1Q1AA

Structure of the yeast hst2 protein deacetylase in ternary complex with 2'-o-acetyl adp ribose and histone peptide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
285
Chain Sequence
TASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITTPQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HST2 protein
publication title Structure of the yeast Hst2 protein deacetylase in ternary complex with 2'-O-Acetyl ADP ribose and histone peptide.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
total genus 96
structure length 285
sequence length 289
ec nomenclature
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 1q1aA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1q1aA01
2H2DA 4IG9A 4GM0A 1EFVA 2AG0A 4KPUA 5EJ8A 1PVDA 1YI1A 2JIBA 2FR8C 1XLTC 2EZ9A 4UTRA 4KXQA 1M2HA 3GLTA 1PNQA 4D5GA 3OE1A 2VK1A 2Q28A 3ZGOA 3CLSD 1U28C 5DGTA 1T9DA 2VK4A 4V1CA 5FEMA 4BVGA 3FLMA 4UTNA 2HJHA 3EYAA 2B4YA 3K35A 3ZGVA 2H2HA 5FYQA 4F56A 3IAEA 1POXA 2JI9A 1Q1AA 5K6RA 5D7NA 4BVFA 1M2KA 1EFPA 4ZZIA 4IAOA 3F6EX 4JU8A 3IAFA 1UPCA 4RMHA 2OD2A 1S5PA 1SZCA 4F4UA 4JUAA 1PO7A 2FWNA 5EJ6A 4MPJA 2IHVA 4UU7A 2JLCA 2NYRA 1V5GA 1DJLA 5K6TA 2VJYA 3U3DA 2FRDC 2JI6A 4JUBA 5K3SA 1V5EA 4Y6OA 4UU8A 2H4JA 4IF6A 3CLRD 4RMGA 2IHTA 2W93A 2EZUA 4X3OA 3F6BX 4ZP1A 4QQ8A 4UUAA 1D4OA 4MQ5A 4RJKA 4Y6QA 1E3TA 2WVAA 1UPBA 2Q29A 4K9MA 4HD8A 1YNOA 3D4BA 3E9YA 1U2DC 4L2IA 4O8ZA 4MZXA 1T9AA 1SZDA 4L3OA 4G1CA 2VK8A 2DJIA 3EA4A 4RMIA 1M2NA 2Q27A 1YHYA 4D5EA 2JI8A 1O97D 2X7JA 1M2GA 1OZGA 4X3PA 4QPZA 2OORC 4HDAA 3GLUA 1OVMA 2OO5C 5MFPA 2Q5QA 2UZ1B 4GPEA 3U31A 2H59A 3JWPA 4C78A 1PTJC 2WVHA 1POWA 4J1TC 1ICIA 4BN5A 2H2FA 2Q5JA 4TWIA 2QQGA 2H4HA 2EZTA 2JI7A 1HZZC 4UTVA 1YBHA 2Q5OA 2FN3A 4MPPA 4FVTA 2EZ8A 1OZHA 4BVHA 4V1CI 4FZ3A 4BVEA 1T9BA 2FSVC 3PKIA 4BV3A 1YI0A 4GG1A 3RIGA 2C31A 3FZNA 1QPBA 1M2JA 1MCZA 4BVBA 4K9QA 4BV2A 5K2OA 5EJAA 4JUDX 4RJIA 1U2GC 1Z8NA 5EJMA 4TWJA 2PGOA 2QQFA 2H4FA 4JSRA 2H2GA 2PANA 5EJ5A 4C7BA 3EY9A 4JT9A 4BUZA 1YC2A 1PYDA 1Q17A 4K9KA 4JU9A 5MF6A 4R8MA 4KGDA 2VBGA 1JSCA 3CLTD 2A1UA 4I5IA 4GM1A 4K9NA 4QELA 5DGDA 1YC5A 3ZG6A 3RIYA 1BFDA 5BWLA 5BWNA 5EJ4A 2A1TR 4UTZA 3PDHA 1Q6ZA 2UZ1A 2OD7A 1U31A 2EZ4A 2VBFA 3CF4G 1T9CA 4JUCA 4MPRA 1MA3A 5IMSA 1NM5C 4COKA 1UPAA 2VBIA 3LQ1A 3JR3A 5DEIA 4J16C 3GLSA 2NXWA 4UTXA 4V1CB 2OD9A 3HWWA 1S7GA 3GLRA 2AG1A 1YTLA 1Q14A 1PNOA 2V3WA 3CLUD 3D81A 4K9LA 2Q5LA 1V5FA 3HWX1 1J8FA 4Y6LA 5MFZA 1PT9A 1YHZA 1ZPDA 1N0HA 3PKJA 4RJJA 2JLAA 4JT8A 4RMJA 4Q9DA 5EJ9A 4GM4A 4FEGA 5EJ7A 5AHKA 4BN4A 3D7KA 4FEEA 4GP9A 1OZFA 1O96B 2WVGA 2IHUA 5MGNA 2BRUC 3FSJX 4JD5A 4K9OA 4UUBA 1Y9DA 1PI3A 4JUFA 2PGNA 2H2IA 5BWOA 4K9PA
chains in the Genus database with same CATH superfamily
4BLVA 4EG0A 2QD1A 4ARSA 4KITB 1BU5A 1SMKA 5KWVA 1GPAA 3N6RA 1NPYA 4L9SA 5TQ0A 1V3QE 2V7QD 4RKYA 1NFFA 1YOBA 2ZPAA 2VXBA 4O33A 1H05A 1P7YA 1O1YA 3D8NA 1N6RA 2FPPB 3G8CA 2CYAA 4HK4A 4R0VA 5F1YA 5LB4A 4F3KA 1X7YB 3SQNA 4K88A 4AO7A 5AVRA 2FR8C 3R9IA 2WPDD 4ILKA 4OQQA 2ECOA 2YUIA 4YP6A 2BKVA 1N3IA 2JFHA 2NVUA 2WJZB 2J0UB 5F51A 3OFJA 5K0ZA 2MSLA 4HB3A 5DGIA 3NHLA 3P2MA 3GLTA 4FS8A 4B6OA 4EUEA 4PG6A 4KK3A 4KE9A 3ZE7A 1EK2A 4ZYUA 1Z5UA 4GR5A 1LBHA 2Q28A 1ORWA 2JHFA 3P97A 5E9QA 1E9DA 2FPMA 1IEQA 1X42A 4DZZA 4JJ7A 3AINA 2QLNA 2FRXA 3LUCA 1SUFA 3NX4A 1EE1A 5LZ2A 4RAQA 4A6XA 4UAUA 4QUEA 1QK4A 1TKAA 2D5BA 2QX6A 1E2PA 1MV5A 1SUAA 3A1FA 3EH1A 1WMSA 4UHFA 2ZWMA 4ZALA 5JXHA 2FLWA 4I4LA 3I8XA 2JRLA 2DRIA 1EVZA 2JKVA 1FVOA 3B9PA 1U5AA 4GOKA 1I3OA 4GPIB 4RD1A 4QLAA 4KMSA 2O57A 1RAGA 4KO2S 2P1ZA 1RWWA 5M29A 1WVIA 4EKIA 2XCOA 4AZTA 3CF6R 3O5AA 1V16B 1R8YA 4IFTA 5LZ5A 1XAIA 4TXNA 3SHTA 2PBZA 1AKNA 4OL9A 4OO3A 4AULA 4B6JA 3HR7A 3IAEA 1FUYB 1UM8A 4XDYA 2OBXA 4YRZA 2GJ9A 3ZE1B 2GA8A 5LQMA 2YVAA 3ZCVA 4MV8A 4EENA 2WWRA 4YRPA 4DV6B 3D8RA 3SC2A 4F8EA 1C4XA 4BNDB 4O59O 2XOEA 3AK4A 1M2KA 1T9HA 2WJVA 2MSNA 5FBRB 3KTAB 3TLJA 4BWVA 3PE4A 3QFHA 4G25A 4D6XA 5LJIA 2IYXA 1JHZA 1UMBA 2N47A 4K3UA 5C7YA 4RE6A 2YJTD 2AHOA 1ODJA 5FWAA 4C4RA 1SCDA 2VYNA 4YIHA 2HCBA 2ZFUA 1YVPA 3EH2A 2D7JA 4EJ0A 5U9CA 4KIFA 4B6RA 2ZS8A 3AP2A 3LYUA 2GD1O 1JA0A 3RS0A 1QQ6A 2Y1EA 1J24A 2CKMA 1JR3D 1PYOA 2OZKA 3FUVA 3UT6A 3ITNA 1BCRB 4MDEA 4M0MA 1YQTA 1XDUA 4KMRA 4I66A 2C9YA 1DDIA 1OW3B 4S12A 4HPJB 2B2CA 2CMGA 3HC7A 3PNQA 4OXQA 5ERXA 3CPEA 2CJYA 2OB2A 2WT4A 2X22A 3OQOA 4IV5A 1MO5A 1EKXA 3LI2A 4G5HA 5EJ6A 2JVIA 3DBHB 1H2XA 4U7TB 3S2UA 4WDRA 4POOA 2ZSIA 5AVVA 3NCHA 2HYIC 2VP6A 2NUAA 3ZXSA 1H2AS 2EGHA 1U3CA 4C2TA 4NWIA 1TUGA 2MSDB 1MG0A 1ZICA 3TTSA 4ZHQB 5EMMA 5CD9A 1H1TA 1NV8A 1ORHA 1V5GA 2QG4A 1ESZA 2NU6A 4EUSA 3I42A 2G82A 5I5GA 4JSYA 3ZVKA 2AW5A 3D6VA 3QBEA 4QHYA 3LX4A 4E15A 5DM0A 4LYDA 3BK7A 3OIYA 2BGKA 3T9EA 3CRNA 1XT6A 2F1KA 2WABA 3DAOA 2VYVA 4FW8A 3UG7A 4CL8A 3IPRA 5I6DA 2OL4A 1NVEA 4DEYA 3W8FA 2RH9B 3IRVA 1JT9A 1M72A 1RYHA 3NVAA 5CLLA 2PDAA 3QXHA 4N4AA 3UHPA 1P73A 1ZGHA 3KTFA 5U1PA 1UBEA 1JVNA 1BYIA 1FTGA 2E5WA 3GLHB 2QLMA 4PQRA 3TQIA 4D0LB 3EE6A 1IZYA 4MQMA 3SVLA 2RHCA 3SHQA 1NW6A 1MIHA 5L3QB 1QZZA 2YC4C 4DQKA 2VDQB 1RBYA 1J00A 1YKGA 1SQFA 1GCAA 2P35A 5IHPA 2XB8A 4LDJA 2QRUA 4UUAA 1K8ZB 3L05A 2QPOA 4UEOA 4D0RA 1IN1A 2CHFA 4AU1A 2VDVE 3ENQA 1NUTA 3D3EA 1XDDA 3CLHA 2BSQA 4B82A 4HD8A 5KU1A 4B83A 3TB6A 4IDEA 1OZ0A 1X1DA 3AEZA 1VBFA 4KO8A 3VPDA 2QRLA 3VZDA 1UJNA 1IDOA 4FI3F 1NNUA 2DWPA 2H85A 4KK4A 4R1UA 3TFQA 1JMKC 3GI1A 5FL3A 1QHHA 2GSDA 3PQDA 1MIOB 1VCIA 2FOXA 3U61B 3OD1A 2D2EA 2D5IA 1I80A 1DAIA 3G2IA 4G0WA 4BATA 1RACA 2VK8A 5C7IO 3ND9A 1GM5A 2K7FA 4B6PA 2HF8A 4KAXA 3VRHA 1XZLA 2C1XA 2HKIA 3AI1A 1YR2A 3FFBA 1HDGO 2QENA 3OCCA 3OEHD 4IUDS 5B58T 4YDQA 4PZPA 4Y98A 3QE9Y 1RAEA 3SX2A 3LPLA 4CEJB 4YJFA 3ZU2A 3HDQA 1N34B 1RZVA 2WUEA 2AOVA 4X1KA 4UMVA 5G2OA 2CNOA 2PD4A 2GHRA 4G5YA 1H1LB 4R2MA 4H9GA 5H59A 1XWWA 3PHIA 1OYWA 1CNEA 2WU1A 3SFZA 4YDHB 2DPLA 3RWOA 4A8PA 4N03A 2Z09A 2ZJ2A 5CM2Z 2Y76A 1UFRA 1R64A 2PRJA 2NTNA 3HBAA 3ISJA 4DT1A 3EVTA 2ANBA 3TG8A 3HGTA 3OOJA 1TUBB 3KU1A 2Z04A 3PGLA 2UZ1B 2Z3VA 3DDCA 3M3PA 4NU5A 3T4EA 1Y8QA 3U31A 1F3OA 4LGYA 3HO8A 5C8XA 1XAGA 3L0DA 4YLGA 1KJYA 4KNVA 3KQKA 2ECQA 4CMCA 4ONEA 1YS7A 5ERGB 4IIXA 2N9UA 2XUFA 1HEUA 2Y2VA 3I04M 4GHWA 3K70C 4EW3A 4YCCA 1Z6PA 1Z08A 4D8WA 4ERNA 5A02A 1KDTA 2HL6A 2PJRA 2HCTA 3BBPA 1PTJC 1DAFA 3R5KA 4LNUA 5D00A 2JAUA 4BQOA 2XZLA 2ZBRA 3ZR4B 4NOKA 2N75A 3MD0A 4PS1A 5B1IA 4FMBB 4EJSA 3LW7A 1YZGA 4UBJA 1YQUA 2W37A 2CKDA 1Y4ZA 2VNHA 1LBEA 4L7VA 4ARVA 4F38A 4CL3A 2YWHA 3G2PA 4HZUA 1K3FA 2V7UA 3E7WA 1YXMA 1NLZA 4UE2A 4UW9A 4JGGA 2HLDD 3V4PB 2O8EA 2IYPA 2BEUB 3DFKA 2FX5A 1H23A 2WHPA 4FYHA 4RK4A 3VU8A 3NYQA 4UOZA 4O4JB 5HMMA 3OIWA 4HAUA 1WSDA 4YP1A 2ZSKA 1XPJA 2WV7A 3BS4A 4R2LA 4C7VA 1DX9A 3P7MA 4GRAA 1NJ6A 4TGLA 2XBLA 1L7OA 1NT4A 2Z83A 1Z0IA 4FMCF 5DOVA 5BPHA 1GCGA 1YQQA 2YZGA 4C43A 1MPTA 3RBZA 2ZIUB 1F12A 1SVUA 3HVHA 3TJMA 2JFWA 4TTIA 1QMGA 5KOJB 3QKSB 4TYQA 4B43A 3LBIA 4ROTA 4DEVA 4I9UA 2MSWA 4ETNA 3BD9A 1OAAA 2K6GA 4S3MA 2Q21A 4M1TA 1KEUA 3IIKA 2BTQA 5FOUA 2YZMA 4AUMA 5KJCA 4M9XA 5HBGA 3W8RA 3W3AH 3CRZA 1Q0PA 3LWZA 4AZ3B 4PAGA 5I4KA 4MYDA 3L4BA 2FA9A 3A3NA 2JGLA 5HR5A 4MWDA 3CW2A 1S96A 3C5EA 4LJ9A 3G2NA 1MQAA 3QOYA 4NMHA 3LY7A 1RRFA 3GJ8A 3QVOA 3PEVA 3DGEC 4J0EA 2J33A 1U9YA 2C7GA 4PY2A 3QQ5A 4YRJA 5J5CA 2JFOA 5HXAA 2HH9A 1OFTA 2BWJA 2P1RA 3K8OE 1XD9A 2IUFA 1P1BA 4I5DA 4G0PA 5L3ZA 1RJFA 3ADOA 4BNHA 1YJQA 1LUAA 4BBPA 1MEJA 1BDMA 2NO9A 2J6CA 1P7CA 1GILA 4DA0A 1ARZA 3ZLTA 1QUFA 1RKBA 1K2VN 5JZBA 4E2YA 3FFWA 2EKZA 1XNHA 3SBDA 4QE3A 5TDHA 1B2RA 1H3FA 3V2IA 4MXDA 3Q3IA 3CLTD 2QBYA 4I5IA 1R0SA 2HBYA 3V97A 1PRYA 3PUYA 4WKPA 3FTQA 2TMDA 4PV7A 1T4BA 3SXJA 4WESA 1T2CA 2X3UA 4CKYA 1JBQA 3B6EA 3E3OA 5CCBA 4E5UA 3KKNA 1OJLA 2J9GA 2P2SA 3ASVA 3JZFA 4AMYA 2FE4A 4P5DA 1QP8A 3ENWA 3P0RA 3MJCA 3MMPA 2OHVA 3PICA 7ABPA 3H2ZA 4W5RA 3A1DA 1NW4A 4FBGA 3KG2A 4ZQIA 3R9XB 3QENA 5A9TA 4PCVA 1ZCZA 1UJ5A 4OCZA 1KU6A 2V7QA 5DNCA 5GADl 5E7JA 4DA6A 4PN7A 1X39A 4A0FA 4MLPA 5JC1A 2AN4A 3I8OA 3P96A 2WF9A 2CL6X 3V8EA 4CM9A 2Y0DA 4GOND 3AQIA 1JLSA 1FK8A 1KC1A 3K1AB 2P1DA 3KQYA 4YVFA 3M6LA 4B75A 3LUPA 2PWZA 2V7WA 3CB2A 3NIBA 5DM60 3G13A 4MH0R 5DM2A 2IRWA 2V4UA 2A0WA 2IPNA 3HCCA 2FU5C 2J85A 4AKEA 1SOWA 2XT9A 1II9A 1MO6A 3DW1X 1C9JA 5KSWB 3IFSA 5L4SA 3Q3VA 1NXWA 2O3UA 3LVQE 1N0VC 2AB0A 3RHZA 3K0KA 3OWXA 4HWSA 4WBNF 4A23A 3GAFA 5CJPA 5FLKA 3NEAA 1YFLA 2HU7A 2LDBA 4OAPA 3LY9A 5H68A 3QYPA 4F5WA 1S3IA 4WBNA 4MUAA 4MNTA 4P33A 3ZVMA 4JUCA 2CNKA 2EHJA 3N74A 3VNBA 3GAZA 4F9FA 3NJ8A 1DFIA 2BMVA 3P9PA 4PG7A 4ENWA 4MW1A 5FNZA 4YMUA 4NCIA 1Z7WA 4IIDA 2AK2A 1MVNA 4Y2TA 4DREA 3LQYA 4WCVA 3K9FC 2I76A 2HSEA 2IZ7A 3BZWA 4Q9JA 1W29A 1D0IA 1ACJA 3JVIA 4PSAA 2H06A 3L04A 2FG5A 1Z12A 4RZ3A 1JWLA 2LRHA 1E18A 2IHJA 5D01A 2C83A 2DUWA 3EGEA 3AVTA 2RIRA 4H1UA 2PFSA 4J2OA 2AQKA 4MCHA 1OI7A 4R2IA 1YF3A 2NLOA 1PR4A 1ZDMA 2ZR0A 3WL6A 3F4LA 2ANCA 2FQ1A 4TTPA 1YTLA 2J9YB 4QARA 5CUQA 2I4OA 4D3FA 4BLSA 3FOCA 1TU3A 2C29D 3GDFA 4FZJA 3D81A 4KQGA 5JXJA 3RC8A 1BXRB 4UD2A 3R7LA 3LVBA 4M3NA 1C7JA 3U7GA 1VJDA 3TLGA 1U9ZA 1T13A 1EG7A 2GO1A 2VL7A 2WIJA 4J3NA 2ZYAA 2VBCA 4MKZA 3RJMA 4WE3A 2OP1A 2DFLA 4TZKA 4J29A 4B35A 2R11A 5JO0A 1EUDB 1L4GA 3OH8A 2ZRNA 3O4FA 3NGMA 2FVYA 1G1MA 4PPYA 1EFPB 1BA3A 5I47A 3JQ6A 1C9MA 4DTCA 2E6UX 2QSUA 4L16A 3FXAA 1IONA 1TQ6A 2C4KA 1BX3A 2EFCB 2X8AA 2NPFA 4CM8B 4ZJPA 1JR3A 3IVAA 4H3KB 3RABA 4WXMA 1AZWA 3UPDA 3N86A 3UTCA 1LY1A 4ADSG 4F2PA 4E13A 2Q2OA 3EPHA 1H0KA 1QDEA 3FSGA 4LDZA 1MQ8B 2ALJA 3TZEA 3NJRA 1PAUA 1ZGBA 4P54A 2OOSA 2H31A 2Z8ZA 1WDKA 5HJ7A 1XMSA 5I9MA 1D07A 621PA 2Q5IA 1II0A 2REBA 3EBPA 2BYTA 4QPDA 1BKDR 3RBXA 1DBVO 2FGJA 2BZSA 3T7CA 3KSAC 1EFAA 2R4TA 2W98A 2WM2A 3E82A 4I1VA 3VKUA 4B4VA 3R8XA 5AUPB 1XXHE 1SD2A 2P9QA 1RZRD 5E6RA 2IVFA 1FW6A 3RU3A 1O96B 4D98A 1KP3A 1NURA 3A4IA 2FWBA 3FBTA 3IKJA 3LL7A 2NO5A 3PNVA 4H3SA 5L3RA 1EPUA 2PH7A 3ETHA 4II7A 1E9CA 4ZTBA 3UF0A 2QD3A 2XB6A 4BGDA 2JLUA 4I3FA 1MR3F 3BSWA 2OCIA 2DJ5A 3MXOA 2C0PA 3FYUC 2GPTA 5L4NA 1PYGA 5T57A 2G9RA 2XOKA 5DJ5A 4D9NA 2X8JB 4IMIB 4GYJA 1JB9A 3OFNA 3W6NA 2GK3A 5EIBD 3D7MA 3FIUA 4FSXA 1YSCA 2DKNA 1NUQA 2IDJA 4LRSB 5ED0A 2Y92A 4KXLA 4F72A 2GZRA 2YYYA 3U4QB 3K9QO 3U26A 2J5RA 4H1HA 13PKA 1CUZA 2X58A 4K9PA 4FYIA 1H6CA 3ZC3A 3FE2A 3S3TA 4DIBA 1E89A 4WNAB 3COZA 1RJGA 1REQB 2VC2B 4PM4A 2WLTA 3KIPA 3SR4A 1BE1A 4G65A 3M0EA 5HZKA 3EPRA 3GUYA 4HRYA 1H3EA 4V0OA 3LQ2A 1J8QA 1G4AE 1AM4D 1NLUA 2XJ9A 4MICA 4QOHA 3UUWA 1WXQA 4AMGA 4EUFA 2WQ6A 1U0GA 3KZMA 3W4KA 3CCCA 4B3MB 4DXHA 4II2A 3T9DA 7MHTA 2CXHA 2VCYA 4BP3A 2YHAA 4M9ZA 4MYHA 4KP7A 4YUVA 3N1UA 2V03A 5KWJA 4FOPA 3VHQA 3JYOA 4B74A 1Z3IX 1MB4A 2EVWX 2BFBB 5EIFA 3VR4H 2FGKA 2PPLA 3H1PA 2QRZA 4BO6A 1E20A 1Z4LA 1Y6QA 2Q5HA 3UHOA 4KDFA 4RKEA 4CLEA 3HNOA 4F84A 1F6BA 1GAJA 4Y9SA 3DV0B 2E82A 3HY3A 2D1YA 1EGAA 1D8AA 2B5VA 5CBPB 2I1QA 2WKQA 2SHKA 1P2TA 2PXHA 1NVBA 1JF8A 3G0CA 3IIJA 1M76A 3PK0A 4I81A 1Z22A 3VZSA 3EQ7A 1S8FA 3BHNA 2YJ6A 4Z3KA 2K4MA 3FGOA 4YJGB 4EX7A 1HORA 2R7LA 4XH9B 5KUTA 2YCBA 2X1MA 4LSMA 4I4CA 1YULA 4O4IB 1ZNXA 2BKLA 5HKBA 2I6TA 1UK7A 1Z15A 3BD7A 3QUSA 2L42A 4RH1A 3B7WA 2XWJI 5KYXA 2E21A 4MTLA 3Q7EA 4Z54A 2BFNA 2GNAA 3NRCA 1GKKA 1IBCA 3IAS6 3QY0A 4NEGA 3FCAA 2WFLA 3T5CA 4D0NA 3EVEA 4DMCA 3W2EA 3Q88A 4DR7B 3SHVA 1I3CA 2ZJ5A 4MWGA 2JC3A 4UNQA 4EBFA 2QRKA 4FN5A 4BCBA 5CEEA 3W5VA 3O94A 4HXFB 2Q4BA 3K96A 4LECA 4N6OA 4MRRA 5IABA 2UXCB 4PO3X 1JHRA 2PYDA 3DMDA 1YMVA 4JB8A 2HSJA 3B89A 4J6FA 3P9RA 4RLFA 2FFAA 4QJ4A 5ALNA 4P93A 1UT5A 3JARA 1ZX1A 1VJTA 2NZ8A 4A8TA 4MR8B 2E37A 4XQ9A 1JLLA 1M0EA 3GRZA 3HXKA 3I37X 1QHEA 3CVVA 4DV3B 2IBTA 3EQ8A 4AIIA 2QP3A 1YAJA 3V1LA 1IG0A 2PSEA 4MYUA 3UXMA 1YGYA 4UATA 1LSOA 5BSMA 4URHA 4BQIA 4CLRA 5M2QA 4YUXA 1KJ9A 4P2GA 3QE0A 4OJQA 3A7DA 1WAMA 2BHNA 2P3QA 5J4HA 3SYKA 3BRQA 5JCOC 4WBSA 2Y05A 3MMZA 2H2WA 1J39A 1JHUA 1PQYA 3FSEA 1G2QA 1KH1A 5FNVF 3A1WA 4MPJA 2P9TA 4ND3A 1ZKDA 1IAQA 2P8JA 1U11A 3ON5A 5CVJA 5FNVA 3W5UA 4BBZA 2C0CA 3TZ6A 2GFIA 3PQ4A 4IHJB 2AZTA 3H5TA 3WG9A 1IY2A 1SNYA 3B82A 5DH9A 4A03A 1XJCA 2EF0A 3DQPA 2QAGC 4GVXA 1QB8A 1QR2A 4F9EA 2YQ5A 3U4CA 1G4UR 4IIJF 3H4TA 3PG5A 4X7RA 4WKOA 3U3DA 3PWZA 5COQA 4AQDA 4JAVC 4ZK2A 4IIJA 3OY2A 1WPQA 1N2SA 1Y3DE 3L6OO 3W3AD 5JVDF 4FDLA 4JJ8A 1YVRA 4WUVA 3SX4A 2WDPA 3I34X 3E0QA 4J1NA 5JVDA 2J08A 4UXHA 3ADBA 5HDBB 3TSOA 1SC6A 1UOEA 2ZE6A 2ZYTX 4NHEA 4S1VA 4ZU6X 2XYGA 4X24A 4AJPA 2V0GA 3C85A 3A37A 2G67A 4YJHB 5DLYA 5EINA 1DAPA 1NVAA 2DQKA 3OJCA 2EW1A 1H4SA 4CKWA 4KI7A 4G0XA 4MK4A 4NV1A 1FVHA 1YT5A 3A7EA 4CQNA 1BWPA 1HDIA 1GY8A 1TYZA 3HYLA 4HDSA 2HPVA 2WWXA 5C7OO 2PM8A 4UTPA 3QHPA 5MDHA 3K0EA 4AJKA 4RV9A 3L1IA 4U4AA 3M6XA 4WSOA 2FUCA 5REQA 1PT8A 4G0YA 2WNSA 4FX5A 3DAPA 2HMAA 4TTVA 2FPOA 4G5XA 1XNGA 1T9GR 4I8IA 3TK1A 3PF9A 3DTVD 5FOXA 1EWQA 3D4BA 1ISGA 3Q12A 1ULZA 2WWFA 2R6HA 4WY8A 4NE7A 4FWBA 1JUDA 4A82A 4YV1A 1ZITA 5HIKA 4OB6A 4LV6A 2O6HA 2SKEA 2R68A 4L2IA 4LJ4A 3IXLA 3T7RA 3AZPA 4MGYR 4E3WA 5GINE 5JSZA 3WLNA 3TKAA 3K0SA 5F98A 1VI5A 3D31A 4I4IA 2DJIA 4FMPA 1UXOA 4IVPA 1G8AA 4UHBA 4XEUA 3EFOB 1DHRA 4ZKDA 5CX1B 3H2HA 4KW7A 5T8KC 3EA4A 5KI6A 2C61A 2IXGA 4KE6A 4YONB 2KJQA 2YYSA 1ZYUA 3CJRA 3R74A 4ANFA 2Q3HA 2QUBA 3IMCA 2FB9A 1VGVA 4UCXA 2WNIA 2DHQA 4RGQA 3DZDA 1VYTA 1QTIA 3TE7A 4DGSA 1W5BA 1VLHA 3HP1A 3UAZA 3W7AA 3WZLA 2CC2A 1AA6A 3TJZA 3C0KA 2UU9B 3AONB 4QPZA 4FFNA 3OSUA 4FC6A 4MPTA 4ZXPA 3GK3A 2RI6A 1ZMBA 1EUQA 3ANSA 1B73A 3K2QA 3LHKA 1EBBA 1E5DA 3WLAA 2H4XA 3OIGA 5A03A 1JEOA 1F7UA 1UOOA 3O3MB 2JAPA 5DP1A 2RHRA 5B5SA 3KQHA 2WTUA 3F49S 3O8OB 2YWGA 2VJNA 5F3WB 3ILHA 4XDGA 3IEVA 1DRUA 1KBQA 1I4OA 2JKZA 2QVXX 2ZSFA 4J7AA 4Q16A 1Y6RA 5EUBA 2EX1A 2P8SA 1NVFA 5EGNA 5LNK6 1IB6A 2NO6A 2V3VA 5BP7A 5JZMA 2BEVA 4DBVO 2P6OA 2PMKA 1SVNA 1UOPA 3EK2A 5CGQB 5C1DA 4X64B 2UZAA 2Q1YA 5HK9A 3STXA 3GFOA 4CKZA 1CJUC 5AJYA 1OA1A 3CUUA 4QPCA 1AU9A 2GYVA 4C0HA 4Y7DA 3E5NA 8ATCA 1Y4UA 4ISBA 3EFEA 4C7KA 2D4HA 1EUZA 1ZOPA 3H17A 4KR6A 1RW4A 2CUTA 3EXAA 2WEKA 4EY7A 1Z06A 2A3NA 2O8BA 1G20A 5HF8A 1EE9A 2AEJA 3RR2A 3SQOA 2D5CA 1FNMA 1YRAA 1NU6A 2E3JA 3NOVA 4YS6A 2P69A 4OVKA 3NNNA 1JMYA 5FPSA 1OLSB 1F0NA 2QP9X 1UM9A 4L4XA 4RPLA 5CCDA 1ZH4A 4AS3A 1DTSA 1M33A 3ZCXA 5GGXA 3N7TA 3WGVA 4C0WA 1P2SA 2J3QA 4ZGWA 4I2VA 1HZZA 2I3ZA 5JJCA 1O6ZA 3E4DA 1UPFA 4G9EA 1FFXB 1WTAA 2XKAA 3PSHA 2VHCA 3I4LA 1FTYA 1VJ1A 4EJFA 2E4VA 3T7KA 1ESDA 2YL2A 2O4CA 5FTKA 5M04A 3NDRA 4IDDA 3OICA 1JXMA 4RPHA 4EB6B 1M2JA 3AFIA 5DWDA 2PEZA 4EW1A 3AUFA 4AMUA 3FIJA 1FOEB 3JVEA 4BFUA 3ROXA 1GUBA 2NSYA 4K6KA 4NAVA 1XMQB 1QCYA 4JBWA 3EFBA 4MI9A 2QAJA 2YC2C 3T06B 2Z9CA 3LBAA 5ITZB 4B44A 3K16A 3O03A 4QUJA 1RQPA 1JDNA 3GA5A 5C80A 2ATIA 2VF7A 4IIGA 2CJWB 4YT5A 3VGPA 3F5FA 4E88A 1B6RA 1GARA 4RHEA 4IIHA 4HWTA 4LG1A 4X54A 1X8KA 2XMDA 2ZUDA 1O3YA 1I30A 3ANYB 3GJRA 3LXXA 3RBAA 3EY9A 3RE1A 3FTPA 4UEQA 5AVUA 2MJLA 1YBFA 2G0AA 4FSDA 4G36A 4UASA 5LBTA 3LOUA 1SKQA 2BGRA 2VSOA 2F6RA 5EKDA 3PJRA 4GBGA 1RZRA 4DSUA 1MT0A 2VH5R 1QLJA 1R4NA 3TWOA 1I7QB 2Q99A 3PDCA 3B53X 3A4YA 4FEAA 1PSDA 1A3CA 3ZCPA 2F3QA 1NXPA 2DVMA 4CEHA 1V4VA 1QQ7A 2BHTA 2MWMA 4OQXA 3V4RA 3BEOA 1US8A 2ETVA 2IEIA 2PCLA 3CXRA 4YP5A 2VCHA 5IMBA 3QV1A 5C5EA 2VQDA 3ZI0A 4P4TA 3NVKI 1GRVA 3S1SA 4HUQA 5DWVA 1KZ9A 2OQIA 5HP4A 3QI2A 3WBBA 1Q5PA 1QNLA 2AK3A 2ADOA 4PLCA 1RLOA 3N8GA 4YRQA 2B1IA 3SR0A 4ZMRA 5BNFA 3UJHA 2PUTA 2QM8A 2ZWOA 1YZUA 4EA9A 5CXSA 2OLJA 1UFKA 2HJWA 2ZIFA 3PDIA 4J4HA 3OLVA 3UHJA 2BZ0A 3PRKE 2AGVA 1K5DA 2XCLA 3LKZA 2JATA 2JRCA 1XR3A 4IOJA 3TRIA 4ACBA 4D8VA 5GVRA 1WMDA 4LYYA 5CXQA 1LF0A 1Q7EA 2HD4A 4KXYA 3M9LA 1NLYA 1Z29A 4X7PA 2VAXA 2VHTA 4NS1A 3I6ZA 4V39A 4ZTZB 2XR1A 3BCSA 4NABA 1V5IA 2C3MA 3O1LA 1BWQA 1W52X 3MCVA 3FKJA 2I6UA 3Q8LA 3L41A 1QVVA 4IS3A 3R20A 2WAOA 3UAYA 2E87A 3AR8A 4B32A 4BQEA 1EIWA 1NYTA 3VR4D 5B6JA 2FOLA 5F9HA 1D1SA 3IGFA 1K8RA 3D6UA 1PFQA 1KZHA 4IJQA 4UNNA 1HDOA 4IJ5A 3K9GA 3UJ7A 4E21A 4E70A 2C2WA 2VUSA 3ZXUB 2H0QA 2VJBA 3ORSA 4NIMA 3VU9B 3H6KA 4W5NA 1MA3A 4LMAA 2VIIA 3QHAA 1O03A 4G8DA 3QY9A 5JS1A 3R23A 1VFNA 3DAYA 3PEFA 5ERYA 2DM6A 3GZNA 4GZ3A 1GRNA 1RXWA 1GQQA 1XBTA 1A8IA 3RASA 8ABPA 3QA9A 4OQNA 1AHPA 1W75A 2PLAA 3GMTA 3ICQB 4UTXA 1FDTA 5T5QA 2I3GA 4EO7A 3ZK8A 5HRUA 1VG1A 4O2LA 1QYVA 2A0KA 2OQRA 2VPYA 3CEPB 4PAQA 4PE5B 3AUYA 2BE9A 3HWWA 1U3TA 3K2EA 3NIFB 1KL7A 5BNZA 3PX7A 2XCTB 2QX9A 4M60A 3QHQA 2VNIA 4HUJA 4F6CA 2YWRA 4D25A 1IK4A 1Z7YA 5I51A 4X5OA 1DLJA 3EY4A 1XTBA 4BU0A 2P2YA 3TNLA 4MHTA 3VX4A 2I1VB 3N8KA 2DPMA 2PH5A 2G3YA 3WV5A 5DBHX 2BN4A 1Z8DA 3JQQA 1I13A 4XIYA 1E3MA 3H11B 4N47A 5KTTA 2HB6A 4WVFA 3W05A 5BMOA 1Z5WA 2HSDA 3VR5H 3NXKA 4AI6A 3NYWA 4G5FA 2OXFA 1CYDA 2YJ3A 3UK1A 2VDRB 3AJ8A 1J97A 2G40A 4GWLA 2BKAA 3K9HA 2QB5A 1FSSA 1UF9A 4FR2A 4OMDA 4UUNA 4KR9A 4EP1A 1LF5A 2RG1A 1OKKD 3SXPA 5J2UF 1RWVA 2GZ3A 4FHGA 4MS3A 2YOGA 3A36A 3GUZA 3A1NA 3NUQA 5J2UA 5HKKA 4DV1B 1KFBB 4R8VA 4W5JA 4NYJQ 3OF5A 1GT6A 3ZIAA 3L0BA 1L8AA 3TDMA 4RY8A 3ZWPA 3RH0A 1XVVA 3SM9A 5GMOA 1P0QA 3WRYA 2DWQA 4E5DA 4DSAA 1DELA 4GKKB 2QGZA 1EBUA 2Q49A 1WV0A 3FPAA 2OVBA 3MTBA 1FB5A 4UZFA 3URMA 4B0PA 3U80A 2FN7A 3LNCA 4DV7B 1GPBA 3OTIA 4MEJA 1KEZA 4FHEA 3LSYA 2ZCJA 3O2NA 2ENWA 1FLAA 3CZ4A 5KYVA 2BI4A 4BN4A 5BV2P 2MR5A 4GC5A 4RHXA 3VGJA 2DWUA 4REOA 3RWMB 3CLTC 3JQFC 4YJ3B 4EG4A 4C0LA 4LF8B 4XJSA 1D5CA 4JLMA 4LDQA 5BOSB 5I7RA 2C5EA 3SYMA 3ESDA 3PR3A 4XKJA 5C8VA 2QUKA 1LPNA 2G1PA 2OSBA 1CNFA 2C0QA 4ECAA 1CUCA 3FMGA 2PYZA 3W3AA 2BLLA 4WOBA 2WWVD 2DYKA 1VE9A 4D6YA 4U2EA 2DQZA 2C3PA 3E9CA 1AXEA 5FBLB 4JP2A 2X9QA 4L72A 2NU8A 3C8UA 1JKXA 4JUFA 2EJBA 3NC4A 4EFLA 1D0SA 2C3OA 3A04A 3GJYA 4J9VA 4P7KA 1FYEA 1SVOA 2AQHA 3N2YA 4QGAA 4D79A 5AESA 4EM6A 1JLHA 1Y9JA 1BHJA 2ZIGA 5K0NA 1FJXA 5D85A 1FFGA 3SY8A 4B45A 4M99A 1T2EA 1HOXA 1GL6A 3QEOA 1N1EA 3ZU3A 4B76A 3E1SA 4TM7A 4EGQA 2Y66A 1K89A 2XQGA 3BJRA 3UWPA 4LOLA 4RX1A 3PFHA 3RFCA 3DM9B 1OFGA 4S1NA 4AROA 4Z3DA 5CT5A 3CISA 5A5EA 3PFFA 2FFHA 2CXOA 5AJTA 3O8DA 5KJ6A 3OKCA 4JB2A 4NBSA 2A9KA 3D8BA 2IIBA 2WYVA 1PQWA 2YH2A 3OUZA 2WJGA 4RCYA 2R8RA 1OXXK 1DOZA 1G41A 2B25A 3AHHA 3AHDA 1ODIA 3KCNA 1V1MB 3DVAB 3AF4A 3GXBA 1Q2XA 4HWKA 3UJAA 1UXGA 1G8FA 1R66A 2Y67A 4OV6B 4EI8A 5IHXA 5K3OA 1GTRA 1E5TA 4L57A 4E03A 2P9GA 1N5IA 5FPHA 1HDYA 4G09A 2FH5B 4PYQA 2IWHA 3UJ3X 4BNXA 2GBGA 4RYDA 2DTXA 3E81A 1JPVA 4K87A 2AJTA 4AWBA 3KOUA 1P9RA 1S3SA 2MSCB 1VL8A 1X94A 1XKQA 2IQ5A 2W7TA 2R1TB 2RJOA 5F21A 3QSYA 2PVCA 3TBKA 1B8PA 4W9NA 1E3LA 3NBYC 2O7VA 4U9HS 3M3DA 4G0UA 1NIPA 2WYHA 3BB4A 4PFJA 5BN3A 4N5HX 5JHHB 3VJMA 3PGKA 2QW0X 2ZJ8A 3L8DA 2PIAA 1FBNA 1QGAA 3OZSA 2LDXA 3PXDA 4CQLB 1GUFA 5BRJA 2ZBUA 3NFYA 3O3NB 5DHTA 2CFIA 5CAEA 4OQLA 1RTKA 1WUJS 5EWJA 2OV1A 5EE9A 3EULA 4BKUA 5CB0A 3ODPA 3EZ2A 2IODA 4MMXB 4GS5A 4P7FA 4JYCA 4RAOA 1CJCA 1NR5A 1I1QB 3DLIA 2O8DA 2C9ZA 2I6SA 1VG0B 1NP6A 1T9GS 1V95A 2QX4A 1ZIPA 3DFZA 3TLMA 3WQQA 4EHHA 3NXSA 2LCFA 4KTVE 4C29A 1OAOC 5EWLA 4ZDIA 1ISMA 2AEMA 4E94A 4U7JA 3FNGA 4IIUA 4O02B 3RB8A 1UZAA 3TW8B 3GHHA 3RUFA 4Z4CA 1J0CA 3WQRA 1EA5A 2VDUE 4ITRC 3MHTA 1E2EA 1P31A 4GNRA 4N40A 1CQJA 3LHIA 1ESCA 4OAOA 2V1UA 3C16C 1DDGA 3DT9A 3GEEA 4NESA 2YWXA 5CIWA 1J9ZA 3GLVA 2AVNA 5EXEA 3CCBA 1SVIA 3M4ZA 4ML3A 5JNTA 3F9CA 3ND7A 4IINA 3KDPA 4QRDA 4QOEA 4X6XA 5DBFA 3T9CA 1E58A 4A91A 2C03A 3ENVA 3QVGA 3BILA 1X87A 2AFHB 3DZKA 3HLTA 3TXAA 1QXSA 2R1VB 3D8UA 1X80A 2CDNA 1F1JA 1F2TB 3P71T 1N3BA 3REFA 5KYNA 1M6VB 5JCXA 2VWHA 1PV4A 1PE0A 3DZIA 5BW5A 5E9WA 4K0KB 2PEYA 1HDRA 1G2PA 3HBLA 1NRJB 4MQUA 5F4BA 4DM7A 3VV3A 3ETLA 3BWMA 3M6AA 1NJSA 1RRPA 2JLCA 1GSIA 1QJ4A 1CUJA 5KIAA 4FPXA 3TN7A 2Q2VA 4YAGA 1V7PC 2IEBA 5AHWA 2J3EA 1ODLA 1LU9A 3HYRA 1E2KA 3ZDAA 2H1SA 5EIBC 1E9EA 3EWAA 3W5JA 5KWSA 4Y3UA 4YP7A 4ZC1A 3DLHA 3L6RA 2NU9B 3FTEA 1Z38A 5ADVA 1PJ8A 2FPGB 3QW4B 2XMGA 1IBRA 3AL2A 1FNBA 3C3AA 2BOVA 4RMNA 4M1SA 4W1QA 1MJ5A 3AZOA 5TQ2B 4KGVA 4EBBA 4YP9A 5EJ2A 1G59A 1JHXA 4ZVUA 4IF6A 5HIMA 4IW3B 3PNYA 2ODEA 1XZNA 1BKYA 1KI8A 4BKOA 1HT1E 3ETEA 4Q00A 4D9JA 3Q2IA 4OU5A 3FAZA 4HLUC 3ZHXA 3KT3A 2JFZA 2X5KO 4HLQB 3PJDA 2FPPA 3BXXA 3CH6A 3MERA 2RJNA 4GZ5A 2ZIXB 1X7YA 1JAXA 3FF1A 4LSZA 4KR0A 2PAFA 2FWAA 5G0TA 1IEVA 3IOYA 2AFVA 3AF2A 4FYWA 4MP3A 4RJKA 4UUPA 4Y6QA 5DM4A 2HSWA 8OHMA 1E3TA 1F06A 1KEVA 1KFEB 1NBMD 2J0UA 1GGHA 1HG1A 2O9JA 3M1IA 3QXXA 1XRMA 4PRZA 1YNOA 4Q9HA 3RU7A 2GFQA 1XJQA 3RNLA 1Q1GA 2DH6A 4I9GA 5I9BA 4E2FA 3Q8KA 2AH5A 3UXYA 1A69A 3V33A 1YZKA 4INAA 4BNFA 4EX6A 3RJTA 2WTBA 5EHQA 3DAHA 3D5QA 4PYMA 2CVHA 4AZWA 4OLJA 5K0TA 2XQKA 2JLXA 2JGFA 2Z4SA 3A6ZA 3G49A 1XHEA 3BSFA 4R51A 4BRWA 4RXTA 4K05A 1G5TA 2IOFK 4ENVA 3ZQUA 4D56A 3FYCA 3O82A 2C7VA 3ELYA 3G8AA 3SEFA 1U6KA 3IC5A 2I67A 4LCEA 4ZAGA 4RMIA 1W1WA 2WV9A 3C43A 1M2NA 4NARA 3INYA 3GRPA 2CBGA 1IM8A 4J0FA 5A3VA 3H87A 3T3PB 1DJQA 3B2QA 3DNFA 2FZEA 2X7JA 5ALYA 2BGUA 5F7ZA 5C8ZA 1Z0JA 1V16A 3RLFA 2ZPUA 3IKVA 4DR2B 4ZCLA 1JR6A 4CGYA 3TIXB 1QG6A 4HDAA 1G7CA 1XYYA 2J9FB 2RK4A 2HQBA 4KODA 2HJVA 2PS1A 4OMCA 1MAHA 1XFAA 3BC1A 2OO5C 5ITWA 4ITVA 2J7KA 2G9ZA 1ONBA 4G85A 3AKYA 2IYEA 1CW2B 3HJTA 1CXZA 3M5CA 2V7TA 2O2EA 3EMVA 3G9ZA 3OURA 1J0BA 1V8PA 1ZLYA 4HGPA 4BNDA 1JFFB 3MGKA 2DBQA 1VP9A 4L3VA 4TPKA 1FNNA 3GLHE 1VLZA 2O8CB 3KTAA 9ATCA 2GERA 2MOKA 3B7PA 2XEXA 5CTJA 3RM3A 3NHSA 3T41A 5JJLA 5B2FA 1PL8A 5AVJA 2JGIA 1AUQA 3O3CA 4BEVA 3BD6A 5T6MA 5L8VA 3LSTA 1GFSA 1I4EB 3AKEA 3EZLA 3IAHA 4LZLA 3T5PA 4AO8A 5ELXA 2GXQA 4CMGA 3B3JA 1DIGA 1Q44A 5FORA 3FOAA 3U39A 5LOVF 1YB6A 1BCRA 4YRMA 2WTNA 2DWOA 2H4HA 5K8CA 2G0NA 2W71A 2BFWA 4B73A 3GH3A 4EFMA 4UDYX 4B7ZA 3PNPA 1TLLA 3UJPA 1OF1A 1NLMA 1FFBA 1O77A 3C5HA 4KZKA 5KVQA 1PR6A 2FUNB 2PZBA 2XTMA 2V7PA 3DKRA 5FUQA 3TX6A 1E4EB 3QFCA 3IQGX 5JRZA 1QIIA 1AD2A 3DBHA 1C29B 1IK6A 1KC3A 3FLBA 2QM3A 3HS3A 1RWPA 1UP4A 4ZEMA 4ZHQF 2PZJA 1AA9A 1AS2A 2A4MA 4DQLA 5FI1B 2H5JA 1J06A 4LY0A 1E69A 5E0OA 2NZYA 4ZHQA 3T1TA 2FSVC 1B3BA 5K99A 4BXOB 2VCEA 2VUTA 3Q7TA 2AXNA 3SQDA 2M6KA 4LJ8A 4CTKA 1JIXA 3CBQA 3DVRX 2XRZA 3R5JA 2PWPA 3TM5A 1UXKA 1DOHA 3FZNA 4AY3A 5HTKA 3WDMA 2WVJA 2WA2A 5F35A 4PTLA 1XPUA 3FPGA 3TRHA 1OKKA 1ZAKA 2B94A 4NZYA 3R3JA 4EPWA 1BD4A 1LI5A 2FZ4A 3H05A 4DAEA 4WLVA 2O06A 4GUAA 1U8FO 3BF8A 4YUZA 3ME5A 3MTQA 2UKDA 3OY7A 3I23A 5J1TB 2P40A 1Z8NA 4G8BA 3TL3A 5EJMA 3GLHA 4D9HA 4EO4A 1NVVR 2DLDA 3V8VA 2A35A 4EUKA 4QT0A 1Q7RA 2IS4A 1DEAA 3IDOA 3TIIA 4YROA 5L3QA 3FWKA 3AB3A 1JE0A 2OK7A 2QRNA 3P9IA 1PFKA 2ODAA 1XTKA 4X20B 5EIAA 1DBWA 3HJFA 3L8CA 1OBOA 4XD7A 4ZANA 2Z6AA 4ENQA 4GGMX 3EZYA 3OHPA 1QGYA 2P5YA 2O0MA 5AW6A 2PR7A 3FOFC 1E0SA 4R3UC 1WXEA 3DQZA 4J2HA 5FX2A 3WGZA 3QXSA 2WI8A 3BGIA 3LXRA 1B15A 2IP2A 1SUCA 2HTEA 2XDAA 1R50A 4B3IA 3TEMA 2RIPA 1AKYA 1QYXA 5MF6A 3E5RA 2HDHA 1MIOA 3F90A 3GJQA 3LA8A 5DV9A 2JCYA 1YFKA 1GO2A 1E7YA 3PKZA 4CMIB 1CUXA 2ZAIA 1NBEA 2J09A 2YBEA 4QASA 1H0RA 3H9BA 3PQCA 4NICA 5WRFA 1BVUA 3U9LA 4OATA 2C3YA 2GK6A 3GCWA 1KI7A 5EMNA 1BCSB 4JR2A 4L27A 1SCQA 3B1WA 5A5GA 1GNTA 1P0FA 3LKDA 3UBTA 3QWAA 3QXJA 4XGKA 4CEJA 4MRPA 4XDHA 2OLKA 4H1WA 1RJ9B 2P9ZA 4NE9A 4DG9A 1EWKA 3T9FA 3NWOA 2ODWA 4DZTA 3A6JA 1UFOA 5E3IA 1H1LA 2A1TR 3HWRA 2P0YA 1K4KA 1SUSA 3R7DA 3ZEAA 1NNSA 5JMPA 3F1LA 1KORA 2Z56A 2ID7A 4H0NA 4QDKA 2H4ZA 2H1VA 4DL9A 2M6RA 3MJRA 1SHJA 2OMEA 3LHDA 3UOWA 4CDMA 1R0WA 1JH8A 2GNPA 2R8PA 1QV9A 2DPGA 1HYGA 2ZT5A 5HX7A 1Y80A 2UZ1A 4PONA 4YO8A 4OFXA 5J40A 5LXTB 3PBKA 5K3BA 3W77A 1NU8A 2QWXA 2V58A 3QBVA 5I5EA 4YCLA 2G88A 3OZIA 1A4XA 1XVUA 2BDUA 3JXEA 4H4CA 3UV6A 3FWZA 4PFSA 3PPXA 3P0IA 1OPRA 2J3JA 1KSGA 2QJTA 2HM7A 2G28A 1N4AA 5L7TA 2WILA 1AK2A 2CD7A 3IQWA 4I4TB 4DLUA 1K7YA 4L1KA 2XUQA 4O6VA 5AW5A 3S5JA 4E6EA 3LL4A 1MTOA 1FLDA 3AYXB 3RUCA 4C5AA 3D0RA 3M1AA 4HDKB 1MJHA 4HYTA 3ZH2A 3E9RA 2GCEA 4NOLA 2P65A 2PQ6A 3NBAA 3A9RA 1YTUA 2AI3A 3C1TA 5LMZA 2ATXA 1BC5A 2YIMA 2ZRDA 4O4JF 3UN1A 2MINB 1PJ3A 2BEUA 3V1NA 5B7GA 5EKXA 4JELA 4EHJA 3G23A 2RKOA 4O4JA 2Q6KA 4QNNA 1IVNA 5I8PA 1XYGA 5CK4A 1XK7A 3D43A 1H6BA 3IERA 1ZSNA 4PSCA 4ZHSA 4I08A 2L17A 4GAEA 4IXTA 2JCVA 3NTLA 3L93A 1YRWA 2J1LA 3HHEA 1SXJB 1UDXA 1AK1A 1IZ7A 2EGGA 1NYRA 2HEGA 4KQHA 1QP0A 3F8TA 3ONWA 3L8ZA 1GWNA 2G25A 2V6BA 3DVQX 3I9FA 4QD3A 4DCCA 2BTEA 1YS1X 2Z8YM 5J4KA 4BUJA 1UBLS 1O6FA 2VHJA 4Q3AA 3W5AA 3A0UA 1RDFA 2V97A 3NPAA 3AIKA 3IQIX 2QUHA 1JLMA 1ULHA 1P7VA 2Y93A 4BNUA 3NHBA 4JBHA 4CZ2A 2ZI4A 4ZOCA 2AIRA 2YASA 4DM4A 1M5RA 4AZ3A 1DKOA 3HBFA 3F3MA 2KYRA 1R6VA 3LF1A 4MRSA 3JAKB 4Y2GA 1U80A 3HXLA 4P81A 4WCFC 3BDVA 4NYMR 4Z86A 4CI9A 4IO0A 4GLLA 4M2LA 2QSZA 1UKEA 3OIUA 2IY7A 1Z6YA 4QQNA 3IPLA 1TO6A 5JDIC 3EQ6A 3OJEA 1ZJ4A 2II6A 1U7TA 4H0CA 2BKXA 1KI3A 4HAOA 1AUOA 2ZUSA 3AIMA 3LKVA 2YMQA 2W6ID 4BLRA 2RH5A 4OGGA 4HNSA 4GECA 4ZOBA 1XCMA 4D3YA 5B6IA 2IYFA 5AK4A 4RHFA 4R05A 5CFPA 2ZBQA 5HQ3A 1VOTA 2X9GA 4BNGA 3KB1A 5TS3A 1QGOA 2JH8A 1UADA 1CEYA 4TKZA 3VA7A 1RU3A 1N4DA 5D1HA 2JAQA 3BB1A 3CGWA 3WLRA 1BVRA 1DDOA 4ZCSA 2DU8A 2WHQA 4HH4A 1R8SA 2A7QA 2A5JA 4ZQFA 3ZV4A 3E6AA 3IV7A 1XD2B 5MGNA 1ID8A 2RK6A 5LKAA 1UWVA 4JP8A 5IBPA 2RGNC 3MJFA 4EITA 5AW1A 2VP5A 4R8LA 4D4LA 1MABB 5ILGA 3FGZA 5IJ0B 3HFSA 4AUKA 5AD1A 1VSUA 1G3UA 4HYQA 5GQSA 2XADA 1F6DA 4JQSA 3EDYA 2QRVB 1KE1A 1VPWA 2W8BB 3R9XA 4O29A 3DHEA 4C88A 1UODA 3CX4A 1KIMA 2FSHA 1SVWA 3KHTA 4DYVA 2BFMA 2DQSA 3Q7QA 4FQ7A 4JLKA 4RFSB 1DC4A 5ULLA 3TSZA 3LT2A 1NASA 2DPYA 2J5BA 4R1SA 1XQYA 5GJWC 5GPBA 1N9GB 1Z4JA 2WQ7A 3CVYA 4TRRA 1N6NA 4IG9A 3AJ9A 4F1KA 4R8KA 1FPMA 3PX2A 3J81A 3MW8A 1RLUA 4MW4A 1Q1QA 1X8LA 3DWEX 3KSRA 2QYOA 3QLVC 4LCBA 3S0JA 1KWGA 2AG0A 1OASA 3EGDB 3PDWA 3LAWA 2D00A 5KTKA 5K3FB 3SGLA 4KKVA 3AEXA 4ARCA 4RCVA 4LHEA 4NBLA 5JWOA 2VF5X 5IUJC 4LDRA 3O9MA 3TEFA 4UTRA 2XYPA 1TIKA 4JWKA 3RC7A 1P81A 3ORQA 3AERB 4MCIA 1KSFX 4HNHA 3S2GA 3IIIA 3FUCA 1Y3FE 1JR4A 2CL5A 2YIJA 3FYHA 4IZHA 2Y6UA 3SLGA 4LNHA 4F04A 2CFSA 3C3XA 3GFVA 5DT9A 2A9QA 1PL0A 3LZDA 3KX2A 2KBFA 3HDGA 3WIEA 3TR5A 3RRZA 5G0WA 4U9UA 2P11A 1IY8A 2BMWA 1CC1S 1J1IA 3Q3EA 3W1EA 4BPRA 2R62A 4W7HA 4Y0NA 4JHLA 2RJ3A 4L9AA 2NVOA 2PKRA 4K2HA 2NVBA 1NOJA 2G4LA 3CPHA 3IBCA 3IT3A 2CHQA 3Q4GA 4L3WA 5FJIA 3PXEA 1UKZA 2FW8A 5AR1A 1E5LA 1YE5A 1ODFA 2IP1A 2PT5A 4LBWA 1QTQA 5EPEA 4TMTA 1ONPA 2ZBPA 2QTWB 1N3YA 2X8WA 3R09A 1OH5A 2Q3DA 1NJ8A 3I53A 4Z8YA 2HPZA 5DXJA 3USCS 4BNYA 2NUPB 4X60A 1Z13A 3RYTC 3QPVA 4E4TA 1Z75A 1TM4E 1BXRA 1X7DA 1M8FA 2ZRIA 3K35A 4TS4A 1MVOA 4NF2A 4CTNA 3E5MA 1J1UA 2IGBA 3SOZA 4CYMA 1J2JA 4WEOA 1LTKA 3G1TA 3FTCA 4A6PA 1I4WA 4E1BA 1Q1AA 4RM3A 4RNDB 1EUDA 1LH0A 1P74A 4M1OA 4GBED 2X76A 3WFJA 4ND5A 4Y2HA 3DO5A 4IOKA 4Q3DA 5FXMA 1AHIA 1EFPA 5LQCA 2JJ8A 4ALMA 3EW7A 1IVYA 1VIMA 3OZAA 4CVNA 4FS3A 4JZYA 4EUHA 4CM8A 1USKA 4OHMA 1NQOA 4L4ZA 1EP2B 2ES4A 3U7RA 1L4KA 2W8ZA 5CT9A 2JASA 3V1TC 1UANA 2IFTA 2IEYA 3OCXA 4OYHA 2BGWA 8AT1A 1ZD8A 5AXAA 1FC0A 1E3JA 3LUGA 5DOZA 4YR9A 3IVGA 4E46A 4MUYA 1JZQA 1IU9A 4DILA 1XMJA 2DP4E 4XWAA 3OJFA 4RD0A 5DBIA 2VTBB 2IH4A 5LP6C 2Q7XA 1JDJA 1YB4A 1UDWA 1G18A 4DSOA 1QO0D 2GLUA 3M3HA 2B7LA 2H65A 1FU7A 3ROKA 3ZLVA 1T5TA 2OECA 1J21A 4U1RA 2X4LA 1E2NA 5F4ZA 3GRKA 3RTGA 4YRKA 4G26A 4QRIA 2ECKA 5DN6D 4BMZA 1O96A 4UJ5A 1RCTE 5BNTA 1C41A 4HN9A 1FJHA 4MV9A 4TS9A 3VR5A 4QOJA 3TD6A 3TI9A 2AN9A 2QUAA 4PX3A 4IV8A 3RC9A 3T3IA 3BA6A 3KJZA 1PHRA 1GSAA 5DHAA 1HPLA 2X8JA 1I3NA 4N6GA 3Q9UA 1SFRA 1R5OA 1XAJA 2ZYHA 3FZGA 4JUIA 4MS1B 5IJXA 3SZUA 4B3BA 1BNCA 1O94D 4NP6A 3ZY3A 4K86A 4OI2A 3WZ2A 4AZVA 2XAUA 3KKEA 4NV3A 1AZTA 1SBCA 3H1TA 3A2MA 3SDSA 4DJFC 1R16A 1JLRA 1Z33A 3K71B 3A14A 5DT2A 1AJEA 5KEIA 4BMCA 3UCEA 3U4QA 3LLCA 3HB5X 4QVIA 2OV6A 1C9YA 3IEIA 4WINA 4UU8A 4LXYA 5TF4A 4AJ1A 2IHTA 2NZ2A 1RJEA 4U6QA 5EMHA 3WKDA 4ASUA 1REQA 2GILA 4Z1MA 4YMGA 3A10A 3I2GA 3Q8WA 3QBJA 4WA7A 3MQFA 3SYTA 4PANA 5ALSA 4DR6B 1SR8A 2YFHA 5BOVA 2VPQA 3KB2A 1EJ0A 3V4ZA 1GLNA 1GLGA 1Q92A 4L7QA 2FCRA 3OZDA 2FZLA 3KLPX 5CRIA 4QATA 4TKUB 1V39A 2O8FB 2HRCA 4N3AA 4R1MA 4WECA 4RVUA 3A06A 4BLUA 3M5DA 3QUTA 5DIZA 1EFUA 3U7IA 2B8JA 2I1WA 1KKMA 2BFBA 2H8GA 3QA3E 3ZV3A 2ZYWX 1IRIA 3MUFA 1WSWA 1KF0A 5ES4B 2NXNA 1LJUA 4DE5A 2HR1A 1JQ3A 1KZ7B 3PXUA 1KSHA 4AS2A 1VKOA 1Y8RB 2EWWA 3DV0A 1U4SA 1E1QD 1K86A 1ULSA 1Z5NA 4OMUA 3ZJTA 2VDMB 5GV8A 2N42A 3V3KA 2IUUA 5AVQA 3HXMA 4JN6B 4H59A 1W87A 3BXOA 5GGYA 3K0CC 1JYEA 4D46A 5IF9A 3INRA 1T2UA 3LX6A 4YJGA 2QRQA 3I5AA 3HADA 5LZ8A 3DGFC 1EK1A 3VNAA 1TK9A 4PLPA 1JG3A 4O4IF 4ETMA 1TYEB 2A9PA 2J59A 3EVCA 3WRXA 4JOBA 3N7AA 4RJ2A 4O4IA 4KC0A 4R2KA 1X13A 3FVQA 4RK0A 3WLOA 4CIWA 4EJ2A 5BSFA 4UEKA 7MDHA 3PNOA 1EQ2A 1JS1X 3GD5A 4RGVA 4B80A 1S1MA 3IPXA 1L4NA 1M3SA 2OCBA 5CH3A 1OLOA 2G6BA 4UC0A 5H82A 5EVJA 3VH1A 2EBWA 5JRJA 1ZMOA 1KOJA 4DSTA 1DEKA 1GNPA 4GRDA 3ROQA 2QN7A 1DEOA 3HWSA 4LDPA 2H59A 4EMSA 3ZWBA 6NULA 4FNMA 3AVVA 2ERCA 1PR1A 2H00A 1EZZA 1FRQA 2I4TA 3N0XA 4NJMB 3QVUA 1BH2A 1TAGA 3JWPA 2YX1A 5SYAA 3J80A 5TV2A 1DO2A 4IMPA 1L5FA 2QI9C 1KBZA 2P4HX 4MR8A 3SVZA 1B4DA 5TQ0B 1XTTA 1XWFA 3FNFA 3GEDA 3K94A 4FJ1A 3ZD9A 3W9SA 4QVGA 2IYQA 3H18A 1A8SA 2RFLA 3MS4A 2CDBA 4TWIA 1G21B 1TUIA 2ZYGA 3DBRB 3K6KA 4J7CA 5BR7A 2QE6A 4B6QA 1CUIA 1AHHA 3BXEA 4FEYA 5DNYB 3FLAA 2JCSA 3QVVA 4Q03A 1GDDA 3ROTA 5A4AA 3F7OA 4U0KA 3LQRA 4CCWA 2QLLA 1HRKA 1V1JA 3V8BA 5DI3A 2XNHA 4EF4A 1TPZA 3LQFA 4G5QA 4QTXA 3SS9X 1A9RA 1V1RB 3E2IA 4N54A 5EC8A 5AM2A 4YAWA 4MPPA 5BV8A 4IHJF 5HZGA 2EHDA 4QDZA 2LKCA 5BRNA 3U40A 4IHJA 5K3AA 3UB4A 1E1MA 2HY7A 4HYEA 4J76A 4JMLA 4L02A 2W2MA 3T4XA 2ZJYA 2V3CC 4OL0A 3AJEA 2ZCUA 3FZYA 4MA0A 1K8XB 1T43A 3H4MA 4G63A 4ALKA 2GARA 2QN3A 1BE0A 3ZWYA 3RIGA 3GC6A 4MEAA 1GEEA 3FWPA 3GW8A 5DB4A 1OFVA 2PQMA 4QLBA 4L0CA 2D74A 4CLHA 5BN4B 2VYCA 1WMAA 3T0FA 1DXOA 2O48X 4BMOB 4I6JA 1SH7A 3C98A 2VZEA 3ZNPA 3D0OA 4YEDA 4F4JA 3WSWA 1XRJA 2HMUA 4MPDA 2D62A 1GUZA 4YJHA 3NHYA 2X2FA 3R24A 1CIVA 2XVXA 3ACCA 3DSRA 3VO8A 4C1NA 5HK8A 1V2GA 4BQFA 4NPAA 3FD8A 2PZGA 4YBRA 3DMFA 2PMEA 2CNWA 2O8VA 3ZU4A 5AKZA 2J5KA 1ZFNA 2W6IA 5EP4A 3VVMA 1K8QA 2NXEA 1XQXA 3KEFA 1NXVA 3EG5A 4KBGA 2ATCA 1V3TA 2H57A 1BD3A 1KI9A 1FVFA 3H0KA 1WS6A 3WLSA 5I7UA 5AW7A 4HNTA 1Y42X 2FFQA 3AILA 4P35A 2VXYA 4PRYA 1YKFA 1MX3A 1K27A 4ZN6A 1GU1A 3LTNC 4DV4B 5L9AA 3K20A 4J0JA 4KDEA 4Z1OA 5KPJA 1DQZA 2GEBA 2OCAA 4BAGA 2VSQA 4DPKA 1GDHA 4MJ3A 5GY7A 1OH8A 1RKQA 2ADMA 3IIEA 4LSGA 2XKJE 5KJEA 1VL1A 3A4NA 3RFTA 3DE4X 3OPYI 4K26A 3TX2A 5FWNA 3A3KA 1XL1A 2DX7A 2C9CA 1WXXA 3Q10A 1J0DA 4IZIA 2FUKA 1CP3A 5M3BA 3EFOA 3IESA 3WOVA 1C0PA 2F62A 5CX1A 4A2WA 4XRGA 5KB3A 2X0EA 4W4TA 4MUIA 1CRZA 4KH0A 3RS2A 5B3AA 2IYLD 4RS4A 2G4VA 4EYKA 3EVZA 1YOVB 5DKFA 2YWEA 2JIPA 4HPXB 1PJBA 2AXEA 3VU3A 1I2DA 3GRUA 3FRIA 3L7OA 3OQBA 4WBXC 2LV8A 1NXSA 4FGZA 3UH1A 1CY8A 2NUTB 2ZJ6A 2AKAB 5KWEA 4AQ7A 1ZUHA 2H7XA 4ISCA 5AK3A 5DCLA 3PDHA 2QUIA 3TCNA 1W73A 1ORIA 2R96A 4G0VA 4YI3A 3P27A 2ZR9A 4P3OA 4ARBA 1EFVB 4Q1AA 4TKMA 1W2HA 3HBNA 2NZJA 4KXFB 2H9YA 2NM0A 2WPNA 3DCNA 3G7UA 4CMEA 3O8OA 3D54D 1HGXA 5JI3E 4D42A 1H85A 5B53A 3HUDA 1QRRA 3DOOA 1WW3A 4GXNA 2HQSA 2Y4NA 3OF2A 1XQVA 1CETA 2EG5A 3EHDA 2YV2A 3KT0A 4KFCA 2QU7A 3I6QA 1IHUA 4J3FA 4JP5A 4KQ2A 2NO1A 1A2BA 3CNOA 2ZIAA 1ZK0A 4MMYB 2GBIA 4NJEB 4JI0B 3LUBA 2EL7A 2Q4RA 4C0AC 3QH4A 2UYCA 3E3AA 1R12A 2IITA 1AXGA 3H1EA 4R7GA 2XMZA 4Y2UA 1FMFA 3CSSA 3R0JA 1ADJA 2PUFA 1DUIA 3QLUC 3VSCA 3LQ1A 2D5AA 1Z2OX 2VDOB 1FMTA 4F46A 3DV9A 1TZKA 3ITEA 5IAAA 2ZBEA 3PHGA 1NI4B 4P4LA 3GR6A 3I4FA 3RD5A 3ACDA 4Z9YA 4DA9A 4DG8A 4UUOA 4EYEA 4KUHA 3ZNOA 4G97A 2ZE8A 1OAKA 4C06A 4ICIA 1MX1A 3TTUA 3ZI4A 2XUZA 2GUGA 1EQAA 4QNMA 1OLSA 5CNKA 2Q4DA 1E5VA 1EUCB 4FB5A 4F91B 2F59A 1WF6A 7REQB 5HQTA 1E92A 3SZOA 2G1UA 6REQA 4L4UA 3NUZA 3ZGZA 2GWRA 2R751 4R4JA 2V3WA 3K4PA 3DL0A 1NF8A 3GVPA 3GJ4A 3H0EA 4K9LA 1UK8A 4IEIA 1J2RA 4MUFA 1FFXA 4HGOA 1Y8CA 1L8OA 2IC5A 1FFDA 3ZW7A 3D7RA 4L0QA 1BTOA 2GVNA 4HGZA 5HW0A 2AMFA 4ZWNA 5L6MB 3UG6A 3ONDA 1W30A 1KKLA 3IJRA 3GNTA 3IPCA 3LU1A 2VPTA 3ESRA 2X2PA 4EB6A 2ZUCA 5IJAA 4JP3A 2VSFA 5G41A 1RADA 4GVLA 4EB8A 4JBGA 1DFHA 1N1DA 1Q7GA 4PU0A 1KMHB 1ADCA 5IUNC 1G64A 4DPMA 4URWR 4XASA 3AUSA 3QX9A 1S2MA 1Y7LA 2J6BA 4MB2A 3AHCA 3VC7A 4DW8A 4YMVA 2V7XA 5BORA 4Q93A 3RSFA 1MB9A 5ITZA 1KOGA 3DBLB 5F1KA 3SC6A 4BO8A 5KJFA 4Q9DA 2CJWA 4GI7A 4J2TA 3ZY2A 3EZXA 1UMKA 3HZHA 4G8JA 3CNNA 4P4NA 4PYRA 2OZLB 4X95A 5H4HA 4DUGD 4DEXA 4TXHA 3RGWS 3P4YA 1N8NA 4JDUA 4IQ8A 1HXHA 1QO0A 1N2IA 1XV5A 1YASA 3NBMA 3G9UA 4LYFA 4RPGA 3DOEA 2OFFA 2W6MA 2FR1A 4K0RA 1M0SA 1F2DA 1MB2A 3L7AA 2VA8A 3DJYA 3PP8A 1ADFA 1CTQA 1SU7A 1X1TA 2ZROA 3EQZA 2AS0A 3OE4A 1KDVA 1GHTA 2DH5A 4TLEA 4LCJA 2V59A 4A0QA 2JLSA 3W9UA 2X1LA 1KWKA 3K6RA 3C5CA 4EDFA 1WY5A 5CA0B 1TA9A 3DE3X 4WH0A 2UZ0A 3PWKA 1QYWA 4M38A 4C0SA 1JHDA 2C2GA 2BFOA 3IXQA 4A8JC 1YZTA 4ZREA 3H16A 1WCIB 3UVEA 3M4NA 3QVKA 2YZNA 1XC7A 2HIHA 3M2TA 1Y9DA 4K9OA 4W5HA 5HVNA 2Z30A 2XQVA 4N65A 1L3BA 1YZVA 1Z82A 4MVJG 1JJBA 1L4FA 3V2UA 3WK5A 4YREA 1AE1A 4BFCA 4NLLA 2FRDA 3V4OA 2NAFA 2P6RA 4F4DA 3D8HA 3C3PA 3ZV5A 1X8XA 4RDXA 1DSSG 4M6WB 5HQJA 2CCJA 3TKLA 2PLWA 5CTAA 2XBMA 4MW7A 3HCEA 3V1UA 1J23A 4DVJA 3ADPA 4S1WA 1HO3A 2IOHA 2OXEA 2W2LD 4E31A 3TGPA 2DFPA 3U5ZB 2SECE 2DBZA 3REOA 3FM9A 5FRDA 5GAJA 1PVDA 3PIIA 1IXYA 2B83A 3NBXX 1JDBB 1ECGA 1YHNA 3NV7A 4JVMA 1IB0A 4WZZA 5KSYA 1YZLA 3HLKA 3EWIA 3RNOA 1PNVA 4EL0A 1QP7A 5JAZA 5FTLA 1F8YA 1RAHA 2Y77A 1FFYA 5KNLA 4FE4A 4D9FA 3VISA 1RYMA 4KXQA 3OA2A 3NRJA 3ZHZA 4WKGA 1PNQA 4D5GA 5JZ9A 3PFIA 2WB2A 5G3ZA 2WG0A 2QJWA 2JHPA 3VU9A 1JFRA 3VH4A 2PWAA 1PJLA 3BK2A 1M83A 3BJZA 2P6PA 3OPXA 5HFNA 3UWOA 3KWJA 1LXCA 2D2XA 1PSZA 2TMGA 2VF4X 4G56A 3GLIB 3U1VA 1QRDA 5PNTA 4RHYA 3W1VA 3TLKA 5C4MA 2WKWA 2PFKA 5IP5A 3QV2A 3REGA 3LY8A 5EIWA 2ZB4A 3CEJA 4CHGA 1M1UA 4Q21A 1SG6A 3LPMA 1B7GO 4OHZA 4CF3A 4OI1A 1R6XA 3FCEA 2PZMA 2XPCA 4IJMA 3EEBA 4NBVA 2OE2A 2I7TA 3FDZB 4JDPA 4FX2A 2VWQA 3RO7A 1BMDA 3A25A 4MUNA 1YACA 5KVAA 4IFEA 1BHO1 1OC2A 1RWXA 2ZRMA 5ER6A 1JDVA 3DFIA 1M5TA 1QH8B 2PX2A 4F56A 2ZP1A 4TM8A 3BX1A 4TSFA 4DLZA 2ERYA 1PW7A 1EESA 4WJLA 4MGZR 3H11A 4LGVA 4YIKA 5K7SA 4MWTA 2Y1FA 3GOQA 2E2WA 3HP7A 2DT5A 3LPAA 3QWIA 2HHHB 3NHJA 1UWKA 5HDQA 4F4IA 4IGAA 1SY7A 4IKOA 1ZNQO 5JS6A 2IBSA 3RAFC 2WWWA 3U0BA 3EGIA 1MB3A 2HEIA 2P5UA 4GR9A 4LHXA 1VMEA 2FYTA 4M88A 1TM7E 2D54A 3BTUA 3C7AA 4J4BA 4R1PA 1HMPA 3CTPA 5AHXA 5DX1A 1JFLA 3CEAA 4F6RA 2XQIA 4LI0A 2PXCA 2V8BA 2ZM5A 4Q3NA 1ZGAA 3O83A 2I54A 2O5VA 4PYJA 2A9FA 4DCMA 3FHOA 3ZJ5A 4AP6A 4EPTA 3IDQA 2C84A 1BKSB 2Q6LA 4JASB 4M1KA 4CM4A 3EOBI 2A8YA 3NI2A 4YJDA 2MSEB 3WWZA 1XPOA 2JJQA 3JQRA 10MHA 1BU8A 1S5PA 2Q3EA 2I91A 3R2JA 4WJKB 5BVHB 3DC2A 3ZZTA 2RAPA 1A77A 4MAAA 3NS7A 1TEZA 4YJ3F 4YRDA 1RI3A 3C7KA 4ZIRB 3FOEC 4JLVA 1SKMA 1JT2A 4YJ3A 4EPYA 2IQIA 5BOSA 3COJA 1DUVG 2C2BA 3EJWA 1KK2A 5ICMA 1Z35A 3D0KA 1G63A 1YA4A 3NHFA 5JANA 4KN9S 1JTVA 4KMOA 3DTNA 1RPZA 4OQZA 3E9EA 1NBHA 1YZHA 5FWXB 5ICSA 2Q9AA 3IQZA 3JYHA 3QU9A 3TH5A 2UUBB 3C1UA 1N2EA 3FVVA 3UCFA 1RLIA 1ZHHA 2OHJA 1YA8A 2V65A 1K0UA 1I9CA 3DXYA 4HADA 4IDCA 1XLUA 3B1ZA 5GJCA 5BO5A 3EIHA 1TK2A 3GFTA 3PQ8A 4QGHA 4UM8B 1PJRA 3NBUA 4QREA 5DK6A 1MW9X 5CVUA 2F64A 1YQ9A 2WF5A 1AS3A 1IQRA 5CR9A 3DV2A 2H4WA 4X94A 1GR1A 3T5BA 1WUHS 5C18A 2B78A 3FPLA 2QSJA 3CLRD 3SAJA 4V0KA 2JAOA 3ET4A 3JQBC 2E1PA 5F7JA 3RK4A 3UMFA 3KXKA 5CDYA 2B99A 4HDNB 4KQWA 4RD4A 4J9UE 2GOYA 3JWGA 5JYCA 1VMDA 1SHKA 5FBHA 3WMWA 1Q0ZA 2XCUA 1TAQA 1U6JA 1DQSA 2W2KA 3BF7A 3HY6A 1ZINA 4QEZA 3NWBA 2QMEA 1S8OA 4TVKA 1K9VF 1V1MA 3DVAA 4LBVA 1YRHA 4PSKA 3K1ZA 1JEDA 5CVEA 1XZPA 5K3CA 3UGQA 3EPPA 2SCUB 3BG5A 1R2QA 2G5GX 1GRQA 1ZSYA 2XB9A 3CUVA 3H6GA 3IVMA 2GEVA 3M8KA 4IXNA 4L5BA 4QAQA 5AT1A 3ZIDA 1X9HA 2QJRA 3OETA 4D4KA 4DC0A 3LDFA 3LCMA 1K2WA 1R9NA 2AFHE 1Z5GA 1HE8B 3ZCTA 2A1UB 4BZZA 3B3QA 2RC5A 3KUDA 5G4KB 3TNYA 5IULC 1Z4QA 4MVJI 2GLTA 2FCAA 2R1TA 4FZRA 2GTIA 1G9SA 1P62B 4BN0A 4P98A 3GT0A 1QHGA 2I62A 4RHCA 3WOHA 1YJXA 4MIKA 4FOTA 5DNDA 4DV5B 2GPYA 3I1IA 2XTNA 3UT5B 4YYEA 2G71A 2DFNA 5EN4A 2Q4EA 1BZYA 1J8DA 3RTAA 4W5OA 2FY8A 1NY5A 5FIUA 3VAAA 2RHMA 3LLMA 1P9OA 3L7DA 4GXQA 4MUGA 4XPIB 3O84A 5FWYB 1HDXA 4M98A 5L3VA 3UV3A 5B2ZA 5HTOA 1MNAA 5YASA 3ZV7A 3O4HA 4KDRA 2GCOB 2QVGA 1GPWB 4NVRA 4AKHA 3A1TA 1MZVA 2YRFA 3LBHA 2OGTA 2DBVO 4EJMA 1A98A 5BRAA 3K0FB 1E77A 1DKRA 1Y8AA 4HXGA 2EJUA 4KLRA 4GPEA 4BO3A 1QBGA 1E1KA 1MJGM 1WSAA 2PRZA 3R7WB 4ZVLA 5IKOA 1J20A 2BVNA 1D6NA 2R6FA 3VKFA 1Q83A 3IALA 3QYAA 3ZX5A 2PGXA 2JFNA 2ECFA 3DWGA 4Z9XA 3TW8A 3TUIC 2Q6VA 5E4JA 1QZTA 3MLAA 5E4TA 3H1AA 2Y8EA 3T99A 5C8YB 5CEJA 3H7AA 4PQFA 1FUEA 4B4UA 3FF4A 2ONYA 3CZMA 3O95A 2I7CA 4FOLA 4M4SA 5BWCA 1P6QA 1B43A 4DB4A 2G5TA 2QN1A 2ARKA 4Y2PA 3QPDA 4Q3EA 2BGLA 3KZOA 2E4XA 1TQ2A 3PGMA 3W9YA 4P53A 2JIRA 4O4HB 3ZQ4A 4Q1VA 3AVYA 5T4EA 1PUXA 1E6EA 1JL3A 1GTZA 2QTLA 3F3KA 2AFHA 4BKRA 3P0JA 1HEYA 2R1VA 1ZBQA 2COUA 3FKSA 3RFUA 1BDIA 1I6WA 3IIMA 1RRVA 1RQGA 1F2TA 1YO6A 3JZIA 3OZRA 4XVHA 1G6Q1 3GDWA 3PS9A 4G23A 1M6VA 1KFJB 3G8BA 1N2CB 3B2NA 2PS3A 3CYFA 3HN7A 1XE3A 3KLOA 3PA6A 1I8TA 1H65A 1NN3A 1U65A 2Q6OA 2FZ5A 4I55B 3JQ7B 4YGXB 1DB3A 3UNXA 2HN9A 4UVIA 4UPEA 1BVHA 2WQZA 4L5CA 3H86A 4ZJZA 3MJEA 1PEDA 2ETXA 2I4LA 2P62A 3NW9A 4LVNA 4QJIA 1ZHOA 1U2ZA 1T1EA 2VF8A 3IXMA 1ZI8A 3BQNB 1ZOOA 5HWSA 3Q9LA 3QNMA 3KQSA 2DY1A 4IFIA 4IFBA 5B7NA 1W8IA 3VZCA 1O94C 4C4XA 4GPZA 2ZJ1A 2R5FA 1ATIA 1B8UA 2NU9A 3PCRB 3WS7A 5JFTA 3AVPA 3T6KA 3DF9A 4HH1A 2D0OB 1KMIY 2FPGA 2HHJA 2O2YA 4GLFA 1L7QA 1VZ2A 4NFSA 4OK3A 1ZCAA 3FNRA 1KI6B 2PTGA 4JR0A 5BT8A 5TQ2A 1R8JA 1LEHA 1U7OA 4NQZA 2XT0A 2FRVA 5DYGA 1OD6A 1WD5A 2FN4A 5E3HA 1KEPA 3LE8A 4IQ4A 4FT2A 1E1CB 2N1BA 4G0OA 3EA0A 4LN1A 2OZPA 2H2GA 2PA0A 4I1RA 2R6DA 1TT5B 3MS2A 1TMKA 3OZEA 2GYYA 1A9QA 2HU5A 2V45A 2ZIXA 3RVOA 4KSBA 2BFFB 1EJ6A 3F8SA 3UMBA 1X7XB 1Y5MA 3C4QA 1SRRA 3FR7A 4FJ0A 2V5VA 4FN4A 5TF0A 3WK7A 5K0CA 1TRHA 1OT5A 3CBGA 6REQB 4RPCA 4B3XA 4I5EA 3OWOA 2UXBB 3FUUA 1H2YA 1U0RA 4H6WA 3G59A 4H31A 4A0GA 3DM5A 4E51A 7ADHA 2C4MA 3ZXXA 3ED1A 1TADA 4IF4A 1I51A 1JA1A 5G0UA 2V5UA 3OZBA 1NW9B 4RVSA 1JIQA 4C3ZA 3PUJA 4Z4GA 1E5XA 4G0QA 2AJDA 1KVQA 1NUSA 1K92A 3C3MA 2PLFA 2P75A 3DXXA 1ULUA 2JH9A 3KP1A 2ZSAA 1I6MA 3BIXA 3N3BC 4WIAA 1SVLA 3T12A 1HQCA 1UIMA 2Y71A 1SIWA 3U09A 5DXAA 4RH0A 3Q6NA 4AB1A 4IYJA 4G9GA 3I6IA 3Q11A 5T4FA 3MUNA 2W2LA 2ZB8A 5EJ4A 1EK5A 4UTZA 3ODGA 5F77A 3BL8A 3T7IA 4AM8A 2J9FA 1MORA 4OSOA 5B3JA 1WM1A 3IP1A 4AN1A 2AYZA 3O26A 1X15A 1JFSA 2QTNA 2XYVA 1B1AA 2ACEA 1EX1A 2B9VA 4ZRNA 4CU2A 1ZUIA 1T2DA 5LDGA 4JKOA 5ELMA 3BWYA 2OO7A 5BSGA 3K09C 1JFFA 1U7XA 2AI2A 1BYUA 4BWGA 2RI1A 3AT1A 2O8CA 1BOFA 3I12A 4A15A 2X40A 1H4VB 1UEJA 2J4CA 2VBFA 1RNLA 3OJOA 3R41A 3N2EA 3ZDRA 3JAWB 5KU7A 4H7FA 2MYNA 1SG0A 1IY9A 2EYQA 1E7SA 1YVDA 3P32A 2R00A 2YXDA 1Y3BE 4RADA 2HK9A 4TS3A 3I3SR 2OV2A 5D8DA 2MYUA 4LC9A 5DCUA 4CQMD 3UGTA 4AP9A 3NETA 4COKA 3IQXA 3FX2A 4K81B 3EX7C 4HTFB 5EAIA 4UOEA 3TINA 2IW3A 4RHTA 3LC0A 2ZI9A 4R01A 3UW1A 1QTNA 2X2OA 2EWVA 1G3QA 4EKYA 1WB5A 1TOAA 2NXWA 2AZ4A 2FETA 3KKLA 3L6EA 4V1CB 4Y1EA 1YI8A 1AKQA 1I3LA 4GVPA 2ZOSA 4RFLA 1LVHA 1E4EA 3HBJA 1XEWY 3IH5A 3I32A 3MAAC 2ZKIA 1ZQ1A 3EPLA 4D9CA 5J63A 4XLZA 4MQBA 3SU8A 1Z45A 5LD2C 3D6HA 4FGKA 1G4HA 1RWOA 4JVSB 1P4JA 2YJ4A 1P29A 5ALRA 3WP0A 4BECA 1SB9A 2WHRA 5JDCC 2PL9A 1OZAA 5B30A 3ESQA 3ETNA 5BSKA 2R6JA 1KEEA 2E5LB 1SUBA 2PSFA 4D3ZA 4ZVQA 2NTYC 3W90A 3ZHYA 2AI1A 2PN1A 4MINA 3IQEA 1G16A 1IHDA 3OA0A 3D0QA 3H5OA 1SVMA 3P2YA 1YK0A 3DUFB 3OPVA 4MLDA 5JXIA 3W6ZA 1PGPA 5ALPA 4TMVA 1Y6JA 5P8WA 2AVDA 1MF7A 3CX6A 2H6EA 3EVBA 3JQEA 4ZTUB 1FYFA 4CWAA 1LPAB 4JFRA 4I6EA 3L7YA 2ORED 4BOYA 3LYHA 4MHOA 3HNRA 4TXLA 2ILTA 5IBQA 4ENSA 1GZ6A 1XZ8A 2W90A 1PL6A 4G1VA 2BEKA 2CEAA 2ATVA 4ECEA 3PWTA 3V4LA 3EG9A 4L07A 4OLAA 1MRNA 4M37A 2ZBGA 3L4JA 1DCFA 4Y6RA 2D5LA 2HZ7A 4X20A 4A0SA 3GJ3A 5KX5B 1EDBA 3R8FA 3BIOA 4IVRA 4LXQA 1PR9A 3ZHSA 4KH1A 4RLQA 4PVDA 1AMUA 2HRDA 1NBAA 2I2BA 5LZ4A 1FTSA 3KJHA 1QAOA 1SKYE 3ZH9B 4CG2A 3MWGA 3WNQA 1KH2A 2Y27A 1SKAA 2A3RA 4EHFA 1MC1A 1G8HA 1W25A 3TQQA 1BE8A 1DI0A 2QEQA 3BGVA 3E3NA 3HRIA 1GA4A 1TVKB 4AD8A 1L7AA 3UW3A 2W22A 4CMIA 1GGKA 1IBMB 1CK4A 1PHPA 1XNRB 2F1OA 2A86A 4NDAA 3SIWA 2CB0A 3L0CA 2BRUC 2YV3A 3HV0A 1L5VA 3JYQA 3UGKA 2C5HA 2OWDA 5BYAA 3THYB 4OD0A 1ETUA 4MRMB 3RUPA 5ALEA 3SS8A 3QBDA 2IVZA 1BCSA 1G6HA 4UXIA 4XIJA 3UYKA 4DMKA 3E61A 4YMSA 2WZBA 3CHYA 4EB3A 1YU9A 1SXJE 2OUIA 4YUYA 2D0PB 1JG6A 1U8EA 1RJ9A 4L8VA 5IZCC 2JFVA 1IC6A 3C8DA 3Q7SA 4FR5A 4N8EA 4U5XA 4GMKA 1KR5A 1V9SA 2COEA 3GJ6A 4HEJA 2IU3A 4LHYA 3PZBA 2QIPA 3VAYA 4CFZA 3A6DA 1J07A 4DQUA 2MYPA 3WLEA 1KRWA 3J7AC 3BQMB 4CN8A 1MXHA 4FW9A 5JALA 4LK2A 1UJMA 4KIWA 1D2AA 4EEXA 1IJKA 4GBMA 1CE8B 3GIDA 2I78A 2J9RA 3B70A 3HU2A 4TMFA 5LXTF 5ALFA 5IRCD 2BGNA 4DCUA 2COKA 5LXTA 1EHCA 1SBQA 4UEJA 5G0SA 2OFXA 2I5PO 6ADHA 3R3SA 4D8XA 3K4QA 1ZJ6A 2I80A 4K5QA 3OM1A 1TB4A 2A9RA 4FCVA 1NVDA 3OZFA 4PQGA 3S1AA 3HDVA 5C1OA 1B93A 3H13A 3IULA 4I4TF 4WFJA 1Z88A 3P9XA 3TSCA 2ZJ4A 1SQSA 4PBSA 4BFXA 4I4TA 3NZEA 3F7MA 3O6VA 4HAVA 1SQ5A 4KKXB 4RU1A 1TVEA 5ECGC 3LD9A 1JEAA 2JIZD 1JEQA 3FVRA 1G3IA 4HDKA 4XM2A 1LC3A 2C5LA 2DUNA 5LA6B 3MWDB 4K6FA 2XJ4A 5J2TB 3WDSA 2AF3C 3OCZA 1E99A 1OLUB 2VK4A 4MYRA 1L5YA 3S8YA 3SIPA 4HEA1 5EQTA 2YXEA 1P19A 3OCYA 2MINA 5DTIA 3RC2A 1WZ2A 1LSUA 4Y9UA 2ZATA 1R9GA 2K2WA 3E1KA 4MJ7A 1UZNA 1YBAA 1FBTA 2NAPA 4OM7A 4WXRA 1R18A 2C4HA 3PFGA 4KOAA 5AXBA 3E9ZA 3U60B 3I2IA 2XNKA 5AHRA 5DYYA 3GPBA 521PA 2ZDGA 3T1OA 3VUEA 4AURA 2VDLB 1YCHA 3ZK7A 1P39A 1SHTX 1UWLA