1Q0RA

Crystal structure of aclacinomycin methylesterase (rdmc) with bound product analogue, 10-decarboxymethylaclacinomycin t (dcmat)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
297
structure length
297
Chain Sequence
SERIVPSGDVELWSDDFGDPADPALLLVMGGNLSALGWPDEFARRLADGGLHVIRYDHRDTGRSTTRDFAAHPYGFGELAADAVAVLDGWGVDRAHVVGLSMGATITQVIALDHHDRLSSLTMLLGGGLDIDFDANIERVMRGEPTLDGLPGPQQPFLDALALMNQPAEGRAAEVAKRVSKWRILSGTGVPFDDAEYARWEERAIDHAGGVLAEPYAHYSLTLPPPSRAAELREVTVPTLVIQAEHDPIAPAPHGKHLAGLIPTARLAEIPGMGHALPSSVHGPLAEVILAHTRSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aclacinomycin methylesterase
publication title Crystal structure of aclacinomycin methylesterase with bound product analogues: implications for anthracycline recognition and mechanism.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Hydrolase
total genus 105
structure length 297
sequence length 297
ec nomenclature ec 3.1.1.95: Aclacinomycin methylesterase.
pdb deposition date 2003-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1q0rA00
3G9ZA 3GELA 5ALVA 4FFWA 3HLKA 3TJMA 2CUTA 4UBOA 4FTWA 4FMPA 3QYJA 1SC9A 2Z3WA 1CUUA 3F97A 4A23A 1F6WA 2PSDA 2VT6A 3F67A 2WUFA 3U1TA 2QTBA 1CUHA 1BN6A 5A7HA 3TRDA 3C8DA 3FBWA 4Y2VA 5FKJA 1XZIA 3JYHA 4YPVA 3W9BA 3KOOA 5IVKA 1MX9A 3LP5A 3ZPXA 4QEKA 3IDAA 1YAJA 1R1DA 3OG9A 4AQDA 2ZYRA 4AN0A 5IVHA 5ALUA 4WY8A 3DDUA 2VJBA 4H7EA 3I2KA 2PSJA 3C70A 2Y2VA 3C5VA 4B83A 2D0DA 3VVMA 4AZ3A 3LIIA 4F60A 4UHDA 3QH4A 4Q34A 5HF5A 2DSNA 2G5TA 5A6VA 3L1IA 4H18A 4PO3X 4RE6A 3WJ2A 3G0GA 5AH0A 1N1MA 4G8BA 1BROA 2WQZA 2O2GA 1XKLA 3FWHA 1L7AA 1QIMA 5FOQA 2WFLB 2WFMA 1KU6A 5ALQA 5FXMA 1IUNA 2ZJFA 3UUFA 5HKAA 4J0IA 3I1YA 5ALLA 3JW8A 3KD2A 2QT9A 1K63A 4LXGA 3G0CA 2D5LA 4B85A 5EFZA 2XQJA 3R3UA 5I9IA 4FLEA 5HQ3B 4Y2SA 1W4LA 4E46A 4UFOA 4XVCA 2QM0A 2QRUA 3G9TA 5DYTA 4WDRA 5FRDA 4BE4A 3WA7A 2OLEA 1CV2A 1ZGBA 1K5PA 4XJVA 4N8EA 3DYVA 3I28A 2XUKA 4WJLA 5AO9A 4FLFA 4HXEB 4F5ZA 1XQVA 2OXEA 2WUGA 1EVQA 1SFRA 1YR2A 1RP1A 2HA5A 5ALIA 4BAZA 3STVA 3BL8A 2IITA 2XMBA 3AINA 4OSEA 1X2EA 1XLVA 3FYUB 4BYMA 2RHTA 2CMFA 2ZSIA 5AKXA 4N8SA 1GPLA 4MWTA 1ETHA 2ZYSA 4Q05A 3H19A 4FNMA 2H9YA 1XZLA 5T4HA 4X7BA 3MUOA 2CZQA 4EHBA 1EDBA 2X8BA 2Y6UA 4LHEA 3E3AA 3QVMA 5IH7A 3DKRA 1JJIA 5LP1A 5FP0A 5EI5A 4P9NA 3WA6A 3E0XA 2OCKA 4K2AA 3O4HA 3SC2A 3MGAA 5F4ZA 4DLNA 2RI6A 4HXFB 1JJBA 4GHWA 3WKBA 3KXPA 2EDCA 2WTMA 4B6GA 1FFBA 3WWOA 1VLQA 1UOOA 2VJDA 3FSGA 1TKRA 1U2EA 2BJHA 4IO0A 1CVLA 3WK4A 2JBWA 2HDWA 1E66A 3W04A 4CCYB 4ZV9A 4BZZA 3IUQA 1FJ2A 2WG2A 3DQZA 3OC0A 4PF1A 2XDWA 5CXUA 4H7KA 2GYUA 1UFOA 4YX9A 3N0TA 2HFKA 4WDQA 3GFFA 2E3JA 3K2IA 1CUJA 2B61A 3D5EA 5ESRA 3MUNA 1EVEA 4UBNA 2VSQA 5CW2A 2JIDA 2QKYA 1SCQA 1QE3A 1QIIA 1UK7A 1XZKA 4UPDA 1UK8A 3FLEA 2XUAA 3EBLA 4J0GA 4Z49A 2XT0A 1GKKA 1HL7A 1QFMA 5EIEA 3M83A 4C89A 3C45A 1YASA 3W9UA 2C5FA 2WG0A 4ZREA 4KE9A 2B4KA 4ZXFA 5FLKA 3BIWA 4ZWNA 4X91A 3QPCA 3KWFA 1UK9A 3IUNA 1E8MA 4WFKA 1WPRA 1Y7HA 2O7VA 5FPPA 1ISPA 1BRTA 4HRYA 1S8OA 4DYHA 3IUJA 2HM7A 3D0KA 1N8SA 4LXIA 5I8PA 5LIPA 2ROQA 2C58A 1LPSA 1W52X 1F8UA 1UT6A 5AOBA 1HPLA 1ZI9A 1LPBB 4AO7A 5AM3A 5A62A 3ICWA 3C8HA 1MT3A 1MX5A 5KWIA 3D59A 4UFNA 5ISMA 3D2AA 2AJLI 1C7IA 3H0CA 5JADA 3MVEA 1BU8A 3PI6A 1E3QA 1W6RA 5JAUA 4UBLA 1JJFA 5I7UA 2PBLA 1CEXA 4KAAA 2VEOA 1CUEA 1BS9A 5AM4A 2QUAA 1CRLA 1W76A 3V1MA 3G9XA 3NGMA 4QWWA 1YAHA 4IH9A 4FBLA 4Y2QA 4UHCA 4B0OA 1P0IA 3QM1A 3D7RA 3O9VA 1G4HA 2FJPA 5C8ZA 5LZ5A 2XE4A 3E1GA 3HABA 3R41A 5CH5A 2JGIA 2XUGA 2Z8ZA 1VKHA 4LYEA 3VJLA 4WFJA 3WL8A 4KJXA 3WWCA 4LYDA 2X5XA 2QVBA 1FFDA 2XUDA 2PUHA 5EGNA 4LXHA 4AO8A 1NU6A 2O2HA 5E4JA 1BN7A 3IVMA 4ZI5A 5K3DA 5DTJA 3ESBA 4U2EA 5CH8A 4RGYA 4EBBA 2O7RA 3NOXA 4ZGBA 3H1AA 4MEAA 4W9RA 4AXBA 1JKMA 2W22A 1GPNA 3STUA 1HBJA 2H1IA 4W1PA 2WHPA 4BCCA 4WY5A 1XQXA 4UHEA 4U2CA 2WLSA 2ZYIA 2HFJA 2WJ6A 1QIJA 2H7XA 5IVDA 3A2NA 1ZD5A 1GPKA 2WFLA 1Q84A 3PDCA 3QMVA 1GT6A 2XB6A 1EX9A 3ESCA 1AMNA 3BDVA 5EIHA 3WKEA 2YH2A 1H2ZA 4YK7A 1A8UA 1WCYA 3ANSA 4OPMA 4DNFA 1LNSA 3R3ZA 5HFNA 5HQ3A 1DQZA 4RNCA 3DLTA 1YB6A 4HS9A 2OQVA 4L72A 4K6KA 2BAGA 2WSLA 2XQFA 2ONCA 4KR0A 4RPCA 2GBGA 3H2HA 3WQHA 1ZD4A 1AKNA 3GBSA 2J3DA 1B41A 4JUIA 4CIBA 2DHDA 5LZ8A 2ES4A 5ALMA 4XX1A 2QZPA 4N8DA 5JAPA 1X2BA 4AMYA 1M33A 1C4XA 4U2GA 1HDEA 3N2ZB 2C5GA 3H04A 5A2GA 2CEKA 4DGQA 5K3BA 1JT2A 1WM1A 4I4CA 5EIAA 2OQIA 2WJ3A 1VXOA 3CN9A 3FYUA 2VQ6A 3I2IA 3DYIA 3OTQA 1EI9A 2AJBA 4FLMA 3G9UA 1R4ZA 3D2BA 4MYDA 3RM3A 2RAUA 4DSAA 1ZICA 4TGLA 2Y1KA 2Y2UA 5CT9A 4BB0A 4AB1A 4HXGA 3F9CA 5C8VA 4FHZA 5ALPA 3LS2A 4DSZA 4EUSA 5C8XA 3LCRA 5CRIA 2VJCA 3S2ZA 4Y2XA 3AIOA 4QDUA 4I3FA 1CFJA 2I3DA 1HQDA 1OILA 3WWEA 4G1FA 3WL7A 1CUIA 2HA7A 2XUFA 1ZOIA 3CN7A 1PFQA 2GBIA 1AC5A 1DQYA 5AOAA 3ICVA 2HA4A 3DCNA 3DD5A 2WIDA 2JF0A 2V98A 5ALXA 4HTAA 4MQMA 1FSSA 5HFAA 3VVLA 4CCWA 4PSUA 3P2MA 1EK1A 4CCYA 4GLBA 1RWQA 1XLWA 4X93A 3H18A 2XMCA 3A6ZA 3EQ9A 2VAVA 5AIBA 3WYNA 2LIPA 2OGZA 2EEPA 1LZLA 2FUKA 2QMQA 3S8YA 2PVSA 4Y7DA 4KAFA 1QFSA 1XZMA 4OCZA 4EB0A 5AI8A 3C6XA 1DINA 3I2JA 3CCBA 1R50A 2QXTA 2XUIA 2WHPB 4X85A 3G7NA 4G5XA 2VF2A 2BUAA 2ZSHA 1XZAA 2PPLA 4OYLA 4CIAA 4OD0A 4ARBA 1VJ5A 2OCGA 1K8QA 4OU4A 2X76A 4QA9A 3SK0A 1H2YA 2YXPX 5ALWA 4C4ZA 1XZJA 1CUBA 3WK5A 5IKXA 1O6FA 4A5SA 1XROA 4BP9A 2AJDA 4Y2JA 4G4IA 3IULA 5ALRA 3R0VA 4IHAA 1LGYA 3STXA 3FLBA 5KWJA 3AZQA 4DMFA 2WIJA 4PW0A 4AZ0A 1CUFA 2XUQA 4S0XA 5AKZA 4C88A 5JD4A 4GW3A 4QNNA 2BGNA 4J0KA 4CI9A 3V1KA 4K6HA 4KAJA 4DMCA 4U2BA 1QIFA 3K9BA 2Z5GA 3WIBA 3IA2A 3RLIA 4H7DA 1W1IA 1UKCA 3GROA 5AJHA 4G8DA 2OAEA 4JYPA 1EHYA 3VJKA 5LZ9A 1JMKC 3C6BA 2DCMA 1DT3A 3DNMA 4K5QA 3L1HA 4UFPA 4FWBA 1U4NA 4MWSA 4J7AA 4EZIA 3HYSA 2GYVA 3OM8A 3FYUC 4M0EA 2XMQA 1XRRA 3ZV7A 4QZVA 1UK6A 1EB9A 1FFAA 4QE3A 3PFCA 4J3JA 3QPDA 4BAUA 5LZ7A 3CXUA 5DNUA 2WIFA 2BFNA 1JMYA 1U65A 5EHZA 1QJ4A 2YYSA 1EINA 4ETWA 2XQGA 1XLUA 2WUEA 3OOSA 1UXOA 2FJ0A 5AOCA 1HKHA 3ZLVA 1DTEA 2PL5A 1QIGA 4OB8A 2K2QB 4CFSA 4XWGA 2WU4A 2I78A 3QITA 2WUDA 4H7IA 4BE9A 1P0MA 4C87A 1MNQA 5AK6A 2HL6A 4H0CA 1LPNA 3TEJA 4B9AA 4LIPD 1YA8A 1DWOA 1F0PA 1WB6A 2QS9A 1BCRA 3BIXA 3ZLUA 1X70A 4N5IX 4FDMA 5JAHA 4Q3LA 5AKGA 3V1LA 1BEZA 3I2FA 1XRMA 2C4HA 4BRZA 1C7JA 3BWXA 2CBGA 2PSHA 1ZIXA 2H7CA 1YB7A 5CT5A 4C01A 1N5MA 3OPMA 2J4CA 2HA0A 3EF3A 1YCDA 2HU5A 2PX6A 4JEIA 1QTIA 1XZBA 2GBFA 4UBKA 3QPAA 1IUPA 1GXSA 3ED1A 1USWA 1CPYA 1GQSA 1ZJ5A 3HI4A 2W6CX 4F0JA 5EHQA 3WK6A 5JATA 4G4GA 1O6GA 3K6KA 1VE6A 1XZGA 3I2GA 2XQIA 2J3QA 4EY7A 1EXWA 1OXMA 3STWA 2BUCA 1A8QA 3WMRA 1G66A 1QIHA 3G0IA 5C81A 4Q1VA 5AKJA 1H2XA 4IH1A 5E4YA 2WKWA 4QLOA 3DS8A 4G9GA 3STYA 5FDFA 2OPHA 5JD6A 3B3QA 5LKRA 3R3WA 5E4TA 4PSCA 2XUPA 3F96A 4FKBA 5ALTA 4HAIA 2HRQA 4J0JA 3WJ1A 3D4LA 5D3ZA 2V9ZA 3R3VA 3M82A 4DIUA 5ALOA 3HJUA 3U0VA 2XUJA 4BAGA 2RGUA 2JGJA 3EQ8A 5K3FA 1ORWA 2XQKA 5DJ5A 1WB4A 3ESAA 5AI4A 5DNWA 1LZKA 4QLAA 5CURA 1EDEA 2V96A 5CMLA 3HZOA 5DYWA 2BCEA 1XZHA 2OGTA 3F8SA 4X00A 1UWCA 4GEGA 1JU3A 4KYVA 1SCIA 4GBGA 5CTAA 3ESDA 1TRHA 4AO6A 1QO9A 4OB7A 2RHWA 1ODTC 3V1NA 1TQHA 5HCUA 1MJ5A 2VAXA 3WK7A 4V2IA 1BCSA 4C6HA 3IUMA 4BC1A 5CT8A 1THTA 5T4FA 4U2DA 5AKEA 1DWQA 4UBJA 2ACKA 3W06A 4FFVA 1J2EA 1TCAA 1VE7A 3A70A 1ORVA 4PSDA 1ZD3A 1XQYA 3C43A 2OCIA 4BVKA 3WWPA 1GQRA 3PF9A 5AK3A 3DL4A 4PV7A 5DYYA 5SYNA 4TPKA 4A16A 3DOHA 1NU8A 3NWOA 4D9JA 2V97A 3M81A 3I2HA 3PF8A 1AGYA 2ECFA 2DFPA 2YASA 2CB9A 2RIPA 3HSSA 2WJ4A 3G0DA 2QJRA 4HRXA 4L9AA 1VXRA 3WL6A 3IB3A 1XRLA 3IIIA 2JEYA 2JEZA 2G63A 3AZOA 3WWDA 1AX9A 2B9VA 1G5FA 5K3CA 1QONA 3A2MA 2HA3A 2DQYA 1FFEA 4BCDA 1CUCA 3G0BA 2O2IA 1G42A 4Q82A 5YASA 1EDDA 3WYDA 4DNPA 3O4GA 4GECA 1W75A 5C7YA 1ACLA 4KRXA 4BVLA 4I19A 5HF6A 3RARA 3Q8WA 5SYMA 4Q3KA 4INZA 1ZD2P 1ODSA 1UKAA 1ZI6A 2IIVA 3GUUA 3PUIA 1YA4A 3UMJA 1UOPA 4E14A 4CG1A 4X6UA 4UBMA 5BV7A 5AHXA 1QZ3A 4B80A 3PICA 3KWJA 1LLFA 4F21A 4J03A 3VJMA 4ITVA 2WILA 5JANA 4LKOA 2DHCA 4JYMA 1WB5A 5D3KA 2PM8A 1A8SA 1GGVA 2DR0A 3QMWA 5ALFA 4GXNA 3C87A 3QBJA 3AIKA 4XIIA 2PSEA 4MEBA 4UHHA 2WHQA 4BCBA 5K3FB 4NVRA 2GYWA 5AKKA 3O4JA 5ALKA 2HA6A 3BE8A 2OGSA 5T4EA 3KDAA 1J07A 2FX5A 3ANTA 2QR5A 5AI9A 1XZDA 3DKKA 1CQZA 5AKHA 1L7RA 2XUHA 2ORYA 3C6ZA 4J0HA 1WPXA 4KE6A 2ZJ7A 3WZLA 1K4YA 2QXUA 1AURA 1XQWA 1CR6A 2XUOA 4UHFA 2I03A 1Q0RA 2QOEA 1MN6A 4CG3A 2VTVA 1SOMA 1MU0A 2H7YA 1PJAA 3BJMA 1HLGA 1J1IA 1XRPA 4Y2YA 4BRSA 4RE5A 5HK8A 5LKAA 5AKIA 5DTIA 5BWCA 3B5EA 4O08A 4E15A 3FSGD 1WHSA 1T2NA 2WU3A 4FBMA 4X6XA 4X71A 5FPQA 1KEZA 4BC0A 2WIGA 1E89A 1CUWA 3DL7A 3IBTA 5T4BA 1MNAA 1Z68A 1CUVA 1QIEA 1A88A 1Q0ZA 1MAHA 1MO2A 1DX6A 2AJ8A 2VT7A 3FCYA 3HC7A 1PV1A 4IH4A 2HIHA 5HZGA 3FOBA 3FVTA 2CKMA 4H7HA 3F98A 4QDZA 5AICA 2QJWA 4QWMA 4B9EA 4B82A 4X94A 3JWEA 1XFDA 4BBZA 3HACA 5AIAA 4J0CA 3VISA 2XI4A 4X6YA 3ZI7A 5AM2A 1VA4A 4QDXA 1A7UA 2PUJA 3PFBA 4Y2TA 5DNVA 1IVYA 3I1IA 1QOZA 2Z3ZA 4BTVA 2XLCA 5JALA 1AUOA 5ALHA 3WK8A 1H23A 1XRNA 3DJYA 4BTLA 3CCCA 4EY5A 3I6MA 4EA6A 1TCCA 2WFZA 3DOIA 4QDOA 5JD5A 1QGED 4MJ3A 5ALDA 3C6YA 3HRHA 4X97A 1XRQA 4Y2UA 1DWPA 4ROTA 1R9MA 1R9NA 3B12A 4P08A 1XZEA 3R3YA 4G9EA 3RK4A 4GI1A 4W63A 3WLAA 5D6OA 4M0FA 1IUOA 4BDSA 3T52A 1AQLA 4MQLA 3VDXA 5CT4A 4DM7A 1ACJA 1LPPA 5A7GA 4B0PA 4Q3OA 7YASA 3WKAA 4BVJA 1QIKA 4YASA 3OURA 2QUBA 1IZ7A 1QO7A 5HK9A 4B7ZA 3O95A 2PKYX 3AJAA 3HEAA 5BOVA 5JYCA 4BATA 3H17A 2NW6A 5LLSA 1LBTA 1DX4A 1P0QA 4HZGA 4KEAA 3AUKA 1ZI8A 1ODCA 1JFRA 2C7BA 3VKFA 3D2CA 2ZJ6A 1VA5A 1YS1X 2WHRA 1FFCA 4X92A 3PUHA 3W2TA 3STTA 2HADA 3C5WP 4NZZA 3H2GA 1IMJA 3YASA 2PU7A 4UUQA 2HHAA 3WZMA 5DWDA 4CG2A 5HKBA 1YSCA 1LBSA 1THGA 1MAAA 5J3JA 4ARAA 3X3HA 3BDIA 1LPAB 3R40A 2GBCA 4WCVA 3H2IA 4IQ4A 5HF8A 1CUSA 3V9AA 4P92A 2JGEA 2JGKA 3A2LA 4P93A 3FYTA 5LZ2A 3I6ZA 5JZBA 5JZ9A 1CUAA 1F0NA 5AP9A 2ZVDA 5EHNA 4DNQA 1WOMA 2IX9A 3FCXA 5E2IA 2VA9A 5D7BA 3WI7A 3ZLTA 4OB6A 3O0DA 4QDTA 4JH0A 1TAHA 1TK3A 2HU8A 5K5EA 4GWLA 2HU7A 4FOLA 5JZSA 4PNZA 4C4YA 1YS2X 2P8SA 3I6YA 5ALNA 2OAGA 5A71A 4JNCA 3AILA 1DT5A 3WL5A 2R8BA 2XMZA 4KE8A 1LPOA 3WKCA 5ALJA 4BZWA 1EB8A 3VXKA 1B6GA 3SX4A 1EK2A 1QIDA 5FV4A 4C4XA 3ILSA 5ALEA 1EH5A 4L3WA 4W1RA 2OG1A 4U2FA 4Y9SA 3AFIA 5ALYA 1QTRA 1XZCA 5BWBA 1E8NA 2ACEA 5JARA 4DMKA 2J4FA 3AZPA 2B20A 4NMWA 5ALZA 4MXDA 4EY4A 5CT6A 4M0MA 2ZYHA 1QLWA 5HF9A 5CXXA 3Q0TA 3G8YA 1Y37A 3H1BA 4DTCA 2JGLA 4FNGA 1JU4A 6YASA 2AXEA 4AX4A 3KSRA 1MX1A 1JI3A 1LPMA 4KACA 1WHTA 1H2WA 5CBKA 4K6GA 4W1SA 4UHBA 3WK9A 4OU5A 4KE7A 1CUGA 3GZJA 1K6EA 2EDAA 4NS4A 3RKSA 1L7QA 2VATA 3EIOA 5AK4A 2VJAA 5JAOA 5K3AA 2HA2A 3BXPA 5A7FA 4EY6A 4W1QA 3EQ7A 1NX9A 4L0CA 3BF7A 3FLAA 5AM0A 1UZAA 5FUMA 4OYYA 2WTNA 1J06A 1SCKA 1CUDA 1TIBA 2Z8XA 4J0DA 1GZ7A 3V48A 3SWWA 2RONA 4ZRDA 5ALSA 1Y7IA 1ZGCA 5LZ4A 3R3XA 1CIJA 1BE0A 3TGLA 2HRRA 3DEAA 5AK5A 5AKLA 2C0PA 4BP8A 3QMMA 2GZSA 2DQZA 1UOQA 4X90A 2OCLA 2R11A 1GKLA 1CUZA 2Y6VA 4KRYA 4H7FA 4WFIA 3WKDA 3GA7A 1ZIYA 1UKBA 2BGRA 3LLCA 1VZ2A 3T4UA 1CUYA 2UZ0A 4G4JA 3FNBA 1BEEA 1ZJ4A 3PE6A 4HVTA 4DMHA 1AZWA 2BKLA 3D3NA 2DHEA 2XMGA 1H22A 4EY8A 1RYYA 1T4MA 4Y2RA 4H35A 3M3DA 5K3EA 5DLPA 3UUEA 2G4LA 4AMZA 5AI6A 2CJPA 4ZV7A 2PSFA 4OUKX 3LIPA 1MTZA 1N5RA 3WIOA 4N5HX 2WM2A 5LYYA 4H7JA 4UBIA 5AM5A 1IZ8A 3L1JA 1U8EA 3FAKA 1R88A 1CLEA 1I6WA 3G02A 4TVKA 1DU4A 3O4IA 2AJCA 1Q83A 3E4DA 4X3CA 5AKYA 5H3HA 4H77A 1MPXA 5JASA 3FVRA 1R3DA 3AIMA 2WG1A 5KREA 1VZ3A 4PQEA 1E8DA 1E5TA 5KBYA 2XMSA 4GDMA 3BF8A 5IVIA 4MYSA 5ALGA 4DNOA 1CQWA 3HXKA 2PU5A 1KU0A 1D07A 4E11A 1VOTA 1CUXA 3H2KA 4X95A 1OCEA 3H2JA 3W05A 2I3ZA 4B84A 2JGMA 2XMDA 2G5PA 4Y2PA 5AI5A 4BDTA 3ZWQA 4B81A 3O9MA 2BUBA 5AI0A 5EHXA 1EA5A 5JIBA 2C0QA 2XMRA 3BJRA 5CH3A 3NUZA 2GZRA 2Q0XA 2JGFA 2WIKA 1XKTA 3IURA 1TCBA 4AN1A 4G8CA 5AM1A 2XLBA 1P0PA 1XZFA 3QZUA
chains in the Genus database with same CATH superfamily
1CZHA 1XT6A 3KB1A 2Q5FA 3GELA 3MLEA 3LSYA 1GPMA 2E7ZA 2Q5CA 2AYYA 1QHIA 2O4CA 3GB9A 3OE4A 3LWNA 2ERXA 4FFWA 2GNAA 4YP7A 4N0QA 1M6EX 1TECE 1KYYA 1P17A 5AW8A 4UBOA 2JC3A 2I4LA 4YP5A 1ZM7A 1ENZA 3CCFA 3HWRA 1GDTA 5M29A 3B3FA 4DJJA 4RW0A 4Y8VA 2KW5A 5IDQA 2NYUA 3MOSA 3U2QA 1CUUA 1NUPA 1D8TA 3TPFA 3C3PA 3UJNA 3GQVA 2Q7XA 4LE0A 1KAGA 2A5LA 2PMCA 3AU8A 5B1SA 4DREA 1AUQA 3BIJA 4QBKA 1UBRS 5KEIA 2II6A 2QTBA 4YV2A 1DQPA 4G5GA 4XPZA 4BO4A 2AL7A 4ON9A 2WF9A 4ALIA 2H2AA 1NQTA 3TRDA 4FSHA 2YMLA 5CFQA 2YZKA 1Z5UA 3SR0A 4ES6A 2R84A 5MFZA 2XXBA 4RYDA 5REQB 1NQ5A 2P27A 3RUAA 3VM6A 7REQB 1EJBA 2W58A 1I32A 2X2EA 3IV7A 5FTKA 4KR7A 1AUVA 2HDHA 2GR9A 2J6IA 2LKCA 2GVDC 3U37A 4D4IA 2H5LA 3PGMA 2P6PA 3FCOA 1YQQA 3OM1A 2BFCA 3OTIA 4FS3A 1QP4A 4W9NC 2LTAA 2VNSA 2NV0A 3FR7A 3DM9B 1Q7BA 2IHUA 3QQPA 2XBUA 4HADA 4AQDA 5L95A 2GDZA 2ZYRA 5LB2A 1C0LA 1O9GA 3CEAA 3K8QA 4IDAA 4C1BA 2MDTA 1V16B 2R5NA 4TMVA 1PBNA 2NUBA 4ZZ0A 2AOXA 3BDAA 1XZNA 1JKFA 5SY4A 1BDMA 1UODA 5BSGA 5IXJA 4RHCA 4GX2A 4ESEA 4WGGA 3HN7A 5FNVF 4H7EA 2AE2A 4ID3A 3I2KA 5CJ2A 2PSJA 1TQDA 2AG1A 1QQ5A 2IC5A 1FLDA 3C5VA 3C70A 1I36A 3WMGA 1HDXA 4ZVNA 5GVRA 4FEAA 4A73A 4CMCA 1B14A 1RBMA 3GQBB 4NPHA 1YOBA 1U1GA 2WTAA 3LIIA 4JODA 1NNI1 2E48A 2G88A 4GOXA 2VHJA 3JQFC 4UHDA 3TCXB 3DO8A 3GLHA 4Q34A 2VIIA 1NBEA 3NM6B 4UHKA 5HF5A 4YREA 3S1AA 2ATEA 1YZHA 4PM4A 4CLOA 3CONA 3C7AA 4TLMB 4H18A 5EKTA 5ELMA 2IHKA 1GFSA 3MUFA 2CXSA 4TLDA 1X0VA 3CUWA 4RE6A 4JZKA 4ZVTA 4KVZA 5HJ5A 1NTRA 3B1XA 2A0WA 4TKVB 3L8ZA 1J8VA 1CDDA 5IJXA 1X8KA 5GZ3A 3JQDA 4BPRA 2WQZA 5BMOA 3SIPA 4D3SA 3UKOA 5IAOA 1RT9A 1VCHA 1VPTA 4L0QA 5HGJA 3DC2A 3TLGA 4V0OA 3F3KA 1E77A 4WZZA 4ZEOA 2W83A 3WJAA 4AK9A 4BGUA 2XF2A 4C7VA 1ZDMA 1KU6A 4OP1A 3S2YA 4D4GA 3JYNA 2QGZA 2Y76A 3CY6A 5FXMA 3VDRA 2LCFA 3RUPA 3M49A 1KDOA 2E4WA 4WHMA 4OMDA 4ZN6A 3IA7A 3KYDB 3KNZA 3I1YA 4Y6LA 3SJZA 4F97A 4CKZA 1KSHA 1FJXA 3B5JA 1F8FA 5CLQA 2QT9A 5EP2A 1ES9A 2AS0A 2D5LA 1X1TA 1MJHA 2Y68A 3FDZA 4B85A 3AO0B 3KLPX 4L8YA 4XXHA 5CVEA 221PA 3U3XA 4M0LA 4E5UA 1ONSA 1JXMA 2R44A 4B75A 5GTDA 5IG2A 2TMDA 2NUAA 4FLEA 1L7EA 4GMXA 1IXRC 1IQRA 2JAPA 5AHOA 2NVUB 4UHJA 4V3CA 2JL1A 4LVNA 4O4IB 4GRIA 4BEBA 4UUMA 5B7GA 3FFTA 3THYB 4YY3B 2IELA 5DYIA 3PFKA 2A9FA 3PEWA 4FZVA 4EABA 3O8CA 3RJMA 5FRDA 3I04M 5TLSA 4KQ1A 3FFXA 4BECA 4ARVA 1CV2A 3G8DA 2ZI7A 1ISIA 3O7MA 2MHCA 5DFAA 3PR3A 3MQFA 1CVRA 3PIIA 3TTSA 3A3YA 5LP6C 4JI7B 1T2EA 1A82A 1J2YA 1PP4A 3B85A 3MYRA 1G5RA 2PRJA 4M0DA 1UJ2A 1MD9A 3ECAA 1D9XA 4Y6RA 1H1TA 1AN0A 1XPUA 3HDYA 2ZZKA 4LOLA 4DBVO 2RE8A 4KV7A 4JLOA 1B0UA 2O3QA 5JLAA 1LX6A 2EJWA 3G2LA 2LPMA 3G2PA 3PQEA 5EE0A 3ZJYA 4F5WA 2ZXFA 1BD4A 3I5UA 5AXDA 3TZBA 1ODLA 2ODEA 2JLBA 3H5IA 5LU9A 2YZ2A 3AEYA 2R6HA 3EMBA 4BQQA 5KSZA 2VNHA 4JNKA 4RUKA 3HM9A 2D1YA 3C5EA 2B2CA 4OUDB 1KO4A 2M6LA 3B89A 4L4ZA 2KSQA 2WUGA 2YWEA 4ER7A 2B25A 2GKSA 1YR2A 3F1LA 2AW5A 1YJBA 2EXXA 3H7AA 4MQ5A 3ZGLA 1A5AB 4MUGA 3GJ4A 3W2HA 3ZGXA 4BAZA 4C5BA 3DW1X 4JXZA 1I9GA 3KQYA 2AYZA 1D7AA 3BRWA 3GVXA 3KE9A 3AINA 4GLJA 3X1YA 3TD9A 2HMVA 2MYNA 5E6UA 5JSFA 4OFZA 1OE0A 2JFHA 2G7ZA 1XLVA 3FYUB 4R1NA 3E5MA 5I5GA 4Z1MA 4Z51A 2CMFA 4X84A 1NBMD 3HKEA 2QYHA 4RQAA 2FSGA 3R7AA 4ND8A 3BXGA 1PJQA 4ND7A 1C9NA 1JBQA 1ETHA 1LLQA 3CF0A 4GPEA 3L7IA 4LGYA 4LMRA 1J9EA 1PYOA 4Q05A 5GADl 4P31A 1GA6A 3KZCA 1EUDB 3MJ4A 1CETA 3F4KA 3FF4A 3MSXA 2H9YA 3O21A 1KIFA 4RWZA 5CVJA 2DRIA 2RGNC 3N5CA 1WUTA 2GK6A 1FQKA 2DUNA 4HGQA 3WTCA 3A6JA 1E2MA 3D6HA 4E32A 3RVQA 2HWUA 4YBZA 5K0BA 3D5QA 2J9ZB 4OIMA 4DILA 2Y6UA 1JQDA 3D3WA 1JWLA 4LHEA 3E3AA 2QENA 2W48A 2ZRCA 3HY3A 4PR3A 4MHSA 2XZTA 2JGDA 3DKRA 3KOMA 3A2KA 4QULA 4DF3A 4YAFA 3LW8A 3ZD8A 4RD6A 5BQXA 1JIIA 1JJIA 3AQIA 3OZAA 1RAIA 2WAMA 3M3PA 3F9IA 1XXHB 2CEAA 3UJHA 5JFGA 2FPIB 5DCLA 1JDTA 4B17A 4EZBA 2IU3A 3O90A 2QEQA 2XNCA 4ZZ2A 1Z6QA 4YRJA 3W2GA 2AOTA 3SC2A 4FK8A 3TZ6A 3BXXA 4XYLA 4BVGA 2AHOA 2RI6A 2PT9A 5D5HA 5G3YA 2P2YA 3SE0A 5JPCA 4P0QB 1DRWA 1ZWLA 5CFNA 2WWXA 4IKEA 1QNLA 3ZCSA 2ZJ5A 4CXMA 4CFZA 3MXTA 3QF4A 3V00A 1O08A 1R64A 2B0CA 3PC8A 1ML3A 4PCLA 3SBOA 3GLHE 1VLQA 1FYFA 2HMAA 1HT0A 3DDSA 2WYUA 2D2EA 3KU4A 4N7RA 2AVNA 3N7TA 1AE1A 4I36A 3ZY2A 1H0HA 4DQDA 3DAOA 2BJHA 4BFVA 3NONA 4L85A 2V6JA 4YRZA 1CVLA 3KM0A 4B3FX 4DIFA 1I7SB 3AEZA 3WK4A 2JBWA 1RC0A 3BWBA 5DHQA 2Y1GA 2HDWA 1JWBB 3QE2A 4PAGA 3WWYA 2HSEA 3HXTA 3W04A 3C4QA 4CCYB 1GP2A 1XNJA 1TU3A 4YP6A 2YHUA 3ZR4B 1DRVA 1E92A 1NN0A 2JJ2D 3IUQA 3WBJA 1Q0QA 2PT6A 3DEJA 3EG5A 4PBSA 4EMBA 4CF4A 3EVNA 2FZEA 1N8TA 2VH5R 1SK8A 3A1UA 1Z26A 3OC0A 4PF1A 5DGXA 5CCDA 3M4YA 2H2IA 1CIPA 2G83A 4H7KA 2O5VA 3NR2A 2ZB8A 1W88B 4R8VA 1YJAA 1QV9A 2I5PO 2VHEA 3JY6A 4PSVA 4TMZA 4UD6A 3QFTA 1FTYA 3LECA 1L8AA 3D8RA 5LFAA 2Y4OA 1UXGA 1RXEA 1RZUA 2UKDA 3FJYA 2QM8A 2IEIA 2M6KA 3EZ2A 1ZGJA 4MV8A 2YCLA 4OHRA 1RCTE 4RA6B 1R0XA 2E3JA 3LY5A 4LHZA 2C4VA 4E2XA 4J9UE 3K96A 4G26A 4NJMB 3AUUA 1AHPA 1Q0TA 3WGUA 4LQCA 4LZJA 5JXJA 2A3NA 5ESRA 4MVJA 5C9ZA 4INPA 3D4OA 5KX5B 1EVEA 1O9BA 2AMLA 3EDRA 2PKCA 1S3SA 1RJ9A 4KUHA 2WJHA 5BQ5A 2ZT8A 4NZNA 1DQSA 2JIDA 1KQ3A 2OGWA 1YQGA 2O05A 2XCRB 4C4RA 3OCZA 2D8AA 1GPUA 1UK7A 4IW3B 3A4MA 1JVBA 5F4BA 1QE0A 3IGFA 2M6SA 4TXHA 4C21A 1SKYB 3EVAA 3S1SA 4LJKA 4MMYB 1T3HA 2YKGA 4TL7A 3VR4D 3GVCA 5JQGF 3JD0A 1XDGA 1KP3A 2FSPA 1CJKC 4NIMA 4C5CA 1VL5A 3LCCA 4YRPA 3OQMA 3V4OA 4YP0A 1EFRA 3M83A 3U3OA 5TQJA 5DIZA 4W8HA 1R6UA 1T9GS 4DQXA 4E51A 4UVHA 4A7PA 3VBEA 2C5FA 2HHCA 1L0BA 4PSKA 1Y63A 3SQOA 4TUYA 4WZAB 3RHSA 4QM7A 5AESA 3VDNB 4EO4A 2RG7A 3C1OA 3IEXA 2BZ1A 2V7QA 2GJ8A 3L7KA 4OOEA 4ZWNA 2VS1A 5CJJA 2OD2A 3ORYA 1E6UA 4K9LA 1JFFB 1F3LA 3M6FA 3OZCA 4DG8A 2PANA 2WU1A 2P4UA 1OOEA 4D99A 4D9EA 3I9V6 2QQEA 1SKQA 4YRFA 3RD5A 3DKVA 2WIBA 2FWRA 4WFKA 4EVIA 3F2IA 2A4KA 1V11B 3IHWA 5AUNB 5EXTA 2RGBA 2ZBQA 5FA5A 3W2FA 3OP1A 4AZ0B 4ENUA 3GLFB 1KNQA 1X15A 1ISPA 3EN0A 3T5MA 2WT4A 5DYNA 3UBTA 1ISGA 1Q3TA 4FUQA 4I1YA 5GMOA 1QH0A 1GL9B 4CR7A 4BMZA 1IJKA 3ACCA 4DYHA 1M7GA 3KKQA 1BQEA 1ZN2A 2W11A 3GX1A 5AHKA 1NVFA 5I7RA 1JN0A 3PD1A 4LXIA 2JA1A 3NNSA 2AX3A 1I1OA 1H1LB 3CSUA 2G1KA 1HDZA 3BMNB 4ZI3A 2X5KO 4DE5A 3K4PA 5HA5A 4RZIA 3OTHA 1TU0A 4PBTA 5GVSA 1U0JA 3GGSA 2R3SA 1YDMA 2O1SA 3C8MA 1JIJA 5E9JA 4DB2A 1E7QA 3AG6A 1PHRA 1KMQA 4C0HA 4DDKA 3GRCA 5AOBA 1IWPB 3ZEAA 4F4UA 3AHIA 2BKUA 3TZHA 3ZOZA 1ZI9A 4DG9A 2PUDA 3LOUA 2CLMB 4YLYA 4Q4DA 3UCEA 1H6CA 4AO7A 5ELLA 5AM3A 3AETB 4JJZA 2HEGA 3JQ6A 1TDJA 1V7CA 1ZM9A 1JQ3A 1II9A 1MX5A 4NK5A 3WJ7A 1AHHA 3I9KA 3K9NA 1DGQA 3GVIA 4TZ0A 2FKAA 5IM4F 2BI8A 2BKEA 2C3PA 2I7XA 3D2AA 5BPHA 1WZIA 2FN8A 2BHNA 3H0CA 4MMXB 3MVEA 5CPBA 1E3QA 1JXAA 3OEHD 3PJEA 1WZUA 2X14A 4KRGA 3KUKA 1C8LA 4J49A 4AJPA 2YRFA 5LDHA 1MVLA 1Y8QA 1ZUWA 2HGZA 3I9FA 3LQYA 4KAAA 4WLEA 1VI6A 2BMVA 3N6RA 1O94A 3D6NB 1N2IA 5FFMA 3V55A 3DEHA 4GVXA 2BM9A 3GVPA 2FSUA 3ZV5A 2Q5EA 1U2PA 2VPQA 2PSSA 3V1MA 1OKKD 3G9XA 3NCHA 3LXXA 2XB8A 3TD2A 3MGCA 1R6DA 1YAHA 1Q5PA 4FBLA 4IH9A 5AWFC 2CMGA 4GRAA 4DCPA 1ZN8A 3ZJ4A 1VGVA 4EM6A 2WVJA 1D6MA 1S02A 3EY4A 3Q3CA 1CHDA 1EFPB 4YQZA 3ZK7A 1CR2A 1JP7A 2A7XA 5ECGC 4GE0A 4KWHA 1G4HA 2FJPA 3UOWA 1OZGA 3WBBA 5A1TA 5C8ZA 3QOFA 5E6SB 1KIMA 2RHGB 5BV8A 3M34A 4BXOA 4NNOA 2XOKA 2NP6A 3ZV4A 4MWCA 5DEIA 3BH6A 5CH5A 1IEWA 2JGIA 3H11B 4LUCA 2H0RA 4ICIA 2VK8A 2WHEA 3IBSA 4N03A 2Z8ZA 5EP3A 1KOLA 4KRFA 2PXXA 2RC6A 1AB5A 4PS1A 1KRWA 3E03A 4AULA 4LYEA 4I9GA 1JG2A 3LX5A 2FG6C 6REQA 1WF3A 4FD3A 3CR3C 1ZA2A 5BPFA 4MTCA 4KJXA 2QE7D 3BFKA 2YWCA 1XEXB 2HK9A 5I48A 1TVEA 2QTFA 1JFSA 2R00A 3LUBA 4ZCSA 4TMYA 1FFDA 4F4FA 1LCIA 1N6KA 1NLYA 1TZ2A 2XUDA 3IAAA 2I4NA 2QG4A 5JC1A 5AXBA 2OBMA 3DE7X 4KIFA 4K9RA 2PXCA 1L1EA 4D4MA 2NTJA 1MB4A 2O2HA 4N18A 3DXZA 5TQ2B 4WAUA 3MSCA 3C98A 4JSYA 1HTWA 4YXWD 1U9CA 3ESBA 4YJFA 4JJFA 4CT5A 5H0IA 5LQJA 2JIZD 4EBBA 2DWPA 4JP5A 3AI1A 3RG8A 3TQSA 1NI5A 4I08A 5CITA 5IYZB 1BO6A 1V7QA 4OHKA 4C2BA 4ZGBA 2FMTA 3NXKA 1RRKA 3JQAA 3W5DA 1HNXB 3H75A 1K7FB 3ZE6A 4MWZA 5JTUA 1VP3A 2ZDHA 3PCRB 2IHTA 3KOZA 4MCIA 4PRYA 4W9RA 4ODIA 5DW0A 1F5NA 1SUWA 5L45A 5KYNA 2H1IA 3MINA 1WR8A 3X1ZA 2B1RA 4UNPA 2NTEA 4W1PA 3DE5X 4L78A 4BZXA 5J9FA 1HYHA 1PYGA 1MRZA 3EWAA 1XQXA 3S8MA 3BFPA 3IT0A 4MVJM 3X2EA 4EQZA 4QVKA 4TQGA 4UHEA 1XWFA 1TUGA 2ZYIA 2BBWA 1BW9B 4IDEA 1MABB 3I39X 2WAOA 2Z8YA 3DTYA 3KETA 5E1OA 5EEHA 1GPKA 3TBKA 1UBTS 2BL4A 1Q84A 2VQEB 1SBYA 3LC2O 4KDFA 4ZGGA 5JCOC 1BE1A 4LDQA 1E1KA 3TDKA 1ZL0A 2EERA 1BVRA 2A58A 3PKZA 4G1VA 4C07A 1AS0A 3T34A 3RU7A 3M5WA 5LNK1 3WC4A 2FOXA 4HATA 2YH2A 4Q4HB 2J0SA 2NU6B 4R5MA 1PR6A 4ZK6A 2ISSD 5KJ1A 1Y1RA 1D2NA 1Q0PA 3ND8A 1E7YA 2WTBA 3N5KA 4IV5A 4XDZA 4Z4FA 1KFKB 2VOEA 5FBHA 2XWSA 4MW2A 1FVFA 3BQNB 4OPMA 4P34A 5B6PA 4PHFA 5FOSA 1LK0A 3RAEC 4JP1A 2KX7A 1DPFA 1WMDA 2QGFA 3BCUA 4NECA 3G6WA 4JLJA 1DQZA 1JW9B 1A5ZA 1HKUA 2BGJA 4RNCA 5DSTA 1OF1A 2PRSA 1LJ8A 5D84A 3R8CA 4Z4CA 3MC1A 4QUAA 4HN2A 4QBIA 4S12A 5J2TA 1P1FA 1YB6A 1L5VA 4KFTA 1VSUA 2QN3A 4MO9A 4TLLB 2JFFA 2Q3LA 2TS1A 3GG9A 4H17A 4K6KA 4E5VA 1OPRA 2F59A 4EA9A 2WHXA 2ONCA 4RPCA 1UPAA 1QSGA 4V24A 4Q00A 1U1IA 2CVOA 4UU7A 4XGKA 4LWZA 1KYIA 1Z4NA 4BFSA 2WA2A 3CUEF 1OXBB 2J1LA 1AKNA 4ZAVA 1XJWA 3E81A 4QU9A 4V0MA 2D0OB 2CXQA 4P84A 4UAVA 3Q0IA 4BNWA 5B12A 4A0FA 3UQYS 2ZCVA 3R4CA 4HLUA 4HUJA 1ZNWA 4Q48A 3ZS9A 2LP4Y 2OKCA 1K5DA 1JEJA 2ES4A 3OQBA 2FEWB 3F3SA 3NHBA 3KL2A 4MW6A 3SYTA 2P2SA 3KOXA 2H11A 3F6SA 1LD3A 4HWRA 1LTQA 5BN1A 3DAPA 2QGNA 3LRXA 3JX9A 2J3JA 1CBUA 1X2BA 2X86A 2I9KA 3Q9UA 1RAAA 1UC9A 1NI4A 4ASUD 4TMFA 3MTDA 1L2TA 1X77A 2I76A 2ZAIA 1E96A 4H59A 1LLDA 4QGGA 4ER6A 4GNRA 3B1FA 1QAMA 3H04A 2EW1A 2CEKA 4UEJA 4XWTA 3PYMA 4U39A 5JZOA 3OO0A 1WM1A 1MEEA 2R8EA 1GTRA 1RXCA 1B26A 1KYVA 1PT6A 1NY5A 2QVGA 3KR2A 3KVYA 5A9TA 1DKLA 1GCIA 1Z38A 2WJ3A 1VXOA 1DJQA 5KVQA 5IFLA 3UJ6A 1GT91 4MAMA 2ZLBA 1CVIA 2X6RA 4HSEA 1QHYA 4C7OB 3I2IA 3DGEC 5B3JA 2NG1A 4OQMA 1UXIA 1ZK1A 1W25A 5EKSA 3UJ3X 2GCPA 1MHPA 4N3GA 3FPHA 4XVRA 1EI9A 4EMUA 2VQFB 1GSHA 2OV8A 4KX5A 4OFBA 1Q91A 1HYEA 1OBCA 4R83A 5CIQA 5DOVA 3T0GA 1NJGA 2FG7C 1QK3A 3D2BA 4ESHA 4R8SA 2BHTA 4MYDA 3GJZA 1CZUA 2DFNA 1DE0A 4XR4A 1VE5A 1ESNA 2V9CA 4GZ5A 3ABSB 3V2GA 3RM3A 3W90A 3USZA 4K1LA 4TTSA 121PA 1AV7A 3WGTA 1XD2B 3LA6A 4E1AA 2PLNA 3CQ9A 3I72A 1D2HA 1HO3A 2Y1KA 3MWYW 4PRKA 2I2BA 3U3MA 3CW8X 3BFVA 3D1VA 4ECAA 5K0TA 4BB0A 3HA2A 1WNTA 4Q1CA 1ORHA 3H4IA 4BN4A 3ZYZA 3K9WA 2XRFA 5TPZA 5ALPA 3OU7A 3BULA 4GQIA 2XXAA 2VJCA 3LT1A 4DIMA 4FMDB 2I54A 1XVAA 2ZETA 1P60A 1Z5ZA 3AIOA 4FYJA 3KJIA 4NFLA 4PG5A 4UD2A 3L7OA 4ALNA 4B1FA 3NFYA 1NG9A 2W2QA 5EPEA 1U0BB 4GC5A 1PVDA 1P2GA 4KXFB 3F6BX 5K0LA 4GGMX 1UIMA 4POAA 2PAFA 1RC1A 2NADA 4G1FA 5E38A 1L4LA 2PBFA 2WMDA 1CUIA 2JI6A 1G7CA 2HA7A 4BEWA 3GFRA 2XUFA 3SX2A 4PVCA 4HAVA 4HKTA 3MWKA 3R7WB 1JLLB 3HUEA 2I6SA 2A2ZA 3IP6A 4R54A 3U44B 3ND5A 4HEA1 1QHFA 1Z4QA 3DFFA 3NAQA 3VI4B 2QVZX 3O2JA 1BNCA 3AUTA 4N3NA 3SBXA 1PO7A 1G20E 1RAFA 2I62A 2VTDA 2IH4A 3QKRA 1ZXBA 2QTRA 4KLZA 5ALXA 3WVNA 4IRXA 5DLEA 4UM9B 2XRMA 1WP9A 4L50A 2N46A 2RHJA 2JFXA 2WJJA 5EZYA 5HFAA 3HR8A 4DIEA 2O5CA 1QYIA 2FYTA 1A50B 4D43A 3K05A 3O38A 3EFEA 5KMGA 2OCDA 3ANXA 3KZ1E 4HQKA 1EK1A 3TL2A 1RKQA 3ZVNA 1NL3A 4Z9XA 1J42A 2NYAA 1Q74A 1FS6A 3D5TA 1RWQA 1F2TA 2JANA 3MTAA 4OHOA 3PDIB 3KTDA 1X7ZB 2G04A 4ZPXA 2PZBA 1QGOA 3U9LA 5KC8A 3T9AA 4X93A 2WTUA 2NT3A 4OHMA 4MHTA 1A8HA 4DMUB 2VAVA 1DC8A 4M21A 3OWOA 2GKOA 5A3RA 2V03A 1KJIA 3B13B 3C85A 3QELB 2WSSD 4G36A 2YBDA 3E8MA 4EL0A 3JYOA 1L5QA 1TC2A 2Z5LA 2FUKA 1MAWA 2CXUA 3PX3A 2NPOA 4ENSA 1DKQA 1PYDA 1WZCA 1E1CA 4NV0A 3M6VA 1OH5A 4KVFA 1OPXA 1Y3BE 2GZ1A 2PIAA 3HDHA 4MA0A 5ENVA 4ZFNA 2QLFA 1WQ1R 1N2HA 4OCZA 4EB0A 4X1OA 5AI8A 4JHXA 3I2JA 2RH4A 4KXYA 3H8JA 2A9KA 2QXTA 3I6QA 4O3FA 2HHJA 3JVIA 5JCJD 4EWLA 4OQXA 4J0EA 3BZWA 2VHQA 3TZQA 1CNMA 2QDKA 4X85A 4WZ6A 4HC4A 3Q3GE 2VF2A 4LK3A 2PFGA 1UH5A 2BUAA 3DJFA 2DFVA 4L73A 3RJ5A 1GG2A 2NXNA 4D6XA 1T3SA 1F12A 1JIQA 3TOXA 3BMXA 3QPBA 1T2VA 2J7PA 2VBCA 1IHOA 4IMIB 5IBQA 3WR5A 1SVMA 3WYGA 2D1FA 3C8ZA 3VHLB 4V0ME 3V8RA 2E82A 2FEPA 4OJQA 5JSYA 4DWWA 3I34X 1H2AS 3HB4X 3IKVA 1NR5A 1ZFNA 1NVDA 2E89A 3IQZA 3OWXA 3AY3A 1ELOA 2AFHB 5ALWA 1AGPA 2IIQA 3ZDRA 4RK0A 3K5WA 1O6FA 2WR8A 5K09A 2JCXA 3K0HA 4IIFA 4Q3EA 2IYLD 3CRZA 2AJDA 3UWMA 2LBPA 2JCYA 3C24A 5DBIA 2R6CA 3K0AB 4F2WA 1VHDA 2MR5A 2X4GA 1E2UA 5K9ZA 1S2MA 4FE3A 4P4TA 2VKQA 4MIYA 3W4JA 1MBZA 2G71A 3DWGA 3H65A 5TS2A 2HW8A 2B5OA 5C0OE 3O83A 3ZCXA 4Y7CA 1ZD8A 3EIUA 4QYMA 1CYEA 3SFZA 2GI4A 2Y0CA 5C7LO 1XELA 5DNEA 1JA1A 1FRZA 4RK1A 1VBMA 3AZQA 2RKWA 3FVVA 3H9QA 1Z39A 4M22A 1XPRA 1GCUA 2HSJA 5IJ0B 5JD4A 3LT5A 5EVCA 3AP3A 1I4LD 4AYTA 4P22A 1VRCA 3G8BA 3WHIA 5AW7A 3CEPB 1LQ2A 1XYGA 4PG6A 4LHSA 2EBHX 4QNNA 2B30A 1W4CA 4KSYA 4Q03A 1M0TA 2OCPA 2A0XA 3ADKA 4K6HA 2Q5LA 1VSTA 2Y1OA 4WOCA 3OLVA 3COVA 1ZM2A 3TI9A 3QG1A 5D85A 2C2HA 1W49A 2Z9BA 4KBYA 2CVPA 3W34A 4K6FA 5GIPE 1E9CA 1J09A 3B2QA 2DECA 2NZJA 3JAMA 3QEBZ 1HL3A 5FEMA 4DM3A 4MW7A 4HX9A 5ECYA 4G8DA 2ZRAA 2NVWA 1TJ5A 3I64A 5BNFA 4JUCA 5IKPA 2CB0A 3KQHA 1OLUA 3C6BA 5KU7A 1U4SA 1P19A 1IQPA 3RFVA 1JFVA 4B6OA 2PEYA 1N3BA 2BGGA 1P5ZB 1RM3A 1M2VA 3DNMA 5K4GA 1YK1A 1TCUA 4UEKA 3HCCA 3OM8A 1MEJA 4OJMX 4E08A 2CC2A 4ZEWA 3NGLA 4G3XA 3W5AA 4G0QA 4P7KA 4QZVA 1UK6A 4JENA 4FC6A 1V41E 4B2YA 3PT9A 1GV1A 1IL0A 1TMYA 2ZCUA 3H5NA 4KN6A 1A2QA 3HCPA 4KTVE 1X1EA 2Q3DA 1RS0A 3WLSA 3O8LA 5LZ7A 3JASB 4CCAA 1FXUA 2BTOA 1JG6A 4EKDA 4AMBA 3T5BA 3QLUC 3PBKA 4CUZA 4EI8A 4EF5A 1KOFA 3KX2A 5CB6A 2GCGA 2OCAA 4BB5A 1DJOA 4JDUA 3DLIA 1TM3E 3DZDA 2C1EA 3FWPA 3CE9A 1LS1A 2G9QA 4QFCA 5CXSA 5COQA 4ETWA 4EIWA 2HRBA 4DMMA 3NIWA 1QCZA 2WP0A 5GINE 4FP9A 1RABA 3DDZX 4OSPA 4PBRA 1DBPA 3OOSA 5SICE 1UFQA 2BCJQ 2QRNA 4IZHA 3EGCA 3MERA 4C3VA 2KPOA 4NBKA 1P3Y1 3KTAB 3SQLA 4G5RA 2DSTA 4EUFA 5K01A 2AOUA 1E2QA 4TKUA 4IFTA 3RT1A 2G0AA 1HKHA 1FTGA 1T2DA 2C42A 1DBRA 2MCFA 5CB8A 4IUCS 2PL5A 3THWB 3MOGA 3UICA 3HJFA 3ZDAA 4WI1A 3R09A 4YXFA 5F1KA 4DA7A 4EGFA 4H2DA 3SR4A 5LIRA 1WQ3A 2Z56A 3A6HA 2K2QB 3HDQA 3NZEA 4XWGA 1JIKA 1IXYA 4U9IS 4OHWA 4W5WA 2HTFA 1V2GA 2WU4A 4WOBA 4J3NA 3V32A 2I78A 2IYNA 2WOOA 1G5HA 2I22A 4AMGA 4D82A 1DC3A 1VG1A 3SOPA 4JP2A 3WYAA 4E5PA 2BTEA 4HB2A 5CNJA 4BGIA 4IEIA 2XA9A 4XM1A 3QLTA 3BD6A 1KH1A 4LHXA 4AAYA 5AK6A 4F6CA 1N0IA 2BFDA 1DRKA 2BEUB 4GX1A 4LIPD 4GXRA 5FNVB 3C3MA 2RK4A 2ZRGA 3KJQA 2HF8A 2UZ1A 4MI3A 3RKRA 3T5TA 5LWHA 1HSZA 1W0KA 5HUJA 2XYPA 5G1PA 4RABA 2XTNA 2Z4RA 1ZESA 4PIVA 1FDSA 3GHYA 1V7ZA 1SK9A 3PHCA 2WIAA 5DIFA 2PQ0A 1YKFA 4Q3LA 1TYAE 2ASEA 4M46A 1BOFA 2XPCA 4PQGA 4MB2A 3GEDA 1WV1A 3V1LA 2Z6QA 2WM9B 3CKLA 1R6TA 3Q87B 4WXRA 1BEZA 1MIOA 3I2FA 4FHDA 1D7OA 2B98A 5EJ4A 3O94A 1P6QA 3FSJX 1PJBA 1V96A 2J30A 1EJ0A 2R6ZA 4IWYA 4NU0A 3LCMA 3G0HA 3E2IA 1ID8A 4AM8A 1Q19A 2XY4A 5B58C 3JAKB 1OUMA 1I4WA 2DWCA 3DFZA 3G8AA 3H5OA 3I0MA 3PDUA 4UMEA 1J97A 4ZGWA 1KBZA 1M6NA 5A0VA 1IBSA 2JLQA 3OPMA 1NW9B 2OVFA 3EDMA 4YBRA 1XTTA 4DVGA 1DCFA 4YN3A 1XMVA 4PYIA 5HZMA 4X66B 1B16A 3Q5EA 2DLNA 4WLFA 5DGIA 3RHZA 1WCXA 2RI1A 2FXVA 3AGPA 3OQIB 2FZCA 3ADCA 3PJRA 4JLDA 4IINA 1VG9B 2R79A 5K51A 1E3WB 1EZ1A 4MS4A 4JEIA 3MBKA 4GNKA 1QTIA 5JNRA 2PQMA 5K0GA 3NHUA 4BLSA 1IONA 2EW2A 1X3SA 2QD5A 8LDHA 3QV1A 3HKDA 1E3LA 4HD8A 5EJAA 3UAYA 2B1QA 2GBFA 1IH8A 2IYRA 1ZR4A 4XEHA 2ZJOA 3RADC 2OHVA 1ORRA 1DFIA 3VA7A 1XD8A 1IUPA 1GXSA 1LRJA 2ZBRA 5CAEA 3SZGA 3JYPA 3NJ8A 3DVAB 3FM9A 2V0CA 1P2DA 4HTFA 4PZ0A 1OFVA 3JD1A 2P9BA 1GQSA 3QHQA 4LZWA 3VYUB 4DCOA 4AURA 1OHHD 4MLPA 1F7UA 1QQTA 1TADA 2P2LA 3KWLA 2HRCA 1B7GO 5HMLA 4NL4H 3A9UA 4I8IA 4TTVA 2YOFA 3VH1A 5KYXA 1E1RD 2D1TA 4I8XA 3AF0A 3KJNA 5HOQA 4HBZA 3K6KA 4LRSB 4BO8A 1XZGA 3GA0A 4MOWA 2GK7A 2J3QA 3G2IA 1EXWA 3KKNA 2X5JO 3S3TA 3HJBA 5EIOA 2CK3D 1K7CA 3I1FA 2C2MA 4QVGA 3OOJA 3IQWA 3CUSA 2QUIA 3PGXA 4YI3A 1HE5A 1G7RA 4CFYA 4PO9A 1Y33E 4LF8B 1M1YA 2AYXA 2EZUA 4TZTA 4AP6A 3DDCA 5C4IA 4NXMB 2GN8A 5E0OA 4DCCA 4IH1A 4IUYA 3T5AA 4EQ6B 2IEAA 2IGBA 3K8ZA 3ZGVA 3CMCO 2WKWA 4IIXA 4OH7A 3DS8A 4XD7D 3WNCA 4G9GA 1GAXA 1GOTA 1T2UA 1BQ3A 1C7FA 2FF5A 2OV1A 4LDJA 5EYPA 2FSSA 3L4KA 4HDMA 3WWZA 4K6OA 1XTUA 1EPUA 3I4CA 4KDCA 3L82B 4C22A 4LRXA 5FR1A 3OZXA 2ZRBA 2BR5A 1G6HA 4RMJA 4C7MA 4K81B 1OFUX 3EISA 4G5YA 4I1IA 2YZNA 1M2OA 2G8LA 2ZRHA 3AEKB 3QOXA 3RE1A 1KZYC 2WD9A 4HAIA 2O4UX 1XNRB 5MN4A 1NF3A 3LKDA 1UPUA 3H1GA 3OZBA 2HT6A 1K6JA 2XNJA 2BWJA 2ZQYA 5CYGA 1IPEA 1NBOA 2EFEB 2GTPA 3WJ1A 1GGJA 1EDOA 1WUHS 3BB3A 3IUYA 3LE8A 4O4JB 4LCEA 3VR5D 3NHAA 3U4HA 3LPMA 3Q4GA 4TUYF 4AKEA 2I0FA 3LUHA 2AF3C 1US8B 1V8ZA 5AK0A 5TMPA 2LDXA 5FBZA 4FFSA 3ZJTA 4HDRB 4MR9B 5CPFA 3EVDA 1X9GA 3PPYA 2EZTA 3V8NA 1Y1KE 2XCSB 4PZEA 3QXXA 2B4YA 2H1FA 5LMNB 3VV3A 2P5TB 1KDPA 1J8YF 1HE3A 2RGUA 3A3OA 3KPVA 1SQGA 3E7XA 3NGXA 1Q7EA 3S4YA 3LUJA 1I8TA 2V5AA 3CX6A 1ORWA 2E5FA 3HGTA 3PFFA 5FFNA 3KUUA 3FBTA 2FEMA 2E5WA 4L27A 1FYVA 2ATXA 2IF0A 4D46A 1THZA 3EIXA 5B3LA 2O8VA 2VDRB 3SAJA 3ESAA 1RKBA 1Q0HA 4U3JB 3FFBA 5ESXA 4L76A 1DQNA 2BELA 1UDCA 4RPKA 5TB5A 2ORED 2FPPA 4OQNA 1O96B 3V8EA 3IRVA 4G85A 2VH2A 3QVKA 3FYHA 5BYBA 3SYRA 4Z4QA 1ZMXA 1I4DD 5C18A 5CU7A 4ZCLA 1KPIA 5B2FA 1ULHA 2VHUA 3LFTA 1JPJA 1WEHA 2C3OA 3Q8MA 3OMXA 2Z9DA 1R0LA 1UJ5A 1XZHA 1Z6YA 3TB6A 3PXEA 5BXQC 5F76A 2CE2X 4M7RA 4O29A 4RY9A 3GT4A 5E8JA 2B1IA 1Q1ZA 3RAJA 4KYVA 1ZRSA 2HJ9A 4B43A 4DV3B 3NUQA 4GBGA 2WVHA 2C8LA 1ODTC 4O02B 3ZTWA 5FWXB 1LTKA 5BO5A 3EJWA 2P6NA 4MKZA 3RV4A 2TRSB 2ZIVB 3IE0A 1P7YA 2W0MA 1OXSC 1EGMB 1FNMA 2D54A 2H0AA 2PGJA 1U3UA 3R2JA 3GP8A 1W7AA 1UBUS 4CF3A 1KZ6A 3E4CA 4A5OA 5HJEA 1BCSA 2HJVA 3GEBA 2QTNA 1AK2A 2Q9AA 2WSYB 1XP8A 3HLTA 3ZH9B 3H8SA 2ZRDA 4BC1A 1TFUA 4RKFA 2PX2A 2XQVA 3RVSA 2XWPA 1G8GA 4HZUB 4KHZA 4L8WB 4N3AA 3ER9A 2NT4A 3MRSA 3PQ6A 3AF5A 1PL0A 1THTA 3L40A 3EVGA 4U2DA 3RYIB 3TRFA 4MYHA 1NJ8A 5AKEA 3JVUA 1HORA 3UWOA 4UBJA 3ZZNA 1JDUA 2QV7A 4Q1AA 3LU1A 3BMQA 3PC8C 4LEIA 2VTBB 1ZVVA 3FF1A 1G21A 4LX8A 1E6EA 1X80A 1FY2A 3A70A 2BFOA 4EJSA 4IIJA 3QBEA 1MA0A 2IZ1A 2XDQA 5BV1A 1FQWA 4BVKA 1YV9A 5A6SB 3B9BA 3GAAA 3WWPA 4F3KA 2VSYA 4YS6A 4KQFA 5AK3A 3F3YA 1ESCA 3WDSA 1VPEA 2FPKA 3VRHA 3HFSA 3KZMA 3NEJA 4QJBA 5DN6D 4Z6KA 4A2CA 1UMKA 2J9FB 3E1KA 3PI7A 4YRAA 1QBGA 4TPKA 3V8QA 4PHHA 4A16A 5BQFA 1YL6A 1WCV1 4C4TA 1GA4A 3JWGA 4TWJA 3DOHA 2UYGA 4EARA 1ZIPA 4F71A 5AVZA 4B3SB 3G68A 2V97A 5KYYB 5FA6A 1VHLA 3KAPA 3CE6A 3IVRA 3MWLA 2CW5A 4GPAA 5CHEA 2H1SA 1YVDA 2TMKA 1M73E 1XA0A 1D3AA 2ECFA 4GP6A 2Q8PA 4MS1A 4GL2A 1YCGA 1JV2B 2YASA 3EJ6A 2CB9A 2RIPA 3B9RA 3HSSA 2C9DA 3N53A 3FHOA 2ZE8A 4MWGA 4BU1A 4C6SA 2QJRA 2O52A 4HRXA 2OL4A 1F2DA 1VXRA 3UAGA 1WEKA 4CM8A 1H2BA 2I6QA 3JAWB 5CFPA 1TUBB 2CD9A 1QF7A 4RF5A 3NH6A 3HVHA 2Z58A 5BSEA 2WVGA 1U0LA 5CM2Z 2FSVA 1ECLA 3K0BA 5E9AA 4RZUA 3C97A 3ZNNA 3ETLA 3VTFA 1NJ1A 2JAWA 5JQGB 1U1CA 1U5AA 5B3AA 1ATIA 2VR1A 3WWDA 3HSYA 1X87A 1M6VA 2ALJA 1RLMA 1ZG3A 1QONA 2HKIA 3G23A 5K3CA 2ARKA 3IR7A 1W5EA 1PJSA 4Q47A 1VGRA 4R8MA 1FFEA 4L6CA 4YHBA 5LN1A 4MCHA 3UATA 3IQHX 3GEPA 4O4HF 1FK8A 3TSOA 4F4DA 3LPDA 4NDNE 1CUCA 2IDJA 2OHGA 2V7PA 4DYDA 4CVNA 1SN7A 3LCVB 2VXYA 2ZREA 3BTSA 3K09A 3BGSA 3EFHA 1G42A 1FFHA 1J8QA 4Q82A 5TJ9A 4BUCA 2EGGA 1GNTA 2CUKA 2Q4EA 3PTZA 3WYDA 4DNPA 3O4GA 4GKVA 1Z4KA 4GECA 1QGYA 4JBIA 2E0IA 2O2DA 4BJ6A 4PR0A 4KRXA 4Z9AA 4C03A 1RJDA 3AF3A 1ZH4A 3HJGA 4TT8A 1DBIA 1YVUA 2FVYA 4BVLA 3DLHA 3MRTA 3N39C 4ZQHA 3S2SA 2B3TA 4U63A 4BFCA 5KYUA 3O74A 1QOQB 1EFAA 1E7SA 4ZDWA 4WBNB 4Q3KA 5GZ1A 1SG6A 1URPA 3LA8A 4DAOA 3L4JA 4WD3A 3GZNB 1DEOA 1ODSA 3EEQA 3U3DA 3ZW7A 4AJHA 2KB0A 1MV5A 2WNIA 5AW2A 2WB2A 1YDHA 4RD2A 3PGLA 1Z6ZA 2FW8A 4XH9B 3IX7A 3TDNA 2AHRA 1UKAA 3EW9A 3NQ41 3S1LA 2AQHA 4A8HA 1A9RA 2IIVA 3LF2A 3E15A 2W2PA 5JO0A 2XNSA 1XEWY 4DV6B 2HK8A 4J90A 1Y5IA 3QPUA 3TRKA 1YZFA 4HX2A 4CG1A 4E14A 3FZNA 3KBOA 4MRVA 5DNAA 4UBMA 3N76A 5KZMB 4PC6A 1LLUA 5CUQA 4DV7B 1A95A 4Q1EA 1U3GA 4X44A 4CQMB 1Q7TA 1D03A 3AHCA 4R05A 3FI9A 3CISA 1BVYF 1Z5WA 2Q0QA 1NWCA 3OIUA 4EPVA 1P4SA 4F21A 4R1TA 3VJMA 2VNJA 4Z9FA 4HFMA 2WILA 2G09A 2JCSA 2I2DA 3IHTA 4OF4A 3CJRA 3BG5A 4KPFC 3R7DA 4XASA 4EHHA 5K0EA 4OQ4A 1D6NA 3EXHA 2PUVA 5J2TF 2DHCA 5EESA 1HA3A 3THXB 1BXGA 4POOA 4IDGA 3NHWA 3C3CA 3JRNA 2H31A 2FN9A 3L8FA 1FDOA 2CLEB 5ICMA 3NFRA 2ZPUA 1QCDA 1FJGB 2PM8A 1R15A 3WV5A 5TC4A 2H4YA 3QMWA 3OCWA 4BL5A 1VIMA 4GXNA 4TVBA 4MKXA 4GT1A 4DUPA 3KEGA 1U3CA 1SHLA 3AIKA 2P2CA 2PR7A 2XD4A 1NVBA 3BRWD 3LHFA 3UK0A 2AW3A 2CHEA 1KRHA 1YZKA 2R60A 4DPLA 1HNNA 2OZPA 3LBYA 4MW9A 4A91A 3WP0A 4NDAA 4CLRB 1Y80A 4Z1MD 5K3FB 4AKGA 2GYWA 2AR9A 3KDAA 1LJLA 4FFOA 4YV1A 3A14A 4EMTA 5H3CA 1J07A 4CKWB 2O5RA 2WFAA 4BP1A 4MV9A 4BZPA 1T8WA 1QYDA 4K0RA 2FX5A 1TYZA 2Q2WA 2WMOB 1XZDA 2A94A 4MS3A 4HFNA 2HREA 3U4MA 2C5EA 1T3TA 3Q98A 2FDRA 3NM5A 1N2EA 1X1QA 2NSLA 4KQXA 1I3KA 5FFFA 3ZWOA 2RHDA 5LMCA 1KTIA 1ZRNA 2HJHA 5KNBH 3INTA 4PY2A 1VPDA 3NORA 4KE6A 4RJIA 2GAOA 3WRYA 3CJTA 2RGYA 2QXUA 1VL2A 2PGXA 3I9LA 1SU6A 4PQRA 5I4CA 2X3FA 3CRVA 2H52A 4UHFA 5IK2A 5L3SB 3P4YA 1K3UB 4HGRA 1ESZA 1M7HA 3EIQA 2VPIA 2YUIA 3GZ4A 2OOSA 4URHA 5FYDA 5HS4A 1IZ0A 2WLTA 5M7EA 5I7WA 1B0PA 4KJZA 5I9LA 1JILA 4JUDX 2XJ4A 4JUAA 2R1TA 2IUTA 2Q2OA 3CUKA 3PGA1 4EF6A 3WGYA 3B1ZA 4M86A 3U7QB 2H7YA 5A4KA 1AH2A 3VYTB 3RBVA 4F06A 1N7IA 1P9WA 3ACDA 3I6BA 3OOWA 5F98A 4FFBB 3PR2B 5EXPA 1BMDA 3OU2A 4BRSA 4RE5A 5SY9A 1JTVA 3ROZA 4N0PA 3RS8A 1UFRA 4C3ZA 1ZH6A 4FE4A 1OXXK 2X22A 1GPDG 4GX0A 1RRPA 4JFAA 1JFLA 3LHDA 4MUMA 1K8YB 2WWRA 5DTIA 3B5EA 4RESA 5LA6A 3SSAA 2HPVA 2R00C 1I7DA 1GEGA 5SZIA 1JLKA 3DZ8A 5BT9A 3H6KA 3QMPA 5HUQA 3HBAA 1N92A 2R8RA 3AFGA 4FBMA 5AYVA 3SLRA 3R5XA 6PFKA 5FL7A 2VZ9A 4KQIA 4X6XA 4NOJA 3UTCA 4Z4EA 4JLVA 2JJ8A 5FPQA 3CA8A 5KNCA 1KEZA 1UBNA 1SUEA 3PU6A 4QXMA 2P9TA 3GD7A 2Z5FA 1HEYA 2YFHA 3LDHA 1OXUA 3QWHA 2R62A 1CUWA 3A1SA 4K9QA 1VIDA 3ODPA 3CH5A 3RTAA 4B48A 5JYDA 3D4PA 1G9SA 3HXLA 5DZSA 5JU6A 2FRVA 4NZMA 2Y0PA 4O1MA 1Q0ZA 3FRIA 1I30A 1MO2A 4MGKR 1GM5A 1OYVA 3FXAA 1XDSA 2NU8A 2CYCA 2YQZA 4R1QA 4TSKA 5CP8A 1KMHA 3U9SA 1E2HA 1P1BA 1JXOA 1Q0LA 5E1BA 2ETVA 4G0NA 4UZSA 3AB7A 4LNAA 1G8HA 4C9BA 3UV6A 4PYJA 2VDWA 4MUAA 5B7NA 1CFZA 5F7XA 2R1VB 4N7MA 4EDHA 5KSWB 1T34A 2KLHA 4HVLA 3LKVA 1YBHA 1VJGA 5EZYF 3WFJA 1FRQA 5E7QA 5I45A 4FBGA 4BMYA 2QJWA 4BNVA 4AY2A 1ZC3A 4TYYA 2VRWA 1RDFA 5IARA 1BGWA 4B82A 1N2ZA 3E2MA 4EVQA 4KXVA 1CS0B 3PNYA 3TUIC 2JARA 3GGGA 5TDHA 4BBZA 5TEVA 4C7KA 3NWEA 3QEKA 2FV8A 1S3IA 3SVZA 1A9QA 2H4ZA 3UN1A 1PFVA 1V3QE 3GLRA 4IJUA 4YHHB 4R16A 4LDPA 4PWYA 2BH2A 1YHYA 4AT1A 3HRIA 1WD5A 1KETA 2QMUA 5TV2A 1PT9A 3ZI7A 5AM2A 4E30A 1VA4A 1L1RA 1A7UA 2DTDA 3ZH2A 1PFGA 4JVNA 4A26A 3SF8B 2VJMA 4IDBA 1WO8A 1EFRD 2DP4E 3J80A 4HRAA 4S1PA 5IANA 5LD2C 1QOZA 3AW9A 2CJWA 1A9PA 3UGJA 2F9FA 1AUOA 4BB9A 4HQOA 3CWQA 3ZE9A 9ABPA 2CMKA 3ZK9A 4DV5B 4DA9A 2ZSBA 3HU1A 4I3HA 1KEWA 1UUFA 2ODQA 3F8TA 4I50A 3TI7A 3PJDA 2Y1LA 3DJYA 4JWKA 4JIGA 1QZZA 5F3DA 2FWMX 5SZKB 4WRRA 3FUXA 4KH1A 4F6RB 5FTLA 3F90A 3IE1A 2I4TA 2HQOA 1QH1B 5EN4A 5GZ6A 5KTSA 3CBQA 4I6JA 4FNAA 3UXMA 2H9IA 2IXFA 1SXJA 2CJFA 2GD2A 2OVBA 4NG5A 4FGSA 3TW8A 4DCNA 4W5QA 1KY3A 2IDZA 2PNFA 1X94A 2GD1O 3EVZA 3QNMA 3A0RB 1CQJB 1CZLA 2WFZA 3KEMA 5D5PA 1L5HA 4BO1A 2N9UA 3OZ7A 4Q4AB 3CZAA 4HH3C 4UCWA 5ALDA 4AKHA 3Q9SA 2VYNA 1XC7A 3OH8A 5BW8A 2ZBFA 4Z2AA 5DCYA 2GN2A 1R9MA 1R9NA 2DQKA 1A1VA 4KV9A 1FDWA 2PS0A 2MMCA 1Z5NA 2GTHA 2WF8A 4LYYA 3RVJA 3LX6A 4GI1A 3ZGZA 2K7FA 4F4CA 3SQNA 5D6OA 4RACA 5FI3A 1EUYA 4GL4A 4M8KA 4FX5A 1N7JA 4G4SP 3FGPA 4BWYA 4MNTA 2QSYA 4QTUB 4EOGA 2E37A 5C7IO 4JK3A 1N9GA 3NBQA 1RQNA 3QENA 3DM5A 3KLOA 3MTJA 4LOJA 2IYUA 1QVZA 2QPLA 4Q3OA 4M98A 4RY0A 5I7OA 2ZITA 1QU2A 5KQLA 1N0WA 3KT6A 4PPQA 1ILWA 3IDOA 3ORSA 4FIZA 3L0YA 1HQKA 4QU8A 5F73A 1I0IA 3HFRA 1MQAA 2QUBA 3P5BA 13PKA 2CL0X 2DUUA 3FTQA 3QVJA 3RVMA 1MPTA 3SHFA 4AYWA 3W8RA 3VO1A 1BDBA 3WGHA 4GC9A 5HK9A 4ZOCA 3FOWA 5L40A 2Q2VA 1SNYA 4LCJA 4HJRA 4OTZA 5IXSA 4PQYA 1M6HA 3F1KA 2PD4A 3GCDA 4X6LA 5BOVA 5TARA 1YC2A 1TJ3A 1V1MA 2VAPA 3W2EA 3H17A 1RCUA 1ZGAA 5LLSA 1FZTA 2I4MA 2I3GA 2X23A 2ZPTX 3GFTA 2XNDD 1LBTA 1E3TA 4QSMA 2IXDA 3K94A 4UXJA 2A0YA 3W5VA 4KQ9A 4RZSA 3ZCQA 4UVEA 4B6EA 1TTTA 2F1JA 3GP5A 4CKBA 1MC5A 1MZVA 1EWYA 2YRXA 2EEZA 4AKIA 1ZI8A 4QFBA 2QT0A 4PLYA 4R7GA 4MQ4A 1LNQA 3OWHA 1ODCA 3QLVC 2FA9A 3ECCA 2OSVA 3LHIA 1J8FA 2C7BA 3ES9A 5CX4A 4ZHQB 4GWKA 4NX2A 4JCCA 4QX6A 4CQNA 5K0ZA 1IN8A 1SCUA 2P91A 4EHIA 5A0FA 2H16A 1XTKA 3SY8A 1ISHA 1V6AA 2ZSAA 3I6IA 3JV7A 3ITKA 3LBNA 1YA6A 1U0GA 2JBAA 4DDUA 1JI0A 3W8EA 3ZDXB 3SG0A 5GPBA 3UG7A 4P83A 4CTMA 1L5WA 1C29B 2EKZA 3MB8A 1Z5PA 3D6TB 5AJVB 1FFXA 1GGHA 4PTYA 2GPJA 1IMJA 5JDIA 2HTEA 1X7GA 1T8TA 4HLCA 4UUQA 3DE3X 1Q2XA 4XRRA 1ONBA 2F1OA 4R51A 1JAIA 2P4QA 3HGQA 3IERA 1L5LA 3OU6A 1NOKA 5DWDA 4CG2A 1T1SA 1TCVA 1NOJA 4NBVA 1RQ2A 2FQYA 4TV9B 2VCEA 1QH8A 5BN4B 3R3JA 2XCUA 3BGOS 4MPRA 4ZJZA 3OJCA 1W44A 2X7HA 1M2FA 1Z63A 1G2IA 4AJ2A 5EKDA 1DMRA 5J3JA 1C41A 1SVUA 2F17A 3DHYA 3BDIA 2F1IA 3IJEB 1TI7A 1SVOA 4AUKA 4XFJA 4JD5A 3E5RA 3PNKA 4RFSA 1NNEA 1JNYA 3SQMA 2NTNA 4KL8S 4R01A 2JGEA 4XLZA 1L7VC 2VDLB 3CX8A 3UYLA 1OI7A 2JGKA 2QR3A 1JVSA 2YMQA 2PGLA 4XOIA 5T6MA 3W7VA 1XCJA 4RQBA 2W93A 4J6EA 2QL6A 3F7TA 3KQMA 4MUFA 1ZK3A 3KLBA 4HL6A 4UE6A 2BFCB 4WEQA 3UPDA 5IT5A 3JQAD 4ID9A 2WOJA 2PRIA 3GMTA 5JZ9A 3PXCX 1WU7A 3A25A 3QF7A 2WMNB 2ID7A 4IIEA 2ZVDA 4OKNA 4AJEA 1NVUQ 4C4SA 4D3XA 4D8TA 4ZAFA 1UM9A 5E7JA 4QXPA 1Q6YA 1IOLA 5JY6A 3M1LA 1L5FA 2I67A 1I3MA 1RYDA 2CKDA 3WHPA 2FX3A 1SU7A 2X5NA 4S2UA 1GKUB 1H65A 1PV2A 3QHAA 3G5LA 4OB6A 2NZ8A 4BNTA 2V7VA 4IIHA 2A5JA 1CE8A 4QDTA 1VPWA 5CLJA 5FPKA 2H3HA 1XZPA 3SKVA 2F3RA 3GPBA 5LU8A 3RRMA 1ULSA 2X9NA 4GI3A 5IMSA 2VHYA 2XE6A 4LC1A 3WGGA 1NJSA 3KCQA 4Q7QA 1DAMA 1VBNA 4GWLA 4HMPA 4F9TA 1YDEA 2J67A 5JZSA 4U6QA 5HSGA 5I9SA 4BRWA 2C97A 1V5IA 1OD6A 2C1XA 1Y6ZA 3THSA 3KXLA 5BSKA 4JCOA 721PA 4KG7A 3I4FA 3PXGA 2P8SA 1T26A 3T7DA 3GK3A 1UMBA 4ZVLA 1NPYA 1YS9A 3FOAA 3IEKA 3W3AD 3WLEA 4W5JA 1H2FA 2YBEA 4JNCA 3TQQA 1RJWA 2CXXA 5DW3A 3UY4A 3BE4A 7ADHA 4MAAA 2CFCA 4B8WA 2BJVA 3ST7A 2R6AA 3AESA 2QPAA 3PNLA 3TLGB 2AG0A 2ZR0A 2HJGA 1NSFA 3L7BA 4PE5B 4WZBA 4CKEA 4DLYA 1L4EA 4UQLA 2G0TA 1ONPA 4XIFA 5IEJA 4Q6BA 2HU2A 3FNEA 2OMEA 3T5DA 3IE2A 5IC4A 1AJEA 1UKYA 3T3GA 5K2OA 1QPZA 5IM5A 2ZQZA 1QIDA 4C4XA 1F48A 5SZJA 3JQ9A 4O5OA 3OE1A 1QMPA 4AWBA 4REQA 4W1RA 5B4TA 4DGSA 3BAFA 2WD8A 1BJKA 4JQCA 3F71A 3USCS 4E7OA 5J5AA 3F5MA 3GO4A 2HV9A 4GF5A 3AGQA 1CB7A 4AYXA 4Y9SA 3ROEA 1UJ4A 2IP2A 5FL3A 2NUAB 1TM7E 5ALYA 5A04A 5C1BA 2FW6A 2AEJA 2ACEA 5GJWC 1J00A 4D8VA 1QV7A 3Q5DA 4BLRA 1T5IA 3AZPA 4IX1A 4IIGA 1HMYA 2GEBA 3F4BA 2Y92A 3SZOA 4HI0E 1QS0B 4EY4A 2VJNA 4M0MA 5JS8A 1PGNA 2OHFA 3BHIA 4HUQA 2IY9A 2CE7A 3ASUA 2H18A 2JAXA 1JA9A 1BD3A 2ZYHA 4TQUS 1AMUA 2WNSA 2WKPA 1WXFA 4INOA 3HUDA 2Y93A 4IOLA 1N2CE 1P2UA 1VECA 3L0IB 4KK4A 4M9SA 2N47A 4WKBA 1SCJA 5CXXA 1QANA 4DAEA 2HWYA 4RQUA 2AV6A 1FL9A 3G8YA 3K1ZA 4M1ZA 4B3MB 4ZAZA 1NP7A 1SH7A 2JHPA 2JGLA 2VP6A 1WF6A 4FCTA 3WOHA 4YQFA 2ZJBA 2DXIA 3SPXA 4YLEA 3VAZA 3OZSA 2XSZA 3NH9A 3RRBA 1KDYA 1FA9A 4EHJA 2YQ5A 1FUYB 1IPFA 3IVXA 3KSRA 4INJA 1YIOA 4HH1A 4KACA 4M54A 2IDMA 2NV6A 4W9MC 4CLEA 1P6XA 4RCZA 3SP1A 3TLEA 3LDAA 4IEFB 3WQBA 1CYDA 2Q4BA 4UARA 4PZZA 3S70A 2YJ3A 3O8QA 1EAYA 2ZG6A 5CX1A 3FR8A 2A57A 4R1UA 4MYTA 4UHBA 2B3DA 3JRWA 2VF4X 3OF3A 5H59A 1J0EA 1QUEA 4LY0A 1P4HA 4BFUA 2WC1A 5KVCA 3GZJA 5KNDH 3BB4A 2J0UA 4LJAA 4NS4A 2R25B 4BN5A 3RKSA 1L5RA 4B2LA 1NP6A 3D3JA 1L7QA 5HGXA 4PANA 3SX0A 5F78A 2MYPA 2CJYA 1JPNA 5AK4A 4PXSA 2PKWA 3SLGA 1Z47A 1YIAA 3IP9A 5EQFA 2VYQA 2PBZA 3M9LA 2PL9A 4F11A 3IJ5A 4X8HA 1YOVB 5KTRA 2RHRA 1H8HD 1M8KA 3HKEB 1ZU4A 3UGQA 3DF7A 1NA5A 1E2BA 1RXIA 5FHQA 1ZOSA 2D4AA 3H0EA 4YUAA 3HP4A 2GEDA 2A9QA 2UYYA 3GDGA 3UJPA 2R86A 3B9QA 4D9HA 5FOVA 4MR7A 2XXAB 2UDPA 2J09A 1M0WA 2DEUA 1YKSA 1K92A 1R0CA 3K6RA 3SS9X 1TQ4A 2FPXA 4MQUA 1HYBA 4OHXA 5GV8A 2ZB7A 1RYMA 1J1UA 2ZUDA 3TGPA 5E8RA 2IXEA 1J06A 4IUBS 2UYCA 2QV0A 3D3WB 2VHVA 4F5YA 5E7MA 3RRYA 1Y6QA 2ID4A 2VP9A 3QWFA 1O03A 3RC9A 4PWZA 1R0SA 2XOEA 3DOEA 4FEGA 3ND9A 4DJTA 2M32A 5CTJA 1JEOA 3C3KA 1NDQA 2CFIA 3JARA 4BMXA 2FMIA 1ZBDA 2IPXA 4GMGA 1F2VA 4NDZA 4PLTA 4UJ5A 4ZRDA 5JI2E 1Q7GA 1IK6A 1Y7IA 1QKIA 4G1EB 1XI2A 3HTXA 2AOTB 3SC2B 1J22A 1TZCA 3NP7A 3P27A 1ICEA 2ZRMA 4KIJA 3OZDA 4ZYVA 2DLDA 4R9SA 4PFQA 5KSPA 3VR6H 8OHMA 1OIWA 4F1KA 2VJOA 5AKLA 3KSUA 3WHLA 2QUJA 2QHXA 3QF4B 1DFGA 1Z6PA 2DQZA 3G49A 1O95C 3PIDA 4X90A 2O57A 1G5TA 1KHHA 4QFMA 1YXMA 2P1RA 3VVCA 4TWBA 2WZCA 4FGLA 3TZKA 1TTPB 3CTMA 2Y6VA 4B3BA 5J4KA 4KRYA 3EA5A 2B7LA 1P0FA 1N2SA 3GRUA 3UOGA 1FPQA 4AY5A 2RH8A 4H7FA 3V4LA 2R66A 3MT0A 4NJOA 5K8UA 3FZEA 4ILEA 4N6OA 4WFIA 3T41A 1E0SA 4LRUA 1WE2A 2AXNA 1AXRA 1LSOA 2ADFA 4KQWA 1NYTA 4XYMA 3GQBA 3P0JA 3UA4A 5DXAA 1VB3A 4RD4A 5ED4A 4FFNA 3T4UA 1CUYA 2Y0DA 9GPBA 1MB9A 3BH7A 3VO9A 4O59O 1WDKA 3U31A 1PZXA 1K7YA 3KV1A 3L6OO 4IIJF 1BA2A 2E4YA 4B44A 1ZXXA 2BKLA 2XWBF 3RDPA 2DKNA 1JHXA 2HMYB 2DPHA 4R2WA 5BMVB 1Y4AE 1QG2A 1U2DC 1KQNA 2J7PD 3KXKA 4JSTA 1F8YA 3BAZA 2ZTMA 3IJRA 4H35A 3HV0A 3QEMB 5K3EA 2FWAA 5KIAA 1N34B 1G3QA 1IBLB 2RSLA 4D56A 1KYWA 5AHRA 5AOVA 3QE4A 4IJMA 4KPUB 4MGHA 2G4LA 4L5CA 4DR5B 1E64A 2Q28A 2IV7A 1GHTA 2CHGA 2V6IA 3QU2A 2V0NA 2VLIA 1AQYA 3ZNPA 4OUKX 2RB5A 3BEDA 2NIPA 2WSMA 1EFDN 3I9MA 1MTZA 4R1OA 2WD7A 4C3UA 3F46A 4A3SA 1RJ9B 4MDEA 2GRAA 3KYDA 1T1RA 3TTTA 2G0NA 4YV7A 1VLZA 4QPDA 1CP2A 4B2IA 4C43A 3NP9A 2J8ZA 4HEHA 3AY0A 4UBIA 2P2NA 2NSJA 1IZ8A 5AM5A 1PAUA 1TYBE 4HNGA 1SMKA 1I6WA 2P0YA 2UXCB 3B51X 3EC1A 3QUAA 4P4GA 5K1ZA 4HB0A 2AJCA 3QV2A 2Q9UA 4G1MB 2VRBA 3LV8A 2H8KA 1PT8A 2JRLA 5JNLA 3GOQA 3BOSA 3NW9A 3BS4A 4O4IA 4KKXB 1EP2B 1XTSA 1R00A 1W73A 1CNFA 5G4LA 3UFBA 3THYA 3E6AA 2I2AA 3X1KA 2FUG1 2GFQA 5K20A 2EWWA 3GIDA 2IKQA 3B1YA 3DB2A 2PN1A 1I33A 5KWSA 1JEYB 3G1WA 2ZDQA 2RK6A 3RRZA 3PQ5A 3KYBA 2YJ4A 5JJBA 2O1XA 4IUDS 3CZCA 3KBBA 3FY4A 1YE3A 1GVNB 1QV6A 1BC5A 2ZTVA 4GOOD 2ZAYA 2ZEJA 5IBPA 1E1YA 2XMSA 5JUWA 5KBYA 1BZYA 4W99A 4MYSA 3B6JA 1O1YA