1Q0XH

Anti-morphine antibody 9b1 unliganded form
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
221
structure length
215
Chain Sequence
EVQLQQSGAELMKPGASVKISCKATGYTFSSYWIEWVKQRPGHGLEWIGEILPGSGDTIFNEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARWVLDYYGMDYWGQGTSLTVSSASTTPPSVYPLAPGGSAMVTLGCLVKGYFPEPVTVVWNKGSLSTGTHTFPAVLAADLYTLSSSVTVSASSWPGQSVTCNVAHPASSTKVDKKIAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 9B1, light chain
publication title Anchoring a cationic ligand: the structure of the Fab fragment of the anti-morphine antibody 9B1 and its complex with morphine
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 215
sequence length 221
ec nomenclature
pdb deposition date 2003-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q0xH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q0xH02
4MB4A 4E0RA 1JK8A 4WY7H 1CFNA 3MRIB 4MD4B 4N5UA 3BN9D 2R56L 2ZOLB 2D31A 1NEZB 1FZMB 4PV8A 4HLJA 3MRFA 5F9DC 2G5BB 2P8LA 1PQZA 3HAEH 5SX5H 1KTLA 3GMLA 4XNYH 4XP5H 4DFIA 3BQUB 1S7UB 4N0YL 4J2XA 4XNXL 3PXHA 5ANME 4H0IA 1HYSD 4EN3B 2Q76B 1EO8H 4QRSB 4ZUTA 5B8CB 4FQCH 2WMPA 1KGCE 1HKLL 4X80L 2B4CH 4MA3B 5EORH 2X4QB 4XP6L 3T08A 3BEVA 3MJ8B 3QH3B 1KIRB 3ULVH 1NFDF 2EKSB 1T04B 4F7TA 3MOQA 3X13B 1K9TA 1X5HA 3HC4L 1B0WA 2NXZB 4YJZL 2VZ1A 5J12B 1KEGH 1RUAH 4G8GB 1A3LH 3IDIB 4FHBD 4PREA 3IJSB 3B3IB 1GSMA 3QWRD 4LVHC 3VXNB 4D8PA 1LD9B 1U8NA 5HHXL 4KWUA 2FX7H 1JF1A 2E7MA 4R2GB 5FUOL 2AEIT 3AC0A 5DJYB 1MFBH 4BUGA 1P7HL 4J3UA 4X5WB 2X4TB 4CVZB 3MXWH 1X3DA 4NQVA 3B5TA 3DMMB 4N8VB 3ZKNC 3V5HB 2CR3A 1D6VH 1D7FA 2VZOA 5KSUA 1RK0B 1OSPL 4URTB 2J4WL 3TCXA 2O26U 4MJ4A 4HJGA 3UTQA 3ZDXE 1JWMA 3JUYA 3KNBB 4LIQL 1E28A 4NT6B 3RNQA 4DOHE 1NBVH 4OFVA 4FQXA 4MQXD 1NFDA 2BVUA 3U7YH 5CIPB 4Z7UF 3P9LA 5D7IE 3BGAA 5EO9A 1S7RB 5INDA 4X99A 2UWEE 2IAMD 1CGVA 2C3WA 4R4BB 1J1XH 3BWAB 5DGRA 1MJ8L 5BZDB 1UXSA 1BREA 6FABH 4PJHF 3CX5K 5F9WB 5F9JA 5M94B 2OQJA 3TYFA 3OXRA 1YYMH 4PJXB 3L3HA 2VDPH 5DUML 4KI5E 1Q1JL 4X9FA 2AV1A 3RUGE 3VXOB 3T4AA 3Q5OA 1XF3A 1PKOA 1MCSA 5JDSA 3P73B 2V7NA 3VXQA 5DHXB 1FV1A 1RMFH 2DMKA 2YKLH 1DQMH 3QUYC 5JHDE 3P3YA 4L5FH 3HHRB 3MPCA 5E00B 3IXAB 3LY6A 4PJAF 4YDLB 3NBNA 3B9KC 4DKFH 4N0UA 3KJ4C 3HMWL 4L3CB 4EBQL 1WGOA 4HKXB 2Q7YB 5D1QD 1BEYH 1KLFA 2IJ0C 3O3BA 2PYED 4X5XB 4OF7A 3ESVF 4OCLC 4Z7UA 1WCBA 1NLBL 5EZJA 1L7TL 5I71B 3ULUD 3WUWG 4JR9H 4YIQA 2GT9A 4KI5C 4UV7L 3QXAB 1I9EA 3O3DB 1ZVSA 1BZ9B 2X10A 1VERA 1YC7A 1DJSA 3SDYL 3O4OC 4BELD 4PJHA 1U8MA 5EBGA 3U0PA 2GITA 2IH3B 4D0BA 5DHVA 1EEUA 4MCYB 4PJ5E 1LGVA 1MQ8A 3VXPB 2AJZA 5IGXL 1RIVH 2KL6A 3AREA 4KPHL 5J13C 1PLGL 1TZIB 4LCWE 5C0IB 1UJTA 4P4RB 4FQLH 2Q8BL 4QXUH 3S36L 4KKNA 5C0DB 2NX5A 2Z92B 5IG7A 4PUBL 4XMPH 4S10A 1UFUA 2YD8A 4PJAA 4MNQE 3T1WA 4GAYB 2OX5A 1YEFL 3OPZL 1IQDA 1Q72L 4D2NA 4F33B 3QZWA 3CDCA 5IB2A 5IQ9B 3EDEA 3EFDL 3HFML 4P5TA 4ZXBA 1RPQA 3WHE1 4Q0XH 2F58L 1MHHA 1CXEA 2Z31A 3QCVL 4QT5A 4PRAA 3X3GL 1R3IH 2MPAL 3A67L 3AM8A 4J4PD 3L9RB 4HC1L 2WQ8A 4RFNB 5HHQA 4I3RL 5D8JH 5IB1A 1EZVX 1UYWL 3BGFC 1N8ZB 4NP4L 4HIJA 3ZE0F 4EI5C 4BZ1H 1S9WA 2C4FT 3QAZC 4ODWB 2E7CA 3PWJB 3LSOB 1X6LA 1OOAA 4MD5B 4XMKH 1Z9OA 2W65A 1CBVL 5EU6B 1NANI 1W8OA 2IQAB 3VD4A 1BFVH 3RTQD 2XG4A 4CVXB 4OLZL 2FD6H 1FVDA 1KF9B 4IIQC 1FLRL 2NW2A 5SWZE 3QWOA 3JWOH 1T1XB 2IPUG 5ICXB 1AKJB 2AJVL 2XQYK 3CIQA 2F74A 1M7DB 4NJAL 1CGYA 3SO3C 1HQ4A 4XPHL 3RWIA 3S88H 3PXJA 2NYYC 5JLZA 2BNQA 1ZLWH 3WKML 1MFEL 5I1CH 5D2LE 3C2AH 2C4FU 4QGYA 5HVGB 3NFSH 1Q0XL 4TOYH 2P24A 5IV2A 3CFCL 5ACZA 3QDHA 3SDDA 4Z78B 4WI8A 1DCLA 3REVA 3E6FB 1AGCB 5L2KE 4Y16D 4MNGB 2FHFA 1FNSL 2MNUA 2VZUA 3BEWA 4JZJA 5FA3A 3N1MC 1FO0A 3VXSA 4MA8H 2W0PA 3AU1A 1RV6X 5T3ZE 4QRUB 4JO2L 3KDMA 5FKAA 1KPVB 4NFCA 4G7VH 4HEPG 1JGLL 5MENB 4B53A 3I02A 4XVSL 2DQFA 3QEGL 1N6VA 1S5IL 1J12A 3P77A 2D0HA 5IKCA 1U8KA 5HHVH 1R3HA 2NY2C 4BSVB 1FIEA 4CGTA 1CFVL 2JJWA 3FRPG 4BZ2L 1IJ9A 4IRZL 4NZUH 5EO0A 1OAXH 3EFFB 2A9NH 1NCDH 4Z7WB 3IGAA 3DWTA 1N64H 1EJOH 5HHOA 1FL5A 4OZGB 1NL0H 4OGYL 3VXMB 1LO3H 1TVHA 3MODH 5D7KD 5T3ZL 4C83A 2R0LH 1GGIL 4OZFG 4PTTA 2P8PA 3OR6A 4U6YB 3NIDF 1Z9LA 4L4VA 3UTTA 3VFMA 4KDWA 1ES0A 2BSSA 3EO1B 3SDDC 2VYRE 2D7TH 2MKWA 4HPYL 1LDPL 1QLEH 1S7VA 3SDXF 2I9TB 4GRWH 4PRNB 1HEZA 3S35L 4KHTL 3O3EA 1OGAD 3HNVH 2AK1H 1C08B 1VFBA 1E4KC 1ULVA 1T89C 1H5BB 1QA9A 1XCQA 1RIHH 1VHPA 3U0WH 5IROC 4NWTH 5HGBB 4N0RA 4NO2B 2EEAA 3B9EA 4NUJB 1V3LA 1ZHNB 2HJFA 4KU1A 4CUCA 2DQHH 5BO1L 2X1XR 3NTCL 3FTGB 2JJSC 3WDHA 5E5UB 4JFPB 2HVJB 1ZLSH 3MRMA 1QPXA 1PYWA 3WNLA 4NBXB 1WIOA 1AQDB 4H8WL 3C09C 3A6OA 2VIRA 3FB6B 1NAMB 5DMGC 3G6AB 3KHOA 4M62H 4ZMAT 1EHXA 5C0CA 4NQDA 2AJ3B 2Z91A 4MB5A 4JHZA 4RFEA 3RIAK 4APQB 2FSEB 5E6IB 1A6UL 4IEFB 2LTQC 1KJ2H 1EHLL 1PDKA 5ADOH 1YEJH 2FYYA 1IAOA 5FKPA 2N1KA 4MYWB 3DO7B 5ICYB 2JE8A 1IC7H 3IAGC 1CE1L 4R4FL 3BDYH 4YFEA 3FN3A 4G6ML 3EJYC 3W2DL 1ZVYA 4QOKA 5GJSH 5HPMB 2DICA 1INDH 1UWXK 4PRHA 5E08H 1X5KA 1MREH 5DURB 5FCUL 3L5XL 4U6VH 5J6GA 4PJCE 1KELL 2UUDK 2VXUH 1XGYL 4L1DA 2X1QA 3KPLB 4PRBA 3KPQA 4BFGA 1JYVA 35C8H 4H1LA 1JGUL 3SGDH 3OJMB 3OKNA 3EYSH 1EBPA 5LVEA 3HE7A 3NZHL 4K71C 5E2WH 3OKKB 1YEIH 2YRLA 4OKDA 4PLOB 5DSCB 1GHFH 2XN9E 3QEHB 5KAQF 1Z5LA 3QFJD 4JPVH 1MNUH 5D1ZB 2DQDH 3AS3A 4NQCB 4M3KB 1WFUA 4KMLB 1Z9SA 5DK2B 4MS8C 1AFVL 4IOFC 3ARGB 1MCWW 2H2SC 5JW4Q 5D2NB 2X4RB 3G5YB 4KTEL 4L29A 2ESVE 4XTRD 2XZAL 1A3RH 2EZ0C 2NTFB 2FO1A 3S37H 1G7PA 2DYPD 5EC1B 3FB8B 3HNSL 1HHIB 1ZAGA 5FO8B 5SX5K 4RIRB 5CZXC 3IB4A 4IRSD 4LSVH 3ORJA 3QUXA 2HJKA 5LBSH 2APFA 4Q6IA 3MLSL 4DUVA 1TFHA 2F54B 4I0PD 1YY8A 4NUGL 3GKWH 3TH3T 4XB7A 3MV9B 1AXTH 3K1DA 4FG6C 5JUEH 1YEGH 2OP4H 1G9EA 1QSFB 4R97C 1CLZL 2RGSA 3KYKL 4RMVA 5LG1A 4JM4L 4QRPE 3U1SH 3GM8A 3MLYH 2I60H 5BQ7B 1KUMA 5KG9A 3MGOB 4ZUSA 5C0RL 2FATL 1EO7A 5HYSG 4K8RC 4K3JL 4OF0A 4PJ5D 1I9IL 5EN2B 2ZNWA 3DURB 3ZHKA 2P5WD 3PP3K 5EOCH 4Y1AE 3VG9C 4DKAA 3UZQA 4ZG1A 1UACH 1ZSDA 2B1HL 4O51A 3IRZA 2DM2A 4OZHE 3O9WC 2V2WA 3LRGA 3O11A 1R3LB 1A4JA 4KKLD 3OMZA 3QHTC 5DWUL 4G8EB 3RWDB 3TFKD 3HI6L 4WHYG 1R3JA 2B1AH 3GHEL 3QA3A 5F1SA 1I85A 1KC5H 1OCWH 3MXVH 4K23H 5FK9B 4PJIE 2IPKA 2R9HC 4U6XA 5CKGA 1AO7D 5DQDL 1JMZA 2ED8A 4YHIA 4JHWH 4ELMF 3MCG1 3PJSA 1G1CA 4HKBB 4JDTH 4M4RA 4N90D 4X0KB 4XNQA 1AD0A 3WBDA 3WJLA 1KULA 5DJAB 1P1ZA 5DQ9B 5A3IC 4JRYA 5K9QG 5C7XH 5MP6H 3U4BH 2EDWA 5DC0A 3WV0A 4LLYB 3HN3A 5I8CA 5BMFH 3LKPB 3G08A 5GS0H 1XGTA 5C0JB 3BKCL 3MREB 4LLMA 2OZ4H 3CXDL 2C7UA 1IAIM 4HSQA 4RSVA 5L88L 1KPRB 4XP1H 3EYFB 4KJYA 3G9AB 5DJ8B 5E99L 1FYTE 1GGYA 1FGVL 4HWZB 5IESL 1YMMA 3CFJB 3HZYB 4JO4L 5FA4A 2LAAA 1F4YH 3MRDA 3D85A 1MCEA 2MCPH 4R26L 1U42A 1JZ2A 4D3CL 3GNMH 4Y4KD 2JLLA 3C6SB 2EDOA 5INCA 5H94A 2EE2A 2FZ3B 4U1JA 2AV7A 2DKSA 3C6LD 4DCQA 4ELMA 2XNAB 4FXKB 5IFHH 1A2YA 2OR7A 2PW1B 5M95B 5D7SL 3FRUB 4AYFA 5DJ0B 1Q9WB 1WZ1H 4NQEB 4ZUVB 1EUTA 4F7PA 2EXWC 4PY8J 4P2QE 3RY6A 4B7LA 5ITBH 2FWOA 4ZPTB 1AC0A 4FQJH 1XGQA 4OCWH 4YAQA 3I3DA 5TPWL 3T8XB 1E4JA 2EEBA 2WBWB 1TZHB 5I16A 1P4IH 1AQKH 4GRLD 4Y2DD 4X4MA 4JFXB 3HG1A 5C08D 2VLRB 2DM7A 3RL2B 1WTLA 2A6IA 1YEHH 5GPRA 3RX5A 5JQ6H 4FQQA 3PDOB 4UAOC 3C87A 5AAWA 5E4EB 3VWKC 5DRWB 4QHNB 1EK3A 5H2BB 1ZE3C 1GIGL 1ZHBB 4JPKH 3QNXB 4MD4A 4O9HL 4PGEA 1YNKL 3TIDB 1NEZA 1FZMA 4OCYL 4Z18A 5GIRB 2R4RL 2NQCA 4WFHD 1PY9A 5KBNC 3ULVF 3ULUH 4WHTB 4OZIB 4S2SB 5KZCB 3BQUA 1S7UA 1EZVY 3TV3L 5C0FB 2HKHL 5I17B 3LS4H 4KRPC 4QRSA 1OARH 5BW7A 2GJZB 4S1DC 3DYPA 1MI5E 3Q5YA 4UQ2B 3WD5L 4EUPG 2X4QA 3ECBB 1IFHL 1H3VA 1DBBL 4LSPL 3VW3L 2NY6B 3QH3A 4WW1B 1KIRA 5I19H 3MV8B 2EKSA 3DGCR 1IBGL 1T04A 1Q38A 1CD0A 1P69B 3MRQA 5BS0E 3X13A 3VXUB 2XY1A 2FGZA 2EDLA 1F42A 5EO1B 4X7EC 4G8GA 1HILB 12E8L 1CWVA 1XFPA 3FHAA 4I18B 4KUCF 3B3IA 5E8EB 1ETZA 2AXGB 4IHOB 3W39B 5CILH 3RY6C 3QCUL 3VXNA 4JPIB 1LD9A 1IEAB 2GSGA 3P0YL 1FORH 2FH8A 5F7YC 2P5ED 4WI2A 1HIML 1J88A 3D2UD 3CZJA 5DJYA 1JZ4A 5KJRL 1YEEL 4HCRA 3NACL 1FH5H 4PJXF 2LE9A 1IGMH 3NPSB 4QRTA 2X4UA 4DAGH 1NLDL 3LKSB 4HS8L 1MIEH 4N8VA 3C5JB 4WTZA 3SE9H 4AJ0A 2QV2A 2DIJA 5TFSH 2OTWB 3I3EA 1AXSB 4PJ8B 5FYLH 2LV4A 1CLCA 3C5ZA 5HYIA 1ZLWK 4NNXB 1NC4D 3MZTA 4DK6A 3KNBA 2KZ1B 3X12A 3MLWH 1L0XA 1VGKA 3SCMB 2EDXA 5CIPA 2EIDA 4YBQC 4OM1L 2NY1D 3BQUC 5FECA 1PG7X 1NC2B 4KDVA 4EN3C 4OGAD 3RWFB 4JGUA 5B8CC 5L6YH 3BWAA 2FL5B 5BZDA 2NY5C 5I1HL 2W9DH 1I75A 4U05A 4GJTB 3V4UL 3G04B 2V17L 5ESVA 4HLZH 3MLRH 4PJXA 5IIEA 2B0SH 5F71A 3CFIC 4LEXH 2NY5L 5IFJB 2AJUL 2F53E 2HTLD 4CDGC 2NXZC 3B2VH 4DGIH 5IBUB 5LGHL 4GOSA 4TNWK 4F7EA 3RWCB 1BM3L 5D70L 1WBZB 5E00A 3IXAA 4NRXA 4L3CA 5JZ7C 3LN4B 1CXLA 2P1YA 3VFSA 5IVZA 5CEXA 2V5SA 1MCKA 3H9SB 1BWMA 3EZ8A 3QDMA 2QQNH 1LO2L 3DMMC 3RWHB 2ZPKH 5C9JB 3ZZ1A 2EEDA 4XBEH 2ZUQB 4H88H 4KQ3H 2FJGB 4YGVB 4KKBD 4RWYH 3QXAA 3GM0A 5JO5B 3O3DA 4QLRA 3HI5L 3PIQA 4PJBE 5DHYA 4X6DE 4F8TA 2ED7A 5ADPH 3EOBA 4M1GH 5LJYH 2F5BL 2IH3A 1AGFB 3VXPA 1H8SA 4LCIL 3W0WB 3DHJA 1WZKA 1T2JA 3QG7H 1JFQL 1F58L 3V4PL 1A7NH 2XA3A 4P4RA 5HYQB 2BSED 3UZEA 3ARPA 2WSKA 2ICWB 3GSWA 2Z92A 2Y25A 1W72H 2CDGA 2P42B 2DLTA 4YO0A 2QL1A 2AKRA 4U1LB 5F9WC 1WEJL 2CIIB 1HCVA 5B38B 1J7VR 1JWUB 3ZYOA 4WFFD 4HD9A 5GRJL 3UAJC 4QRPD 1TQCB 1F2QA 2Y4SA 4JGJA 4F3FA 2VXTH 4OLUH 5IQ9A 4DTGL 1I7ZA 4MJIB 2ADFH 5C0AB 1D5IL 1F4AA 4I48B 2R15A 3MNVA 3L9RA 2EDHA 3OZ9L 1CGUA 5DJXB 4YDLC 2D4FA 3WN5B 4AY0A 5DMYA 3WIIL 2A74B 1N8ZA 1QYGL 4UQ3B 1IGCL 1NDMA 4LASH 3L6FB 4CAGA 3QIBA 5EPMA 4NO0D 3PWJA 2ZCKL 1QLFB 1G7QA 5EIIA 5I1EH 4MD5A 2RBLA 5EA0H 4O2FA 2CDFB 5I71C 3JV6B 2IQAA 4TNVK 3BESR 5GXBB 4Q9RH 3S3JA 1MWAL 4ODUB 1AE6L 4CVXA 4J3VA 3H42H 1JYXA 3MA9L 4OFDA 3OV6A 4HMCA 2ZSWA 1T1XA 4MAYB 4LNRB 5ICXA 1AKJA 4FN0A 3H3PH 4EQ3A 3INUH 5IR1A 3QEQA 3E2HB 3B4NA 5FDWB 4OCRH 3IS0X 2J1KA 2VLKE 4GRMB 3BZFB 4U7SA 2EXYC 1T1WB 4GQPH 1VCAA 1U91A 4PRPE 4JN1L 1NSNL 3GI8H 1I1AD 4JFEB 1YN6B 1MVFA 5A40E 2DTML 3GDBA 4PRIA 2IFFH 1CDIA 1GOGA 3CU7A 4Z7WF 1FNEA 1ZGLM 3BRGC 1D6EB 1RULL 3E6FA 1BFOB 5DO2C 1MFNA 4KK6C 3QHZL 5EU6E 4OZGF 4WUKH 4GW1B 5C09D 2EKJA 1NGWA 1NGXA 2BC4A 2EDYA 4XWGH 4MNGA 4P23C 5EZLB 1L4IA 3FONA 4QRRD 1DDHB 4OT1L 2CJUH 5I0ZA 4QRUA 3ILPB 2ARWA 4K7PH 3CPLA 3HUJF 4RFNC 3SGJA 3JV4B 3S5LB 5DLML 2Y07L 2W59A 2R0ZH 3SO5A 4G9DB 4MDJA 2WBJB 5TDNB 8CGTA 1K4DB 2NLJA 1IZKA 5MENA 3LS5L 2BFVL 1J0ZA 3RI5K 4XHJD 3KPOA 5JIPA 3QCTH 3QO0B 3DETC 4A2MA 3BUYB 1I3VA 4BSVA 5JXED 3F7QA 1H3PH 4P2QD 4J3XA 4OAWA 5JR1H 4LHUB 3RGVA 1UB6A 3P2TA 3V52L 5HI3D 4NSKB 3EFFA 1F90H 3F5WA 4Z7WA 2MWCA 1RFDL 2DI8A 3CFDB 1DQTA 5K33A 2IBZX 4OZGA 1CN4A 3JZ7A 2BJML 4ZFOB 4Z9KB 3U4EA 3QNYA 1K4CA 1S7SB 3Q6GL 2Y5EA 1CDJA 4U6YA 5HD8C 2Q87A 2A0LD 1A7QL 4H0HB 1QFWI 3VA6A 3T0ED 5IJKA 3HUJA 1JHLH 1ZOXA 4YZFF 3CVHB 5GGTH 3A6BL 5I6XB 1I1RA 3IS1X 3CK0H 3QQ9D 3RVTC 1MCWM 4LOUD 3JWDH 1G9NC 1PKQB 1WIPA 4Z0XB 4M9PA 2PW2A 1AY1L 1INQB 1BLNB 4TQEL 5GHWL 3Q1SH 1G9NL 4O5LH 1OTSD 4JM2A 3SJVB 5A43C 1CIDA 3JBG7 5EB9A 3SGJC 4WI9A 2YK1H 2OL3L 3FQXB 1ZHNA 2E5EA 3O4LD 5TDPB 4LAJH 4ERSH 4JFPA 5DD6B 4R7DA 3C60D 5ILTH 2COQA 3CGTA 1AQDA 1CK0L 4JO1H 4GXUM 4BH8A 4NCC2 3RWGA 5DK3A 1PX4A 3SE4A 3NFPB 1NAMA 5D5MA 3MNZA 1GC1C 1N4XH 4APQA 2OI9B 4GBXD 4ONGH 4S0SD 4QHLB 4MXWH 3QRGL 4HXBL 5F6IB 4GKNA 3EYQD 4NZTL 3EGSB 2WK2A 3QJHB 1GC1L 5D71L 4EIGB 3IDJB 3VH8G 2AW2A 5SWSB 3TT1H 1UXWA 3HAEB 1EBAA 5IJKC 5F7EH 3WNOA 1V8HA 3HB3D 3GJFA 2FGWL 3VXRB 1BFSA 4HF5L 3D39B 3KPLA 4FQ1L 4G6KL 3BZ4B 3N9GL 4BYHA 1I1YB 2HMID 4AL8L 3OKKA 3MUGA 1LP9E 4M02A 5FUCC 3O6MH 4YHPB 4C56B 3MV7B 2W92A 3IFLH 3V0AC 5FF6A 2QKIB 5BVJB 1JNHA 1YECL 2BY1A 2VH5H 1H5BC 1FBIH 5HYJD 4WV1B 5DK2A 2AGJH 4YE4H 5FM5M 3ARGA 5DJ6A 4ZFGH 4GQ9L 5ISZD 3P30H 4JQVC 4KROD 2X4RA 2P47B 1ZK9A 4XPAH 5D72H 3OJVC 2F53D 3IFOB 3FQWB 3ET9F 2X7LA 2NTFA 4JG0H 4ZAKA 4L3EA 5EC1A 3FB8A 4DGYH 4PIRF 3QUZD 5E6IC 3PWNB 4RIRA 3BO8B 3QIWB 1JUFB 4Y5YB 4X6CB 3RVWD 4MAUH 4ORGB 4HWBL 5MEQB 1LO0L 2F54A 2GJ6B 1U6AH 3QXDB 1HCFX 3K74B 3T0WA 4JFDB 1EEYB 2R1WA 1MF2H 1HDMA 3BZEA 2HT3C 1XIWB 5L9DL 3Q6FA 5FCSH 5EIQA 3VFVB 3OG6B 1U3HB 4UOW0 4KI1A 2FEEL 4YQXH 3VXTA 3EUUA 2CQVA 5BQ7A 4LSSL 4LQFL 3MGOA 2J88L 1I9RH 4DN3L 3JTTB 4YXHL 1RUPH 3L5JA 4P2RD 3ME0A 1IM9D 5EN2A 4XNUL 4LCCB 5E2UH 1IQWH 3DURA 5EBMA 5I74C 2FB4L 4M6NL 1QNZL 4PJGB 5D7LA 4ZS6C 4M9OA 4OQTL 3TJEL 4UIKH 1HWHB 4NKMB 4TUJB 3WIHH 3FO9B 3OKMB 3VFWB 3M17B 3ETBF 5D1ZC 2FO4B 4OCMC 4G8EA 4RNRB 2CLVB 4K7FA 3TYGL 3K4DA 4GUPA 4ONFL 2B8OT 3TJHC 1DEEB 2JF1A 3HE6C 1VEOA 5CBEB 5JPMB 1VACB 5D2NC 4U4BA 4YDJB 3ARTA 1ACYL 4RBPH 2BY3A 4GAJH 4OSUL 1XF4B 5E7FA 2DOCA 3H9HB 4JG1H 4X8JA 5I1GL 3DI2B 3WFBL 2Z9TA 3D48R 4J1UB 4HKBA 2JK5B 5F1KC 3LMJL 4ETYA 4F57H 4GXVH 4YX2H 4FQIL 3FFDB 1MCPH 5DQ9A 1U8LA 3UXFA 4N0UE 2KDGA 3BI9X 2FLRT 4XXDA 5I18H 1PX3A 4LLYA 4XBPB 5I1IL 5I1KL 3PWPD 1CLOL 3GRWH 3LKPA 2PXYA 5A16B 4M6MH 2VDNH 4U0QB 3EYFA 3BP4B 4KZDL 1KSRA 3D9AH 3KLAB 3TEUA 2WUCL 5L8KB 4HWZA 2D3VA 4XGZA 3CFJA 3HZYA 3PV6B 4OF6A 1VDGA 5KSAD 3PP4L 1AIFB 3N1GC 3GHBH 3OB0K 5F72S 5EOTB 2WQRA 2ADJB 5GRUL 1A9BB 4Z95H 2VLKD 1MQKH 1MCFA 1QSED 3R0NA 5FIEA 3LD8B 1VFUA 4WO4C 5IBTH 1PZUB 1U58B 2XWBB 4Z7VB 2ZUWA 2H32B 2Z93B 5C07E 4U3XA 2OZ4A 5F7LB 4OZIF 1MJ7H 3K4AA 1GGCL 3QJFB 1LK2B 3FFCB 3FRUA 2F8OA 2J6EL 3LEYL 4ZUVA 2C4XA 4OB5L 1WF5A 4AH2B 4WFEE 2UVEA 2VDOL 4YDKH 1P5UA 2R4SL 4U1HA 1A7PH 1AGBA 4OIIH 4P2OD 1OW0A 1A02N 2JB5H 1QOKA 3OKLB 3T8XA 4OFYA 4MQ7A 1FVCB 4YH6A 1JRHH 1A6WL 3CSPA 4JFXA 3IDNA 1MCOL 2HTKD 3OAZH 5LQBH 3RL2A 5IEHB 4W6WB 4R8WL 2Z8VC 2BVTA 3OKOA 4X7SH 4BQCA 3BP6B 1OQOA 4MWFA 5DRWA 3M45A 2BY0A 5H2BA 3H7LA 3QNXA 2FEEI 3LQAH 4LLDA 4UMGA 3TIDA 2V7HB 3MRJB 4MCZB 4MGXA 4JFFA 4F58L 4EI6B 2V6HA 1H8NA 5HHMB 2XA8H 4NQEE 1HHJB 4Y4FA 2APXA 4J3OC 1JZ7A 4YNYB 4WHTA 4OZIA 3CH1B 1HHHB 5CP7B 1WTGT 3RZCB 4PG9B 4YUEL 5E8DL 2GJZA 3IDXL 3NN8B 1A9EB 4MNHA 1MCQA 3GBML 4N1CA 2AXFB 1NMAH 1PSKH 4UTAH 1J5OL 5E0QA 3O45A 4M1CC 1EH9A 3KPRD 3WLBB 3MV8A 1RZJC 4BK4A 4LSUL 1UCBL 4IDJH 2RIKA 1CDGA 4XCCH 2V9RA 3VXUA 4DW2L 1SY6L 2BSTB 5EO1A 1BWWA 4AK1A 4H1LG 2AXGA 1KPUB 3W39A 2DQCH 4JPIA 2YPLD 1I7RB 4LKCB 3D3VA 1AJ7L 3CSYB 5IJVA 3BP5B 1OW0C 5CWSA 4LLAA 4CU8A 4QXTB 3DLQR 4B7IA 1NBYA 4JO3L 4JY5L 4JVUA 2DF3A 2HFFB 5F1IB 3VJ6B 2ZCHH 3PWUB 4E41A 3UC0L 4HJ0C 4HUWA 3LKSA 4NHUB 4P59H 1HXYB 1KTRL 5CEYB 3QDJB 5DD0H 4ZTPL 4PJ8A 3ARZA 2FIKA 2PR4H 4LAQL 5ITFB 4WWKB 5AEAA 4NNXA 4YHNB 3AMKA 3B8SA 1R0AL 1IEBB 4HWUA 4LLUB 3RWJA 4IM8A 2AQ1A 2Y1VA 2OK0L 2X4PA 2CKBH 3NOIA 4Y7MA 5DMIL 4CMHB 4DVRL 4OLEA 3MRGB 4ZDHB 4PJDB 2W91A 1X5XA 3OGOE 3SCMA 3KAAA 2WZPD 3RDTB 3KYMB 4NN7B 1ZEAH 3L3GB 1WQVT 2M8XA 4JB9H 3RWFA 4YEEA 3BOVA 4H26A 4FABH 5E8OA 4ETQB 5HHOE 5C0BD 3T04D 3RHWK 1AR1C 1BGXL 1ZT1A 4OF3A 5KAQG 2E7LA 1Q9LA 3G04A 1JTTA 1KB5B 3I2CH 2NY6C 4Z7OE 4UT6L 1NGQL 3P4MA 2DLFH 3CUPB 4HMDA 4ODHL 3QUMB 1D5MA 3JVGC 3UYRH 3BSZH 4PJ9A 5HDQH 5DUPL 3C8KA 3KPMB 4GRWB 1Y6KR 5JW4R 3TN0A 5KVDL 3RWCA 3ZE2E 2AERT 1NKRA 4I18C 3V95A 1WBZA 2FH6A 2IBZY 5DR5L 1BQUA 1F4WL 1QUNA 1BD2A 3A6CL 4K3EH 3LN4A 3EIFA 4PLKD 2PO6A 1DUZB 2GUOA 3NCYS 1J1PL 2EYSB 3HMXA 3MNWA 4L3AA 3NPSC 3P4LA 3RWHA 4BFIB 3U36B 1P7KB 5C9JA 1ADQL 3DV4B 2NY0B 4XCEB 2FJGA 4YGVA 3KXFB 5F96L 2EC8A 2UY7A 4G7YL 2X05A 4YHLL 1KCSH 5K59E 1QEWA 2H2PC 3VFOB 4D0DB 3UTSB 4YHML 1FDLL 3W0WA 4OI9A 3IU3B 1BMGA 1K8DA 1CL7I 3MJ9H 4RISH 5IF0B 1V7NL 3SCMC 1GRWA 2WIIB 3DPBA 3NIDE 4P57B 4XVTL 1Z3GH 3MGTA 2WUBH 4P3DB 3P4NB 1QHOA 4OFPA 1DLHB 3TO4B 3H9SE 2PTUA 3KGRA 3E8UH 5F7HA 3FKUS 4ZO6A 4RMRA 1OQXA 3ZDYE 4WI3A 5EZOH 1NCBL 1XR8A 5A2FA 4QOKE 5IOPA 1Q94B 4RAVB 2YXMA 4JRXA 4PRHE 3ZKXB 2ZNXA 4M48L 5C0AA 3CXHJ 3U9UB 1KENH 3LKNB 2OXHA 4I48A 3VDBA 4FQXD 4PYGA 1N5YL 5GGRA 1N5AA 3U48A 2HT2C 1EDQA 3WN5A 1JGEA 3LN5B 4UQ3A 1JPST 3EDFA 4M1DH 5FOBA 2DQGH 3D0LB 1E6JH 2ZKHL 1AGDB 5HDLA 1RIUL 1S8DB 3CFEA 3ZDZF 1KJVA 4A6YH 3HZKB 5TF1L 4KAQH 5MERB 1J8HB 3RY5A 3JV6A 1MH5A 2CO7B 2ZUQC 2E6PA 4ODUA 2XRAL 1P6FA 2DWEA 5MEPA 2EE6A 25C8H 3I50H 2VC2L 3MCKA 4YXKH 4NKIH 1RZIB 5DDHB 2IQ9H 4P3CH 1IC4L 2B5IB 2C1OA 1GGBH 4Z7QF 4GS7B 4XVJH 2KKQA 4XPBH 1JZ5A 5JHLL 4XAWH 5FHAL 4WHYH 1A14H 1NEZG 3U6RA 2J12B 1HINH 1EPFA 4FMFA 1CD1B 3CX2A 4OIBA 1A0QL 5IFAL 5HGDA 1JPSH 5CLTA 3PQYB 2DQEL 4LPVA 1D6EA 4OI8A 1BFOA 3S8WA 4GW1A 4D9QE 1TQCC 4Q97A 2QHLA 4WFGE 4MMXC 5DEFB 5KS9B 4WEMB 8FABB 2ZCLL 1Q9KB 3AAZB 2H1PH 1MEXH 1CG9B 3MA7A 4XPFL 3EAKA 1YY9C 4N9GB 4OZ4B 1MRCL 5E6YA 1BAFL 4O2CB 1T0NA 3VGEA 3ARED 3S5LA 3UO1L 4NCC1 1T21B 4G9DA 3MLXH 2WBJA 2NYYD 1P6AB 1WWWX 4M7LT 4WUUB 5TDNA 1K4DA 5K9KB 1S7XB 4CBPA 1FNGA 2IGFL 2EDRA 2XTJB 1T5WA 1OAQH 3RU8H 5L2JB 2A38A 4LU5L 1F2XK 2NX5D 1QBLH 3BUYA 4Z8FL 1N59B 4ZTOH 1VPOL 2O5YH 3NABL 1QBAA 1GOFA 3RA7L 4L4TB 4IS6B 1T5XA 4K94H 3IKKA 1PBYA 2CLZB 2VDKL 3HI1A 4V1DB 4MDIB 5EU7E 2XIDA 2OSLA 3FT3A 4MAYC 3D69B 4RMUA 2A73B 1FNAA 4OCSH 4P5TD 5FYJD 4ZXBD 5GS1B 4N8VG 3CFDA 3E2HC 4WTZG 3T3PF 5GRYA 2Z31D 1UJ3A 3P0VL 2YN5A 4MA1B 3B43A 5CUSH 3VU2A 2EIZA 2YUVA 1ITBB 4KK9C 4NZRH 4QXWA 2X4SB 1QACA 2FBJH 4JRYE 1MAMH 4D9LL 1YQVH 4MQTB 1KCRL 1CFQA 1QBMH 5B3JE 2W9EH 1UM4L 3B8YA 1P53A 3CNKA 5I8OH 2VSCA 1A6VH 1B2WH 2DI9A 2BXZA 4M7LH 2ORBL 2XKNB 2E8YA 5DJDB 3VGBA 2NY2D 4NM4L 5KANI 5KTEH 5EU7C 1PKQA 4R3SB 2VUOA 4JKWA 5J1SC 3O2WL 2MQCA 4UU9B 3TT3L 4XCYB 3WFEL 4RBPK 1M71B 5T1LD 1BLNA 1T0MA 3TBTB 4LLWA 4X8XA 2IH1A 4WI4A 4Y19E 2W38A 2VLJE 3FQXA 3KWWA 1I4FA 2IAMB 4Z7NE 2C3XA 2WBJC 2JJTC 4XVUC 5GGTA 2DB8A 2O5XL 3ARBA 4BM7A 3OJDB 1D9KB 3EO9H 1SBSH 4TRPH 4K3HA 4WWID 4J6RL 3OR7B 4FZ8L 3SDDD 1U8HB 4J7RA 4FXGB 4KVCL 4MA7L 3QO1B 4QHLA 3SKOB 4EUPH 3CZFB 4FFZH 4YHKL 1AHWC 3EGSA 3VXSD 3MC0A 5F97E 4X4ME 3TVMA 1ZHLB 2DJSA 1AI1H 3QJHA 1AD9B 4JKPL 1QVOB 5E2JA 2AK4E 1EHNA 1EGJL 5GGSA 4JN2B 5D1QB 1R24B 2VKWA 3G5ZB 1QR1A 2PYEB 4XP4H 2HKFH 1YPZA 5SWSA 2ICWI 2VISA 4UILL 3WNKA 4NRYB 4ZFOL 3C8HA 4X6CF 4KMQA 5I6XC 4BK5A 3F65A 5F3HB 3NIFF 4PG2C 3BZ4A 1J1OH 2Y36L 5IK3B 4TUKL 4TVPE 4XWOC 3TNMB 3AB0B 3BXNA 4O4YH 4RGNE 1PY4A 3GFUA 3GSXA 4WU5B 3CVHL 4DKEH 2QKIA 5AD0B 4ALAH 4I77L 5HHOD 3MR9B 4HT1L 4WV1A 4FTVB 1YDPB 1RAMA 1HH9B 3LEXB 1BVLB 1IKFH 3MLUH 4OJFH 4IDLA 1UWEL 1BVKB 2JCCA 1DBJH 1KCLA 1SEBB 2H26A 4FS0A 4PJGF 2OR9L 2XXMB 1MIMH 2BDNL 3IFOA 1WZMA 4KQ4L 4DEPC 3FQUB 4XCFL 4L4VD 2BCKB 2ZJSH 5J3HD 3VXRE 4YR6B 1LDSA 3IAPA 3P40A 4RGNC 2YUZA 3PWNA 2OI9C 4RFOH 3W5NA 3QIWA 1JUFA 2G9HB 4Y5YA 4X6CA 1PG7L 5F6IC 4HIEB 4ORGA 5MEQA 4BFEA 2GJ6A 5F9AC 4IMKA 4LCYA 1FAIH 3V4VL 4C56E 4JFDA 1EEYA 4TVPL 2AI0L 5FO9B 3ARYA 1N7ML 3PNWA 4M5YH 4G8IA 1N6QH 2J5LB 3ULVE 4HUXA 1H15B 3BISA 1XIWA 3DUSB 3VFVA 1KCVH 5IHUH 4N1EA 1TIUA 15C8H 1H3XA 4F80A 3DVFA 4WY7L 5HVFB 1RUQH 3BPCB 3JTTA 4WJ5B 3D25A 1VFMA 3G6DH 4NBZB 2MJWA 4LCCA 5T1KB 1WV7T 5CKAA 3ZKQD 5C0CD 2I26N 4PJGA 4NQDD 3REWB 5I75B 1CXFA 4R6UA 1FN4A 5CZXD 1UKSA 3BIBX 4XNYL 4TUJA 3VRLF 2L7UA 4P9HC 3OKMA 3VFWA 1IGIH 3M17A 3PWVB 2X40A 4FFWC 1EO8L 1B3JA 2FO4A 1T2QL 4FQCL 4RNRA 4NGHH 1QG3A 2UY6A 3CFKB 4JKLA 4N0FB 4WV1C 4QHMB 5EORL 1MVUB 1A6TA 3NIGF 2KH2B 2D0GA 2R56H 3M1BB 1HOCB 4QOKD 1XF4A 5D6DA 3N06B 4O2EB 4PRHD 2YD4A 1BHGA 3H9HA 4Z7VF 4DZBB 3GZKA 2E9IA 4KUZH 4Y16B 1KEGL 1RUAL 4F37K 1A3LL 3O6FA 4EOWH 3FT4B 3WHXB 1JF5A 3DTXA 5E9DE 3WUWA 1HNGA 4PLJC 1B0RB 1NDGB 3HE7D 3QIWC 1KG0A 2FX7L 5F3BB 4Y5YC 3DYOA 2VXVH 3Q3GA 1JZ8A 2W1NA 1JGVL 3AVEA 4IMKC 5BXFA 4GT7A 1LE5A 3FOMB 3QDME 5A16A 3T2NH 1XIWC 3G5VB 3MXWL 3OF6A 1A47A 3HPJB 3BAEH 1U3HC 3OHXB 1D6VL 1A64A 3ABZA 2ADIB 3KLAA 3VGGA 1S9VB 3ARVA 5DVKA 5B22A 3WS3A 3TESA 3VWJA 4U1MB 4J12A 4Y5XB 1G6RH 1AIFA 5HHXH 2E6JA 3WL9B 4N68A 4LCCC 1NBVL 1A9BA 1H0DB 5J1AB 4MXVF 3U7YL 1AP2A 1KYOJ 5E5MA 3GRWA 1U58A 3DO3A 4Z7VA 2LVCA 5A3ID 3EYOB 3QUXD 5EBLB 2H32A 3RPIB 3X3FH 3MJ7B 5TQ2H 3QJFA 4OF8A 1LK2A 3FFCA 4CN4A 3QXUA 2VAJA 3WLWC 5FHBH 2EDJA 3WNNA 6FABL 4RQQB 3G6JA 2XV6B 2BRRH 3IU4H 3WFHB 4LIQH 2BHUA 1NANH 3OKLA 1KEML 2VDPL 2DIBA 1Q0YH 3ZYIA 1FG2B 1JV5A 1HXMB 4UDTA 4WEBH 1WK0A 5IEHA 3O8XC 4QGTA 1RMFL 2YKLL 1DQML 5ANMB 1WBYB 4L5FL 2QEJA 2D9QB 4MSWB 1VADB 4DKFL 3SKNB 3DXAE 1G84A 3FT2A 3TZVA 5AZ2H 4ZYKB 1P9MA 1BEYL 2BERA 3QXVA 2FEDD 3D0VB 3MYJB 4I2XA 1SMAA 4E9LA 1EMTH 4CNIA 4JR9L 1EFXA 4QF1B 5CP7A 4KJQC 3WFDH 1GAFH 4GG6E 4TNWF 3DX7B 4PY7A 3NN8A 3QEQE 1A9EA 5HPOA 5J0BA 3FN0H 2AXFA 1T20A 1RIVL 1NCTA 3LD8C 4V2BA 5I8EB 4C57C 3WLBA 3F7PC 4LF3A 4HK0B 4JRYD 3MRRA 5DXWA 4LSRH 4FQLL 4QXUL 3GMOB 3OQ3B 3LV3B 4TVSa 4MD0B 4HZAA 4PRIE 2BSRB 3O3AB 3E6HA 1FVEB 2DLIA 4YBHA 4HKZB 4XMPL 5FB8A 3RNKB 4JKMA 1PG7W 5CEZD 1LO4H 1I7RA 3SDYH 4LKCA 3EDJA 2P45B 1FE8H 3P4OB 3BP5A 4QWWC 1YQ2A 1CR9H 3QQ4B 4QXTA 5BJTB 5BRZE 4DOHB 2AP2A 1YMMD 3Q5TA 4Z76A 1U2CA 3K4ZA 3QIUC 2Q20A 5D7IB 4Y2OA 3QUYB 3D85D 1X5AA 5CEYA 1R3IL 3QDJA 3X14B 2YRPA 3B9KB 2KQNA 1DZBA 3HC0B 4OKVB 3MCLH 2K3TA 2V5TA 5I66A 5D8JL 1CVSC 2UWEB 5F70A 1VKXB 2D2OA 4WWKA 3RVXD 4YHNA 2NZ9C 4JFHE 4Y4HC 3O2DA 4BZ1L 4LLUA 5HGHB 1BBJA 3KPSA 2XYCA 3V6ZB 1ZGLB 3JWOC 4XMKL 4YC2B 1DQQB 5JA8B 1FC1A 4JFZH 3ROOB 3RDTA 2J8HA 3RUGB 2NW3A 3KYMA 2VXSH 4E42B 2FD6L 3L3GA 1YNTA 3BW9B 5KN5B 3KR3H 3A67H 3RZCC 3JWOL 2DYPB 1CICA 4OZFA 4OBRA 1HH6B 3GIZH 3HG1D 5KVGH 1FPTH 4IRSB 3UPRB 1NUNB 43C9B 1YMHB 3U7WH 1DQLL 3QUKB 3NAAL 3S88L 5J13B 1KB5A 2VLME 4I0PB 1DUYA 3QUMA 2ZUUA 2BOCB 5F1OB 3RKDC 5I1CL 3C2AL 3W5MA 4QCIB 3NFSL 4TOYL 3EJJX 1RJYB 1MAKA 1KN2H 5DEZA 3FO0H 1FNHA 4KKCC 2FECL 4PJDE 1C16A 2V2XB 2GQHA 3NCMA 3VRIA 4GO6B 4YWGH 1DUZA 3BQUD 3CXHK 4OD3H 2VO5A 4PJ5B 3UJIH 2CK0H 5EC2A 1CGSH 2EYSA 1ZA6B 1X5ZA 3A0OA 4MA8L 1EV2E 1VFAB 4LCWB 1NEUA 4BFIA 4HWNA 4KHXH 3U36A 1P7KA 4LSTH 4NC0B 2YBRA 5AZEH 3KXFA 4HIHA 4X4XB 1JYNA 4G7VL 3QAZB 4ENED 3HLAB 2EH7H 5EUOE 4CKVX 4LARL 4R0LA 3BKMH 4MJ2A 3JUZA 5JMOC 4G8GD 4CMHC 2FRGP 3LOWA 4WI5A 3FQTA 3KYNB 4GRWE 3BIKB 4S1SL 5HHVL 2OS7A 5D5ME 5IM7B 4W6YB 3GSNH 5IB5B 2WIIA 1U8PB 4P57A 4NN7C 5JIHA 2VE6B 2AJYH 4R2GD 3V7MA 4NZUL 1E4XI 2A9NL 2NY7H 2RCSH 1MCNA 4NC1C 5JNYA 3OKEB 5FYJH 1N64L 4NKOB 1CF8H 1EJOL 3ULVD 4WVRA 1NL0L 5ID0B 1J18A 1LO3L 1F4XH 3MODL 4JY4A 3C5ZD 5KSBE 1EHAA 1Q94A 2R0LL 4RAVA 3SGKA 4AQOA 2I9LB 5IMLA 1FQ9C 2GSIB 1IL1B 1WAAF 1N3NA 3DBXB 2GEEA 3LKNA 3UTSE 4R90H 5SWZB 1XF5B 3JTSB 2DTSA 4K7PY 1L7IH 1PD6A 5IBLD 1BZ7B 2JIXB 2ILLA 1UKQA 2VDMH 3HNVL 3D0LA 2WW8A 2AK1L 4KUCD 1S8DA 3QDGE 1EVUA 3V5DA 3HZKA 5I30H 3MUZ1 1RIHL 3U0WL 2VAAB 2NY0C 3C6LB 3EDDA 4NWTL 2E6QA 5D2LB 4CN1A 3UAJD 3PGDA 4X6BB 1UA6H 2ZG1A 1KT2B 4KGLA 3L5WA 3S34L 2DQHL 1L6ZA 5CJBA 3WUZA 3RRQA 3BMWA 3QB7C 1ZLSL 4LPCA 1AXIB 5DDHA 5L2KB 2X1PA 3OXSB 2WP3T 4L3EE 2YUXA 5FM5O 4XP9L 3IF1B 1F13A 4M62L 1P5VA 4Y2DB 5T1MB 1WAAA 4YPGB 1KJ2L 4L9LA 1TENA 4EDXA 2E7HA 2Y6SD 5ADOL 1ZT7B 1YEJL 4JZOB 3QDMD 3TO4C 1FO0H 2ZUVA 4Q7DA 1J8HE 1IC7L 4NNPH 3BDYL 4ODTH 5EUKA 2FECI 3SGKC 5DRNB 3MRKB 5DVNA 5GJSL 3ZKXC 8FABA 5DVLA 1INDL 2VRAA 5E08L 1MREL 4I5BA 1CG9A 3IETA 4U6VL 3S4SB 1A6UH 4YXLH 3O6LH 2GAZA 1NCUA 2VXUL 4N9GA 4OZ4A 4UBDC 1X44A 3SDAA 35C8L 5D7LE 1T21A 1QQDB 3LHPH 1WFNA 3EYSL 4HBCH 4N5EC 4WUUA 1BQHB 4I3GA 4NQXA 1S7XA 5E2WL 1I1CA 4HH9A 1YEIL 5KVFH 5CAYB 2J2ZA 1GHFL 5GRXG 1PZ5B 2Y72A 3H7BA 2G2RB 4JPVL 1F6AB 1MNUL 1N59A 2DQDL 3B9DA 5TE6H 4U33A 4L4TA 4IS6A 5DTFB 1MHCB 2OLDA 2CLZA 4NWUH 4NYLB 4V1DA 4NZJA 4MDIA 1UADC 1N6UA 3GJEB 3V8CA 2G75A 3F8UB 2A73A 5D1XB 5GS1A 1FLTX 4C54A 5JMRA 2HG5B 1A3RL 3C09B 4ZQKB 1CT8B 2B5IC 3RZWA 3NZHH 4HWEL 2C26A 5JPNB 2N56A 4NQTA 4GS7C 4Q9CA 3S37L 1REIA 3D2UB 3RVUC 1A21A 3T3MF 2GY5A 3LB6C 2J8UE 4LSVL 3CC5B 4NFBA 5LBSL 3QIBD 4TSCH 3GKWL 4XCNB 3LKOB 1AXTL 5JUEL 1YEGL 2OP4L 3RPKA 3MRCB 4I4WB 1I8MB 1YN7B 4R3SA 1DQDH 1UKTA 3BN9C 2YA1A 1MFCH 3U1SL 3GK8L 4GKSB 3MLYL 3T65B 5EU5B 1G0DA 5L8JB 1M71A 2I60L 3WHE0 1G7LB 2CXGA 1HSAB 3SPVA 3UDWA 1AKJD 3VD5A 3QEQD 3VE0A 3TBTA 5KANG 2QHRL 2NY1B 3GSVA 3GEWB 1OAYL 3MRBB 2GJJA 4P4KA 1JHKH 4NUGH 3MRPA 4K71B 5EOCL 1UACL 1EAPA 1MLCA 5E7BA 1RJLB 5IBUG 2XTJC 3BKJH 4HGMA 4ZFFA 1I8KA 1D9KA 4PRID 4X6FB 1BBDH 3DX6B 1KLUB 3PDGA 5JIIA 3DVNA 3OR7A 2B1AL 4OQ1A 1CZ8H 3NCBB 4X98A 3RVTD 2P7TB 4FXGA 4M7KL 4EJ1C 1U2HA 3GIVA 2BNRA 1F5WA 5J7CC 4M4PA 3MXVL 1KC5L 1OCWL 4K23L 4PJCB 4J3SA 1S7QB 2GY7B 4K3JH 1MJJB 3CZFA 2EDQA 5DK0A 5ESQA 4KTDH 5GS1C 2DBJA 3NGBB 3BVNA 1FFPB 3MOAH 3QHFH 1NBZA 5GS2D 4YEFA 4RGOH 4HGKC 1QVOA 4L8BA 2FIRT 4JDTL 4JN2A 4K8RH 1R24A 2XN9B 1UQSB 2BMKB 2X4NB 1NH6A 3DSFH 3G5ZA 4XZUA 3QG6B 4H1LH 1I8IA 1MSPA 3V8OA 5C7XL 5MEND 5MP6L 5AUMA 3HR6A 3U4BL 4ZPVA 4NRYA 3JWNC 5F1NA 1RZ8A 5BMFL 3CLEH 4FZEH 2KBGA 2W0LA 1DLFH 4UNVA 3H2WA 4XP1L 1XAUA 5E5RB 2XZQH 3TNMA 1SEQH 3RGVD 4WU5A 5AD0A 1BIIB 2XQYG 1L0YA 4HKJB 1IARB 3C2SA 1F4YL 4PJ7E 5B38G 1IT9L 3O81A 4FTVA 2MCPL 1YDPA 2PCPB 1L6XA 3LEXA 4HBQA 4HS3B 1INEH 2H3NB 4ISVA 2IAMC 2VLMD 3EOTH 1BVKA 3GNML 1QO3B 2YUWA 3H3BC 5I1LA 1U8JA 2EDNA 3CXDH 3MUJA 2PYEE 4PGDA 1I3RA 1ZT4B 5IFHL 1D9KC 1N0LA 1PEZA 5GJTH 3QEUA 4XBGA 3UYOD 5K9JH 4QRPB 3ULUE 3MLTA 3KLSA 1J0JA 1WZ1L 2NXYD 4YR6A 5ITBL 3D3VE 4EIZC 1X5IA 1YEKH 2NCMA 4FQJL 3U79A 1MCDA 4HIEA 4OCWL 3GMNA 5C8JB 2PTTB 5E4IA 5DJ2A 5HJ3A 1P4IL 1LQSR 1NCAH 4JDZB 5E8PB 1AQKL 5T5NF 3V6OC 5CJXA 1H15A 3DUSA 4JM2D 1Y0LB 1X4YA 4OZHB 5D1QC 3VCLB 1YEHL 4QXGH 5JQ6L 5H35A 1B88A 3IKCB 2ITCA 1KOAA 3L5HA 2E7BA 5JORB 3NCYP 4W4NA 4GW5A 3ULUC 4JPKL 4WJ5A 4JGMA 5EWIH 2R1YB 3IJHB 3BD5A 4PJIB 5T1KA 5DS8A 3REWA 4APQD 1JNJA 2C3GA 3TA3A 3ULUL 4LEOA 4AEIL 3L1OH 4QYOA 2X1WL 3PWVA 3LS4L 5JW5B 1OARL 2WV3A 3MRHB 1F97A 3PL6A 5FYLE 3D18A 1KYOK 1K3ZA 5TJWK 2IALA 4QHMA 1MVUA 1I1AB 4O9HH 2A77H 3WDIA 3K2MC 5I19L 1HOCA 3V9FA 1D5BB 4NPYB 3DROB 4KMTH 4O2EA 3OBAA 2AEPH 1TITA 4ZNEA 5IB4B 1ZTXH 4JZNB 4IRJA 3S5LG 4TTGA 1FYTB 4QNPF 1B0GB 4MJ5B 4CW1A 5CILL 5IMOA 5CEZH 1B0RA 1BD2E 1NDGA 3EKCA 5E8NB 5HXMA 5F3BA 1FORL 5IVXF 5CBAB 5IB3A 1IC5H 2BOBA 4J4PC 3UTPE 1P2CA 1JTOA 2NY3B 3FOMA 1FH5L 2J5LC 4TPRH 1IGML 3U2SB 1DN2A 4DAGL 1F11B 2R8SH 1MIEL 3HPJA 3ARGD 4NBYB 2HFTA 3SE9L 1JWSA 4NFDA 1C12B 1KN4H 5TFSL 3OHXA 3VWKB 5FYLL 3SQOH 5C6TH 2ADIA 1OL0A 3DX8B 4NM8H 1QHPA 2ED9A 1S9VA 1EXUB 3C8DA 5TE7H 1B4JH 2Q8AH 1ZANH 2CH8A 2JB6A 3B2UD 4P2QB 3NCJH 3RTQC 1N26A 5F8RC 3MLWL 1FFNB 1QRNA 3LRSB 3P0YH 4ZAKD 4L3ED 5J1AA 5KJRH 4F8QA 3MLPA 3VG0L 3RPIA 5HI4D 3EBAA 5EU3B 2F54D 4GFTB 1GZPA 5L6YL 2DWDB 4BJLA 5D96B 2W9DL 3EW3B 2OTUA 1MLBA 4XPTH 3MRNB 5IVXA 3WFHA 4XX1E 5DJCB 2IANA 1EJ6A 3MLRL 4NHCH 2B0SL 1U3YA 1A4KB 4LEXL 1NMCB 1IAII 4Y16C 4DGIL 3B2VL 4OM1H 1HXMA 3KS0H 5I1AB 2GKIA 1N0XH 3BGMB 5FUZH 3BX7C 5ANMA 2OCFD 4PFEA 5D7LD 2VMFA 4MSWA 1VADA 3O6KH 3SKNA 1JPFB 1MI5B 1VEMA 3TBWB 3ZDXF 1WC7B 4ZOEA 4MVBD 5IQ7H 3RHWF 1EAJA 3I6LE 1F45A 3V7AG 1G7IA 3MYJA 4PRDB 2LU7A 2QQNL 1L9MA 4YK4C 2ZPKL 5D7KE 2XT1B 3DI3B 1FZOB 3C60B 5D7IF 5BS0B 4XBEL 3TNNB 4H88L 1DFBH 4KQ3L 4RWYL 4QF1A 3E3QE 1RQ5A 4CJ0A 1NQBA 1S78D 3DX7A 4Y5XC 1S7WA 5ADPL 2VITB 4M1GL 4GBXB 1EA9C 1JTPA 1OSZB 4X9HA 5I8EA 5EBWB 4YFLI 2V2TA 3BIAX 1G7JB 1OGAE 3HAEG 4HK0A 4F7MB 4UDUB 1A7NL 5IHBA 4KI5F 4AT6B 3GMOA 3RUGF 1MELA 2VQ1A 3O3AA 1FVEA 1W72L 3HI5H 2PXYD 4HCRH 1C5DA 3U46B 3E3QC 4WU7A 4MZ3A 2BNUB 1O5DT 1TETL 1QKZH 2VXTL 2CLRA 4PGCB 1L0QA 2ADFL 1DBKH 5ETUB 4BH7B 5D7IA 1O0VA 3QUYA 1NJ9B 4QTHB 5L7XH 3B9KA 5F7FA 3L3IB 4OKVA 4X83A 1K8IB 3DYMA 3CFBB 1VKXA 3NFNA 4Z77A 2IFGA 3GSQB 5CIPH 5GS0D 4Q9QH 2XFXB 1A5FH 3HRZB 3N50A 1KNOB 5I1EL 2DQIH 1M6OB 5EA0L 2C1PA 3RKPA 1QFWH 3LN9A 1JNLH 3ROOA 1E6OH 1U41A 3RUGA 1RD6A 2F53B 4JFQA 1U3ZA 4E42A 5BOPA 3H42L 2EECA 3ZTNH 2OMBA 3IXTB 1RUKH 4OFYD 5JHDA 3KPPB 3H3PL 3NZ8B 1NFKA 3INUL 3TBYB 4HJ0D 3UPRA 43C9A 1YMHA 1WFTA 1R5WA 2D03H 3QUKA 4OCRL 5T33H 1MHEB 4GLRI 4W81A 1UH3A 1X4ZA 3U9PH 1CE6B 2BOCA 1XZ0B 3GI8L 5TDOA 4QKXB 1DQJA 3QFJE 1LE9A 3PABA 4Q2ZB 1R3KA 2IFFL 2Z35B 4JFFD 1RJYA 4BQ6A 4RAUB 5GGVH 4KDTA 4PJBB 1XGPB 4X6DB 4HC1A 4Y4FD 4WUKL 1ED3A 4XWGL 5KZCD 1C7TA 3MMEB 5CMAB 2Z8RA 4L1HA 1ZA6A 1O7SA 1RZFH 1A7RH 4I0KA 1WICA 2LQRA 4LVNB 3IAQA 4LRIC 4LCWA 1PAMA 4K7PL 5DFTA 1A7OH 4BKLA 3SKMB 2M26A 4X4XA 5IW3A 5ENWB 4EI5A 3MV8D 1MWAB 3SKJH 2R0ZL 5L0QC 2HWZH 1TCRB 4MNQA 3WYRA 3VXUD 2BVPB 1NMBH 2G5RA 3QCTL 5JOEA 4YC2C 3MBEB 2EYRB 1KFAH 3BIKA 5DZNA 2N7BA 4XTRC 1CD8A 1H3PL 5IB5A 3NMEA 2XWTB 1UZ8B 3D3VD 1T7XA 4AEFA 4IIQA 4FMKA 2APBA 1J8KA 5I15H 5JR1L 3VH8A 1AGEB 2FX9H 5D2LF 2VQUA 4DQOH 1F90L 5GSRB 4DJMA 2DQUH 4OLVH 1F4HA 1A22B 1G0XA 1UM6H 4E41D 1RZ7H 2Q3AA 4GG8B 4IRSC 2P5WE 3QI9B 4OLXL 4JFOB 1T4KB 5ID0A 5F7DB 5J9PB 1PFCA 4I0PC 4PJ8D 5DEGA 3PWPB 4RRPA 4LCUB 4IOIB 1YPZE 2BY2A 1DBML 2I9LA 3LH2H 1HSBB 4PTUB 3FO2B 2H2PD 1IL1A 3GSNA 1QSVA 4LHQB 1JHLL 1OTUD 1FFOB 5GGTL 4KDTC 3HPLA 3CK0L 5SWZA 2N7AA 4PGJA 3SCMD 4UT7H 3JWDL 1NGPH 2HT4C 4J8RB 4JANB 4P23B 3QULA 2A1WH 4IOSD 1AO7E 2JIXA 2HJLA 1KXTB 1TVDA 2VLKB 3UEZA 3SGEH 1OTTD 4N90E 5FYLD 4QY8B 3T4YA 3Q1SL 4PRPB 4O5LL 4TSAH 3TPUA 4XAKD 1FC2D 3KLDA 4YPJA 4HHAA 5D2LA 3ZO0A 1NUFA 2YK1L 3BYTA 4X6BA 1KT2A 1ORQB 2JCCE 1HK6A 1WIUA 4KKLC 3TFKC 4XXCA 2OJEB 4ERSL 4PJ9D 4H5SB 4LP4A 1OAZH 4D0CB 5ILTL 5L2KA 3QNZB 2X70A 2YSSB 4JO1L 3TN0D 4P2OB 5TH2B 3IF1A 3IDMA 3STLA 4HDIA 4Y2DA 1BD2D 5DI8A 5T1MA 5I76A 3ULSA 1FYHB 3GSOB 1CU4H 2PO6D 4ONGL 4YPGA 4MXWL 2A6DA 4JY6A 4HFWB 3UTPD 2CUMA 2XQBL 4UINH 1ZT7A 4JZOA 3KPNB 1T80A 1U0QA 3WO4B 3VFPA 1C5CH 3PHOB 4AENA 3PHQB 5GS2H 2YMXH 4WW2C 1OP3H 5FO7B 5I2IB 2YPKB 1W0VB 5DD1H 1IC1A 3W81A 4R4ND 3TT1L 1UM5H 4G9FA 5LAXA 4WGVB 1LVEA 5F7EL 3S4SA 4C59B 3X17A 4U1KB 3W0WD 1OAUH 3DX9A 3ZMRA 1WWCA 3NA9L 1QQDA 4XB8A 4P5MA 2AEWA 4ZSOB 2OL3B 3OKDB 1E4KA 3O6ML 3VI3E 2P8MB 1I7UB 1FZKB 1PZ5A 3IFLL 1T89A 5C08E 4ONHA 2G2RA 2B39A 5IROA 2VH5L 4W4OC 1FBIL 2JJUA 5J56B 4DZ8B 2AGJL 3C6LC 4YE4L 4ZFGL 4LDOB 4PD4J 5DTFA 2N4IA 1MHCA 3WE6A 3P30L 5B4MD 4NYLA 4ESKA 2JJSA 1XMWA 3DNKA 5DJZB 4XPAL 4XXCC 2Y9RT 4JLRA 5D72L 4JRXD 1A1MB 1E27B 1UWGH 5D1XA 2BX5A 3TM6A 5KVMC 2HG5A 1RJZB 4ZQKA 1IKNA 5HHNB 3GMMA 5JPNA 4WFHE 1YY9D 4NNYA 3TO2A 2F8VA 4HZLB 3UX9B 4DGYL 4ZODA 2BXYA 2R2HB 4GRLC 4Y2DC 5HY9A 3SY0B 1RUMH 4P0DA 4ZUWB 3B6SB 4MAUL 2YWZA 2WWKO 4U0RC 2BRQA 2BK8A 1FL3A 5AG8A 5FM4A 2QJDA 4PJCF 1U6AL 5TGBA 3I6LD 4XCNA 1FL6A 3LKOA 4AG4L 1MF2L 3MRCA 4I4WA 4JRWA 1G6RB 1YN7A 3QYCA 4LLQB 1A6ZB 1U8OA 4GKSA 3TPKA 3T65A 5EU5A 3CMGA 4YQXL 1G7LA 1HSAA 1XR9B 1ZA3B 1EVTC 3VMNA 1I9RL 3F6IA 4W68A 1RUPL 2GTWB 3NIGE 3L3KB 5IMKA 4CRPA 3S35X 4KK5D 5MEOA 5E2UL 1IQWL 1B90A 3MRBA 3AXLA 3PGCB 3D1MC 1NAMH 2FR4B 4KK9D 1A1NA 2P5EE 3VGHA 3WSQH 2MFNA 2YS4A 1RJLA 2X2YA 2VL5B 2XWJB 4UIKL 3P9MB 3WIHL 3GSRA 3BPNB 5JXAH 1PEWA 2VN7A 1LK3H 3CMOH 3GB7B 3TCLB 3MYZA 4XNMB 5DFVD 4H8WC 1UZ6E 3G6JE 1JK8B 1URLA 2P7TA 2VDLH 4PJEE 3S97C 4PJCA 2D31B 4PV8B 1MJJA 4GAJL 2FB4H 5D1XC 4JG1L 5HSFA 1IKNC 1U8IA 1KTLB 3EYUL 3GMLB 4LRNL 3GJFH 3OAUH 4FQHB 1LP9B 1NCCL 2XN9A 4POUB 1UQSA 5ESAA 2X4NA 4YX2L 4F57L 4GXVL 3QG6A 1MCPL 4ZUTB 3WMSA 3VDCA 2WBJD 5EOCJ 1HNFA 3T2PA 3QT2A 3ARDB 5T5FH 4XVUD 1QSZA 3ZE1E 4KJWC 2VB5A 3GRWL 3SDXA 3BEVB 4I2XE 1OP5H 4M6ML 4F7TB 2ESVA 2VLLB 4G6AD 2VDNL 4G3YH 2VZSA 4DN4H 4OZHF 2X4OB 3D9AL 3C9NA 1BIIA 4LNVA 4D8PB 4HKJA 3TBSA 3T0BA 1U8NB 3GHBL 5I74B 2NY1C 1TTFA 4UT9H 1WITA 2PCPA 3TC9A 4KZEH 4Z95L 1MQKL 4HS3A 2A83B 2H3NA 2MHAB 5IBTL 1FRGH 4PJIF 5HI5D 3O9WA 1UENA 4C4KO 2DMCA 1ZT4A 1VENA 1MJ7L 4M6OH 5BV7H 4CU6A 3HE6B 1WJ3A 2EIEA 4YDKL 1T6VN 2HTLC 3UBXB 3PP4H 2DAVA 4OIIL 5IP4A 4JCMA 1E28B 2JB5L 3RNQB 5C8JA 2R1XA 5C2UB 5J06A 3SQBA 3NGBC 1AC6A 4JDZA 5E8PA 3WXVH 4Y1AA 3P9LB 3LQAC 2Y7QB 1YJDH 1Y0LA 4AM0A 5EO9B 5LQBL 4JHAL 5JW3H 3IKCA 4I9WE 4X7SL 5JORA 1GGCH 5I1JH 1UXSB 1WT5A 3UJTH 2QQLL 1T2XA 3LQAL 3ARBD 5F9JB 4KKBC 2HLFD 2OQJB 5C1MB 5CLWA 2R1YA 4G42A 5BOZG 2NY4D 3ARUA 4PJIA 4WFFE 2XA8L 3WFCH 3VI4E 2AV1B 1KCUH 3OL2A 4OFIA 1BQLL 1XF3B 2GK0A 1JNNL 4M8QA 1P4LB 3DHMA 4NN6B 2R0KH 2V7NB 3VXQB 2CXKA 4ORZC 1FV1B 4RX4A 1FCCA 2BHZA 3MRHA 3TVMD 1KJMB 4N0UB 5JW4N 4KK8D 4LPYA 3GMPA 4WO4B 1NMAL 1PSKL 2P49B 4UTAL 1QRKA 3L7EB 3S96B 3V5KB 3O3BB 5C0GA 3F58H 4PB9H 2X89A 1JIBA 4IDJL 4G6FB 4NPYA 1WCBB 4XCCL 5SWSD 4FFVC 5FEBA 4Q6YA 5D7JB 2KZWA 4YIQB 1KJ3H 2GT9B 1FYTA 3K8LA 3WKNA 4OF5A 1ZVSB 4MJ5A 2A9MH 4OCXH 1TPXB 2DQCL 5D9SB 4YUEH 1VB9A 1CL7H 3QSKB 1J05B 1Z6JT 2BVQA 2AJSH 2YD2A 5DHVB 4Q58C 2AJZB 2F5AH 1HI6B 3QP3A 1B6DA 3IJYA 3AREB 1ZWIA 2ZCHL 4LSUH 4FNLH 3U2SA 1F11A 4O00A 4QRQA 4P59L 4DW2H 2DJUA 3F7YA 5DD0L 1C12A 5C07B 3VWKA 1LEIB 1BJ1H 4B41A 5IW6B 5IG7B 3DX8A 2PR4L 1WT5C 1RZJH 2OJZH 3DV6A 3DIFB 1SHMA 3UMTA 5IEKA 2WIMA 4R7NA 2A6KB 5CJ5A 4PGBA 3U0TA 3R1GH 3LRSA 1JE6A 2CKBL 1HHGB 3RQ3A 3QZWB 1LO5A 5C09E 1MRDH 4QEGA 4P5TB 4ZXBB 3AGVA 4JE4B 3UC0H 3QIWD 3B5HA 1ZEAL 2Z31B 4LMQE 2ZSVB 4QT5B 4QRRE 1T22B 5EU3A 4KJPD 5FGRA 4JB9L 2GJ6D 4JFDD 1SYVA 4FABL 5IB1B 3FO1B 1XIWD 2D7NA 4HIJB 1I1AC 5TQ0H 2VXQH 2DQTH 3I2CL 5GZNC 5DJCA 2QSTA 2IADA 1RVFH 2DLFL 4OGXH 4JVWA 3WNMA 4X7TB 1OPGL 2W65B 3UYRL 1MCLA 3BSZL 5HDQL 4OV5A 1U92A 4LGPB 3QRFM 5DGQA 1S9YA 1II4E 3MQIA 4KKAD 5DT1H 5I1AA 1FVDB 3RFZC 2NW2B 5T1LB 1TVBA 4M6AA 3QWOB 1NKOA 4NN5B 4O02H 2F74B 5DRXA 4K3EL 1JPFA 1MI5A 3TBWA 1HQ4B 2W0FB 5C9KA 2NY3C 3DVGB 3Q0HA 5CJQH 1WCQA 3C5SA 4ODHH 5JLZB 4LLVB 1S9XB 5BS0A 1FZOA 3L3OB 3TNNA 1IRAY 3MRIA 2CIKB 2ZOLA 3T0EE 1KCSL 1QFHA 2AQ2A 1RURH 1YEDB 3V2AR 4FFYH 2G5BA 3CVIH 3O6FD 5HI3C 1D5XB 3MJ9L 4RISL 4JZJB 1FO0B 4F7MA 4UDUA 3AU1B 2NR6D 4EN3A 4KV5E 1Z3GL 2Q76A 5B8CA 3PF2A 3OTTA 4P2YA 2JJVA 4LP5A 4CN6A 1IE5A 4UV4H 4MA3A 1OAKL 2QQKH 5D96C 5CJOH 3OF6D 4LQ1A 1PVHA 3MJ8A 1WISA 3O4LE 3I02B 2A0LC 5I9QC 5EZOL 4YHMH 1I1FB 5AYUH 1FDLH 5IKCB 1U8KB 4HFUH 3UPAA 4PGCA 3VWJD 3QQ9C 2DS4A 1NMCC 3STBA 3IDIA 5ETUA 3IJSA 4OV6F 2G60H 1KENL 4QTHA 5EO0B 3QISA 1K8IA 3H9YA 4RMTA 3MTRA 4PJBF 3GSQA 4M1DL 4X6DF 2ATPB 5HHOB 1OTSC 2HFGH 2DQGL 4MB3A 1E6JL 4X5WA 3HRZA 2X4TA 1KNOA 4CVZA 2B7DT 1TVHB 2K7PA 3DMMA 3FFCD 4A6YL 3V5HA 4KAQL 4J3WA 1MFAL 4Z6AT 1RK0A 3C60C 4PTTB 3OR6B 3EJZD 3Q2CA 3B9VA 1QFUL 5TF0A 3T1FB 25C8L 3IXTA 1ES0B 3I50L 4YXKL 4M7JH 3KPPA 3H3KA 2D0FA 4NT6A 4NKIL 3NZ8A 4PYHA 1RZKH 3TBYA 4GBXC 1S7VB 2IQ9L 2EDKA 3D87B 4P3CL 2DJ4A 1GGBL 5SX4I 1K5NB 1MHEA 2P44B 4XVJL 2ZKHH 4ONOA 4NOBA 4XPBL 4Y88A 1RIUH 1VFBB 4HAFA 1S7RA 4XAWL 1XZ0A 1A14L 4R4BA 3TZVD 1HINL 4Q2ZA 5HYJE 3N85H 2Z35A 3OB8A 2W0KA 4H25B 4RAUA 4PJBA 1V3KA 1JPSL 3HMXH 1IGYB 5ISZE 4X6DA 4XH2B 1EFXD 1V7MH 2E9BA 3MRMB 3MMEA 5CMAA 3VXOA 2VIRB 2F19L 3P73A 3ZLQC 2D7PA 2MMXA 5FHAH 3K2UH 3SBWC 2GK2A 2P48B 1P7QB 5FXCH 5T5NG 2Q7YA 4HKXA 1MWAA 3KHQA 3RBGA 1A0QH 4R96B 1OGTB 1IAOB 5FKPB 1OAQL 3RU8L 4X5XA 4K94C 3RKDD 3SKUD 3GI9H 1UEMA 1QBLL 4KROC 3MBEA 4HUUB 1TJIH 4ZTOL 4JJHA 2PYFB 2O5YL 1ZVHA 4QOKB 1ZGLP 2XWTA 2ZCLH 3FMGH 4PRHB 1BZ9A 5CD5D 4K94L 3JV0A 5E56A 1M7XA 1AGEA 2RJMA 3FQNB 5GSRA 4P2RE 3KPQB 4OCSL 1CDHA 3HKFA 4PP1C 4XC3H 3OKNB 4MCYA 4PLNC 5E94B 4GG8A 2VOTA 3HE7B 3QI9A 4EKXA 5CUSL 2ADGB 3RVWC 5F7DA 3QDJD 1TZIA 3VFGH 5J9PA 4H20H 5C0IA 4LSQH 4I9WD 3LDBC 4NZRL 2FBJL 1MAML 1BOYA 2B2XH 5C0DA 4IOIA 1VPOH 1FJ1B 4GAFB 1YQVL 4WWKD 3NABH 4X4ZA 1QBML 3FO2A 5CSGA 2W9EL 4ELKB 3KPSD 4GAYA 1BECA 1FFOA 5CHNB 1B2WL 2B20A 4M7LL 4L29B 4F33A 5KTEL 4J8RA 4P9MH 3RDTD 4P23A 4U49A 1IVLA 2ZUTA 3WXWH 4Y8AA 2AAVA 3TH4T 4MXQD 1CICD 5CJ8A 4LVNC 4KY1L 2AABH 1R5IB 5J4MA 2KPNA 1NGYB 4PRPA 3QUXB 3GJFK 4UTBH 4YHZH 4Q6IB 3OG4B 1ORQA 1YY8B 3IT8D 4ODWA 5EH1A 4P48A 2QSCH 1TTUA 3PWPE 3LSOA 2R69H 4H5SA 5B21A 3RIFF 1JGDB 2QSQA 4NKDB 3QNZA 4TTDD 4KVNH 5EU6A 3EO9L 1BF2A 3MBEC 3O2WH 4TRPL 4PD4K 5TH2A 2V9QA 5ECJE 5DRZB 1S5HB 3VFTB 3GSOA 2YZ1A 1T7VA 4J23A 4HFWA 1M7DA 2Q3ZA 5DZOA 3RAJH 4FFZL 1DVFB 4BA8A 4DKDC 1AI1L 1M4KA 1QSEE 3N1FC 3LZFH 1ZSDB 1MRFH 3QI9C 3PHOA 4ODVL 3CDGB 5FO7A 5JIKA 2C3HA 2V2WB 2O5XH 2YPKA 3KXFD 1W0VA 4I1NB 4YHOH 4JEGB 3SE8H 4P3WA 4XP4L 2Q1EA 2HKFL 2XXCB 3CH8A 3S98A 1KIUA 4O58L 3QA3B 1CYGA 1OM3H 4Z78A 5I8KH 4U1KA 3JSSA 2MKLC 2RB8A 2FBOJ 1AGCA 2ZUYA 4LSDA 2IPKB 4IMLB 4U6XB 1SJEB 1T03L 4HIXH 3GSUB 4YHIB 5GGQH 4HMEA 4O4YL 3ARFB 5E2VL 3ARRA 4TN9A 3MUHL 4GMTH 3PJSB 1SJXA 4M43H 4DKEL 4ALAL 5A2IH 2VN4A 3CCHB 1FIGH 1P1ZB 3SE3C 4JRYB 2GTZB 1F6LL 4DZ8A 1KPVA 2P4AB 5I73B 3LEVH 3HZVB 1KXQE 5LCVH 1IKFL 4OJFL 5SV3A 1DBJL 3G08B 5DJZA 2LU4A 3WFZA 1E27A 4LLMB 4ZNEE 1MIML 3P0GB 2C7UB 1RJZA 3ZL4H 4KJYB 4P2OC 4UBDD 3DRTB 3GBLA 4QHUB 2ZJSL 5TE4H 1OWWA 5F7WC 4RFOL 3UJJH 5CP3A 5HDBE 4ZUWA 4F15B 2HTKC 2AEQH 5E6ZA 3MRDB 1AHWB 1JVKA 3B6SA 4KTYA 5C3LD 1RU9H 4ZSOE 1X7QB 4Y19B 3RGHA 2WINB 1FAIL 2VLJB 3MLZH 4U7MA 4M5YL 5INCB 3WO4C 1N6QL 4OTXL 5H94B 4U1JB 3VXMA 3AY4A 3U4AA 3KPRE 4DCQB 3MACH 4ELMB 4LLQA 4U2ZA 4PJFE 1RSFA 1KCVL 1LP9F 1TTGA 1F3DJ 2UUDH 15C8L 1LNUB 4MQSB 2WAHA 1XR9A 1Z0MA 2YR3A 3F12B 1SM3H 1RUQL 2GTWA 2C9AA 2IG2H 3EO1A 1QRNE 3W9EB 3GO1H 2FWOB 2YA0A 2YPLE 5CZVH 3TGXA 2I9TA 3PGCA 2QADD 4PRNA 3EDKA 5I16B 2FR4A 4FP8H 2YD6A 2XACC 1C08A 3P9MA 4F9PC 1H3TA 4ODSH 4FQPA 2AK4B 2A6IB 3SOBH 1H5BA 3GB7A 4FQQB 3TCLA 5HGBA 4XNMA 4NO2A 4NGHL 1KCKA 3JV5A 4NUJA 1ODAA 1T66D 4JQVA 1K85A 1CGWA 1JL8A 5IVXE 2D9CA 4PGEB 3WEXB 2EICA 2BZDA 3FTGA 2IANE 2HVJA 4FQ2H 3BMVA 2KQMA 4DEPB 1IAKB 1OHQA 3MFGB 5MHSD 4HWBA 2X09A 2AQ3A 3FB6A 4KUZL 1C5BH 3G6AA 4FQHA 3BUTA 2PNDA 1LP9A 2AJ3A 3PHSA 4EOWL 4RGNB 2EE9A 3SDAD 2FSEA 5E6IA 3SDCB 1C8PA 3AROA 4WUUD 1T2QH 4PS4H 1FGNH 4X4YB 3ARDA 2XTJD 4WGWB 2VXVL 3CLFH 4P9HH 5C0BE 3DO7A 1YZZA 5ICYA 4LIQE 3GBNH 3T2NL 3AY4C 1HWGB 2EDDA 2VLLA 3MRQB 3TF7C 3KLHD 3BAEL 4L4TD 5HPMA 2X4OA 4V1DD 4OQTA 5C2BH 1ETZB 3BE1H 2E27H 4HAGA 3PP3H 1G6RL 3MLVH 2GSGB 1SQ2N 4HPOH 4U1IB 5F9OH 2YRZA 5IT2H 4RRPG 2A83A 1JGVH 2MHAA 2DQJH 2ARJB 1MHPH 3NH7H 5DSCA 1FFQA 3QEHA 3BPNC 4QRTB 2X4UB 4N9OB 3X3FL 5D1ZA 5TQ2L 1GJIA 4NQCA 3C5ZB 3HE6A 4YLQT 5FM8A 5FHBL 1F3DH 5D2NA 3G5YA 2BRRL 2HH0H 3UBXA 3IU4L 4UUJB 3X12B 4KFZC 3WIFB 1T1YB 3M8OH 1NCWH 3U83A 3V6FB 1KBGH 1Q0YL 1VGKB 4HUNB 4PLKC 2Y7QA 4B0MM 1HHIA 1U3JA 4WEBL 4PBXA 5FO8A 1IGFH 5FECB 1CTNA 4P4KD 3LPFA 2IPTH 3OJ2C 5C0ND 3ARDC 4NO3B 1CGXA 5I1DB 2YOCA 5AZ2L 1IM3B 3MV9A 1D9KD 1RHHB 1QSFA 2L0DA 5ESVB 5IIEB 1KEMH 1EMTL 2UYLB 2BNRD 3H6JA 1KACB 1P4LA 4G6JL 4F7EB 2VDQH 2DM3A 3WFDL 1GAFL 4DK3A 4OD1H 1XH3B 5EFIB 5E9DB 1KJMA 1NFDE 4NRXB 2XKUA 3FN0L 2O5ZH 4WO4A 2J6EA 3VFSB 4KRMB 5IVZB 5CEXB 3BYYA 3L7EA 3S96A 2A2QT 3V5KA 5GZOD 3I75B 2XI9A 1BF8A 3QDMB 1R3LA 3S4SG 4AEHH 4LSRL 2V5RA 3RWDA 4B50A 5D7JA 4GAGH 2VABB 1X5YA 2R29H 2H8PB 5DHYB 3BP7B 3PIQB 4TULH 1T7ZA 3ZKMC 1BQHG 3BRFA 1LO4L 5D9SA 3IFNL 2VZVA 5FK9A 4XT1C 1S3KH 4EVNB 1FE8L 4JREC 1CR9L 1J05A 3EOBB 1K6QH 2X6MA 4FQXC 1HI6A 3FZUD 4X0KA 3O8XB 1E4XH 4FTVD 5DJAA 2WWMD 1GOHA 3FL7A 5C07A 1LEIA 3MCLL 3GSWB 1CQKA 5IW6A 4K9EH 1FSKB 2CDGB 4YO0B 1QTYT 1VGEH 2AKRB 3DIFA 2A6KA 4NDMB 2H32H 4Z7UE 5C0JA 5EU4B 3MREA 1Z0NA 1HHGA 3H0TB 1KPRA 5FDYA 4F3FB 5DJ8A 4OLWH 5T1DH 1I7ZB 4JFZL 2DLEA 1UC6A 1R5VB 2VXSL 4NN6C 2ZSVA 1T22A 4K3DH 4PJHE 3KR3L 1QFOA 3MNVB 4DUWA 5KW9H 5DUBB 1BFTA 2YD7A 4M5ZH 4RDQF 1SY6A 1XEDA 3GIZL 2RR3A 3FO1A 5KVGL 1FPTL 1NDMB 3U7WL 3DXAB 3C6SA 3QIBB 5EPMB 2FZ3A 3C08H 4V2CB 1NGZB 4HXAH 1G7QB 2XNAA 5EIIB 4FXKA 4O2FB 4X7TA 5AAMA 2NX5E 4CMMB 2PW1A 2YN3A 4PJAE 5D7JC 3PGFH 5DJ0A 1Q9WA 4NQEA 4AIXA 4P2CG 1QLRB 1KN2L 5T1KD 1TPXC 5T1LA 4GG6B 2ZSWB 4E5XB 4ZPTA 3FO0L 1AR2A 5FGCE 1SJHB 3TA3D 5IR1B 2GHWB 3F7RA 3QEQB 1TZHA 4QTIH 5FYJE 5LXGH 4YWGL 2W0FA 1DQLH 3MOBH 4OD3L 3NAAH 3QIUB 3UJIL 1Q9OB 2CK0L 3AREC 2VLRA 1CGSL 5K9OB 2VZTA 3DVGA 3PL6D 1U91B 3PDOA 4KHXL 4LLVA 2JTDA 4LSTL 1S9XA 1HZHH 3QPXH 3CU1A 3L3OA 3THMH 5AZEL 4QHNA 4PRIB 5GS3A 3VMPA 7FABH 4Y4HB 1ZHBA 1F8TH 4UB0H 2CIKA 4D9RD 1FNEB 2EH7L 3K46A 3O0RL 5GIRA 2YPVH 1YEDA 4YGAB 2E8ZA 2WNGA 3BKML 4TSBH 4IRJD 1NGWB 1ACZA 1NGXB 2BC4B 3OWEA 1D5XA 5BRZB 4Z7OF 4M93B 4P5TC 4ZXBC 3GSNL 4S2SA 3FONB 4QHKJ 32C2B 1V3JA 3S6CA 5C0FA 2Z31C 1N2RB 5I17A 2AJYL 5K93A 3AM8C 1IMHC 4MJ6B 3CPLB 2NY7L 5LKNA 2RCSL 4UQ2A 5A1AA 5CGYD 3ZE2F 5DMKB 3ECBA 5FYJL 4MDJB 1CF8L 1JI1A 2NLJB 5F7UA 4WW1A 4JFYB 1M1SA 2EDTA 1BX2B 5GGVY 2BNQE 3KPOB 4LARH 1F4XL 1I1FA 3JVGA 2ICEB 5B39B 3T77B 2WLZA 4S1SH 4G9FE 5HVWA 2CK2A 4PB0H 1HILA 1JF6A 3O2DH 6CGTA 4I18A 5E8EA 4OAWB 4ZOAA 4IHOA 1QRND 3I9GH 2DDQH 1FCGA 3ZE0E 2APTA 5SV4A 3K3QA 4WCYH 3RGVB 1RK1B 3AMLA 1UB6B 4HIIB 4R90L 3WJJA 5ALCH 1IEAA 1ADQA 3F5WB 3UBXI 2DD8H 5FYKU 3QWQB 4NN5C 3EOYG 1G7HB 1L7IL 2I07B 1F02I 2CRIA 3MSPA 3JXAA 5K59F 5IVNA 2ATPA 2XICA 1UH4A 3VXSE 2VDML 2HRPH 3NPZB 5FYKH 3U4EB 3QNYB 2QSVA 3BHBB 2JKXA 3C5JA 5I30L 5DD3H 4OZFH 4OI7A 2OTWA 1K4CB 1AXSA 2X9XA 2WM0A 1GXEA 5DQJB 1FHGA 1UA6L 3HUJB 2YD1A 1KB5H 2IAND 3T1FA 1IZJA 2NXYB 1FG9C 1CIUA 3QUMH 5MI0B 2HLAB 1OB1B 1YNLH 1K5NA 2A6JB 3NCEB 3ZDYF 4P46B 4JZJC 3TLRA 2PW2B 3LIZH 5T3XH 4FXLA 1NC2A 1KGCD 2YEZB 4WHCA 4JM2B 2FL5A 4ZD3H 4POZC 1I9JH 4H25A 1FO0L 3ZKND 5E2TL 3S34H 5F8QC 1IGYA 4N0CC 4XH2A 4R7DB 4WHDA 5EUOB 4NNPL 3UPCA 1G9MH 4ODTL 5IFJA 4BH8B 2JELL 3RWGB 3D5OF 4XP9H 1XGRB 3M07A 3X11B 4L4VE 3UTTE 5D5MB 3MNZB 5CSBA 3SHSA 4F7CB 3VFNB 5LWYH 4YXLL 3O6LL 1ZMYA 4GSDH 5F6HJ 3WJJC 1P7QA 4Y0GA 4GKNB 2DL2A 1C1EH 1JPTH 1TJHH 3LHPL 4HBCL 4R96A 5EZIH 1OGTA 1OP9A 3H9SA 5KVFL 4HQQH 3MJGX 3FB7B 3K8MA 2EDBA 2ZWLT 3KJ6H 2VR9A 4DGVH 3ILQC 4HUUA 4ZOCA 3WO3B 2PYFA 3T0XA 1GH7A 5KSBB 3ELAT 4AEEA 5JO5A 5TE6L 1UXWB 4U1SB 3ESUF 4X5LA 2C5DC 3GJFB 4NWUL 1XF1A 2O61B 3FQNA 3QQNA 4M7ZB 5J3HC 4ZNCD 4G43B 1KJ2B 2XKSA 1AGFA 4YDIH 5E94A 3QUYD 1ONQB 1W8NA 3PWLB 4XI5C 4HK3J 5C0CE 2ADGA 1YUHB 3MUGB 4NQDE 3HA0A 3B9KD 2H6PB 5DF0A 3TH2T 4EDWH 5FF6B 5HYQA 3ALWA 1JNHB 3QDGB 1FJ1A 1LEKB 2ICWA 2ICCA 1L9NA 4ELKA 5DJ6B 2EDFA 3SDXE 4TSCL 5CHNA 2XZCH 4U1LA 1X5LA 2CIIA 3CAFA 5B38A 1JWUA 4NRZB 4U6HB 4KI5D 1DQDL 1MFCL 2X7LB 4MJIA 1K3IA 3DGGB 4OM0H 4HWEH 1CVRA 3F62A 1NAKH 4ZAKB 4L3EB 5JHDD 3R8QA 1R5IA 1NGYA 1ITCA 5A2LH 5DJXA 2GCYB