A 1VLJA 4FR2A 1N7HA 3CX4A 3B1YA 3B8EA 4CEHB 1HNWB 1T1IA 1F60A 5JS6A 1UBOS 1RNLA 3LO8A 3K71B 1YZUA 5TQ0B 3PL5A 1DC7A 4RK7A 5ALGA 4BKUA 5FWXA 1KI9A 2ATIA 2X4DA 4M86A 5IPFA 1JFVA 3T52A 3GJTA 4BNIA 1G3IA 4MS4B 1RRKA 2PPVA 1VGVA 3MM4A 1YR3A 5DM60 2ZSUA 1VCHA 3BJEA 3PBKA 1V5IA 2H1LA 4N0QA 4BGUA 2EF1A 2P90A 2D06A 1E7QA 1GGNA 2VRNA 3AI1A 4GVPA 1U94A 3BD9A 3I37X 3MHPA 1CF2O 3R0VA 1M2FA 1WMEA 2FLKA 4TLLB 1TO1E 1F17A 1PW7A 1N4DA 3I6IA 2QTRA 4FW9A 4GM4A 4MUKA 4AQDA 2FDCA 1CERA 4QDUA 1SBYA 5DTIA 1SBIA 3D2LA 1U0NA 3TLBA 1THTA 1JU3A 4PLHA 2JARA 2XQVA 3CB2A 1IXSB 3OZAA 4P93A 1M5TA 1XTIA 4Q12A 1KEEA 4ZHQF 2Q5FA 3KYDB 1GZHB 3OKAA 3KQSA 4DC1A 2HIGA 1TZ2A 2NUTA 1B3RA 3FM9A 3V7UA 2DFDA 2RFLA 4IUBS 4R6XA 1Z25A 3C8MA 2DYKA 1K4KA 3HADA 1NW9B 3QGMA 5KWIA 1L7OA 4QSMA 5F51A 4CTJA 1MO6A 2COEA 3FYUC 2C4MA 2FF7A 2QQFA 4P0TA 1G2QA 4RWEA 4U2BA 4D99A 1VZ2A 3C5HA 4BVBA 3C8UA 5B64A 1YRBA 1ADGA 2JK1A 2YFKA 1Q7EA 1BMDA 3FR7A 5E2AA 3UMCA 4B3DA 4E7OA 4ENPA 4LZAA 1Y6QA 1NW3A 2LCIA 3I28A 5TX7A 2O50A 4WZBA 2V3WA 2J5XA 2O9JA 1N9ZA 1PVOA 3A36A 2F3SA 4WXPA 2ZKLA 1QYRA 2HGSA 2W2VA 1BKSB 1TM7E 4KHZA 4MGYR 3RI3A 2ZBGA 5B5SA 1SQ6A 2LGJA 4XCQA 5CFOA 4QGHA 1UJNA 3KKEA 4BVJA 4UHFA 1E1CA 3PUIA 3BS4A 4AROA 2ZJ6A 3U60B 1FQKA 1HPLA 1GG9A 1RFLA 2IZ5A 1Q1GA 2O06A 3AESA 4ZIRB 1FUUA 5L3RA 1E5LA 3EUWA 4PZEA 2YY7A 5CBPB 5IJ9A 1GFSA 4X71A 3M4NA 1AQUA 1OFHA 1S2DA 1A04A 5H8WA 4J2TA 1B6TA 2OGSA 4WACA 3UQZA 4IUCS 4HAWA 4YVFA 4HXFB 2QLLA 5A4DA 1AO0A 1H3NA 4K8RB 3ZW9A 5IAEA 2XWBF 5IM5A 1CSEE 3N0TA 1ZWLA 2APJA 3KXDA 3HO6A 4FOTA 2X0FA 1I4WA 1OIXA 4QRDA 2P9BA 3SIRA 4OLAA 3I04M 1ISFA 2BCGY 2Q6TA 4URYR 3GA0A 2O8DA 3DBLA 5FWAA 1P31A 2CHFA 4D9FA 1BX0A 5EUMA 3DNFA 5SY4A 4GP7A 4LC1A 1WF6A 5C3UA 5F7ZA 2HBQA 4ZOLA 3VDQA 1N8TA 2XZLA 3GNSA 4D9IA 1ECBA 3ZDXB 3ASUA 1YDWA 3VZQA 2C29D 2GDJA 2FEXA 3B5IA 1X7HA 3H11B 3WLLA 1F0PA 2VH1A 1M8PA 1V25A 3V4LA 2LZ0A 1D2NA 3JVVA 5EEGA 1ZK3A 4LI0A 4FPXA 1GPDG 4WD3A 4X6YA 3A6GA 5CTAA 1U0EA 3ZU3A 3UPUA 3PGLA 3VVBA 1FRVA 3E9ZA 2JLAA 2GHTA 1ZEMA 4G8DA 3S2GA 4IDDA 2R6FA 4BP3A 2L17A 4DY4A 1KH3A 1GAWA 1CRLA 4IV0A 2HZBA 4AKTA 5I8WA 3IT2A 2GKOA 1L4LA 3EZLA 3CTMA 4XASA 2AUMA 3DZFA 5BT9A 3WIBA 5L3SA 1J8MF 1N9KA 1O5IA 3H1TA 3AOEC 5I47A 2VUSA 2I65A 3K9NA 3L4SO 1KO7A 1ORVA 2WJ6A 2O5RA 4CU5A 2HJVA 3E82A 3IAXA 1ES9A 4I1IA 4BLPA 3R7LA 3T4UA 1Y8ZA 3DLAA 2D2EA 1FYWA 3F7TA 1RSZA 3O7MA 1R6AA 1W34A 4BIIA 4TMWA 1IJEA 2JJYA 3UK7A 2PXHA 4DB2A 2HPHA 4Y8VA 5EMLA 3TSCA 4W5TA 1RZ3A 1QS0A 5E7QA 1VI2A 2HQRA 3FPFA 3N0WA 1P4JA 2P4SA 2CLCX 1UWLA 3HPRA 4A0FA 1E9AA 1C29B 3EFEA 4MV6A 2QRPA 1J49A 2LVBA 1M73E 1EDZA 4IIJB 4YAFA 4ZYLA 2IZ0A 1UDAA 1DIRA 2QNIA 2YJGA 5AOVA 3OLWA 1X0XA 4KGVA 4KWHA 4Y6OA 3T95A 5FQOA 5ICMA 3E22A 3N8HA 4KQGA 1YI1A 4MV1A 3U4DA 1VHDA 1XEWY 1JQKA 2Z8YM 3BXPA 1TKBA 4Q03A 3VQTA 2FFAA 1BXZA 1KXJA 3WIEA 4PZYA 4DQDA 2H9YA 1U7OA 4GFDA 3WIDA 1HF3A 1VE5A 4OAOA 2Y3IA 3K0FB 1JQAA 1NVTA 4G0OA 2ZBFA 5F3DA 1JHQA 1DQPA 5EAIA 7MDHA 2OE2A 2VPZA 4RTNA 2VNHA 1F1JA 3QPUA 4L02A 1WSAA 1QQ5A 2XGSA 3R7SA 1ECJA 5KQRA 1UPXA 2XF8A 3RSZA 4CDRA 2ORED 2CGEA 2R1ZA 5ALLA 2QZSA 3I5AA 5LM3A 2CSUA 2FKAA 5CA1F 3FCYA 4O4IF 5KC8A 3QV2A 2FW1A 2QNBA 4Q9AA 3WOHA 3HUEA 1JAZA 1ZS9A 3ZC3A 2J9YB 2X8AA 3IAM6 3HDVA 4H6PA 2XMQA 1IG0A 3TD2A 1ZNWA 4L5JA 3VMFA 4KO8A 1I7QB 5DGHA 3OIGA 2IOHA 1H2FA 3IJ5A 5F3WB 2I7CA 5ALPA 5FA5A 1LPBB 1N1GA 3CWCA 1VQ1A 3HBLA 2IXTA 1Z37A 1TJYA 1WV1A 2HXSA 3NEJA 4D81A 1ODLA 5BOVA 1C5KA 3LP5A 4IZIA 4LRWA 4MQFB 4RNDB 8MHTA 1FMLA 2HA7A 1G8MA 3NI2A 4HGYA 1JI0A 1JWAB 2D74A 2R8BA 5DM2A 2DUNA 5HIMA 3DW1X 3VO1A 4EDHA 1FRQA 1BH2A 1IBLB 3IS3A 3EZYA 5FADA 3WIVA 4GR5A 4KPEC 4HWGA 2QN1A 1GAEO 3RAJA 5AESA 3ZV3A 1D2GA 1R8JA 4Q1VA 4UHKA 4IZHA 2IUFA 5AJUA 5JI3E 2ZVDA 3DEIA 3NV9A 3F8TA 1EQAA 4U1RA 2MR6A 4FEAA 3UT6A 3I61A 2Q1TA 2AXNA 2FEKA 1K4MA 2QRHA 3BZUA 2I3ZA 3DMTC 1T4CA 4HH0A 3OFSA 1L7PA 4P4LA 5EUQB 2G3YA 4HVAA 4CLRA 5D86A 4DR3B 5DBEX 2HSGA 3EAQA 3OZIA 4GLFA 3PXEA 3SP1A 5CLGA 3O90A 4G1EB 3O8QA 2HN9A 4RF3A 5F1OA 3YASA 3WGLA 1IXKA 3DGFC 3HM9A 3IP7A 3NDJA 2N3ZA 2R8RA 4HLUC 4D9NA 3M8KA 2PLFA 4MR7A 4EQ6B 3CR7A 1GZUA 2H54A 5BOSA 5D7BA 3G2HA 2WHXA 1E7RA 5EZ5A 5C8YA 2ATEA 1HZZC 1NJFA 4MWGA 9LDTA 4ALLA 5ES4B 1TECE 3F1KA 3IKTA 3PDUA 1AM4D 2F8SA 1CIVA 2PQ2A 2K2QB 5IHXA 2J67A 2XX3A 2P1DA 4GQAA 2OV8A 2XXBA 3RSGA 1DL5A 2P6MA 3OHPA 1KP3A 1XEWX 4ZT3A 2IEGA 2YV4A 2X5NA 5BP7A 1RABA 2QTVA 1PFWA 2LUOA 2XB9A 9ATCA 3KOYA 2J4DA 3LWDA 3ZE8A 1RC8A 1OFGA 1EDOA 1U3VA 1VLHA 2OP1A 2ZI7A 3JQFC 3CFYA 3OCJA 2IVFA 3GGOA 3PR3A 3R5FA 5D3KA 2BI4A 2MYPA 3SS7X 4E5PA 1C30B 1CUHA 2D00A 3EPRA 5B4VA 4E0BA 4NZZA 4QRHA 1X8JA 1Z62A 1M34E 3D6NB 4MINA 4GS5A 2GEUA 1L4KA 3DDSA 4Y6PA 1PBTA 5TQJA 3FY4A 1HGXA 2YINC 3QQPA 1Y3CE 5EVJA 5FNVB 1V7QA 3WLRA 1OQAA 1DAOA 4BNLA 2IEBA 3BBLA 1SCUA 1B8UA 2O2HA 2JH8A 3PGJA 4LX0A 1M6HA 2ZIGA 2FW0A 4EUHA 3SEAA 2BSQA 4NE9A 2CUTA 2J4FA 1GYQA 4JLMA 4TXMA 5ALWA 5J43A 3A4YA 1I2AA 4LRQA 1T2AA 1UF9A 2XMBA 3H8JA 4ZVTA 3UAVA 3P9QA 3CZPA 3B6IA 4JCOA 1B1AA 5DBIA 3THOA 4D79A 2F1HA 3T3NA 3ZJ5A 1TXGA 4BZPA 3FROA 1ZNQO 4BGEA 5EI5A 4ZDIA 5KOYA 1EXMA 5LA6F 3TR0A 4EL5A 4GSYA 1CNMA 4JITA 1G1AA 4KRFA 4I8DA 3JVUA 4GKAA 5IK2D 1MORA 1Z2DA 1JQ5A 1S2NA 3OAAA 1R0RE 5EQTA 1PD1A 1UEIA 2P9YA 1IY0A 2WPNA 3N6RA 4GAEA 4CM5A 1XQ9A 1BDJA 3AEYA 3PC4A 1FJGB 4A7PA 3BB3A 1A9TA 3RAFC 4KIGA 4Y18A 1ZNYA 3Q3HA 4CW7A 2J5QA 1LDGA 2ZJ3A 3TQHA 4NU0A 4MGZR 2NZYA 1IONA 3MOSA 5J2UA 5ICFA 5JD5A 3GT7A 4PLFA 1NLUA 4E51A 1ICEA 1Y89A 1XL0A 3EH2A 3UC5A 1PD0A 7REQB 5B2FA 4FP9A 4I1PA 1JTVA 1NIJA 1Z4QA 4HH4A 1XPOA 2TMDA 1K8YB 2O1EA 2XA1A 3JQGB 1N5JA 3D7MA 3K05A 3S1AA 2VZLA 1I7SB 1Y8AA 2ZQYA 4P08A 5CVJA 1Q0RA 1U2RA 1E2DA 3B1XA 4AS2A 2QUJA 5G0TA 5IXYA 3K70C 3GAAA 5KOJB 4TKUA 5DKFA 1D6JA 1E1YA 3IP1A 3O8LA 3IXMA 3A7DA 3DLTA 3AB3A 2ACKA 4E5SA 4IY1A 2F00A 3N8GA 5FEMA 1E0DA 1EWYA 1WW3A 2O0MA 5THKA 4F60A 3M6VA 3SYMA 3RHTA 2A3RA 3PJDA 1YQUA 1W49A 3HVHA 4UNIA 1IPEA 1NFFA 2TRSB 2DEUA 2FW6A 2O19A 1GR0A 2BDTA 2QLNA 3PF8A 3CZ9A 1ADBA 3HKDA 1XROA 2C3UA 3HLYA 4YCLA 1AKYA 1MXHA 4EJSA 3AHIA 2HA5A 4BVFA 3FVVA 1W5FA 4Q5IA 4CHGA 1P0PA 4DEXA 4Z7OB 1KQGA 3QVSA 3GDWA 1A5BB 2PH1A 4N7BA 4PRYA 2EGHA 1ZH8A 4W9NA 5FOUA 4DVGA 2EGGA 4QUIA 4DLXA 3H1AA 3KXLA 5KX5A 3KPWA 2UZ3A 1IN4A 2FZVA 1E1QD 3WR5A 2I4RA 1DAFA 4FI3F 2CUKA 1F2UB 1SH7A 2O0KA 2M9MA 2YVUA 5GIOE 1Z83A 1WNFA 2NV6A 4ZVVA 3WHLA 3IHTA 4N54A 2YXLA 3SZOA 3FNQA 3PA8A 4I4TF 3FNBA 4V2UA 4CF6A 4BPBA 1V8BA 3CG4A 4ZAGA 3PYMA 1KO1A 5FX2A 1YIOA 5E4YA 4HB4A 3OQPA 4P0PB 2YIVX 3DM5A 3LY5A 3VR4D 5BMVA 1UIRA 1K8QA 1Z5ZA 4R71A 2IHBA 3CTPA 5AVVA 3QJ5A 3EDQA 5C5DA 4RJKA 4X1YA 3HXKA 2J8ZA 4Q7EA 1ZINA 2CYCA 2IU3A 4LFBB 3ZVRA 4OB7A 1GPAA 2MDTA 3ANTA 2VS1A 1GA6A 2O2ZA 1NVVR 3BSFA 3NDIA 4BNKA 1GUDA 1N8KA 4ZVQA 3DPUA 1L5YA 3K15A 2F3TA 1IY1A 3OIVA 4H17A 4I1RA 4KAFA 4WCFC 1ZGHA 1JDUA 5CLIA 4DGSA 2EERA 3JWPA 3P0FA 4XA8A 3CB4A 3IAAA 4HFNA 1SBZA 2GZAA 2I6QA 2IRWA 3KCQA 4EYQA 1USIA 4DIKA 2I1VB 1YAHA 4N3CA 4EJ0A 2W2LD 3GR6A 1A27A 4BB0A 1YBFA 2V7GA 1MF7A 2A58A 3LT5A 4LGYA 1RQGA 4YRDA 4DRXB 1OFTA 1E6KA 1EZZA 2GS9A 2WU3A 2WFAA 4L9SA 5F76A 3ZBTA 4N41A 5AI4A 4JI4B 5EYPA 1DADA 3GROA 3M70A 2IELA 5EQJB 1G4HA 1SU8A 3JQBC 5I9NA 1H0HA 3TI9A 4RTKA 1YONA 3UBMA 2ZE7A 4M87A 1CUBA 1YDMA 2DQZA 4JFRA 3HVUA 4WAUA 1P3DA 3AV3A 1UBCA 1TK2A 1FP1D 3QP9A 2JGIA 3RC7A 5FWYA 2P27A 1BEUB 2R6GA 3NHZA 2C82A 4Q4DA 3QF4A 4G56A 4UOZA 3LUGA 5E38A 4EG6A 1OVGA 2QU8A 2PO5A 5D1NA 5EWLB 2G9VA 2I22A 3VR6D 4F4JA 1IBSA 1RCFA 1YKFA 2AFIE 1Z4NA 4AIIA 2G83A 1JB9A 1MPTA 3IDSA 5B58C 4D9JA 2WF5A 2DSNA 4TMVA 4XH9B 3FTQA 4M21A 3PQDA 1UODA 3BHIA 3RS9A 3R3WA 3HSSA 2W93A 4RF5A 1IFXA 5EJIA 3VSAA 4IW3B 2E21A 5EKDA 3PUWA 5GONF 3N8DA 2QJFA 3BXEA 4EUKA 1P5RA 1B3BA 4HGZA 2G7ZA 1LI7A 3I32A 3O1HB 3P94A 4FD3A 4L4RA 4PHFA 4U9IS 5F1KA 4ZEXA 2PA0A 3AWIA 5IJXA 1II8A 3E2MA 4KQWA 5GMOA 4KR6A 1TK9A 4PIPA 3SLKA 1RJGA 1Z6GA 3B6MA 4K6HA 7ADHA 2JFBA 3D5QA 3ZCQA 1N2EA 3NM5A 1T9CA 3U09A 1RVV1 1AO3A 1I5OA 1BJKA 1R0SA 4Q39A 3IEIA 1SCJA 1YA6A 2FF5A 3AL0C 1GPLA 3P0HA 1K0FA 4KWIA 4BGDA 1KI8A 4MVXA 1L4MA 4OTZA 4C3ZA 1EFRA 1KNXA 3BE5A 3A2NA 4TWJA 3QVWA 5JQGB 4NXNB 3CVWA 5CUQA 1MAUA 4NS4A 4LRXA 4RH1A 3O73A 2Q3BA 2J1LA 2BMVA 3A6HA 4KE6A 4WLEA 3ULKA 3M3PA 1OOEA 1G9SA 1O94A 2CCGA 1QQ7A 2GT1A 4D25A 2E4AA 3KCNA 3ZNNA 1SPXA 3FGZA 3ETLA 1E60A 1N2OA 3LUPA 1VRWA 4TLMB 2VDMB 2FRXA 3L07A 1CLEA 1TTHA 2AG8A 3HL4A 1CS0A 4ZT4A 1H4VB 4DQKA 3VJRA 2Q50A 4O2AF 2WTXA 1GTL1 2AN4A 1IQPA 1MRNA 1OXBB 1BCRA 1FFEA 2CVZA 3DAPA 4QYIA 1I0ZA 4J0HA 5LCXA 1KO5A 4V1CA 2PWBA 5JAOA 1OLXB 3FVRA 1M5RA 2DPGA 4BJ5A 2NVOA 1K1EA 5B2EA 4LXGA 3L04A 1M10A 3JVEA 4H7PA 3K2BA 1YDFA 5CPBA 2CLKB 2I2FA 2Y93A 5HW0A 2JAPA 4Z53A 1DX4A 3PVSA 2GOYA 1PL0A 3GN2A 4KYVA 3CKMA 2PAAA 1O9GA 2WILA 2XCQA 3A6LA 1NPTO 1RJDA 2ZDGA 3BSYA 3GFBA 3JQDA 4J8PA 4JJZA 1FFCA 1WMDA 3G2OA 4YJ2B 2HNBA 3K0HA 3KZOA 1ZO8A 2WYUA 5DZSA 3W9BA 1QH0A 1RS0A 3H05A 2W2QA 4G4IA 3AVXA 3VZPA 4RKFA 2FQWA 5CK5A 3PV0A 5C2JB 1TTQB 1WKBA 2XNCA 2B0CA 2GR9A 3A05A 4OXNA 1EFDN 3D6VA 1K7SN 3PXXA 3BHJA 3CF0A 1E2JA 1PX0A 4MKIA 4X8OA 2RB4A 2ZETA 4TKZA 1YOVA 1UR5A 3C7CB 1OKKD 4L7QA 3RRBA 2ZTUA 4CMKA 4B31A 3G7UA 3LC7O 3E3MA 1R0BA 1UANA 4CL0A 1KWKA 3W5DA 1G8JA 1BGWA 1J07A 3HO8A 1JE1A 2FQYA 3KLNA 3O4IA 4FGZA 1ZMOA 1TFUA 4MR8B 4RHUA 2Q6IA 3C70A 2JLRA 1YR9A 2OLJA 4FR5A 2BYTA 1VP9A 5JDIA 2W2MA 3NRBA 4JEUA 4LXIA 4TLEA 2WF8A 3TTWA 5KQPA 4UXHA 5I48A 3VU9B 3WSWA 1JEYA 1Z6QA 2OLKA 4GKBA 4H6VA 1G7TA 1L3IA 1M6VB 1PG2A 2ZANA 3MJ4A 4FC7A 4OBXA 4Q6WA 2YQ5A 4X41A 1YA4A 4XYLA 5ERXA 3RNOA 1AIPA 1Q74A 3HRHA 2D1YA 4JXJA 3NHAA 1DC3A 1QGUB 3QTBA 1ZCJA 5CAEB 3PA6A 1DUIA 2EFJA 4A2CA 2H4ZA 2P3SA 3WRXC 2O3RA 4AMZA 2XW6A 4KW7A 3PZBA 4ZI7F 4NK5A 3KXPA 1I33A 2I7TA 3WFZA 1F8FA 5LJIA 2NZJA 1BTOA 2AN9A 1QE0A 3R44A 1TEVA 3NW9A 4YQZA 5F2NA 5CD1A 1LU9A 1ZU4A 1ADFA 1X92A 2NO1A 3RYHA 5C7LO 1G8GA 621PA 1N2CB 1OGIA 3UWPA 1Q7RA 2LIVA 2XADA 1WXXA 5DO9A 4F4IA 2CUZA 2MTBA 3ZUPA 4B47A 1U7UA 2BM8A 2J9XB 2P3LA 2RK3A 2ZKIA 3U1VA 1H0SA 1A1VA 2Z6AA 4KFUA 4TQ9A 4MMZB 5D8DA 3ZQKA 1YASA 4LHVA 4XYBA 4R8LA 5DB4A 2J3QA 1VKRA 4HZUB 3JQAD 3MUNA 4IILA 4LZPA 4DAOA 5A4AA 1CZRA 3RJTA 3GZTB 2ERCA 4JA2A 1QX4A 4PQRA 1WBDA 5AJHA 5DGTA 3RHFA 2FXIA 4FEGA 2P3QA 4K6CA 2PFGA 3RTEA 5FLEX 2P6RA 3E6AA 2R5FA 3SBXA 3ROQA 2ONKA 4OI1A 2BE7A 2R8XA 2EKBA 2QLJA 4U2CA 1UEJA 1SKMA 3LWBA 4C76A 4P84A 3IIKA 4FFBB 1SXPA 1DWUA 1PFYA 1HT3A 3IPCA 1QHHA 1MEJA 3S27A 4ENQA 4DNPA 4XVUA 1Y4UA 3DAOA 4MDFA 1N7IA 2YC4C 1CUDA 1I10A 3BULA 4PBTA 1VCIA 3TD6A 5HQTA 3HA7A 4GP6A 4LOAA 1K63A 2WYVA 4A0HA 3OIDA 3LCCA 3D81A 4Q9IA 5L3VA 3P5SA 4B3BA 1MABB 2IYAA 1Y81A 5F5LA 1CQPA 4XM1A 3OKPA 5REQB 2PBRA 3R5KA 5JPCA 1PDOA 4FFVA 4QUHA 2A9KA 4U7TB 2RGNA 2CXUA 2GF0A 4DV1B 1T1GA 5DN9A 2FFJA 1M0TA 4WGFA 3ST7A 2VSXA 1GRNA 3X1YA 1XZDA 3IV7A 4MO2A 1GPNA 3STUA 3VKGA 4E14A 2RBGA 1DJMA 3WWDA 5LLDA 1E3IA 4BZWA 4TKLA 2BDEA 4LYFA 3W7VA 3OLQA 4TROA 5JZVA 4DHWA 3L8GA 1BMFA 3HCPA 1JDJA 1F38A 3RSFA 4E7PA 4BU0A 1S7CA 3R3ZA 1SHJA 1Q20A 2QRUA 4DA9A 4ZTUB 2X77A 3QU9A 2E4XA 2PVCA 2W2KB 5B6IA 2GO1A 4YRIA 5B30A 4BRWA 4NPCA 2Z83A 1K8XB 1MQSA 2OAGA 3JAWA 4HZGA 4PG6A 2Q1WA 4W8HA 4ZOEA 3Q12A 3ZW8A 2VSQA 4PLCA 5HMMA 2UUCB 1RI2A 4TXLA 3K20A 4FNMA 4N3GA 2LE0A 4A3SA 2R9VA 2XRYA 3LXRA 5EP2A 2YJZA 1P8JA 2HNKA 5A4FS 3FCAA 1DO2A 1CQZA 1EAYA 2HCFA 2FZWA 3LUDA 2CZQA 2DPHA 1Y7IA 5CJPA 1JVNA 2I66A 5FO1A 4TT8A 1QCDA 1RBZA 4HO1X 3TRHA 3VAYA 4XIYA 1AK9A 5DNEA 3HZRA 5KYVA 3RSLA 2PSFA 4DYHA 3DKVA 1HH4A 1OWPA 2WP8J 1DRWA 2FN7A 3CUYA 4JGGA 1U2GC 5AHKA 4HNUA 3K9FC 3VKUA 4BFSA 3U7GA 3PFCA 1KI3A 3L4KA 1K7FB 4QREA 4JJAA 1T15A 2PS9A 4IHKA 4IMIB 4GX0A 4ZN6A 3G2NA 4R16A 3NYWA 4WKGA 3PEUA 4ZARA 2AJBA 3SQLA 1KRWA 4LXQA 5G0SA 3PE4A 1FP6A 1KFKB 1WM1A 2P77A 2QVZX 2VO1A 4KWEA 3ICVA 3ZWXA 3GD7A 4J03A 3GMDA 3PX7A 3LQFA 1DG1G 1XLUA 4CEJA 1JIXA 2XUFA 4ZVOA 3GA5A 4MI3A 3VOSA 1LSOA 3QYAA 3TNFA 1DJPA 3ZE6A 3ZKAA 2IS2A 4HUQB 5CT8A 3TKYA 5EIWA 2H0RA 4RE5A 4DF3A 1AXGA 1KZ9A 1U2EA 2CLOB 2G4LA 3SCZA 1XZEA 4BQFA 4HDKB 3M9WA 2O52A 2XVYA 2AOUB 1WSDA 1EUCB 1SUBA 4U3JB 1IY9A 3EA0A 1FDIA 4M9UA 3TGWA 2Q7DA 3RVDA 1U0HC 1AZTA 5EZSA 1I3KA 1OHHA 2H2HA 5I9TA 3UK0A 2HPZA 4DKJA 1QHGA 1ZRNA 3OQHA 5DH9A 4MPPA 2C4UA 2O8EA 1DC5A 2L2QA 5BW6B 3J7TA 5HJ5A 2VP4A 4MO9A 2YJNA 5LYJB 1GTRA 3VZRA 2QB5A 4MW4A 4H4EA 2Q7OE 4N5MA 1UBUS 1TQ8A 2Z95A 2Q6OA 3MTIA 4LGVA 3K8ZA 1JYSA 2ZI3A 3I39X 1ZGZA 1XFAA 3KWFA 2MT9A 4X95A 2IV7A 1L7BA 4X66B 4ON9A 1A71A 3PDWA 5DX1A 4CG0A 5BVHB 3CUKA 5T8KC 3JATA 3DC7A 1W59A 3ORQA 4F4FA 5MFZA 2O2JA 4W5JA 3GG9A 2ZREA 1G2IA 2I87A 3CC8A 4BO3A 3DLBA 3RAGA 3ZY3A 1PNVA 1GKIA 3AUYA 2UUBB 1U2QA 1CY1A 4FMDF 5DCWA 1ZL2A 2JLVA 3BBPA 2X0DA 1NN1A 4EX7A 4QTYA 3I2HA 1B43A 5K03A 2HLDA 5C5CA 3PNSA 1YJCA 3VNSA 1D2CA 2H1VA 2KHZA 3C5CA 1CHNA 3MJFA 3DDHA 3C8DA 3PQ4A 4DT1B 2WUGA 3DZCA 3FTPA 1Z12A 2BKLA 2YRFA 1NE2A 1Q91A 2ZQ5A 4BX2A 3REOA 1KA9H 2XUIA 4QKQA 4G3XA 1C4OA 3G3EA 2DJ5A 2QM7A 5DWVA 3V7FA 4RFLA 4BNHA 4D0LB 2ONCA 3KKKA 4NONA 3Q7PA 4R8KA 3C4QA 4YJKA 3WO1A 4AJ4A 1TEZA 5TVGA 5JSZA 2C59A 3OMWA 3E7XA 1LWNA 4IGAA 3ZJYA 2A5GA 2WIGA 1W6UA 2AC7A 2BF7A 4DE5A 1O8CA 2BMEA 1HFKA 5EHGA 5L3QA 3REFA 1SXJC 3BJMA 5GPBA 4R0NA 1EI9A 2QLMA 3U4CA 3GDFA 2HQ1A 3DOEA 3SHFA 3GEPA 5AVJA 5IT4A 1XKXA 2K6GA 2YXEA 1ZH6A 3DV9A 2PJZA 4KXLA 1D07A 1X42A 5ITSA 2PKQO 2P3OA 5BMVB 4MJXA 3PFIA 2QVYX 4EEXA 4YDHB 3RBVA 1H93A 2WD7B 1A88A 4K28A 3VJKA 1WRBA 4BNNA 2Z58A 3VX3A 4CKWB 1QWOA 1FYVA 2J9RA 2OZLA 1EK0A 3DUFA 3FX2A 4FHDA 4JS0A 4YP5A 4BO2A 4Z7NB 3BK1A 2X2PA 4KN5A 1XKQA 1XK6A 2I1WA 2ZCVA 4KBGA 1OXUA 3EIFA 3DV0B 5CB6A 1VL1A 1GUFA 4EI9A 1NG1A 5ARDA 2RGDA 3ICPA 5JXJA 3M4ZA 3DXZA 4ZEMA 2P4UA 3WLMA 1KAEA 1SUEA 2J3DA 3VH1A 3H9CA 4CN9A 1L7NA 1UJMA 1RW4A 3L0CA 2W2LA 5J2TF 1C8LA 1J20A 1T4GA 3NWPA 4LZNA 1SCNE 1A2QA 3FWZA 2A5DA 3BM5A 3ZWPA 3MQ2A 2FEMA 3N2EA 4M1KA 1AH2A 2PZ8A 1NNLA 1ZHFA 2HF8A 4ALKA 5EIEA 4D4LA 3V42A 2ID9A 1IN7A 2Y9MB 4PSCA 4AJ1A 3W0LB 3ZGLA 4GF5A 1FIUA 1NOKA 4REMA 2QM8A 3PWZA 1JGTA 3EPKA 4X92A 4K6FA 5F9MA 4PPYA 2Q3CA 3K73O 1SCQA 1P0QA 4L76A 4M9SA 3D59A 2QA5A 1TJ3A 2WF7A 1P7VA 1NVFA 5ALIA 1ZOPA 1WSBA 2A59A 2BIFA 2QUZA 2O0JA 3K7EA 4OH7A 1BXKA 1ULAA 3QVKA 4YGYA 3WK8A 1FNDA 1AGPA 5HKKD 2I2XB 3FPBA 2I4IA 2PRIA 4IYRA 2V74B 3BREA 3GZNA 5DDIP 1J9ZA 5NLLA 2R44A 4GRIA 4KR9A 3TTYA 4PR0A 3VR6A 3ZBPA 4DIUA 2EFGA 5CH3A 4Y6RA 3EF0A 1UK7A 4PO9A 8GPBA 4FKZA 2JNWA 1Z7GA 3Q0EA 1NWCA 4QPNA 5CEEA 1I24A 3DT6A 3DHWC 3DT9A 5JISA 2SKCA 4BU1A 2Q1XA 3E35A 4TLAA 4FDVA 3BDVA 4YASA 3GQBB 4BQIA 5U1PA 2WTUA 4B3HA 1DFIA 2IC5A 4G36A 1JHVA 2ZIZA 4LNHA 3G0CA 3SXJA 3U4QB 4KXXA 5KI6A 1P2UA 2OV1A 3BJIC 4GM1A 3FB4A 1RR6A 1X1EA 3EHEA 1T6ZA 1Z7YA 2F3RA 4FDUA 2RB5A 4G2TA 1JECA 4YCDA 3QWFA 5G53C 1R10A 3Q11A 5DI3A 1D0SA 2YWDA 3OQIA 4LHSA 3MTGA 3W6ZA 5A0TA 4GBJA 5HM6A 2NSHA 1XRLA 1S01A 3HVKA 2JASA 1NVGA 4KACA 4E12A 4EY6A 1L9XA 3AKYA 2D3TA 4OXIA 4HGNA 2BHLA 2Z30A 2PFKA 3Q72A 4UUMA 4EHKA 1ZONA 4YCAA 1TTTA 4BNXA 2PUEA 1Z16A 1D9ZA 3IP3A 4IHJB 5KDDA 4XLLA 2R47A 2VQEB 3BILA 4BX3A 3THYB 1W0JD 1CQIB 3I04A 5BWOA 3SR3A 3Q1LA 1J25A 4X0EA 1RAFA 1NTRA 2V3CC 4M7PA 3TEJA 3N8NA 3Q3IA 2Y1LA 3RK0A 4W9RA 4AZVA 1MAWA 2VTDA 3BSSA 5AVOA 4EW6A 5DVZA 2IOFK 1B2RA 3A70A 2PO7A 3IPXA 1TZCA 1U81A 4X3CA 4ALMA 1KOJA 4PYNA 3CLUD 4CMEC 3IYLW 3WISA 3WNDA 1GV1A 1VE3A 3A0RB 4HN4B 3C0KA 4DEVA 2ZR0A 1FTSA 1QOZA 1TW3A 4QU0A 2QE6A 3QM1A 3RSQA 2CSXA 4R98A 1NU6A 5K20A 1Z4PX 2TECE 3A1CA 1P3Y1 2ZM5A 2BGNA 2OV6A 3L4BA 4NX2A 4NOLA 1JHDA 2I55A 3ITDA 4K0KB 4DY6A 3I9LA 3UJ8A 3KSDO 2X76A 1QFMA 1UBFA 2QN8A 1MT3A 3E2IA 3ICOA 3MT0A 1A97A 4H3KB 3T8YA 2JAXA 4TV9A 2O3TA 2XSZD 3H19A 1N7JA 2GJKA 3FI0A 1PQPA 4AO6A 4JXKA 3KR1A 5AW5A 3TXAA 4KXMA 1M34A 1RI1A 4I2VA 4P5EA 3BHNA 1NHGA 4L6AA 1N5IA 4O1MA 1I5RA 3RU7A 1YC5A 3RJMA 2WSYB 5ELXA 5IEBA 1PL8A 4LK3A 3I3OA 5JVDB 4KRXA 1VKJA 4EFLA 4O4IA 4GE3A 2JI6A 4QUEA 1PTJC 4H6WA 3WIUA 5JZSA 1Y9ZA 4YFVA 1KKUA 4XSHA 4ZO4A 4OL9A 3CVYA 1HXHA 3GL9A 2C9YA 1Z5OA 2QY6A 1B0UA 4O3FA 3B3FA 1KU6A 1V5FA 2R1VA 4KNWA 4F8EA 2X9VA 1XVLA 1LXCA 4QRIA 4GSKA 1GUYA 2A9VA 3OZBA 2UUOA 1JT2A 3CEAA 3I8OA 8ADHA 3BWCA 2ZOSA 4MUJA 1GKKA 4HQFA 5FUBA 1TVMA 3ZJ4A 5K0LA 2Z8YA 3VHLB 2Q0HA 2BISA 3RFTA 4BN0A 4M1ZA 2R8YA 2A5FA 1PWXA 3L0YA 5IVKA 1LPMA 4ZU1X 3UW3A 1NDQA 1S6YA 1OW3B 2C1ZA 5TPZA 2FSVA 4NCJA 4C0WA 5B3LA 2CEAA 3UY4A 5IXJA 1M83A 3RVPA 4MAMA 1W88B 4PC7A 2ZJ5A 4TRJA 4Y2RA 3WL6A 3MA0A 3CUWA 4FFDA 1JILA 2AJLI 1OXXK 4PTYA 2HEGA 2VF2A 4LOIA 3ZPXA 4I14A 1PDVA 1VE1A 4FS8A 4MV4A 2Q5CA 4ZVLA 1RD4A 3DBHA 4RULA 1W36D 4LQ4A 3AF5A 1YHNA 1BMQA 1P45A 2QRMA 2WWVD 1BHQ1 1E0KA 5LXTA 1PSDA 5AXAA 5F21A 4EY4A 4U0KA 4G65A 1ZNXA 3ZQ4A 1HYGA 3F7OA 5FI0B 3ROTA 1IQUA 1SUWA 5T6MA 2G9NA 3A31A 4HXYA 1WXWA 3OIUA 3RODA 2WM2A 1QZ3A 4OX9Y 2QVLA 3I9V1 3JQAA 4DSOA 1JKXA 5CH5A 3BXGA 2EXXA 1E4EA 2VJOA 4Z0HO 5GJVC 1Y82A 2RJOA 4EK9A 1XEXB 5I9LA 2ES4A 1SQSA 1TZBA 3SOZA 1REQB 2GARA 4IQ4A 2AFIB 5BV2P 4IGFA 1PR0A 3LGSA 1ODJA 1WQ1R 3CNBA 5A5FA 3FWKA 5FH9A 2YNMC 4AP9A 1G6Q1 1BYIA 2ZRPA 4J9VA 1FNCA 2CXNA 2BFPA 3PRJA 3L0IB 5CDTA 1AC5A 4RK1A 4XD7D 1PK8A 2CXOA 4G26A 5EG5A 4N0DA 3IQWA 2GPAA 4W63A 3ZI0A 4BRSA 1KEKA 2LIPA 2XUKA 4FCCA 3WHPA 3TQIA 4YP0A 5KTYA 4JV5B 2A7QA 4CDMA 2V8OA 1XZMA 3AFIA 2JAWA 3NYIA 1X8KA 2P9EA 4UE6A 5GP1A 5CDYA 1J1ZA 2VHVA 1I2DA 2WAOA 1W76A 2GMWA 1SVMA 2FPOA 1NQWA 4YX9A 1W5BA 3N53A 1LS1A 5IDYA 2D5IA 4W5NA 1P1BA 4XXHA 2YVKA 1XTPA 2AXPA 3DDUA 4ISBA 3RIMA 2FWPA 3EMBA 4AFNA 3SLGA 3R6DA