1Q0XH

Anti-morphine antibody 9b1 unliganded form
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
221
structure length
215
Chain Sequence
EVQLQQSGAELMKPGASVKISCKATGYTFSSYWIEWVKQRPGHGLEWIGEILPGSGDTIFNEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARWVLDYYGMDYWGQGTSLTVSSASTTPPSVYPLAPGGSAMVTLGCLVKGYFPEPVTVVWNKGSLSTGTHTFPAVLAADLYTLSSSVTVSASSWPGQSVTCNVAHPASSTKVDKKIAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anchoring a cationic ligand: the structure of the Fab fragment of the anti-morphine antibody 9B1 and its complex with morphine
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Fab 9B1, light chain
total genus 41
structure length 215
sequence length 221
ec nomenclature
pdb deposition date 2003-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q0xH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1q0xH02
4CRPA 1K4DA 4IRSD 2WBWB 4TSBH 3V5HB 2P8MB 4KK9D 3QUZB 4OZHE 5FDWB 3NAAH 4Y1AE 1RI8A 3KDMB 4P4KD 3WKML 5DC9B 4DN4L 4Z7VB 4OQTA 1T22A 1P7HL 1UQSB 3EDEA 4BZYA 3O8XB 1A3RH 2NLJA 3LEXA 3MC0A 3EFFB 3QUZD 1RJZA 3WJJA 5INCA 2EE3A 4BQ9A 1R5VB 2H26A 4MMZC 2VL4A 1G9NC 3LEYH 5JW4N 3OJDB 4KHTL 4EUPG 2BNQD 2JJSA 4P2OA 3R8QA 1AQDB 5KVEL 4WU5B 5D93B 3CGTA 4ALAH 5I8CA 1MHEA 3HB3D 4ZYKB 3DECA 5DJ0B 5E03A 1KCKA 3RWJA 1GGTA 1FNFA 3TA3C 4I9WE 5C0ND 3HMWL 2R8SL 2PETA 5JNYA 3BZFA 3BSZL 1SY6H 4XBPA 1CU4L 1KOAA 5AZ2L 3HS0B 3ZYIA 3I75A 1GZPB 3O2WL 5C71A 1FYTB 1JZ5A 2NXYC 2VDKL 1P4LA 2WIIA 3NN8A 2DQCL 4OZHB 4N1EA 3MCG1 4NIKB 2EZ0C 4UINH 2FZ3A 3BJLA 1JFQH 2YA2A 1ADQA 3MRCA 5DLML 3C09C 1CL7L 1NGZA 4PJ5E 2AV1B 3ELAT 3HE6C 3WFDH 3QEHB 2CSPA 3AREB 1NFDA 2IANA 5BV7H 4WFHE 1W0VB 4N0YH 4PJGA 5K9OA 4PJ7B 2K9UA 1OD7A 1KCVL 3E6FA 5CJXC 1NGXA 2H8PB 2XRAL 1CXHA 1FC1A 4LNRB 3MRHA 2QEJA 5EORL 1NGWA 5EBWA 5IVNA 3GJFH 1U8LA 4LF3A 1VADA 1MWAA 5C6TH 4KKCD 1A0QL 1QHOA 3CPLB 5I8OL 3GUTB 5I71C 4JDZA 4ZS7L 1FN4B 4P3DA 1XF3A 1CE1H 2GTWA 2NX5E 2FO1A 5D8JL 5LCVH 2WWKT 3KHQA 2CLZA 5CJQH 4M8VA 3KPSB 3RA7H 4N0FA 1T2QH 5F44A 3TESA 1UH2A 1MJUL 4Q9QL 3I2CL 1M6OA 1Q9OB 3NABH 1WTGT 5AZEH 3TPUA 3G6JB 3I3EA 1FFNA 3LHPH 3GO1H 4NSKB 3RGVC 2DKMA 4HXAH 4LLYA 2WZPD 4WJ5A 5I6XC 1C1EH 1ND0B 4L3AA 2YUVA 2VH5L 4C4KT 4NNYB 4YX2H 5ADPL 4HG4J 5JZ7C 1NSNH 1T3FA 3RDTD 2VLJB 1BX2B 3MUZ1 1V7ML 4O02L 1C5BH 3UTSA 1CFSA 1X5IA 1A7OH 2FYYB 4P99A 5E6IB 1F3JB 1DN2A 3CSBA 3KPSD 3IVKB 1CE6A 4D2NA 4KTDH 2IPTL 5TQ0L 3T0AA 4GQPH 2P5WD 3S88H 2XKUA 3G04B 2HT4C 2DQIH 5IF0B 5LGHL 2XICA 1S78C 1ZLWH 4P5TA 5HI4C 4KK5D 3G5XA 3TWCH 1R5IA 4KRPC 4LRNL 3U0PA 1N6QL 1QKZL 3WLBA 4GBXB 4FQCH 4PG2C 5IMKB 5TE6L 3BDYH 4DKDC 4PV8A 2MHAB 5EO9A 5F7FA 3FO0L 3RDTB 3QQ9D 1KCVH 1UWXK 4I48A 1K8DB 2XKNA 3C60D 4Y5YA 1KG0B 3EYVA 1BFTA 4NDMB 5SV4A 3VFOB 4XBPB 1YMMD 1LO3H 1BQHG 5I9QB 2VDPL 3LN5B 1CFQB 4DZBA 2X44D 2OX5A 3BPNC 3KPMB 5GGQH 1SBSL 5HI4D 2BERA 3MPCA 1G6RB 4MB5A 1FG2A 4K7FA 5TDOA 5E8DL 5JXEA 1N2RB 4XVSL 5FYJL 4C59B 5JMRA 2E7MA 5HPMB 5HHOE 4HZAA 5FYKE 3TBSB 1X5HA 4Y5XC 3QDGE 3C8DA 3HPLA 3V4VH 5HGBB 1DANU 3TO4B 4G8GB 2VXSH 3V6FA 1HNGA 2DI9A 4HJ0D 5D1QC 1EEUA 3V6OC 2ZCLH 2VB5A 1SBBA 1JRHH 4NKDB 1D5BA 4MDIB 4WW2C 2YZ8A 3VXUD 2NY0B 3RVXC 3PV6A 1ZLSL 1D9KD 2PO6B 2A74B 2D0HA 4PBWD 4RWYL 3DXAB 1V7NL 2AW2A 1U58A 2NTSP 5HDLA 4Y2DD 4N8PA 4U1KB 3PWLB 5CEZL 4HCRH 1IT9L 3HZMA 2P8MA 5FDWA 2XN9B 3DYOA 3U4AA 2GK2A 3OKMA 4M48L 2R4RL 4LMQI 3UJTH 3QDHA 2HT2D 2OI9B 2XA8L 3MGTA 3PP3K 4LLVB 3SHSA 1EHNA 5EG6C 4U6XA 4QRUA 5AG9A 4FQHA 5GSVA 5EN2A 3WDHA 1QSEB 1NCBH 1VFOA 4NNXA 1XGPA 3ES6A 3LPFA 3WDIA 1U93B 5KSBE 2CKNA 4MWFB 4GRWF 1BM3H 4YDIL 1ZHKA 2H45A 1SVZA 3MOAH 2NY4D 5JLZA 1NCAH 3BISA 1OPGH 3X3FH 1J7VR 3T2QA 2BVQB 4N0CC 5CUSL 2W60B 1N0XH 1NMBL 2V9TA 4KRLB 2QADB 4HKXA 3RBGA 1UEMA 5HHMB 3LQMA 3O3EB 5EPMB 5H2BB 1A1NB 1TPXB 2LQRA 2FIKA 5JIHA 2AKRB 2AV7B 2F53A 3AFLA 3WE6B 5IP4A 2EYRA 3VFWA 1AO7A 3C60A 3FQWA 4OGYL 5IVXE 2P1YA 4LQ1A 3SKNA 3O6FA 4H88H 1BJMA 2DYPD 4ONHA 4QHKI 3HPJB 4G8FA 4P2CG 2VKWA 3TH3T 1A9BB 3EO1B 5DD5H 5GZNC 5DHVA 1DLHA 3TN0D 4NUJB 1T7XA 3ZKMC 4BZ1H 1G7JB 2HYMA 3DTXB 3BYYA 1IQWL 3O2VL 3GMNB 1JHLL 3ARGA 5GJSH 2F5BL 3MJ7A 1NFKA 5CGYC 4R9HA 4LSPH 2Z35A 3K8LA 5MI0C 2YWYA 1YC7A 2FH8A 5HGGS 3NFPA 1NAMH 3DIFA 1N8ZB 4AMKH 2H9GB 3BP5A 3CFKB 2NXZB 4KY1L 1T21A 3U30B 2FX9H 4PRBA 2Z0BA 3T0ED 2IALA 4WI6A 3WFBH 5TDPA 2APFA 4O2FB 4B5EA 4N9GA 1JGLL 3L3IB 2MCG1 3EYFB 1MJ8H 4HDIA 4Z76B 1JMXA 1UB5B 5MP6H 4OZIF 3IDIB 4GRLD 3PNWA 1XFPA 4N0RA 1BD2D 2ERJC 1I7TA 1GZQA 1FHGA 4Q6IA 1A7NH 4HK3N 4LEXL 4XPBL 3HI5H 4JHWL 1C7TA 5CHNA 3TNNA 3RJQB 4TPRH 4QGTA 3I9GL 2E27H 2ICWB 3FAXA 1UYWL 4C56D 3X13B 2IMMA 3BI9X 1PZUB 1FFNB 5DS8B 5D2LF 2BNRE 3MBXH 5LGJA 3U83A 3MNZA 2NY1D 1OCWL 2Y6SC 4JANB 4K2UH 43C9B 5HDBF 4DGYH 2Z8SA 5DRXB 3TZVC 3IJHB 1P53A 4HPOL 4KTDL 2B20A 1P84K 1NAKH 3KJ4C 2VLJA 5IVZA 5JHDB 3KPSA 3VCLA 2BSSA 2GY7B 5E2JA 4YK4C 1AJ7L 4MS8C 1MCPL 4Y16B 4F7TB 4NFBA 1P7KA 1FZKB 4LLDB 1IAIH 2ILLA 1S7WA 1EK3A 5GS1A 4M6AA 5CP3A 4OFPA 2AK4A 1H3GA 1X6NA 2GUOB 2YK1H 1RIHL 1ZSDA 4J8RA 5FV1L 5FB8B 2GY5A 2XI9A 3G04A 3EOTH 2XG4A 1FL5B 4JFEE 2XQYG 3S97C 2G60H 3ZE2E 1CGXA 2F54E 5E2WL 1RK0A 3WIFA 4PJ5A 3UTSB 3BT2L 1EMTL 3KPRE 2LTQB 1R3LB 1CGSH 4G9FB 2OR7A 3O3UN 4NQXA 4QXUL 3GBNL 3VXQA 2V7HB 2EYRB 3RVUC 3T4AA 3UJIH 1AXIB 4OZ4A 3SO5A 4K7PL 2BXZA 1R3JA 4TTGA 2R2BA 4IBLT 4NDMA 3MFFA 1ZTXH 5F7YC 3OX8B 4HS3A 5DJZB 3VD4A 3P4MB 3ZTJG 3MZTA 4UV7L 5SX4I 4IS6B 2UYLA 5TPWH 3HE7C 4JGMA 1A6UL 1JPTH 3B5HA 4N0FB 4DN3L 5E2WH 3WJLC 4HX1A 5F9AC 1S7TA 5DD3H 4D0CA 5CKAA 4LFHG 2WWMD 4PJEA 1AP2B 1YUHA 3QQ9C 5IM7A 3GBNH 5HYFA 4K3DH 4NQVA 5D1XD 2IQ9H 1RZ7H 4UNVA 4GRMA 4UDTA 4I9WD 2EDDA 1S9KC 4B7LA 2QSTA 3DV4A 1AR1D 4LKCA 4EIZC 4YPGA 4DOHE 1AE6L 3IJSB 1WBXB 3P9LB 1TETL 5E2UH 3EJZC 4KDTA 4S1DD 3QRGL 4R7DA 1A6UH 4HIIB 1T6VN 2YS4A 4FS0A 1MIEH 4YQXL 2OR9L 3BXNB 4LNVA 3QPQC 4IRSA 3O3BB 4JN2B 5HTSA 2CDEA 3ARFA 3LN5A 4M1DL 3V9FA 4KPHH 4JG1H 1FL6B 4YHZH 2KPNA 1RUKH 4DJMA 1CT8A 1XGQA 2EDQA 5ECJE 4AM0A 1EV2E 1F8TL 4RQQB 4PGDB 5EU7E 4OQTH 3RWIA 3WFEL 3MLWL 1B0RB 4HIJA 3MRQA 1MI5D 3FCTA 4OZFB 12E8L 1U8NB 3HFMH 5CP3H 3ZDXE 3QWQB 1JGEB 1OSPH 3M1BA 4OUUB 1A64A 3S36H 2XPGB 1LNUA 4OQ1A 3WN5B 1NBQA 5BO1L 4PS4H 3ZE2F 4X6EA 4Y4KC 1AGEA 4CADB 3B2UD 4YHZL 4DZBB 2NY6D 4J4PC 5C0DA 1HWGB 4LLVA 3CLEH 2P7TA 3U7WH 4WVRA 4HKXB 3QH3A 2BRRL 4O4YL 4OSUH 1NMCC 1ED3B 3AY4A 3H2WA 4GRLC 4Q58C 25C8H 2AK4D 2FX7L 3K8KA 3T0VA 2KUTA 1G1YA 4JQIH 1RUMH 1ZLVH 4EKXA 4S1RL 1IM3B 1QQDA 4GOSA 3VXSD 2EKSA 4QHUB 1RZKL 4LDOB 1OTTD 4HHAA 2VZVA 1HIML 2FHBA 4U1GB 3D85B 4DWHA 4JKMA 4U1HB 4M5YL 5LG1A 2X4TA 2DLIA 3L3JA 1NEZG 1I7ZB 5JLZB 1BIIA 4MNGB 4NN5B 5E99L 4BKLA 1JJUA 5I17B 4HK0A 5CILL 1K5NA 4YHLH 3W0WD 1AGBA 4JFZL 5FXCH 4L3EB 4ZUUA 3FQUB 3QT2A 4S1RH 3E8UL 4XNUH 2JIXB 2BRQA 1E4WH 3MNWA 2VQTA 3IDJB 2FWOB 4XXCC 1OTTC 5DRNB 2YPLB 4FFZL 3F7RA 2LV4A 3I6GA 4OJFL 5EZJB 1KB5B 1A9BA 4CJ1A 4U3XA 3RGVB 5CIPB 5F1NB 3W2DH 1X6LA 5C0EA 3RWFA 3BDXA 5DK2A 1EHLH 3BP5B 3BOVA 1IQWH 3O2VH 4XPGL 3QJHA 2Y7QB 2R0WL 1JN6B 2X2YA 5ID1A 2CXGA 3M45A 2R56H 4TRPH 4X5WB 4I0KA 1I4FB 3GHEL 4G43B 4HWBA 5L2KB 1INDL 3MROB 4HWNA 4IJ3C 4XAKE 3EJYC 1OGAB 4JKWA 4XGZB 4WHDA 2Z8WC 1AIFB 5HHVH 1AQKL 2FX7H 5EFIB 3UCRA 2IAMA 4LCWB 5DYOB 1FGNL 5CD5D 1XCTB 5ICYB 2MPAH 4M7LT 3DO7B 4JFHE 1HIMH 4IDJH 2BVEA 2I9LA 1BF2A 5JR1L 5LBSL 4IOIA 3C8HA 3HI5L 4JHWH 5BS0E 1AKJA 1TXKA 2IWGA 1AR1C 3E3QE 4MX7B 5CHNB 2XQBH 4YHMH 4MJ6B 4Z7WE 1J1XL 3GBML 4H25B 3RWGB 3W9DB 3DVNB 3WEXB 5I9QC 5KS9B 1JWSB 2R0LH 3D2UA 3P4OB 4FQ2H 3ZE1F 4A2LA 4F7CB 2UWEA 3ILPA 4HWZA 3DUUB 5L0QC 1TCRA 4L8CA 2D9QB 3BZ4B 4JFDE 3DMMC 43C9A 1G7LB 3VGEA 2VLKB 2BDNL 2OTUA 4JPWH 2OJEB 2QQNL 3EO0B 4JM2C 5E00A 1KTLB 4R0LB 4WDIB 3LQZA 4GJTB 1AJ7H 5GXBB 2OSLA 4OJFH 1F97A 1B2WH 1XZ0B 1IAIM 2CR6A 1A7RL 3TO4C 2WUBH 1MHHB 1CGWA 3QJFB 1QO3B 3SDXA 3MOBH 5DQDH 2GAZA 2VXUL 3HMXA 2H1PH 1X5LA 4OCMC 2VE6B 5DJ8B 1A3LL 3BEVA 4P5KB 3L3OA 2G5BB 3ZTNH 1LK2B 1DUZA 3MYJA 3QRGH 2CXKA 4NQTA 5F9DC 1OQOA 2UVEA 1P7QD 4L5FH 1DLFH 1CGSL 4HEPG 2ZNWA 4WV1A 2XNAA 4FQIL 2RHEA 1OGTA 3QUYC 3MYZA 1A22B 1C12A 1BOGA 4MAYA 1IGIL 4KJPC 4NWTL 5KSAD 1T1WB 1D5ZB 1T5XA 4OCWH 3RIFK 1GIGH 1HINH 2FLRT 4HMCA 1QLFB 1E6JH 2HFFA 2VDKH 4QOKB 2YXFA 3NACH 1JK8B 4MCYB 4ENED 1RK1B 5LJYH 1KUMA 3AS2A 1DFBH 5JR1H 3WXVH 4RSVA 3IAQA 4N5UA 5JXAH 4AT6A 1C5CL 2J8UE 4YPJA 4URTB 3B3IB 2DJUA 1LWRA 4PRDA 3FB5B 4HC1A 4G9FA 1OHQA 5B39G 4DEPB 2QADC 2HT3D 2DLFH 3WO4C 1B9ZA 3UPRB 5C0NC 5I1LA 4JFFD 4NQED 4P0DA 5AWNL 4LASH 3CDFA 3V6BR 3V7AE 2QLVB 4DVRH 4APQC 3RTQB 2OK0L 5JHLH 2AK1H 2W0FA 1L0QA 4XX1G 4UT6H 1GCFA 3O6ML 1KIPB 1ZK9A 4M1DH 4P5TD 1PY9A 3TCXA 1U8PA 1MCKA 3SPVB 4YO0B 1NDMA 5EH1A 3ARED 1OL0A 3MJ9H 1JPGB 1IC7L 3LN4B 1TJHL 1OLLA 5DQ9B 3VFVB 5EUOB 1YECL 2O5YH 3IDUA 2X4UA 1KENL 3VFMB 1J88A 1QLRA 3TYFB 1P2CA 2DDQL 5DMKB 1B3JA 2IH3B 3QI9C 1ZGLB 3Q0HA 4M1GH 4NUGH 5F7NC 3SGJC 4K8RC 5GZND 5CCKL 5JMOC 5F21B 4PRHB 2Z8VC 5ERWB 1NCNA 2PYEA 5EWIL 4JZNA 3KNBA 5DQJB 1J1PH 3IU4L 4YHOH 1BD2A 4LCWE 1C7SA 3SBWA 3LS4H 3RWHA 3IJYA 3KXFE 3RY5A 3T1FB 5C07D 1YYML 4IRJC 2X4PA 1OM3H 2B0SL 2JCCE 2XWJB 5F88B 4L3CA 2ZUQC 4EDXA 5BS0A 2DMKA 5CGTA 4CMHC 2IPKB 5LWYH 3QP3A 4NQCA 2JJSC 4P2OC 3FFCE 1GGUA 1CZ8L 1J0IA 1OARL 4TTDD 4J6RH 4JDTL 3S4SB 3C08L 3EHBD 1CS6A 2HN7A 4KMTH 3VH8A 1OTUC 1UZ6F 3C9NA 4QHUA 2DS4A 4H8WH 4P46A 2XACC 3H9HA 3T2NH 2B1AL 3E6FB 1QLEH 1FAIH 4E0RB 3WSQH 4WI3A 5ADOL 1YDPA 3HC0A 5HGAA 3RZCA 1IGML 3C6SB 3CC5B 2PR4H 1OAYL 3TZVB 2EYTB 3Q6FB 3AAZA 2VXSL 3P11H 4FNLH 1P1ZA 4LSQH 3L6FA 5DJ6B 3QH3B 2Y25A 4BSVB 4QT5B 3EUUA 1PEWA 1IAOA 4FQ1L 2NY1B 4ELKB 3P73A 4UAOB 4YDKH 5E8DH 3DUSB 2V2XB 3GSWA 1KFAL 3FN0L 2XA3A 4FXGA 2VDRL 2E5EA 3N06B 1IM3A 1YNKL 1PQZB 3CVHL 5T1DL 3LH2L 4PREB 4XPTH 1A1OB 3F7PC 4OTXH 3OKLA 1PW3A 2JJVA 3DNKA 4QTIH 4Y19D 3SDXB 2YC1A 1F58L 4N5ED 4XTRC 2LTQC 5F1NA 3DX8B 3MODH 1F6AA 4NKMA 1KC5L 2HRPL 5LVEA 2F58L 3JWOH 3SDYL 1INQA 4PJXE 1G6VK 5CSZB 3L7EA 4XCFL 4WU7A 3RL1A 2FX8H 1GOGA 1N5YL 4GQ9H 2VDQH 3S35X 1T7ZA 2GSGA 4ZFGH 1KCSH 4JPWL 3VRIA 1IC4H 1OQXA 2QSCL 1Z6JT 3C5SB 4ODWB 1EEZB 1JF5A 4UQ3A 3BIKA 2UWEB 4C58B 1VGEH 4J3OC 5DD0L 1XGYH 1KTDB 4HC1L 3GBLA 3RVUD 2UVFA 3HNSL 3IGAA 1P9MA 2X05A 1QBMH 3ULUH 2CRIA 3IFLL 1QFPA 3GKWH 4OGYH 5CEXB 2R2HA 4KK8C 5D7LE 3SOBL 5DGRA 5EU3A 4I48B 3TBWB 4FZ8L 2J6EL 4JO1L 3LSOB 3M8OH 5GGVH 1UM6H 1CN4A 3W5NA 4I5BA 2VQ1B 2B5IC 1HHJB 4M8QB 5T1LA 5ITBL 1SVCP 1A6ZB 1TIUA 1MJUH 5ILTL 3I2CH 2BHYA 1OY3B 3O3AA 4FQ2L 4R97C 2J7LA 3QCVH 1XZ0A 5ISZA 1ZHNB 4K3EL 4I4WA 3D5OF 3K80A 5B4MD 4JRWA 1LEKB 3G6JE 3GNMH 4NBYB 4PJCF 5FEBA 1E28A 4I2XA 1M6OB 4H20H 3DROA 1C5CH 4ONOA 4BSWA 1QA9B 2FLBT 3HRPA 3ARFD 1QLFA 2BVPA 3R06B 2MFNA 1KACB 1YEJH 2UZIH 2G5RA 2DM7A 1ZHBB 1CDBA 3LEYL 2N4IA 4CVXB 1IEAB 5IWLA 4HKJA 1Z9OA 5HBBA 2H6PA 2Q7NA 5ENWB 3OR6B 4PP1D 3WFZA 4P2QE 4QT5A 2IG2L 2BY2A 3QZWB 1N5YH 4Q9BA 2HLAA 2NX5A 1XGPB 3ES6B 1MH5B 5HDQH 5IW3A 3VFGL 1EAPA 1UM5L 3GRWA 2WP3O 1IC1A 1HI6B 5ALCL 5HJ3A 3NABL 4GAGH 4P5TB 3TN0C 2A73A 3WL9A 4LSSH 1KGCD 4QCIB 5CMAB 4LDEB 3NIDE 2JB5H 2VC2L 2JJTA 4JFQA 2WIMA 5DUPL 3RX5A 4NJ9L 4M61A 2CLRA 3KPSE 1F6AB 4NKMB 3RZCC 2UUDK 4IMKA 4Z0BL 3RDTA 5I2IA 1Z3GH 4PJHE 1VGKB 3RPKA 4P4RB 3HUJB 4QRSB 1N3NA 1VB9A 1MJ8L 2WUCL 2AAVA 1NDGB 3RI5F 5SWQB 4APQD 3K1KC 3D39E 1FO0L 4M03A 3T0EC 4ZMAT 5EU4A 5I73B 3O6KH 4WY7H 2JJUA 1NAKL 5TDPB 4YBLC 1KTDA 2XT1B 5C08E 3TWCL 4JFDD 5IKCB 4WHTB 1DEEA 4G8GE 5IMOB 3HE6B 5SWZB 4PJ8A 1KJ2B 3B2VL 3QUML 5E7FA 5DMKA 5BS0D 3CXHJ 2DQTH 1NAMB 4R26H 5JOPE 2JJWA 5FFLA 1H15B 5EOQL 4NKDA 4L8SA 4HCRL 3FHAA 3L3IA 1VDGA 2YHGA 1OT2A 4HDIB 4P46D 2EICA 1J0YA 2Y23A 2EDTA 2R4RH 4M7ZC 5EC1A 3MLPA 3T77B 5E70A 2H2PC 4U1KA 2VH5H 4YUEH 4Q6IB 5ACLA 1M7DB 4E0RA 4X4MA 3MRBB 1HQ4A 1N2RA 1EZVX 1Q0YH 3PJSB 4KKNA 1ZS8A 1SM3L 2HTKD 1ZEAH 3VG9C 3WS6A 1G7IA 3LN9A 4JFDB 3SQOH 5IHUL 3L5WB 3MV8B 3MV7A 4HUWA 1I7RB 3RNKA 4IHOB 4A6YB 4GSDL 4P46C 3SN6N 1LEIA 4HS6B 2XWJA 3HN3A 2RCSL 4ZDHA 5C6TL 4NO5B 1WICA 3NIDF 1DBBH 2ZCKH 4Z8FL 3DHMA 2OJZL 2EYTA 3Q6FA 4CVUA 3T09A 1RJCA 5HHME 2H3NA 4K3JH 4DZ8A 3QHZL 5ISZE 4HF5L 1OD9A 3RGHA 4YDJB 5EOTB 1IT9H 3QHFL 3TIDB 3MV01 3U0WL 1AD0B 2OR8A 5AZEL 5J6HA 3HFML 1ZWIA 4E41E 1OOAA 3DMMB 5EBLA 5I19L 1I9RH 5HD8C 3QYCA 3E6HB 3L1OH 3LPGA 1VGEL 3JWNC 4HFWB 1ZGLP 3GM8A 1KN2L 2OCFD 5F88A 4OGXH 5GGVY 3GJFB 4NZRH 4LAQL 2YC1B 4D0BB 2DB8A 4OF3A 4HX1B 4ZO6A 3BH9B 5ICZA 4O2EA 1DZBA 2GHWB 4OLWL 4YFLF 1GGIL 5FO9B 1YA5A 5DR5H 1QFWI 3Q48A 3VXQB 4UTBL 2EDEA 4XNZB 1ERNA 4HH9A 3I3BA 1GC1H 3BJ91 3VFNA 2BC4B 4GW4A 1K9TA 4PTTB 1I1AB 3VFTB 1KPRB 3VA6A 3O2DL 3SDYH 2I25N 3AY4C 3O6FB 4I5BB 1F4YL 2VQ1A 5E1HB 1OAQH 1K3IA 5I1HH 2AEQL 3V0AC 2BVOA 1DEEB 2Q7YA 3BWAB 4NQDB 5ESVA 3BYTA 2NW2B 4OFYA 1JWMB 3V0VB 4GKNB 3ULUE 2GJ6E 4LVHC 5CZVL 1XCQB 4MNQD 4NRXB 1CLCA 2YEZA 4I13B 4WO4A 5M7QA 4UDUA 3GSXB 3B5GA 2HWZL 2BNQE 3B43A 1XR9B 3BKML 2CDEB 4ZFFA 3SEPA 1W2KT 2DLTA 2CR3A 5IQ9A 5E8OA 5KSVB 4ZAKB 4KUCD 4JN1L 4YGVB 5GGSB 3D2UD 2J6EA 1MI5E 1XGTB 1CXLA 2ATKA 4MQSB 4YDVA 4UIMB 1ZHNA 3GSQB 1HOCA 2BNUB 2DQJL 4MGXA 3TC9A 3FFDA 2DM4A 1NBYB 5FUZL 5FYLL 5E4IA 3L1OL 4MZ3A 1T1YB 1A6WH 2P43B 3QULB 4O2CB 5EZLA 1S7WB 5GS0D 2AV1A 1ZVSB 3K8MA 1HWHB 2OP4H 1DBAH 5KS9E 2BVPB 2P5ED 4XBGB 4JCMA 1I3RB 1UVQB 3I9GH 1S7RA 4JHAH 4R96B 2DMCA 2ZSVA 4DK6A 4KKAD 1IFHH 1RZGB 4YFEA 1EBPA 5ANME 1QNZL 3LRSA 5C3LD 4JFPB 5BRZE 3OR6A 2F5AH 5CILH 3SGDH 4G5ZL 4XCCL 4AH2B 3BZDA 4JRYB 1XF5B 2CGRL 3MXVH 3U9PH 1U2CA 2XA8H 3QUXA 1MVUA 1NFDE 2IANE 1AD0A 1HHJA 4M8QA 4W4NA 2V7HA 3I6KB 1FIGL 4Z7UF 3IFNH 4RX4A 4FTVD 3O6KL 4PGBB 5C08B 1PVHA 1GGCL 5C2BH 4PRHD 4U1IA 2OZ4H 1D5MB 1ZKAA 2Z4QB 5KANG 4JJHA 4XMLL 1F13A 2X4TB 2Z31C 2NX5D 1WVZA 3QCUL 4YDLC 1A5FH 1JRHI 2X7LA 3OJDA 5T33H 1MQKH 1J10A 5J4MA 5BJTA 5J1SC 5IQ7H 1IL1A 4U1MA 4KKLD 3IB4A 2H32H 4Z77A 1DQDL 5TDNB 3VFSB 4ZUWA 1FNEB 4N90D 2VL5B 3A67H 1HH6B 5EZOH 1FO0B 1NBZB 4HPYH 4JAMA 3VWKD 5CEYB 5GGRB 4KI5E 2CPCA 2ID5A 4Z7NE 3OX8A 4HS3B 2OS7A 3O3BA 5TPWL 1T66D 1E4KC 1JWMA 1W8NA 1HILB 1OCWH 1CK0L 2I24N 5CGYD 3PWJA 1R24B 3P4NA 3H9SB 5IB1B 3MRMA 1MFAL 5CLTA 4O51A 2AJVL 3H3PH 1ZHLB 2MCPH 4D8PB 3MRCB 3MRQB 1RZ7L 1UEYA 1VKXA 4NM4L 3DPBA 1DBBL 4OGAC 1U8NA 3GMOA 3VFOA 4ZD3L 1WJ3A 1EEYB 1HINL 3T0WA 1T22B 5E6ZA 3WHE0 5ID1B 1CDYA 3VXMA 4KRNA 4TVPH 5GS2D 4JQXA 4R4NC 2QQNH 1Q94B 5SWQA 3WMSA 3S88L 1NL0L 2W59A 2P5WE 1F00I 3EO9L 3BXNA 2BOBA 1JTOA 3CMOL 1YMME 3DMMD 5CJBA 3NN8B 4FQLL 3GUTA 3HR5A 1EFQA 5AD0A 2XYCA 1IC5L 1T6WA 1UA6L 4J2XA 1XF2A 3C5ZA 5ESAB 3UJIL 2E9BA 5GISH 3F6LA 7FABL 4UQ2A 5F3BB 1IMHC 2FGZA 2CRYA 1ETZA 3HG1B 3CU7A 4ISVA 5IB3A 1HHIA 4KHXL 3SJVA 4NM8L 4NZUH 3MMEA 5GGUA 2ZZUT 4JFPA 2ZG1A 3NBNA 5HHPA 1H3PL 4XC1H 4LMQE 2Z93A 2EECA 3NCBB 5FUOL 4KI5D 1KF9B 2XFXA 3NCYP 1OAXH 2A74A 3AB0B 3ARDB 2D7OA 4MS8D 3NMEA 2VLJE 1NGQL 5C0IB 5F6HJ 4QHMB 3RBSA 4Y1AA 1HHGA 4ONGL 4HFWA 5LQBH 4PP2A 4R97B 1ZVHA 3B4NA 4LCIL 3BFOA 2VISB 4MXQD 1VEPA 1W0YT 3ORJA 2BNQA 1MJ7L 4OZFH 5J6HB 5DHYA 5I19H 4NNXB 4CBPA 4Z7WA 1MREL 1DSFH 3OAUH 4FABL 2LVEA 2WBJB 4XPGH 1LP9A 5DA0B 1QO3A 1TJGH 3QJFA 3PGCB 4FFVC 3F7VA 1Q0XL 1G7PA 4K94H 4QRQA 4W6YB 4BYHA 3RWCA 2DICA 4PJAE 5FKPB 4ZDHB 4XP4H 3V0VA 3ARXA 3F12A 4OF8A 3OKKA 2XNAB 1XCQA 5DMIH 3PGDA 3SCMA 2C1PB 5IR1B 4M02A 3WBDA 4Y5YB 2HT3C 2IQAA 1K3ZA 3HE7D 3IU3B 2ZSWA 1CE6B 1ZLVK 1OB1B 3QIWC 4HZLA 4NT6B 5DXWA 1GGIH 3BZEA 4NQEB 2RIKA 4UT6L 1IAII 1L7IH 3L7FB 3UO1L 2OLDA 1OGTB 5JXEC 2BHZA 5B39B 1T0MA 1NC2D 3FO9A 3U79A 4RISH 1KPRA 4FFZH 4FFVD 4LHUA 1G0DA 1ZANH 4KAQL 5E8PB 3VGGA 1ZXQA 1G9MH 1CLOH 3BP4B 4P5TC 3TN0B 4PJXB 4YAQA 1EZVY 2Y72A 3AMLA 4F57L 1RK1A 4ERSH 3MRIA 1TETH 3O4OB 2NW2A 1SQ2N 4YEEA 1T04B 4GG8B 2I9LB 1BP3B 2OMBA 3ULUC 1N0XL 1NMBH 4P3CL 3QUZC 5D6CB 1DN0A 1RZJH 3F7YA 3V5KA 4FHBD 3VRLE 5D6DA 3TYFA 4ODXB 4ODHL 3PWVA 4X7TB 4QYOA 5T1KD 2W38A 1KT2B 1MEXH 2D9CA 4GXUN 1DTUA 2CK0H 3RPIB 4DQOH 4G3YL 4OLXL 4LARL 1YYMH 4GRLB 1XF2B 4FNLL 1IKFL 2HJLA 4JLRA 3LKOB 3MREB 5FV2A 1HCVA 2EDJA 1U8HB 4HJJL 5BVJB 1IZKA 1WV7T 3IF1A 5GGTH 4PGBA 4GBXA 2CUHA 1EEQA 1F2XK 3TM6A 1V3JA 4TQEH 3MV9B 3VU2A 4L4JA 5ITFA 1MRCL 4HMEA 5IMLA 4NRXA 1H5BC 3TH4T 3WSQL 5ADOH 1BD2E 1BWWA 2GCYB 2ZP0T 3INUL 3UJJL 1P5UA 3AM8A 3L3DB 3BKJL 1GHFL 5F9WC 1NAML 3V6ZA 3KXFD 32C2B 1QYGH 3QBTB 4RFEA 1JNNL 2D4FA 4QRPA 3DRTB 3ARPA 3VGFA 1BFSA 1F90H 3L3OB 3PQYB 1LHZA 4C56E 1URLA 1XGYL 4L1HA 2YD8A 2AJSL 4HWEL 4P59H 1MY5A 1C8PA 1PYWB 4OFYD 4NBXB 4HWZB 5FO7A 3VXRE 2J5LC 1CTNA 1MUJA 2RFXA 4UZGA 3KNBB 4FQCL 3AC0A 5DQJA 3ULVE 1S7SB 4QGYA 3BIBX 3ZT5A 1QSFA 4HUXA 4ZFGL 1C12B 5FA4B 2HN7B 5FB8A 2OSLB 4XNXL 1G7QB 2GEEA 5E8EB 4YBQC 5JORA 3L5XH 2LU4A 1CXEA 3WNNA 3HC3H 5BXFB 2MCPL 2GTZA 3FB7A 1F2QA 3OAZH 5L8LB 1AC6A 5D5MB 3ZHDA 2Y5EA 3MSPA 5EC2A 1F90L 4FQXD 4PJIA 3KPRB 2IFFH 3QCUH 3L95B 5GZOC 1EBAA 4KXZH 1T4KB 4HIEA 3P40A 4UV4L 2AEPL 4X7CC 3U2SA 4NHCL 1FLRH 3FB8A 1EIBA 5IW6B 4NT6A 5AEAA 3X11A 3O3EA 4BFBD 4PRDB 4NQEA 4QHNB 2BMKA 4O58L 3PHQA 1MCLA 1A3RL 2LE9A 3NCJL 4BSJA 3QIUA 4Z78A 4HKZB 4XXDA 2GK0B 1U92A 3VGAC 3MCKA 4KHTH 1PX3A 3PL6A 1IAKB 3U1SH 3WKMH 4EQ2A 3LV3A 3GJEA 4OD1H 1JUFB 4KH2A 3D18B 2R0WH 3TYGH 5KS9F 4KFZC 2JB6A 3U0TB 1E6OL 5BJTB 1V3KA 4U1JB 5CSZA 5GRZA 2NY0D 4FQXA 4WWID 3BPCB 3KPRD 4HUVB 5FHBH 2X4OA 3NCJH 4HEME 3RVWC 1T21B 1XR8A 2V7NA 5FK9B 2VLRA 4M3JA 5TGBA 3V0WH 1NBZA 4E5XA 4MAUL 3I85A 4P5MA 1JZ6A 3S9DB 1NC4D 4Y2DA 3RVVC 3UROR 2HJLB 2ADGB 4CDGC 4UT9L 1AGCB 3QNYB 4KWUA 5D7LA 4F33A 1JCKA 3MLSH 3QWRD 1FJ1B 1XIWA 4OZHA 1FNSL 3WV0A 1MHEB 1MFBH 2X4SB 1E4KA 1XAUA 3FQRA 3N9GL 4LVHB 3CSGA 3P77A 3C5ZB 5ESAA 3I02B 1YECH 1FAIL 5CJOL 1FNGB 2I5YL 2O5XH 3ARDD 1GAFH 3G5VB 3Q5OA 2R9HC 4G6AC 2V17H 1Q1JL 3B2UC 4MJIA 2Q86A 4DAGH 2AEIT 3H9HB 1RVFH 2WWMC 4I3RL 4PRIB 4X4YA 5C0DB 3X12A 3QEQA 1G7MB 1Z3GL 1MNUL 2Q8AL 2ICEB 4JZJC 4CL7A 4KK9C 1IGJA 1FP5A 1DANT 4J3UA 2FBJL 3RUGF 4R4FH 3TO4D 3UTQA 1LP9E 5IUSA 3WJLA 1JHLH 4I0PC 3CVHH 1QA9A 3D3VE 3IJYB 5EOQH 3SDDA 1MFEH 5AWNH 4Z95L 4HQQH 5KVGL 2R15A 1S9YB 4JPIB 5D1QB 5HI5D 2CJUL 3AS0A 3QFJB 1FL5A 4G6AD 2CMRL 1H0DA 2F8VA 3THML 2GYSA 4UIKH 1IVLA 4I3RH 1CE1L 5IGXL 1RZJL 4C4KO 1T0NA 2BMKB 2FEDC 3ARDA 1FGVL 5E2VH 3F58L 3C5JA 4NWTH 1BBJB 3MJ9L 4WY7L 5FYLE 4NQDE 2BSSB 3JXAA 3RWDA 1U8QA 3X3GL 3GM0A 3QFJD 2NR6C 2PCPB 3UXFA 4APQB 4PP2B 3QQ4B 2EDXA 4RZCA 1IAKA 4HC1H 1KNOB 1I8KB 4GKZB 3P9WB 5DD6B 3I50L 1IGCH 3MOQA 4U7MA 3MJ8A 1AXTH 2V2TB 1JPSH 1YQVL 1EH9A 5IBTL 1AI1L 2A73B 5DVKA 1ZANL 4NQVB 12E8H 4YHOL 3C6LC 1Z9LA 3F7VB 4LP4A 4OF0A 1ZA6B 4JQVA 3K1DA 4Z7VF 1RIVH 4Q0XL 4Q9CA 2ICES 3P9LA 4GMSH 5FGRA 1RVFL 5GGTA 4W81A 5IVOA 4QOKE 2QQLL 5HYQA 2HLFC 4XWGL 3UAJC 5D7KD 4XVTH 1V5JA 5ID0B 3W0WE 4WW1A 1INQB 4RGNC 1JV5A 2ZKHH 3A6OA 1DCLA 5E5UB 5DJAB 1GZPA 3L7FA 1JZ3A 1JYVA 2Q76B 4OCRH 5KSUA 4OI7A 4ODUA 5DMJB 5IMKA 2VXTH 2VZTA 3PUCA 4M7LL 3UBXG 4W6WB 1RZFL 1FL3B 4YAQB 3UEZA 1TITA 1FNGA 2CMRH 3RWJB 3S37H 2ZCKL 1H9VA 4P2RA 4MVBC 3EGSA 3GI8H 3QEQE 4UBDC 1UWXH 3PHSA 5L88H 2HVKB 3CVHB 1LEIB 4AG4L 3DVGA 3T8XA 1KCRL 2X41A 1IBGH 1B0GA 1S9VB 1VESA 3PWVB 4X7TA 1SEBB 2BOCA 3ARYA 5A16A 2VIRA 1MHPH 4DKAA 3KPOA 4K3GA 1RMFH 1UM4H 3CXHK 5HYJE 2Z92B 1BVLA 3NZHH 4LVEA 2ZCHL 3CK0H 3NGBC 1FNLA 1JWUB 1X9QA 2X09A 2GJJA 4DGIL 1TQCC 3KXFA 5L2KD 3LEVL 3IDGB 2C4XA 3BUYB 3PWUB 2C3VA 2LAGB 2HT4D 3O3DB 3ULVC 1MFCH 5CINL 4U0RB 1CD0A 3V52H 3Q3GB 5SX5K 4NN7C 4RCAA 5SWZE 2C5DC 5HYJB 3AB0C 4PFEA 2PXYD 4O5LH 3NPSB 2QQKH 5TQ2H 1I1YB 1RULL 4MYWB 3QIUB 1HYRC 3KJ4B 4OI9A 2P7TB 3JUZA 4Y19B 1V7NH 5IFAL 1W8OA 3OR7A 1EA9C 2NQCA 2ZPKL 3QUKA 4NC1C 5I76B 4M43L 2Q20A 4LPYA 3WIHH 2E9JA 4QHNA 3STLB 2YUZA 5EO0A 5IV2B 1IQDB 5LXGH 2HJKB 3BH9A 4P5MB 3RZWA 3JWDH 4PJFA 4G5ZH 1XT5A 5IB2B 2Z91B 2FNBA 1QRKA 4H26B 1I1AD 3CVIH 2D03H 3D0VB 5F97E 5IKCA 1U95A 2WBJC 3QXAA 5E56A 4KKBC 4FP8L 4Y4FB 3VI3F 3WS3A 1KXQE 3LS5L 1GAFL 1EFXD 3ALWA 4LVNB 4XNMA 4F8QA 1PKQA 3JTTA 1KV3A 3RVWD 3PDOA 4Y0GA 5KVDL 1F42A 4MXQC 1MAKA 1DLFL 2HAZA 1IC4L 2B5IB 5MHSE 3T2OA 1AC0A 2CLVA 5EOCL 3HZVB 1CFTB 3P4LA 2B4CC 4Z9KB 4MD4B 3VXUB 3CUPA 3FO1A 4G7VL 4GW4B 1X7QA 4Y2DC 3J7HA 5JPNA 4ZFZB 5DC0A 2W92A 4PYHA 1J8KA 3PNWB 3T3ME 1M7XA 5DMYA 1A6AA 1AGFA 4H1LH 4MLIA 4MNGE 3IDNB 1CI5A 3DETD 4HQQL 5KVGH 4Y4HD 3A67L 5ADPH 2K7QA 3QIWD 1U8KB 1LO4L 1A9EA 4ETQA 1GYAA 5IGXH 2H9GA 4DW2H 3JZ7A 4WO4B 1UWGL 1A5FL 4HGMA 4LPUA 2DJ4A 5HVHC 5TQ0H 4NNPH 1NC2B 4LIQL 1HXMB 1KN4H 4WTZA 4FQQA 4LASL 1T1YA 3VXRD 2DQEL 2P5EE 3HRZA 1EMTH 3ZYZA 4L4TE 1LE9A 2YMXH 3KXFB 1WZ1H 3DETC 4YBHA 1WCBA 3SBWC 4YDJA 4UIMA 3IXAB 2VLKA 1X4XA 2FRGP 4J23A 2VDMH 4WUUD 3G5ZA 2NY3D 2IADB 3E6HA 1WEJL 4K9EL 1I1CA 1HN1A 4MCZA 5CSGA 4EN3D 3FQRB 5B8CB 3IRPX 3QWOA 4LKXB 3PF2A 3WUWA 5DK0B 4X7SH 1NL0H 2VLMD 3WN5C 1H5BB 4R8WH 5LAXA 3UYOD 4P23A 5D1QA 5DD3L 2N56A 2BVQA 4X7FC 4G8EA 5T1KB 4XH2B 4MJIB 3FO2B 1NCWL 4CMMA 1FNEA 1BVKB 2PTTB 3ARRA 3TP4A 1MVUB 4RMVA 4ALAL 3QHFH 1LO5A 4OM0L 1GSMA 1NJ9A 4BK4A 5I30H 2J5LB 4Q74A 4TOYL 5DVMA 3DWTA 1NUGA 1QHPA 2AJ3B 2M2DA 3P73B 4K8RD 4LCCB 2QHRH 3HZYB 1FFOB 5H35B 2KZ1B 4IIQB 2VXVH 3BUTA 1EXUA 3RTQA 3MRKB 3EO1A 1I75A 4XPHH 3NTCH 5E5MA 5FYKU 2Z4QA 4C54A 2DTSA 2QHLA 4JREC 3OAYH 1BAFH 3PV7A 1IC7H 5K33A 1YPZB 4MJID 5EO9B 3MRLB 3LB6C 2VUYA 3AU1B 1JPFB 5FA3B 5J12B 5MERA 2FIKB 3WUWG 4XAWL 5JO5A 1UB6B 4MQ7B 1ZEAL 3BP7B 4CNIA 3O6LL 4NN5C 2HH0H 5DSCB 2PR4L 4DFHA 1EERB 3K3QA 1YEFL 3WIHA 3B9KD 3VI4F 2A1WH 1VHPA 1CL7H 4TTDC 1NQBA 1NLBL 4ZAKA 4JAMB 2AJUL 3GEWB 4Q6IC 4XPHL 2VZSA 1PLGL 3ZYOA 3WFCH 2NW3B 4DUWA 4HGWB 1KB5H 2W65B 1KLUB 5J11C 2RQ8A 5EULV 5JQ6H 3Q1SL 3UZEA 2ZJSL 4JKPH 4F9LC 4Q2ZA 5HGDB 4RGOL 1YMHA 4ODSH 1MIMH 5CBEB 2Y4SA 1BJ1H 4MQXD 25C8L 2HFGL 2AXFB 3S5LG 3OAUL 3OMZA 1NKOA 4ISVB 5DFVD 4QRRD 5F1IB 1I8IA 1NCDL 3BD3A 2DWDB 5HHXH 1DBMH 4X6EB 3FONB 3TIEA 5DJCA 2OBGA 4NO0B 4LGSB 5MENE 2DQUH 2HTKC 4TULL 3U7YH 3VXMB 5FYKL 2WIIB 3Q6GH 1OSPL 2C3VB 4HJGA 4NYLA 3UPCA 4F37K 1ACZA 4DVBB 4L8BA 5B8CA 4GRWH 2VLLA 4WI2A 1BAFL 4OUUA 1K4DB 2IEPA 5D2LB 1CLOL 3U7WL 4QWWD 1P2CB 5L8KB 3IDXH 1KXVC 4JANA 4K9EC 3OKNA 5BVPL 4I3SH 4TSAH 3MLUH 5HHQA 4LEOB 2Y07L 3DVGB 3T8XB 1NGWB 5AAMA 1A21A 4JFYB 5IOPB 1GPOL 3OR7B 1CFBA 2PYEB 3RKDC 3ARUA 2F9BT 3EDKA 4HKBB 2EDRA 1J0HA 3TT1H 1CR9H 2Q6WA 1RJZB 4LPCA 2WBJA 5BRZB 4OV6F 5JOFB 2Q1EA 4LARH 3MQIA 3ZKSD 4NC1E 4AENB 4Z18A 4XNYL 1JP5A 4OAWA 5F1OB 3K46A 2C9AA 3DX9A 5DUMH 4YHIB 3ZL4H 4M1GL 4BQ8A 5GGQL 4AJ0A 4YXHL 3UYPA 4LLWA 1YUHB 5IM7B 5T33L 4CNIB 4OIIL 1FV1A 1SHMA 2CUMA 3TT1L 4FZEL 1DVFA 1PZ5B 2CLVB 1AGBB 4OD2A 3SGJA 3U4EA 3B9AA 4ACPA 4BZ2L 4ZAKC 1ES0A 4M4PA 3F7YB 2PYED 2DLEA 4LLAA 4OZFG 3VXSA 1TMCB 1J9CT 3L3KA 5K9KB 1PD6A 3ULVL 5J8OA 5E24E 1N5AB 1DUYA 1CLYH 4XPAH 1EX0A 5IG7A 1D7FA 3TV3H 1IAOB 1UM5H 1IM9A 4L8DA 1AFVL 1SYVB 4JR9L 5ICXB 3SKOB 5C0RL 5HVGB 1LDPH 3CFCL 1A6TA 4XHJC 3SDAD 3TH2T 1AP2A 3JVGC 4G6JL 1MAJA 1YMHB 1W72H 3HZKB 1Z0MA 4ESKA 3BPOB 3RRQA 4P48A 4OUOA 1XH3B 4H1LG 4OZIB 1NLDH 3DXAE 1ZHLA 5BOPA 1H3TA 1UQSA 3UTOA 2IH1B 3HNVH 1MFNA 5C08D 2NZ9C 2ICCA 3RVTD 1G7HA 4PRNB 4MX7A 3MOBL 3ZKQD 5LGJB 4L4VD 8FABB 1IKNA 2EDLA 2DOCA 2DYPA 2WAHA 4MSWB 1PG7X 3EFDL 4TNVF 3MLXL 4JFFA 5C0FA 1RURL 2IJ0C 5J0BA 5F7UA 2HRLA 1BEYL 4QKXB 3OGOE 3LKRB 3C5SA 4ODWA 2DIJA 2R0ZL 3G6JF 2YKLL 4NKIH 1FORH 2ED7A 1A6VH 3EOAB 3HNTH 3G6AB 4PG2A 2JE8A 3QI9D 1WCBB 3QAZC 3VXOB 4NFDA 3TBYA 1ADQH 1KPVB 5GIRB 1Q9KB 2HLFD 4WJ5B 1QSFD 5E2TH 5FGBC 2AJXL 1BECA 4CU6A 5GS2H 4KHXH 2X9WA 4Y4KA 4UV4H 5D6DC 1AD9B 5IB5A 1LP9B 5IMLB 1UFUA 3K7UA 2PO6A 4B50A 2CIIA 3QWOB 3QDMD 6FABL 2A6IA 1CG9B 4KVCH 3DUUA 1CD1B 4TNWF 1QBBA 1FN4A 4LLMB 4NZJA 1FORL 4XMLH 5D7JD 3IU3A 5ABDE 5DSCA 5MHSD 1KIRA 4PJGE 3DYPA 4X4XA 3QEUB 1WIPA 1RZKC 2ATPB 1X5ZA 4F15B 3VD7A 3OKEA 1UWEH 4JFHD 4U49A 5JW3L 5K93A 4CMHB 1U3HC 3RNQB 1JZ4A 4XT1C 1JK8A 3DROB 3PE9A 1NSNL 1S7TB 4L5FL 4FZ8H 2VXVL 3LB6D 2HFGH 1HYSC 4D0CB 2IF7A 1S9XB 4O02H 1TJGL 4K94L 3T04D 3VXRA 4XRCA 5EC2B 2YRPA 3SGDI 3JUYA 5D7JC 1A7BA 5EIIA 5EPMA 1OVZA 5B3JE 3KPQA 4WI7A 1E6JL 3NPSC 5IFHH 1KIQB 4L29B 3FT2A 1RZ8B 4JGJA 5JDJA 3UTSD 4D9QE 3RQ3A 2AXHA 2QKIA 5DEGA 2R2EA 3EFFA 4P9HL 4EXPX 1KT2A 1U8IA 2MOVA 4KGJA 3H6JA 5FF6B 1KJVA 1M4KA 2VITA 1MFBL 4MCYA 2R69H 4Q97A 2AJUH 2Y1VA 1MPAL 3WFHA 1GGYA 1NPUA 1U92B 5DF0A 2YOCA 2FGWH 4HLZH 4G6KL 1CCZA 4X4ZA 1BQHB 3BSZH 1M7IA 2A38A 3PWNA 3ARGB 4OCWL 3HMXL 1KJMB 3IDXL 1KSRA 2BFVH 1L7TL 4Y4FC 4F9PA 4PJ7E 5J3HD 1LEGB 3FOLB 3IFPA 5J89A 1QLRB 4LVNC 3QCTH 2QTEA 5E9DE 2L4OA 2VSCA 1FC2D 1DE4B 1EGJA 1TZGH 1WAAF 2P5WB 1TQBB 3ARDC 1WFTA 1XGRB 4Y8AA 3PWPB 3BP6B 4XGZA 3N0PB 2VTFA 1ORQB 2J8UF 5HHOB 2XN9E 1NH6A 3DVNA 5TGBB 3WEXA 3U0PB 4G8IB 4N8VB 4NYLB 1QLEL 3QEQB 4QHKJ 4KMLB 1MJJA 5HGBA 5DURD 3HC3L 3N85L 5EOTA 1KLUA 4WDIA 4PUBH 1E27A 5HGDA 2W0LA 5I8OH 5J6GA 3HI1B 1D5BB 4MDIA 3TT3H 4OCSL 2GTZB 1SY6L 1JNHA 3VGHA 4S2SB 3BKJH 1BF8A 1HXYA 32C2A 2A9NH 4HBCL 3DRTA 3MLWH 4LFHD 4JN1H 2BHUA 4QTIL 5DUBA 1S7VB 5HHQB 1KXTB 5C70A 1YPZF 5C1MB 2Q86B 4X4YB 1MJ7H 5CCKH 4POUB 5DLMH 1P7KB 4CU7A 1ZLUK 3RVXD 5C2UB 3C2SA 4X8XA 4Y16D 5EOCJ 4JDTH 2F58H 4JR9H 2XY2A 4HIHA 3U9UA 5D7LD 4KZDL 5FECB 4G6KH 4ZFOL 1YY8B 2AQ2A 4U7SA 2UY7A 3MV8A 3GJFK 2W91A 4XPTL 5EZJA 4WW2F 4HBQA 4ONFL 3VXRB 1JUFA 3KAAA 4DGVL 1I8MB 2YBRB 4F7MA 3GBMH 4EQ3A 4AT6B 3QISA 1TZHA 3FQXB 2XQYK 2VDNH 5J7CC 4YZFE 3TZVA 1I85C 2VRAA 4KK6C 2ED8A 3GSXA 2FHCA 2YXMA 3FQWB 4M3KB 1WAAE 3UAJD 2VDLL 2Q8BH 4Z76A 3MLYH 3RL2B 4IM8A 1OP5K 3VFUA 4L9LB 4XCEB 5DHVB 4RA0C 4GXVL 4KRMB 1UXSB 4ERSL 5FCUL 3SDXF 2NY7L 4R7NB 3DGGB 4ELMF 4LCCC 4YR6B 2JELL 4AIXA 2HA1A 4RZCB 4DOHB 5FYJU 5DI8B 4XP5H 4QHLA 4OAWB 3FT4A 1QG3A 3TJEL 4POZC 4D0BA 4QNPE 1ZT7A 5T1MA 1MCJA 5C0JB 4Q7DA 2NY4B 3GJEB 2B1HH 1BM3L 3OHXB 5JW4R 2FCBA 3LMJH 5EZIL 5IVXF 3GSOA 4QRPE 5CEXA 1WK0A 4NCC2 4J1UA 2PXYA 4DQOL 4XBEL 1Q9KA 1WLHA 4HS8H 4NPYB 4P4KC 5M95B 2V9QA 1I9RL 3QG7H 4R4FL 1BFOB 2NY7H 2X4QB 3VWJC 1KELH 3QR2A 3CFDB 4PV9B 5TDOB 2FSEB 2VIRB 4RWHA 3P0VL 4JPVH 3D0LB 3U82B 1VFAA 1RUQH 2YRZA 3UDWA 1CFNB 2ZOLA 4F80A 2DBLH 4XVUD 3MLVH 5E94B 4P2RD 5A43C 3UYRH 1XIWB 3T3PF 4OLWH 4PGEB 1JGUL 2YKLH 4NKIL 3G08B 3KS0J 1K4CB 4KJYA 5KG9B 3FAWA 2IPKA 2X70B 3GSUB 1II4E 3F7QA 4ZS6C 4ZXBC 4K8RL 3V4UH 2VMFA 1FPTH 1TNNA 3A6CL 2FD6L 4H0HB 4EI5B 4HWEH 4RBPK 2R1WB 2ARJQ 3O2WH 1N59A 3BQUA 2OXGA 5L2JA 2M26A 3GSNH 1QVOB 2FH6A 3TBTB 7CGTA 1GZQB 2Q8BL 2BOCB 4MXVF 1VFBA 3SGKC 1HHGB 5EIIB 1VENA 4BFIB 1KIQA 5GISL 1S9WB 1FH5L 4BSWB 3NH7H 3SQBA 3OXSA 4P46B 4TPRL 4QXUH 4GH7B 4AEIL 5F7MC 4GBXD 5FYLD 4Z7VA 4ZS7H 5ENWA 4HMDA 5D8JH 5LCVL 3B2VH 1CXKA 3QUMH 4TUOA 1WC7A 5A40E 1TDQA 4HW6A 1J1OH 1N7ML 2RAMA 2KL6A 3GMLA 3CDYA 5HYQB 5EU6A 4PJEE 2Z91A 1R5VA 2H26B 4KGLA 4KI5C 4PLOB 2A9ML 2XZAL 4MA7H 4KTYA 3STLA 1AY1L 4OZGF 2BSTB 5BZWB 4BFEA 4DAGL 1CIDA 1CDHA 5EU5A 3GSVA 1KJMA 1IGFH 1QSZA 3B9DA 3MA9H 1YMMB 3MJ8B 3TPKA 4OLZH 1AI1H 2XZCL 1FPTL 4QOKD 3R4DA 5F7KC 4PJIE 2I26N 3GHBH 4MAYD 4OLUL 2YPKA 1A6PA 2VC2H 3BRGC 1NDGA 4QTHB 3KWWB 1YY9D 1T1ZB 5EU3B 1QRNB 3ARFC 2EYSB 2GJZA 1MFEL 4L29A 1M05B 4XNZC 4JG1L 3MLSL 1EGJL 1S9VA 1P4LB 1MWAB 4PB9L 3EYOB 4B41A 5IEHB 3IKCB 2J8HA 2CUIA 4RBPH 1KEGH 2A6JA 2D3VA 5HHOA 1UC6A 1X3DA 1YEHH 3L3GB 2V6HA 4IRZL 4U1NB 3SE8L 3D25B 3RUGA 3LQAC 3WFHB 4K2UL 2IPTH 2YA1A 2WANA 2YD3A 3AREA 3BWUC 1CQYA 3O45B 4HXAL 5ACMA 4PRID 3CZFB 4FABH 4LRIA 5SX5H 2MTPA 3MRPB 4MD5A 1YY9C 1HHIB 4EN3C 2XPGA 2R1YA 3MMEB 2OK0H 5IJKA 2C7UB 2V2WB 2YR3A 3QDME 2Z9TA 3CFBB 5EIVA 1U8JA 3NFNB 3N1FC 3UX9B 4NHUB 3D39B 1AE6H 1K85A 3BKCL 2XWBB 3SDCB 1A6ZA 4OFDA 1OSZB 4NOBA 1JHTA 3X14B 3E2HB 4NKOB 3C6SA 3CC5A 2G60L 1CICB 1G9NH 1HQ4B 5JIPA 3RUGE 3BHBA 3EDDA 3ULUD 5K9JH 2BZDA 3IXTA 1VCAA 4EOWL 2PTUA 4Z95H 1LO3L 4PJEF 3BN9D 4NUGL 4RMSA 5EO0B 5DWUH 3BMWA 4WFGE 3SO3B 1DQLL 4NO2A 2UWEF 2DLFL 3HG1A 5JUEL 5C0CD 1ZT4B 3MBEC 5I1DB 3U7AA 2C1OB 4L9LA 1JI1A 1YNTB 3GMRA 5I1GL 3V5HA 3WXWH 1HQRA 3U36A 3VXTB 1ZLWK 2NTFB 5E2VL 3C6LB 3V8OA 3FFCA 2R29H 3CSPA 2Q3ZA 5BMFL 2RR3A 2IMNA 4R4BA 3QO1B 3MFGB 1ED3A 1SJEA 3ETBF 4RFNC 1T04A 2QQQA 4F7PB 1U41A 1R0AH 3E8UH 4XNUL 4XX1E 1TZHB 3FQXA 5AYQA 3MROA 2OTWB 1VPOH 1EXUB 3P0VH 4JPVL 3ARTA 5C0AA 4MNHA 2UYLB 4LSRH 1D9KA 4PLJC 4CW1A 3ROOA 4XWOD 4HHAB 5FM5M 2O26U 5IBTH 4M93B 5B39A 1F4XL 2FL5A 5GSRA 2H2PD 1J87A 2A77H 1OW0A 4K71C 4F15C 1IZJA 2OXHA 5ETUB 5HYIA 3L5XL 2VZUA 3WYRA 1GPOH 3RI5K 4X6DA 2F74B 3VDBA 1TJIH 4YDLB 2EE6A 5IEKA 3DRQB 1MVFA 5C09E 4HIXL 4BKLB 1S5HB 4AIZB 4X6DF 4GG8A 1KN4L 5D9SA 4PJDF 1WWAX 5HHMD 5I8CB 3GZKA 1KBGH 3REWA 5EZIH 3GSNL 2G9HB 2DBJA 5TF0A 1MQ8A 3EYOA 1FG2B 2PXYB 1QTYT 1HEZB 2APTA 4R2GC 1TCMA 2GT9A 3BZ4A 1AHWA 1AIFA 4KI1A 3NGBB 1N4XL 4KDVA 2XTJB 3KYKH 1RUPH 2NYYD 4Z7OF 4WHTA 5C0EB 1KIPA 3DI2B 3WHE1 2YD2A 4YR6A 4LPXA 2BCKB 3KYMA 5DDHA 3TVMB 1NCBL 2VZ1A 1GGBH 5DI8A 4AQOA 3RWIB 4FZEH 1OAQL 1F3DH 2GFBA 2I27N 1UXWA 1YEGH 3SY0A 1H3WM 4DCQA 2XQBL 1QSFB 4TUKL 4L8SB 2UWEE 1U0QA 1N59B 3VD9A 1CBVL 1KIUA 3HAEH 3DI3B 1PSKL 3MRFA 5F7DA 3G5VA 5FHBL 5FHAH 2AEPH 2P48B 3U9PL 5DD0H 1R0AL 3QA3A 3IAPA 2DWDA 1E4XL 3C60C 1VPOL 3LZFH 1NBYA 35C8L 4PJAB 3LDBC 5HYSA 2OTUB 5E00B 4OFVA 4TUOB 4JDVA 5FDYA 3QUXD 3TBTA 1T5WA 4G8FB 3TF7C 3RAJH 1CDJA 4XBGA 3IDYC 3CDCA 5HYEA 4PRPD 5IJKC 5IFJB 1YEKH 4GAJH 2JF1A 4LLQA 4V1DE 4X7DC 2H1PL 4LOUD 3V4PH 4XAWH 4JM4L 4XVJL 1A4JB 1JGDA 4GRWE 4ODTL 1B0WA 5TF1L 3TGXA 3ULSB 4Y19E 1NLDL 3CFJA 5LAXB 2DF3A 5DJDA 4MLSA 1WZMA 2W9DL 3PGFH 3FB8B 2JB6B 3U0TA 3VFRA 4GS7B 4DTGL 4JFXA 4RFOL 3EO0A 4PJHA 4J4PA 3OGCB 4ZUUB 4CUCA 1QBML 3T65A 3VXNB 4HH9B 2VOTA 5MP6L 1RSFA 1MCNA 1EFXA 3ABZA 4QEGA 3OAZK 2DD8L 5I1KH 3KLAB 3MLXH 4Z78B 3EYSH 4GO6B 4E5XB 2C4FU 4XVJH 4P57B 4U0QB 3F6IA 4WHYG 5J1TC 3BT2H 3IKCA 1LO2H 3CH8A 3HNVL 4AIZA 4HGKC 4JG0L 5GHWL 5I75C 4I0PD 4XMKH 3PG2A 4QRTB 5GS0C 1T1ZA 1AQKH 3NA9H 4YFLI 4WO4C 4EI6B 5EOCH 4OKVA 2JCCA 2B8OT 1BQSA 3MGAA 1I8IB 5F93C 1E4WL 2PNDA 4N9GB 3S98A 3T4YB 5IROA 5T5NG 5JHLL 4ZPVA 1C08A 1PBYA 3SKOA 3DBXA 3MGOA 1U42A 3PHOB 2ADJA 4GW5A 3QIBB 2FBOJ 1NCTA 4NJ9H 3HPLB 4PG9A 3CH1B 4PJBF 5D7LB 3RIFF 4F33B 2FEDD 3ROLB 3VJ6A 2HKFH 1MCBA 2IAMB 1P7QA 2XWTB 5DJYA 3HLAB 4KK6D 1KYOJ 5EUOA 4WTZG 3D25A 2R23B 3KPNA 1LDSA 4JFOB 2Z8RA 3O4OC 1F02I 2CKBB 4Y5VA 3WXVL 5JXAL 1X5XA 3SJVB 4P2YA 4LPWA 2BDNH 2MJWA 5IMMA 3GSRB 2XWBA 4HT1L 1DQJA 5DFTA 2FHFA 2KDGA 3WDJA 5JDSB 1QRND 3QDMB 1ONQB 2EYSA 3O2DH 5GRUL 2DIBA 5CS7A 4DZ8B 4R2GD 1P6FA 1BVLB 4M7JL 1T5WB 5EU7C 2ADIB 4P2QD 3WCYA 3S4SG 3DSFL 2V5MA 3Q6GL 1HSAA 4F37F 4CVWA 2AK1L 2YD1A 2MQCA 4PY8J 2LAAA 3EO9H 3RUGB 5E1AB 4YQXH 3OKMB 5I8KL 3DUSA 1OAXL 2D7TL 4NRYB 5E0QA 1HSBA 3W9EB 2R69L 5F7WC 3G6AA 5JPMA 4JY4A 5J06A 1ZGLA 2R1XB 3H9SD 5GHWH 1J1XH 1QPPA 5KSBB 1BZQK 1KGCE 5JUEH 4M5ZH 4RGMC 5FGCE 4KAQH 4P2QB 5D2LA 3B9EA 1JYXA 3LHPL 5BVPH 1NKRA 1L0XA 5FKAB 5J13C 4NZUL 4O4YH 4ZQKA 3MV11 5MEPB 3QRFM 4JY5H 2FECI 1P4BH 2NY6C 4J4PD 3K2UH 1IGJB 1UH4A 1DSFL 3O11A 3JV4A 5GS1B 2FJGA 3GMPB 5I71B 4HKBA 4IMLB 5J57B 4ZTPL 5BS0B 4F7EB 4KMQA 1W72L 4P57A 4ZS6D 3H7LA 4AEHH 4Z7WB 3BIKB 2LU3A 5FF6A 1E0OB 4R4ND 3DURB 2CK0L 5J11B 1N6UA 1AHWB 1MFCL 3HPJA 4M6OH 1EAJA 4M7LH 2ARJA 2A83B 1R24A 2BXYA 1RZFH 2RBLA 1HQRB 5I6XB 1Q1JH 2CO7B 4YHYC 2O93L 3DV4B 4LKCB 4OZFA 3U36B 3U48A 3B3IA 2C3GA 3IS0X 4OV5B 3T08A 1XMWA 1QD0A 4JQIL 1TJIL 1LE5A 2YEZB 4QXGH 4G42A 4PRPB 4TQEL 5DZOA 1U91A 4WUKL 3HKFA 2VITB 1CF8L 1G7HB 3CNKA 4PRNA 1PZ5A 3U4EB 1KB5L 3H3KA 5KSVA 5F7DB 3ET9F 4WNQA 4G9FD 2A9NL 5HGHA 2OZ4L 3ULVH 1E4XI 3CJJA 2ZOKA 2QKIB 5SV3A 2O5ZH 3KYNA 4RQQA 3VGAB 3TN0A 1ZVYA 1B0RA 3ULUL 4YHLL 2OL3B 1VFMA 3GGWB 2OJZH 3F5WB 5CBAA 1A6TB 1KFAH 5H37G 2VWEE 5GRVL 1U3YA 3X13A 4UDTB 3KGRA 1KLFA 5T3ZL 3EOAA 3B6SA 3VDCA 5EU6D 4WEUD 1FVDA 3RDTC 1MCRA 3F58H 1B4RA 3QQ3A 2DQIL 5ALBH 5LGHH 4F57H 4TUKH 1J0KA 1J5OH 5HHPB 1QFWM 1NFIA 5D1XC 2YD7A 1MJJB 5EUOF 1N6QH 1D5XB 3E0GA 2RJMA 2JK5A 3ULSA 4LCYA 1FGNH 4RRPG 3IFOB 3SE4A 3C08H 2ZPKH 4LLMA 1G0XA 3GK8H 2DKSA 3DV6B 3PJSA 4E41D 1WFNA 3GHEH 4WFFE 1QQDB 4HAGA 4Y5XB 4X6CB 3TVMD 3QO0A 3KPPB 3QPQD 4ZPTA 1MCFA 3NIFF 4YHKL 1QP1A 3MBEA 4ENEC 4OZGA 3GMMA 5MENB 4CN4A 5JTWA 5DMGC 3CVIL 3C5ZC 3QDJE 5GJTH 1I3GL 3G5YA 1H5BA 4NO5A 5B3NA 4Y4HB 2WSKA 3C9NB 4J3VA 4TN9A 3K81A 2FB4L 4YDKL 3PIQA 1JNHB 3ULUF 1M71B 1F5WA 1CDGA 5GGVL 1R3LA 4JZJB 3CFEB 2BSRB 4OF7A 1JGUH 3B5TA 1DQTA 4P49A 1BQUA 4MNQE 2YSSB 3BKYL 2EO9A 5I1CH 3C8KA 3MACL 2VISA 3BN3B 5LWYL 1HZHL 4XCNA 4KC3B 3MV7D 2G75B 4HKZA 4L1DA 4X0KA 5BXFA 1IEBB 3BKMH 1TTUA 4LHUB 2DQFB 4OV5A 4ZNEA 3OPZH 5D7IB 2AVGA 4POZD 4QXTA 2WINA 1KCSL 4U2ZA 4HIEB 1BJ1J 4ZAKD 5T1MB 4M48H 4D8PA 1BREA 5TJWK 5D1ZB 3UTTE 1BMGA 1VGKA 3PQYE 2ORBH 4DW2L 1I8LC 1NGQH 1PKQB 2VXQL 3OKOB 1CU4H 1T2QL 3BQUC 3MRNA 4V2CB 1VSCA 1W72A 1CLZL 3SE9L 4DGIH 3NA9L 3WD5H 3O9WB 2P8PA 4YPGB 5CFHA 4F3FB 1G6RL 1PG7L 5DD1H 4DN4H 3MRJA 2VDRH 5I74C 4WUUA 5MEQB 3ARBD 3VXUA 2Y5TB 4L3ED 4JB9H 3HLAA 2HJKA 5B38G 2FX9L 3N1GC 3PXJA 5KSAC 4LHJB 1NGZB 1K2DB 3LKNA 1J86A 4OZHF 1OF2A 4IRJD 4HPYL 2VXQH 1I7RA 3RNKB 2GSIA 2VN7A 1MI5B 4HS6A 1HCFX 2VR4A 4FOMA 1A3LH 1I4FA 4V1DD 3ZTNL 4G7YL 4GQ9L 1P69B 2Y6SD 3JV0A 4JFOA 3W0WA 2I60H 3CZJA 3H7BB 4MA3B 4NGHL 2NXZC 1LK2A 5T5FL 1IM9D 2D7NA 5IB4B 1MNUH 3VGBA 4BH7A 1Q9LB 3GI9H 4WV1C 1NGPL 1SJHB 2CD0A 1M7DA 1PFCA 4R2GB 4BJLA 2FECL 3MGTB 1L6XA 4W4OA 3CH1A 1TNMA 2P8LA 3NH7L 5TE4L 1KENH 1JL8A 2ERJB 3B9KC 5JQ6L 3UTTD 3OV6A 2H2SC 3VMNA 3L5WA 5MENA 3W11C 5CZXC 4G7YH 2AJ3A 2NMSA 4RMRA 5I66A 4WEMB 3QPXL 2VAAB 4LVOC 1T89A 4L8SC 3BEVB 4P5KA 3TBVB 1Q9WA 1OWRM 1BIIB 2B39A 3W9DA 5EWIH 4PJDA 4FQLH 4X80L 4P3DB 3EBAA 4V1DB 2X1XR 3EIFA 4LLYB 4XC3H 2FGWL 5I0ZA 5H2BA 3O6LH 1EHAA 5KOMC 5IT2L 3GMPA 3GDBA 1T7VA 1TVHA 3BD5A 4B7IA 4G42B 1K8IA 1UB6A 4MQ7A 1B6UA 4PRPA 3N50A 1PEZA 1WFUA 2IGFH 1KN2H 1QFWL 2PN5A 5GGTL 5IBLD 4GW1A 3DX6A 1RAMA 3KPTA 3QEQD 2EXWD 4L3EA 4K7PH 1AGDB 3G5ZB 4KMTL 4RWYH 3RVVD 3B83A 5I1EH 4K94C 2WUCH 3Q1SH 2NNAB 3GMNA 3D87B 4PJIB 4U0RC 2A0LD 1FNHA 2R39A 3S3SA 2PYFB 4Y2OA 1ND0A 4WI4A 5K9JL 1FYHB 4Q2ZB 5HHNB 3MRNB 2DQEH 4X5WA 3BEWA 1C1EL 4N0UE 3CFKA 2AJSH 3GSOB 3QUZA 4PV8B 1AH1A 4DUXA 4R3SB 4EUPA 4YH6A 3QJHB 5INDB 3T2PA 1RFDH 3A6BH 1CD8A 3QEGH 2DQTL 5D96C 2ZUVA 1Q0XH 5EFIA 3KHOA 4JZNB 4LOUC 2WBJD 3PL6C 4PYGA 4BH8A 4OCRL 1LQSR 3MA7A 5IF0A 3RL2A 1CFQA 1IGMH 1NCCL 4HWBH 3EZ8A 4NRZA 4GRLA 3X3GH 1RMFL 5DVOA 3TO4A 4MA1C 3UP1A 4EOWH 3OXRA 6CGTA 2ARJB 5C0BE 4HUMB 3WLBB 4KJPD 1OARH 1KC5H 2HRPH 3ECBA 5TE7L 5DRWA 3O45A 4UOW0 2MHAA 2FJHB 5T3ZH 4X80H 1G6RA 3FN3A 3V2AR 5DJ0A 4KQ4L 5IB4A 4Q9QH 3ZMRA 4HUKB 4BZ1L 3MLZL 4KJWC 3QUXB 1ODAA 4YLQT 1CXIA 3G5YB 1XGTA 2ATKB 3CDGB 4OFIA 3UJTL 4EVNA 4DUVA 4U31A 2OQJA 5IVXB 4X9IA 2SEBB 3X17A 4S0SD 3QIBC 1A7QH 4F7TA 4Z7VE 3I75B 3MRBA 1JWSA 4FQ1H 4BSVA 2FR4A 4WWKD 2ITCA 4F8TA 3LKPA 1VFAB 5JW4Q 4M9PA 3LCYA 4YC2B 2OL3L 5ACZA 5I1EL 2MNUA 1JE6A 1F3DJ 4KY1H 3DO3A 3PWUA 3C5ZD 5C0AE 5JORB 4G8GA 3NOIA 2EDHA 4X6CE 3ZL4L 3DXAD 4I77L 1MCWW 1FFPA 4MNQA 1JI2A 4YDVB 2V2WA 4GKSB 5HVHB 1SYSB 3RZCD 4JZJA 2QQKL 3QIBD 5TQ2L 5HYJA 4Z7QF 4MJ2A 1T4KA 1P1ZB 1NMAL 4OD3H 3SKMA 4EZMA 3UTPE 3QEGL 4TUJA 3O8XC 3L7EB 1Q72H 3RKPA 5DJ2B 1BEYH 5C0BD 3V52L 3W39A 3LKSA 4UMGA 3SE3C 3CX5K 3BVNB 1WBYB 5C0AB 2C4FT 1BHGA 2JIXD 2EC9U 3MR9B 3LQAH 2ZSVB 2E9WA 1OTSC 4G6JH 2ARWA 2XZCH 5IG7B 2ADFH 1QUNA 1GC1L 1O5DT 1D5ZA 1T5XB 3BAEL 3NAAL 2AJXH 3QO1A 1QSFE 3GKWL 4UNUA 4UNTA 5ETUA 2AJYH 2F8XC 2ZUXA 4U1MB 1QR1B 5D1ZD 4EN3A 2E8YA 2QR0B 4OSUL 1MCOH 4HF5H 5I1HL 4J3XA 3C5JB 3O8XD 1WBXA 4Z0XA 3V4VL 4MNHB 2C1PA 1HKLH 2EEBA 4HJJH 3ZT6A 3MNVA 4U6HA 4WEBH 1WC7B 3REWB 3ZDYF 2EDYA 1MCEA 1Q8MA 3VXSB 4JN2A 4UU9A 4TVPE 4JGUA 2OTWA 4LHQB 2V5YA 2DL2A 1OAZH 1KULA 4K3EH 1I7TB 1OF2B 3ARWA 5GS3A 1UZ8B 1Q9LA 4ODTH 3MRJB 3IETA 1UACH 1A1OA 1U2HA 3C09B 4PJXA 1XIWC 5GSRB 1AHWC 4TSAL 1ETZB 2A0LC 3MLUL 4H8WC 4JREB 5TFSH 2X1OA 1TTGA 3NFSL 1C16A 1LO4H 5EIQA 4X6FA 2VDOH 2AJZA 4JM2F 2F8OA 2RGSA 3GMOB 3HR6A 4JPKH 4ZXBB 2R4SL 2EDBA 4UT7L 3J8F7 5D1ZA 2R1YB 5IW1B 2GT9B 1UADC 4W4OC 2DQGL 2YPLD 3GO1L 2VAAA 3I84A 3NFPB 3VMPA 4XMPH 4X7SL 1CFTA 1WF5A 4XNXH 4LCUA 4YDIH 5CLWA 1BWMA 1CG9A 3WNPA 1D6VL 4C56A 3CLFL 3FFDB 4NKOA 2D31B 3VFGH 1FZOA 3EYFA 4UOW1 4DCQB 1AXTL 4W68A 1LGVA 4NQUA 1TVHB 3ZE0E 1A7OL 4OT1L 4NM8H 4NHCH 4K8RH 3V4UL 3IDGA 4B53A 3MO1A 3KYMB 5DDHB 1H3PH 3MV7E 4GT7A 4ETYA 1Q9WB 2J12B 1U3HA 4LLDA 5TF1H 3WIFB 3KVQA 4ZUVB 5C0GA 4MJ5A 1MCOL 4ORZC 1SEQH 2IAND 5F9OL 4KPHL 1SEBA 1FG9C 4ODVL 5I66B 1H8OA 4FQQB 1RJLB 5IBUG 4FTVE 1VEMA 1QKZH 5IR1A 4NQCE 3CU1A 3U4BL 4NHUA 5D1XB 4FG6D 4UV7H 3ARQA 4PJ9A 2R2BB 3RA7L 4JO3H 1JWUA 5DJ2A 3KS0H 3C87A 3EJYD 3LKSB 3QA3B 4OCXH 2GUOA 4UTAH 1FH5H 5AUMB 4Y1AD 2HMID 3ARGD 3SGEH 4U1IB 4R8WL 3T65B 2PKDA 1E28B 2A1WL 4I2XB 4JM2B 4XNQB 1JZ8A 1OP9A 2QSVA 2V5SA 2ZG2A 4K3DL 4PBXA 5JIKA 4KRPB 3OKEB 1SEQL 1IAIL 4GBXC 4JY6B 5LGKA 2VDML 5TE7H 1ZT4A 5I1DA 3BH8B 2X7LB 4PIRF 1R3HB 4MAUH 3RWCB 1IJ9A 4CVXA 4MDJA 3W81A 3QHZH 4L4TA 1WUNT 1UT9A 4Y4HC 5D6CA 1SMAA 4PREA 3MX0A 5DO2C 1CD1A 1HH6A 1YEFH 3LY6A 3KLAA 2HMIC 1SJEB 4AIOA 1N4XH 4RMWA 4KQ3L 5C92A 1T80A 1OAUL 2EE2A 1NEZB 4PRAA 1MRDL 3FMGH 4YXKL 1PLGH 1S8DB 4C55A 1JV5B 1UXSA 3OXRB 4WUUE 2CDGB 3ARZA 4X4XB 4G6ML 1I1RA 1NGYB 4MMXC 1AQDA 1SM3H 4IEFB 4R90L 5I18L 4GRMB 1C16B 2IAMD 4NUJA 3MRMB 1NAMA 1YPZA 3NCCB 3WNKA 2GJ6D 3N1MC 1P7QB 3D6GA 3P0GB 4WFED 4WHYH 5FHAL 1SJXA 1W0WA 4WW2B 4HIXH 2DMBA 3H8NA 4ODVH 2F54D 3QNZB 1YYLL 2ADJB 1IC5H 5D9SB 4DKFH 4X9BA 1GIGL 1H8SA 2XXMB 1S7XB 2O5YL 5F8QC 5KTEL 4XHJD 1ZAGA 3UBXA 3MUGB 3OKYA 2F19L 5FM8A 1UGNA 2YD9A 3FO9B 4ZUTB 4OBSA 1MAML 5E2UL 5I8KH 1ZV5A 3D0LA 2AXGA 3WLWD 2NZIA 2IBGA 2MWCA 3WIIH 4F9LA 3STBA 2JLLA 5AAWA 4KXZI 4YHNA 4XVUC 5KSAB 1G7QA 5E8EA 3D3VA 1J8HE 2HTLC 3BUYA 4GLRI 4I4WB 4ZO9A 4GG6B 3GSUA 3ZHLA 3TNNB 2LU7A 1FBIH 3TA3A 5HYSG 3OZ9H 4LDLB 5L6YL 4NO0A 1P4BL 4ZO7A 3U2SB 2A77L 1UCBH 1UZ6E 5CZVH 3X11B 1CZ8H 4RFNB 1CFVL 1TPXC 4MHHI 1I8MA 1K5NB 4EJ1C 2HLAB 2NX5B 5DVLA 3CMOH 2GI7A 1A8JH 4G8EB 4RMTA 4OM1L 4WV1B 4JFXB 3FMGL 2L7JA 2SEBA 4YXKH 1G9EA 5F7EL 3VXME 1FZJB 4HJGB 2ZUWA 1Z9MA 3VFNB 4OD3L 1QBLL 1F4YH 3VG0H 3DJ9A 4JY4B 2DQUL 3LKQA 4BZ2H 4NSKA 4U4BA 5FA4A 4M93C 4HIHB 2E7LC 3N1QC 2BRRH 2BY1A 4IRJB 4K71B 1EO8L 5SWSE 1RY7B 2ZUQB 1UG9A 5D7KE 5FKAA 3TA3D 3CD4A 1GC1C 3GB7A 3REVB 4LVOB 3ZKND 4F7MB 4ZOAA 5MI0B 5I1JL 4OM1H 5IOPA 5I15L 3GK8L 4LSVL 2OP4L 3MNVB 4JFEA 5DRZA 3PGDB 1U9KA 4N90E 4YWGL 4NWUL 4RAUA 3TIDA 4PR5A 2NXYD 1FNAA 3ZO0A 4Y8DC 1NJ9B 3W11D 1ES0B 3FZUC 4PGCA 2CO6B 3B8SA 1JN6A 1QACA 1YEEH 1AFVH 4AENA 3RFZC 1MHCA 2VWEC 3O8XA 1Q38A 2CRZA 1CXFA 5J9PA 3D85D 5C09B 2FATH 3RWFB 2EXYC 1U8PB 3PWPE 3ZT7A 4D9RE 1J12A 5KSBF 3QULA 4O2CA 4H0IA 1KG0A 3EYVB 2A6DA 3HI6H 3OHXA 4M43H 3W5MA 4KKCC 1FRGH 2J88L 4WNQB 2YPKB 4QRTA 2YK1L 3S96A 4RDQG 5F1IA 4IOSD 4F7CA 2B4CH 3HAEG 4Z7QE 3KPLB 3ZHKA 1BFOA 1AKJB 1BGXH 1K6QH 1MRCH 2X4QA 3VGDA 2VYRE 4JM4H 2YUWA 1J8HA 3FRUA 4YK4B 5L2KA 3MGOB 3VWKC 1KJ3L 2A6JB 5D2NA 2OJEA 3U46B 3QIBA 4GW5B 4LPTA 5DHVH 5HYJD 5EC1B 4O9HL 3D69A 3CMGA 3D3VB 3P9MA 4ONFH 2HKFL 1FZMB 1B90A 2CK2A 3IDYB 4JVPA 5E94A 4O5LL 1HE7A 2CLZB 4L8CB 4MJ5B 3VXOA 5C0JA 3O0RL 3JWOL 5D7IE 3EFDH 2VLLB 5I1IL 4H25A 2FX8L 3RWGA 1WFOA 1WSST 5DT1L 2R1XA 1L0YA 3MJ9A 3V6FB 1E4XH 2DQDL 1DQDH 1MCIA 4LSVH 3PL6D 2AJVH 2XN9A 1RZIA 4GS7C 1HHKB 4PJHF 1MRFL 1HOCB 3QUXC 2BNUA 3DUHA 3NZ8B 2AP2A 1RJLA 1RIHH 2NY2B 3ARBA 4C57C 2FYYA 3PWLA 4JO2H 1N64L 5EZLB 3CFEA 1Z9SA 1WTLA 4IOFC 3GMLB 1NC4A 1QEWB 3DVFA 3GJFA 4NNPL 5JXED 2HG5A 5IHZB 4YC2C 4Y89A 1YJDH 3QQNA 2DQDH 4IIQA 1H3UA 3MO1B 1S8DA 3G08A 4QRRA 3LRSB 4PJ7A 1WZ1L 5HHXL 3ZE1E 5FUCE 1NGXB 4GFTB 1U93A 5D2LE 1DBJL 5H94B 5AZ2H 5C0CB 5C8JA 2DQHL 3AU1A 1FO0A 2F53B 4PJBB 1O7VA 3C2AH 5DK3A 4Y4KD 4DVRL 4TSCH 3QXVA 5T3ZD 3ZZ1A 1DVFB 1XEDA 2YN5A 4KTEH 4N1HB 3FT2B 4OD2B 4XP1L 4I0PA 1NGYA 5ESVB 2PW1B 2EC8A 5F3HA 3C8KB 1T2XA 4HT1H 5FCSH 3QFJA 2DLHA 5D1QD 5DD6A 4XCYB 1JPSL 1YQVH 4JG0H 4KI5F 2IAMC 4PJCA 3HR5B 1DVFD 4ONHB 3EYUH 2HP4A 2FD6H 1A02N 4QOKA 3TO2A 3Q2CA 3QG6B 3CLEL 5DQ9A 3BIAX 4LL9A 2J4WL 3V5DA 4PB0H 3N85H 2DQFA 3NACL 1UJ3A 4XNMB 4QXTB 5AYUH 2R29L 2P8PB 3PDOB 3T0DA 2AI0H 4F2MB 1L4IA 4YE4H 1U6AL 5DJXA 1IARB 5E08H 4GG6A 4O2FA 4I18B 2QJDA 5ERWA 3RTQD 3IAGC 2GJZB 3FRUB 3H42H 1U8JB 3OG4B 3PV6B 2AXGB 1KJVB 3AROA 5D5ME 4JQXC 3RHWK 2IH3A 1F8TH 3NCEB 5TE4H 1NMCB 1NUFA 5I73C 3T1FA 3PP3H 5B3JF 5FGBA 4AK1A 4YBLB 2V17L 1QFOA 3IDNA 1LEKA 1EVTC 1FCCA 2X4SA 3VD5A 5CP7B 3TBSA 4WI8A 5CBAB 2W9LA 1NCWH 2BJMH 5CZXD 1F4WH 3V6OA 3JVGA 5E08L 4OCSH 3VWJD 2Y06L 4NKQB 4CN6A 5GRUH 4TNVK 4RGMB 4L3CB 2R0KH 1KBGL 1TLKA 2VLME 4QTHA 1JZ2A 5L7XH 5T3XL 4FXKB 1IKNC 4X6BA 3MUGA 5E5RB 4M7ZB 4ZUTA 3O9WD 3LKQB 1PKOA 4G9DA 1OB1A 5GS1C 1HK6A 3UC0L 4HLJA 5GGSY 3G9VA 1MCWM 3EDJA 4PR5B 1C5BL 5HD8D 2BJML 4UQ2B 2I9TB 5CSBA 3FTGB 4WTXA 4ZXBD 2P24B 3BPLB 4NJAL 2P8LB 3CXDH 5IB2A 1QSEE 5B22A 3GB7B 4RRPA 3GIZL 2GIYA 1JF1B 4JHBA 4ZPTB 1MHHA 4TULH 3RNQA 3BGMA 4IRJA 1YDPB 3HC0B 4YHYB 3OBAA 5C8JB 1A7PH 1HXYB 2X1WL 5H37H 4EI5C 1OGAD 3TT3L 4MJ4A 4P59L 5DJDB 1I3UA 3D39A 1I1YA 3JV5A 3REVA 2A6KB 4PTUA 3VW3L 4V1DA 1OAKH 1L6ZA 2WBKA 4WGVB 3VRLF 1RJYB 3SQOL 3RJDA 3BHBB 1N8ZA 3CXDL 5J1AA 3MLYL 2PCPA 4APQA 1MIML 3UTZA 1KEMH 3MLRH 4R3SA 4RGNE 5HVFB 2D0GA 4I77H 2R8SH 3VFWB 2Y36H 3S34H 1XGUA 2EXYD 5MEQA 3QZWG 4NOFA 5CD3B 4OCYL 4NP4H 3IGAB 3U6RA 1YN7A 4EI5D 5A2JH 5C3TA 5MEND 3O6FD 2VNCA 1BQHA 2DQCH 2ZKHL 1EEZA 4HLZG 2XG5A 3INUH 3QDJA 3UJJH 3EKCA 4OCNC 3MLZH 1CGVA 1OPGL 1R3KB 4HIIA 3IRZA 4P23C 1LEGA 3FOLA 3PABA 4HXBL 2R9HD 5C0BA 3PHOA 4MSWA 4Q6YA 3MV8E 1ZLSH 3HS0A 1T20A 1D9KB 2AABH 2AJYL 2PO6D 4LSTH 3O6FC