1Q1AA

Structure of the yeast hst2 protein deacetylase in ternary complex with 2'-o-acetyl adp ribose and histone peptide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
285
Chain Sequence
TASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITTPQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the yeast Hst2 protein deacetylase in ternary complex with 2'-O-Acetyl ADP ribose and histone peptide.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
molecule keywords HST2 protein
total genus 96
structure length 285
sequence length 289
ec nomenclature
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 1q1aA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1q1aA01
4UUAA 4F4UA 1J8FA 3EA4A 4GP9A 1UPAA 2FR8C 2JLCA 4JT9A 4UUBA 4BV3A 2W93A 5EJMA 4RMHA 4KGDA 4RJKA 1U31A 5DEIA 4MPPA 1M2KA 5EJ9A 2H4HA 4ZZIA 4C78A 2Q5QA 2VBGA 2Q28A 1E3TA 4UTXA 1T9CA 2VBFA 4K9NA 1U2DC 4GM1A 4QQ8A 4V1CI 3D7KA 2OO5C 4FEGA 4JU8A 3GLSA 4KPUA 4BVGA 4MZXA 5EJ7A 5MF6A 3CLUD 4R8MA 1EFPA 2QQFA 3HWWA 3FZNA 1UPBA 1POWA 4C7BA 1V5EA 4F56A 2EZ4A 2EZ8A 2IHTA 4K9LA 3K35A 4Q9DA 5EJ8A 5K3SA 4I5IA 4JUBA 2NYRA 3D81A 1O96B 1ZPDA 4V1CB 2Q5JA 4BVHA 2WVHA 3CF4G 1XLTC 1ICIA 1M2GA 3FLMA 2JI9A 2OD2A 2JI7A 2PGOA 4TWJA 3FSJX 2JLAA 4FVTA 1T9BA 4K9QA 4Y6OA 3OE1A 1OZGA 2JI8A 1YC2A 3GLTA 4MPRA 4JSRA 1UPCA 2WVGA 5MFPA 1EFVA 2BRUC 1D4OA 2A1UA 5K2OA 1PNOA 2FWNA 4JD5A 4MPJA 2IHVA 4Y6LA 1N0HA 5BWOA 2JI6A 4IAOA 2Q5OA 3EYAA 3PDHA 4J1TC 3EY9A 4K9PA 4V1CA 2EZTA 2VJYA 1JSCA 4GPEA 5DGDA 4RMGA 1Y9DA 3F6EX 5FEMA 1BFDA 1PNQA 2FSVC 4BN4A 1Q14A 3GLUA 2C31A 1OZHA 4GG1A 5EJAA 2AG1A 2H2IA 1V5GA 2Q5LA 1T9AA 1PTJC 4GM0A 4O8ZA 2PGNA 2UZ1A 5D7NA 4COKA 3LQ1A 1NM5C 4BVFA 3JWPA 4UU8A 1V5FA 4QELA 2WVAA 4K9KA 3E9YA 2H2GA 2X7JA 3CLSD 4G1CA 4MQ5A 1MCZA 1PVDA 2H59A 3GLRA 2V3WA 3JR3A 5AHKA 5EJ4A 2H2FA 4UTZA 3PKJA 4D5EA 4X3OA 4FZ3A 1PO7A 4X3PA 5DGTA 2H4JA 5EJ5A 3CLRD 3U3DA 4JU9A 2A1TR 4K9OA 4JUCA 1M2HA 4QPZA 4BVBA 1Q17A 4TWIA 1YHZA 1S5PA 1YTLA 1YNOA 2EZ9A 2FN3A 1OVMA 2OORC 4ZP1A 4HDAA 5EJ6A 1YBHA 5MFZA 4JUAA 4RJJA 1MA3A 2H2HA 5BWNA 1YI0A 4KXQA 3RIGA 1OZFA 1Q1AA 3CLTD 2VK8A 4JUFA 3U31A 2DJIA 1Q6ZA 5IMSA 4IF6A 4D5GA 3ZGVA 4IG9A 2AG0A 3IAFA 2Q27A 2NXWA 3HWX1 4K9MA 1M2JA 5K6RA 1SZDA 1YC5A 2VK4A 4L2IA 1QPBA 2EZUA 1YI1A 1HZZC 2OD7A 5BWLA 1POXA 1DJLA 1YHYA 1U2GC 2VBIA 4JT8A 5FYQA 4UTRA 4BV2A 1O97D 1PT9A 2UZ1B 3IAEA 1M2NA 1Z8NA 2VK1A 4RMIA 3ZGOA 1PI3A 4UTNA 4FEEA 1U28C 5MGNA 2H4FA 2JIBA 4BN5A 2B4YA 1T9DA 4UU7A 2PANA 4JUDX 4RJIA 3PKIA 1SZCA 4UTVA 2QQGA 4RMJA 5K6TA 2OD9A 4GM4A 1S7GA 4BVEA 2FRDC 2IHUA 3ZG6A 3F6BX 4HD8A 3D4BA 4L3OA 4BUZA 1PYDA 2HJHA 4Y6QA 2Q29A 4J16C 2H2DA 3RIYA
chains in the Genus database with same CATH superfamily
2CNBA 1MX1A 2V7WA 5GADl 1QFMA 2I87A 3QXHA 2K6GA 5AQ1A 1PRYA 4DJEC 1KJYA 4M9SA 2WB2A 1UK9A 2XZOA 5B64A 3UW1A 2DBRA 3HA5A 2CUZA 1YVUA 5BOVA 3K96A 1JHUA 2Y3IA 1ECPA 3I5YA 1ZFNA 4ND8A 1CUXA 3B51X 2FR8A 4IGIA 5IDQA 1KQFA 3C3WA 2YYSA 1O6FA 5CDYA 5HFJA 1M6WA 1V5EA 2Z5GA 3P9ZA 4F56A 1TJ3A 1CVIA 3I2IA 4KQ6A 4O4JB 5L3RA 5ENZA 3WC4A 3HUFA 1E77A 1YTUA 3FI9A 2H1SA 1RLMA 3W3AD 3HO8A 4IOMA 1BCRA 3CF4G 3LXXA 4PIVA 3UHJA 3CVJA 3GB9A 1G0NA 4MITA 1MHPA 3GUCA 5LQNA 2C3YA 3TINA 4AUKA 4U2KA 1W8DA 4BNDA 5A4AA 2Y6UA 2YMQA 5BOSB 2C5FA 3CJRA 3KRTA 1NN0A 1YT5A 5MDHA 3BK7A 2J3MA 3HR7A 5E4YA 5EHGA 2Q6TA 4PYKA 3NGLA 5BSVA 1IM2A 1RQRA 3ED1A 1Z0SA 3SYRA 4KO3S 5EVCA 4WK6A 2ODBA 3P0EA 3O2NA 2H52A 2R5WA 2ZAGA 3WMEA 4M0EA 4JBIA 3OOWA 4W5WA 3C6MA 1P5HA 2AX3A 5I48A 1XWFA 1E5LA 1XVLA 2GM4A 1I2AA 1PEKE 4XRGA 4BU1A 2ISCA 1NZJA 3AGQA 3OX2A 4QELA 3L40A 2WJAA 3O8QB 4DY6A 2QN8A 5JQGA 1P9LA 3CB2A 3L6UA 1KNXA 1MC1A 3C5EA 4EY6A 4GMKA 5AI4A 4MWEA 3OHMA 3Q12A 3HN2A 3I72A 4MQEB 1V1MA 4PZLA 5IDYA 2XVAA 1I9CA 3R6DA 3KB6A 4D26A 2WWFA 3CKYA 1VOTA 4AZ0A 1TKAA 2VHZA 4FQ8A 4BMZA 2RIRA 3HP1A 3N8HA 1U9IC 3NRCA 1APBA 4UTPA 4ZZ1A 5JD4A 4XB6B 1YF3A 3TD2A 4WXEA 4NXNB 3M6WA 4AQ7A 1K7FB 4NS1A 1G8MA 1UANA 3M89A 1Y98A 5JYCA 5B6IA 4F46A 1GU7A 4RESA 1ZONA 3LUFA 2HH9A 4BX8A 2R6AA 2NXWA 4CTNA 4OF4A 1SIUA 1T25A 2BFDA 2QL5A 1E0SA 2AB0A 1E2QA 3FYCA 2C54A 4XTRA 3E5HA 4GBED 1JA1A 1RKXA 3VI3B 5JIBA 4RA9B 5FV4A 4R1PA 4C7OA 1NVEA 4AZSA 3QVLA 4WUVA 3OPYB 4NENA 1KYXA 3A1FA 1ZRSA 2HK8A 1COZA 2I3ZA 4QOIA 5JSFA 3M6UA 4LBWA 1WWKA 3IULA 3Q8XB 3PTZA 3V9PA 4B2YA 1TLTA 1U8TA 4JUDX 5AVVA 3FNQA 4N9QA 4TXMA 1Q15A 3Q5EA 4F60A 3E5NA 1BHJA 4PZPA 4GS5A 5IT9A 1I5OA 1VMEA 5H4GA 4O02B 5D84A 1MTOA 5ELXA 4ZQIA 3ZY3A 3VYUB 3PLAE 4KQMA 4BB5A 3MBIA 1KU0A 1AC5A 2A5JA 3AXTA 3ZWDA 1EGAA 1XXHA 2A9KA 3KOUA 2O8BB 1NMQA 5B2EA 1V1RB 3W3AH 3AUJB 2VUIB 5BRJA 2AMVA 2RGYA 4LYFA 5KHAA 1LV7A 1V11B 1TU3A 4QATA 5BV1A 4J2TA 4JV5B 4D4LA 2A6PA 3PXBA 1Z0UA 4IDHA 3PPYA 4UTXA 4OYYA 1GRNA 1PR5A 5D8DA 1W0JA 3CJTA 3GLSA 1SOWA 5L3VA 3L7LA 1DADA 2A5DA 1RMYA 3A3NA 2M1XA 5T5QA 3FZNA 4Q24A 3VPXA 4D3ZA 2XAAA 1LLFA 4LXXA 1S89A 4FSHA 2PUAA 2GWRA 1K8QA 5FDFA 1YNSA 3COWA 4S1VA 2VDLB 1TUBB 4IYRA 4HTFB 2Q3DA 4QNNA 4YRRA 4DXDA 1SRRA 3K0FB 5A3JA 3KK0A 3NVAA 4X1KA 3OZ7A 4XJTA 5FBHA 2PAAA 3UFBA 1JHRA 1XN4A 2W2KB 5FOXA 5C51B 3FY4A 4IIGA 2FK7A 1BXGB 1P4JA 2WMOB 5DT9A 5IVIA 4HAYA 4TRMA 4GU5A 5EHZA 1JYFA 1K68A 1QKJA 1HYEA 4TS3A 3U1BA 2GF9A 4M0FA 2Z6AA 3GDHA 3WGGA 2IS4A 2PS1A 4XCQA 2FX2A 3QF4B 1ECLA 4OYRA 3WTCA 4PO8A 4KODA 3NC4A 4KXWA 3U62A 1JHZA 3S1SA 2FPSA 4ZARA 1T5DX 1MHTA 4RVSA 2I76A 4QXQA 2J3QA 1CUCA 3REOA 4WCVA 4HDSA 4AJJA 2AQIA 5EIHA 4ZOAA 4V03A 4BVFA 1WIWA 3AUUA 4PWZA 4RH1A 1USWA 3REQA 3QYJA 3VJKA 2A9RA 4AY6A 2F3QA 3LLUA 3AHEA 3ZY5A 3ROTA 5IWCA 1R16A 2CLKB 2J5BA 4KU4A 2ZJFA 2C20A 3WFIA 2QLJA 2F2TA 3AVPA 1HWYA 3FOCA 4IDCA 4JUCA 1WXXA 4V0LA 5EE5B 3HDTA 2HLNA 4WT7A 3WV4A 2JLZA 1MAAA 1W4RA 1LW7A 1KZ9A 5DW0A 4IS2A 1GAQA 3FFBA 4CE6A 3GOQA 3I42A 1O1YA 3NNDA 3K3PA 4L8LA 3FBWA 3AERB 3H75A 2VSQA 3M49A 3NGMA 1G8AA 5K8LA 4GOXA 1NF8A 3P97A 5KTPA 4YACA 4CM3A 3M1IA 3TXXA 1TADA 2IUSA 3DDNA 5LC1A 3EZYA 5CNIA 5AVQA 1YMQA 1XV5A 2QKYA 1EVQA 2REQB 5CAEB 3ROQA 5KJ6A 3T9DA 1P45A 1GL3A 3D9QX 3MWEB 2AZ4A 3ZV4A 2C5GA 4KOAA 5KREA 3EGVA 2E4VA 3AMVA 1LJUA 1ONBA 1U3VA 3SZMA 3L02A 2EF0A 1Z74A 1HKHA 1NLMA 3EIHA 2Q7XA 4IVRA 1T8WA 1XAJA 1CY1A 2HTEA 2V0NA 2YC4C 1K06A 1G5IA 3MRSA 2HV8A 3O4HA 3CFYA 2JIDA 4N39A 1N2BA 3F9IA 3ROGA 4E2FA 3OQBA 5D00A 5LLTA 2WKRA 3ZXYA 2P62A 1KXZA 2FH5B 3KSAC 3ANSA 1UDWA 1RAIA 2IL1A 2Y27A 3ZWQA 4Q5IA 3L8HA 5BQPA 2WMDA 1SB8A 1V16A 1C14A 3JWJA 1AB5A 1SBCA 2MIIA 1K9VF 4K6MA 4LVOA 3K5HA 1JZTA 5FI5A 3CNBA 4GICA 4NJEA 3AY0A 4HNRA 1H6AA 3OA0A 3ICWA 4PSCA 3KJQA 3QOYA 4RD2A 5JPIA 3T99A 1KMNA 2ZRKA 4D6XA 1T5LA 1K5PA 2PWYA 3EG9A 1FLDA 4B6PA 1F2VA 2NU7B 4K3UA 2OZPA 4LQDA 1E63A 3HYRA 1WCXA 2XNJA 5D85A 4ZAFA 1OFGA 1T5SA 3N8KA 4UZSA 3TPCA 4ZDKA 5CVEA 1WKBA 4URFA 1EFPA 3R5TA 1AK2A 2EVWX 3IOBA 2B2CA 1P17A 4NMLA 3HO6A 2V6BA 4TLCA 3ZZ1A 4OL0A 4BVHA 1VI2A 3ZBUA 3FPSA 3NFRA 2AFHB 1JG6A 5CVVA 2OB2A 5TX7A 3W04A 4HNVA 3QOXA 2Q1WA 2O2EA 2WIBA 2II6A 4LQLA 5B4VA 3KETA 4KSYA 1ZCZA 2CL5A 2G9NA 4UUOA 3GEIA 1JVNA 2OXFA 3GJYA 3P71T 3UUEA 2X7XA 1RC1A 1AKMA 1G6Q1 3Q72A 4U9IS 4JBXA 4NG4A 1OGJA 1X8JA 4IFIA 3RQIA 1WVIA 4GKAA 5IBRA 2JGKA 5CFMA 1NVXQ 1A9SA 4EB3A 3M0EA 4JQCA 4ZO8A 3OQ1A 1JHPA 3MC1A 4GG1A 1ZJWA 2BCEA 3KVNA 3QRWA 4CT5A 4AY2A 1MGPA 4U1RA 4F5WA 4BE9A 1WPXA 1DBWA 3PSHA 3ZHXA 2UAGA 2V9CA 4IDOA 1U9JA 1NYTA 1KZYC 1NRIA 4DB2A 1DOHA 1OF1A 2OO7A 1WMBA 1E2UA 5COBA 1DJQA 3KUCA 1K0FA 5SICE 1Z68A 3GF4A 4RTPA 1Z6TA 4DIBA 2WJVA 3I2GA 1OAOA 2C7VA 2VRNA 3DL4A 3MIIA 4HAUA 4R0MA 1QK5A 5D5QA 4E3WA 2XTAA 4HFRA 1OVMA 2Q3CA 1N5MA 1USUA 3NP9A 3RJ5A 4B76A 1IVSA 4CV2A 1IZ0A 1HT0A 1ULZA 4JELA 2H2HA 5DXJA 3WK8A 1WCWA 3ENQA 3M83A 1GN8A 2QE7A 3BXGA 2R1UA 4JJKA 1ZOIA 4D9HA 4P3XA 3WGKA 1ZM4A 3JALB 2I55A 2VF4X 1RPTA 3EW9A 3O3CA 1ISGA 3QTBA 4CKBB 5KTOA 3FTDA 121PA 2OM2A 3IDAA 2R1TA 3BPSA 4MRSA 3UMCA 4RZ3A 2C4HA 3UFXB 3KJFA 4UHJA 2NO0A 4J7CA 5EUQB 4BZWA 2BM8A 3ERCA 1YHYA 3ND9A 3I62A 2XUHA 1RYYA 1LRKA 3BEOA 3H11A 3IBTA 4KLRA 1IXYA 3OH8A 1A72A 4F9FA 4Q16A 4RXMA 5L95A 3OURA 2VTVA 4Y0NA 5I7HA 1NAIA 3O2SB 4PQYA 1MD9A 1EK0A 2HF7A 5EPOA 1DEXA 3ZWCA 2JFZA 3JVIA 4J0FA 2QQGA 3EBLA 3EVTA 4R6WA 5EWLB 1E4YA 2WIDA 2BSAA 2NZWA 3LFHA 1E2FA 1GZ3A 2BOVA 2P2YA 2YJNA 4IVQA 4UCWA 5E8JA 5IVHA 2QBYB 1T2UA 1GPUA 3FMVA 1SXJB 5L4LA 1DAEA 3BCHA 4HCJA 3W6PA 2H7YA 2FN7A 5F51A 3BL8A 2DT5A 4B17A 2N75A 2DFPA 5HTKA 2Q4TA 1QH8B 4HN9A 3RI3A 1WM1A 4MR7B 3WKCA 4DADA 4KNYA 1Y0BA 3WGLA 4E5UA 2GBIA 3DEKA 2B21A 1JB9A 2D1QA 4UHKA 2NSYA 2OT3B 5HIIA 2YXDA 3NYRA 3PGMA 4Q47A 4DR7B 3WRYC 2YQ5A 1X7XA 4B7CA 5EJIA 1P91A 3IERA 4AFNA 2ZIWB 4M6WA 1V11A 3C45A 1O0BA 2BFPA 1PR9A 3QLUC 1Q7EA 4HAIA 5TPZD 4CMBA 4XYEA 5EAIA 3ZBPA 1GPLA 1WMEA 1P9OA 3TDNA 2MYNA 3LSYA 4HZIA 2JS7A 2BP7A 3SQLA 1M2GA 3U7EB 4G8DA 1C4XA 4ZD6A 3DMYA 3K05A 3Q2KA 2GF2A 3MYRA 1QU2A 3A6GA 5EKXA 2FPIA 4U39A 5HMLA 5LYYA 1NW5A 4A2CA 1WD7A 3HU1A 4FC7A 4MRMA 4RKEA 3PFCA 3T9FA 1VYUA 4IIJF 4TV9A 4D56A 3A9TA 1HGXA 2PMDA 4EPYA 3EQZA 3QM1A 5DGDA 2W6OA 4F92B 3PYXA 3A3YA 2VNSA 5F5LA 3AW9A 3ONWA 1BW9A 3T9BA 3SQXA 3U4DA 1MA0A 4B87A 3UXMA 3B1XA 3JWIA 4GLBA 4HB2A 1UOOA 1SG0A 1Q12A 5CGQB 1CHNA 1C9EA 2H1IA 4GR5A 2GJSA 3U3JA 3A4TA 3CLSD 2OESA 4O2BA 2ZIZA 1JBEA 3U4CA 1O94A 4H27A 2I78A 2P8JA 4O8CA 3IL2A 1CS4C 5G4KA 5B3KA 1AM4D 2IGBA 4BMYA 4WEQA 4K9RA 1HLPA 3WLOA 1VSUA 4D92A 1Q2XA 1YTLA 2WUWE 4WWHA 4EHHA 3QBDA 4WY2A 2HTFA 1IY2A 3KJHA 2HHAA 3HCWA 1F17A 1DLJA 4XB2A 4EJ0A 3ABZA 2WTNA 4II7A 2O8CA 3K9NA 4YMSA 3UICA 2ICAA 3V5NA 4QUHA 3EOBI 3GLKA 5IJZA 5BRNA 5M29A 1P2TA 1X77A 1Y1RA 2P5UA 4PVDA 1PLKA 2Q5HA 5J40A 3UWOA 1UT6A 1J9GA 1XP8A 3LPNA 4AROA 1SKYE 3FOZA 2VN8A 4H7HA 4B3DA 1NAHA 1XNJA 4DAOA 4DV4B 1HV8A 2RHDA 5BURA 5AM0A 1XTIA 1WW2A 4OCZA 1AKNA 2CMGA 4WCFB 1O97D 3OIVA 2QJOA 2QL7A 2XF2A 3QUBA 3QVUA 4S0XA 2OA0A 2BMJA 3C8DA 2CK3D 4HNHA 3T15A 4PVCA 5ERXA 5BN5B 5KOJA 4MYDA 4A8JC 3UWDA 3MT8A 5MGNA 2ZU6A 1CUZA 2I6XA 1Z4QA 2C9CA 2YVLA 4PG8A 1HI9A 5KDLA 3K0SA 4YO8A 5ICCA 3BL5A 3WP0A 2NTEA 1FS5A 2P27A 2WJPA 2XB6A 5FF9A 3H1PA 3IC5A 4B3FX 2FSPA 1SXJE 4MDEA 2FSIA 1CETA 2VDRB 5CVTA 2FRDC 1D6JA 4KO2S 1HFKA 1UKAA 2WPDD 4ZI7F 3T38A 5K1ZA 1EEHA 3ZDRA 1YB5A 3GFOA 3EC1A 4FYMA 2AYXA 4MAFA 1QIKA 2ZBDA 4XXHA 4YQFA 5I7FA 3HCRA 3OTWA 1PWXA 4GXNA 1C7RA 4ZCMA 2OQRA 3CZAA 4KMSA 4RADA 1E9FA 2JLRA 2TECE 4KWCA 2I3GA 3JYHA 2R9VA 3O03A 4OKIA 4XIIA 4Y30A 5GONB 1L5FA 3GHYA 5KCMA 1LCIA 3AJ9A 4ZYTA 3ZHOA 4DW8A 1T9CA 4K86A 4MUNA 1KK3A 1TKRA 2Q6LA 1M8GA 3EX7C 2OOSA 1N5KA 1H8ED 2C88A 3LC7O 3R6LA 3I5XA 1F7VA 3IVRA 3FWZA 4FGZA 3COJA 3OT5A 1SKAA 1TX4B 1U2GA 2C2GA 2G1AA 4XSHA 4F5YA 5CB6A 1VP3A 3MS7A 2JA1A 4C0KA 2I6FA 1XD2A 2HDNB 1H42A 1NXXA 1DS6A 2ZCVA 3HLKA 2Q0SA 3D81A 1UBEA 1WULS 1W0KD 2FSUA 3H11B 1NJ2A 3IT1A 4OQZA 3SYLA 1R8YA 4LSMA 3LY8A 2VNIA 3I09A 2ODQA 1RC8A 5JSHA 1COWA 4ZAYA 1M8KA 4H7KA 2Y1GA 3E1SA 4FHEA 4X5OA 4ZODA 5TEVA 3WWPA 4EJMA 1OTHA 3B3AA 4R8SA 4G4SP 4ME6A 3QIAA 4F93B 1W4BA 4ZV9A 4QOSA 2PH5A 2PR7A 1XZMA 4TTVA 3KHSA 2QBYA 1L5ZA 1BQEA 1NRXA 3L4BA 3W8EA 2I6SA 4A0SA 4KR3A 2HSEA 3OEHD 1JFFB 3C3PA 2YMMA 3X44A 3MMSA 2A4KA 2H2IA 4GR9A 3T5CA 4M2LA 2ZE7A 1ZD9A 3OU2A 3ZWMA 4DCTA 4ZI5A 1OZAA 3KQSA 1OYWA 3AESA 3W7VA 4GNRA 1KGDA 4H7EA 3F5FA 3ABIA 3HKEB 5EE9A 3WV5A 1Q19A 4JENA 4YMIA 4EJFA 3V8EA 5AIAA 3AFGA 1TCBA 2X2PA 3IKJA 3FVWA 1UKVY 3ZY6A 2GXAA 1QHYA 2X5KO 4MKGA 2Q4RA 3HKEA 3PFWO 4AS1A 2EU8A 1NVFA 5AI0A 4MGIR 1CZLA 2ONJA 2DWOA 4Z9YA 4XX0A 4GL4A 4W9NA 1RBMA 4S04A 2N1MA 3U4IA 3QVGA 4LCJA 3RYTC 1BE0A 3PX2A 4BVJA 5DK6A 4KK4A 4RIEA 4O1MA 1JNYA 1Q7TA 1KFCB 3ZIDA 3I6MA 3QEAZ 4AVYA 4B4DA 5KX5A 2O5EA 3AB3A 1IVNA 1QPBA 2CWWA 5HF9A 1F2TA 3A9WA 1LBTA 3FE2A 4U5QA 1HZZC 2OG1A 3E15A 3QU2A 3H4TA 2KPOA 1ISSA 3WQQA 1IC6A 5FFFA 3WO0A 3A58B 3ZYCA 5JS1A 4QNRA 2NT4A 3SE7A 1R6XA 3L0PA 3I12A 4J1NA 2GD6A 4CMEA 4YAUA 5C1OA 1MO4A 1P0CA 3KBOA 4RIFA 3TGWA 3D3NA 1I3MA 3GBSA 1QRTA 2PX2A 1LX7A 1YZQA 3D6HA 3JRXA 4CG0A 1BXKA 1HOXA 2BKXA 5ITZB 2AFRA 3H8WA 1DTEA 2O0KA 1NW7A 3LO8A 3QGMA 1RM5A 4FGSA 4KE6A 1XZ8A 2P68A 2GBGA 2O1WA 2PPLA 3DLAA 3NTXA 2Q29A 3QE0A 5ESDA 1LI5A 5BQOA 4CIWA 1RRKA 2XXAA 1DTWB 3U9LA 3RVPA 1FZQA 1BQ4A 3HO1A 2IUTA 2XE4A 2OVBA 3GOHA 2MINA 4G0UA 4YRAA 2PYDA 1KU6A 1M3SA 1T6YA 3A6FA 4CTOA 3TQRA 5DBOA 4Z9FA 2AOVA 2WI8A 2XUKA 5LJIA 1XLWA 3FKSA 5H4HA 5JCOA 2K87A 2JAWA 4EKEA 4BE7B 1A50B 2YJ4A 4BRZA 1Z35A 1KDTA 4PYMA 5BUZA 1ZGAA 1YE3A 4PTZA 1Y7HA 2OXRA 4NU0A 2QY6A 4P83A 3AR7A 3CA8A 4DJFC 1DX9A 1YR1A 4UFOA 3MFQA 2VK2A 1U1GA 4LZZA 4RDCA 5EZYB 3RIMA 3KUUA 4XLZA 5IJXA 2CHUA 1YU9A 4A8HA 4AMZA 3QE2A 2B6HA 1YONA 2QVLA 5ALJA 5KOJB 1ZKDA 4S2UA 3AF6A 5BXYA 3TRJA 1RYNA 1HNWB 4EX7A 2ANBA 4EQ6B 2VZ0A 2GKOA 3MLEA 4GI1A 3EJWA 2VYVA 4M38A 3MHTA 4LTMA 3CRNA 4LNUB 2HXYA 1VGVA 1FDRA 3PEUA 3NANA 4P34A 4JIGA 4TLBA 1QYRA 4K9PA 2PX8A 5JVDB 2VJMA 4FU0A 3ZE8A 4DSNA 2XB4A 3SLRA 4X44A 5IPFA 1HK7A 2ZYRA 5ES3A 4DLTA 1NJ5A 5SZKB 4BQSA 2ZE5A 4TQUS 3B3GA 1Z34A 2ADMA 3E9MA 1X3LA 4R7ZA 3U3ZA 1KYTA 2P4QA 3DHWC 4H4DA 1PL8A 3CU5A 1NLZA 3F8TA 3V8RA 4YXFA 3K72B 1OCEA 1Y3IA 5JZMA 3FB4A 3GGGA 1F8UA 4TV9B 5J4HA 4AP9A 3TF5A 1K7SN 4RCYA 1A82A 2VAWA 1PQ4A 3KZKA 1OTXA 4HEA1 2PU7A 2XLCA 4XCXA 4RUKA 3W3AA 4DSTA 4WZZA 4IKOA 1HG0A 1GTSA 3FBGA 3EVZA 1XQWA 2O6LA 4O2BB 3EXFA 3QY0A 4QPCA 2R66A 2AVDA 2CZGA 1VKOA 4KIUA 4M1SA 1C4OA 1EK2A 1J2UA 3LFUA 2SBTA 4MLDA 5IYZF 5BSUA 4A6DA 4EG8A 3LUCA 1KQ3A 1T13A 6REQB 1C3XA 5KQPA 2ASVA 3VV3A 2QW1A 3F90A 3E8SA 1XNRB 9MHTA 3BXXA 4H3HB 1IUKA 2WYIA 2XTZA 5HYVA 3QJYA 2ZREA 4ZXPA 1JTEA 2FQ1A 4CKWA 521PA 3IP5A 5ARDA 1YJXA 4UXHA 3IQWA 4RJLA 5HHTA 1YDWA 3KQUA 2O7NA 3OZBA 5CDSA 5KJFA 3G7NA 3QOWA 2HU5A 4Z9BA 3CT6A 3A1UA 3OOYA 5ED4A 1KEZA 5E1BA 3GW8A 4DR4B 1YA4A 2JFGA 1OE0A 2OGSA 3EXG2 4TUYF 3C3DA 2VPWA 4PYLA 4F1KA 5LKRA 3TIXB 2IJGX 3VSDA 3Q3CA 2JK0A 1LJ8A 5AKZA 2WYHA 1K6JA 1N92A 1RAHA 3RTEA 3ZK7A 4PSVA 1XZFA 4IIBA 3KE8A 4TT3D 1RBQA 4C30A 4C7KA 1RXWA 2QRMA 2VPYA 2D8AA 1ADCA 3OZEA 4XVRA 5FLYA 1OX6A 4BDSA 1XR3A 1E5XA 4LYHA 3MELA 1O8BA 4RCVA 1OLUA 4V3BA 1FX1A 1MABA 4MDHA 5JDIA 2Z6UA 2GN4A 2P35A 1I2BA 2GA9A 4PBRA 5JALA 4BJ3A 3E48A 1HYQA 4MUIA 5G1NA 1W36B 2FPPA 3GZNB 2GAAA 1U3UA 1Z2PX 3B2EA 1UEIA 4LZNA 5CT5A 4N18A 4Y2JA 3KKOA 1LK0A 3PJRA 1PGQA 2MSDB 4LZLA 4EVIA 1AKWA 3PIDA 3MTJA 5DYWA 1QYXA 5HMMA 4C05A 3DLCA 4YUZA 2YWFA 3JATB 2YJGA 5AOAA 4EIWA 3FHCB 4JJGA 5LP6B 2I54A 4IJMA 4K81B 2DJ5A 4NNJA 3UAXA 4CV1A 4BMSA 4F2DA 3A27A 1B76A 3QTLA 4ZJPA 2ETXA 3WA6A 2FV8A 2QI9F 2BEWA 1NFQA 3QPUA 4JI8B 2Q50A 4FQ7A 4IMRA 2FPLA 3N07A 1VDMA 4M49A 3G1WA 4PZCA 5F1PA 5C4GB 4DPLA 1O9HA 1UMBA 1IN7A 4RTSA 4AI6A 4A6EA 3S2FA 2RGUA 2ZRFA 1A0OA 3LOUA 5FFNA 4RK6A 3K2QA 1Y3FE 4QUKA 1E6WA 2X8AA 3B1YA 3LCMA 4UM5A 3CVWA 3MGAA 3ESCA 2HCFA 4D1YA 3HL4A 2EG5A 5C0OE 1IZZA 1VLHA 4F5DA 1CXZA 3GJ7A 3MWJA 2GLUA 3ZY4A 3KYIB 1EP2B 3L84A 3R3HA 3MGKA 1GPWB 4E30A 2CSXA 1OZHA 1V2HE 2WD9A 3UXYA 1ZD3A 3S2UA 3IIEA 4E4RA 2IZ0A 3FTEA 3P5BA 4UAJA 5EZQA 1J90A 1W0JD 4I1VA 4L07A 4I3GA 1V1MB 1BU8A 3U7IA 3D0KA 3DVLA 1QCYA 1ZM2A 3HCDA 1U2TA 1UPTA 2O1SA 4LI3X 4LKOA 3VQTA 3OM1A 4FN5A 4L8FA 2QUZA 4CXMA 2B94A 1PSZA 2PK3A 3NAGA 4C0XA 1XLVA 1R10A 5K0FA 3JR3A 1XA4A 4WW0A 2IS2A 2YXBA 2H2FA 3D5EA 3DBVO 1S4MA 3HVHA 4UE2A 2H9YA 1C1YA 4OFBA 1IB6A 4JLWA 4JSYA 3PGKA 4M9ZA 3P27A 2EHJA 1ILEA 1KL7A 5BR8B 2ILVA 4MJ3A 4QUDA 3U3XA 2FPOA 1JEOA 2W4QA 3LX8A 2O4UX 4G8JA 2J45A 2BRUA 2RBKA 1WVMA 4OH1A 2XMPA 4XUEA 5SZJA 4CM7A 4Z4CA 3WWYA 3DZFA 3IPAA 2OKCA 1ZNYA 3QX9A 5LWHA 4IF6A 2OC4A 4W82A 4JFRA 4X9XA 2H5LA 5HP4A 4B6JA 2DQZA 3ND7A 3BGSA 4JJIA 2W2XA 5BV0A 2XITA 3X2SA 5JVDA 5BWLA 3KIPA 4EA9A 4C6HA 1TQ4A 4DDUA 4JC8A 1FMLA 3TKLA 4YCCA 3L1IA 4KFUA 3UT6A 5KHOC 2BFAA 3ZX5A 3UJ7A 3DMDA 2Z2JA 2IBSA 1E4OA 2EW2A 1CWUA 1MB3A 3HWSA 3PHGA 1QQTA 3ANMA 5IKXA 1Z3IX 3FAKA 2JCXA 4NFHA 1WUKS 4OV6B 3SHVA 4IO1A 3KR9A 4WUTA 1ESCA 5CIWA 5CK5A 5EUBA 1ESMA 1V3TA 3HQ4O 3GEPA 5G1OA 5IAJA 2E5LB 1KH3A 3QU9A 2PH3A 3IAM1 4MV9A 4OAOA 5KWSA 4X62B 5E0OA 3HABA 5DGCA 1W0CA 4WOJA 4BVLA 3LX5A 1D1PA 2ODTX 2H4ZA 3BA6A 3FOAA 4HAZA 1NBMA 4YRFA 4BJHB 4JC5A 4Q66C 1FL9A 3OWOA 4QSMA 5AKXA 4FMCF 4DDMA 5CVDA 3DOUA 5JSKA 1QGOA 3QBEA 4A36A 3S7TA 5GIOE 2R6CA 3FNEA 4BMPB 1AY0A 3AUXA 5C5CA 2YWBA 3GHHA 3LW7A 1WY7A 4MUJA 1PX0A 1TC1A 3NEAA 3TW8B 5E2BA 4DRYA 2WM8A 3NETA 5GJVC 3REGA 4EB6B 1BAPA 1J0AA 3ZWPA 2QY9A 3VOSA 3PDUA 3PNLA 1QGED 2H0RA 3LCJA 5KQMA 1JQJC 5TE9A 2IFTA 1DELA 3BCRA 1DKPA 1ULUA 3OCZA 5I8ZA 2OQVA 2J32A 4F4CA 3OQNA 3HUDA 3D0QA 1C3JA 2HDOA 2WHRA 3PUYA 2GJAA 1KYIA 3K31A 3R9KA 4BQNA 4C01A 4ZOEA 2AR7A 3HACA 2ID8A 4WX2B 1HQKA 3HJRA 4KAAA 3ZQUA 3C1TA 5GM2A 4ANFA 3DQZA 4PAGA 1X39A 3S8EA 1ISPA 1GZ5A 3KEOA 3PEFA 1GU0A 4RLHA 4GD3Q 4BO9A 4J0EA 5K2OA 4FYJA 1XTPA 3DAOA 1P8JA 4YMVA 4AJHA 1DDGA 1WXIA 4CCAA 1UK6A 1BMQA 4OHZA 4IGAA 4WGGA 3O4RA 3RHZA 5I8PA 1RDFA 3H1TA 3EIQA 2RJNA 2W6QA 5DSZA 4RCZA 4E11A 3DNFA 2QMUA 2F64A 1DAPA 3VTZA 2A5FA 3JZMA 1YOBA 1GDDA 2C58A 3LKZA 3WHLA 4F21A 2DUWA 3PENA 3PFBA 3ZWBA 3WAGA 1YJQA 3IUJA 4CM1A 3PFGA 2CFCA 1HLDA 3JD4A 1A7KA 3O94A 3I0ZA 1XHLA 1NV8A 5HF5A 3GLRA 2EL9A 2IEGA 1V5WA 5JCJA 1THTA 1LD3A 4X3OA 2XYHA 5EZ5A 4EG4A 1NFFA 2OHHA 3OP1A 1JJVA 2ECPA 1Z5WA 1O9BA 1TF7A 2A1TR 4KN8A 4LNAA 4FT2A 1L7RA 3RSHA 3N39C 2PQ0A 1S5PA 1T10A 2Q4OA 4HRYA 2NVUA 2ETVA 3MTAA 3DLIA 4GI2A 2ESRA 5JQWA 2VEOA 2XIQA 2F3PA 4JVSB 4N6OA 1GUYA 3DB2A 1I30A 3RARA 3WBKA 1XMOB 1AUPA 3QSGA 3SS9X 1RE1A 1KDOA 3OEYA 4DLXA 4U9HS 5KNCA 4JX9A 1X9GA 4E2YA 4WLNA 5IKEA 2CXRA 2JFNA 3KYBA 1IHOA 2Q6IA 1U4SA 2RG1A 3ILSA 3LPLA 1LVUA 4A6PA 3H17A 2HD4A 3T06B 1M34A 3LBYA 4EGCB 1ABEA 1Q6YA 1EJ6A 4UPEA 5KKCA 5G3ZA 4D3DA 3GV0A 4JASB 5TR9A 1FTYA 4JUIA 4LRWA 4QRIA 3RYIB 3W2IA 2GS9A 4D0GA 3U13A 2P1RA 1RAGA 3ORQA 4CMEC 4EJ2A 1WY5A 4ZYYA 4MO9A 4LFAB 3I1IA 3GO4A 4IJ6A 4KUEA 2VL7A 1KEPA 3FYUB 3U4HA 2C9ZA 4H31A 1D0VA 1DAMA 3DL7A 4BNGA 1CJSA 2QSZA 4QKQA 1LS6A 1SUAA 1Z5PA 3QG5A 1O9GA 2EKDA 3ZQ6A 2I1LA 5CFOA 3QF4A 2VQFB 4G0WA 4IDQA 3L3BA 3LQRA 3RS3A 3JRNA 4IJVA 3B1KA 4N6NA 3ST7A 3TLZA 1M2KA 1SIOA 9GPBA 1BG6A 4TL6A 3RUIA 3PIIA 1ZNWA 5JBNA 1W88A 3MD9A 3NRBA 5GV8A 2X1MA 5HRAA 1RJWA 3ZHBA 5GP1A 4ARZA 1KWKA 2BGKA 2JDID 1I2ZA 5BN5A 1YFJA 2B7LA 1UQRA 2YQ4A 4KRXA 2ILTA 2F8TA 1UODA 2FK8A 2P90A 2GM3A 5TQJA 4DV5B 4LWZA 1GFWA 2FF5A 4DDWA 5DI3A 2FPPB 1VPTA 3AFOA 2J48A 2FUKA 3F5QA 4OJNA 1HF3A 2XWQA 2YWJA 3H97A 3I39X 2OFXA 1P2VA 3RVRA 5A4FS 3NRJA 5DNVA 4N3NA 1XCBA 1TECE 5KTTA 1KWGA 2BGGA 3KD2A 4WMLA 5E6UB 5F64A 5TT1A 2Q6OA 3ZEIA 1ZK2A 2QDXA 2XADA 2YY5A 2C5EA 4CMKA 3DBRB 2JHGA 2ZCJA 4CM8A 4AWXA 2GXSA 3B7GA 5CYOA 3C6YA 4Y2YA 5I45A 1EU1A 1T3LA 2QNRA 4C2UA 2HBRA 3W90A 1YRWA 2CXSA 2VIIA 1L1EA 2FUG6 2OM6A 3DBHB 4BAGA 3RYCA 2F7SA 1GU1A 4NZZA 1FTWA 4F1WA 1LY1A 1E1LA 3STHA 1QYWA 4BLSA 2HMWA 4B3JA 5DCUA 2EIHA 4YDQA 2Q99A 2VQEB 2HSWA 3OMXA 1ZGBA 1N2SA 2V7VA 1IY9A 1ADJA 1G17A 3FVQA 1XTZA 3Q8WA 1SELA 4NK5A 4BOYA 1ZU5A 1I6WA 5FBWB 4Z86A 2OR3A 5H9VA 1FS6A 4WIAA 3IKVA 2FQQA 3DEZA 3KJNA 2O5CA 1OXBB 1JEAA 1VYHA 3KZCA 4JOBA 4B80A 3B5EA 2ZRJA 3V1YA 4D7AA 4U8GA 3NH6A 4QSHA 3AY3A 4BO5A 3H4VA 5JTUA 5TMPA 1AUXA 2R6FA 2WD7A 4K46A 5J43A 2R6JA 1ZSNA 5LQDA 5F2EA 1AMNA 2G07A 3SC6A 1OYVA 5C5DA 1PQYA 3JQAA 3CZ4A 4W7HA 2XZDA 2Q27A 1FEZA 1T4DA 2G77B 2HRZA 1SG6A 2R8OA 2IYWA 5EC8A 3EXHC 3AZOA 1WX1A 4FXPA 5BN3A 3OVMA 4FLMA 4HV4A 5CD9A 1USGA 3KZVA 4OOEA 4Z4QA 1GUDA 4URHA 1WOMA 3IIIA 4IQFA 1BCRB 1CJCA 4OXKA 5JMOA 3B3FA 2BM1A 3HCOA 4O2AF 4HFNA 2DOKA 1BDJA 4RE5A 4EW1A 2NTYC 5FA8A 4OHVA 3HBAA 1N2ZA 1ULTA 2GEUA 3EQ9A 3LYHA 3EGDA 1QIHA 4OHOA 4L50A 4W7SA 4WL0A 3FGPA 4YXWD 5KJCA 4DDTA 4DXHA 5A4JA 2VPPA 4QT4A 2IHZA 1L9KA 4MOWA 2RJOA 2HA0A 2FNAA 2DGDA 4C87A 3ETCA 1PD0A 1Z2NX 5JWHA 4ATNA 1C4WA 5CIQA 2GK3A 1ZOLA 1G3IA 3CPEA 4RW0A 4U2CA 3HM9A 1E79D 3P9PA 3EXG1 4M0CA 3T41A 4DCJA 1G98A 1J42A 1OFIA 3F6SA 3K71B 3N8GA 4TV8B 1WB4A 2FKNA 2WFLA 1HYBA 1GUAA 3SGLA 3P5SA 1IH8A 5KI6A 4OPMA 5HJ7A 4TLEA 3UAZA 4R98A 1S3GA 3GLHB 3VPGA 2HO5A 4MS3B 3RIHA 3H1AA 3IBYA 4GBMA 1BA2A 1SKYB 3V97A 5IASA 2HK9A 1U7ZA 4IZOA 2EZ4A 2HADA 4LNUA 3SKYA 1EUCA 5K4GA 1VJ1A 4WA7A 3VR3A 1U2RA 1EIZA 2GD1O 3QHAA 3HVJA 4H17A 4A8JB 4D82A 1F3OA 1LI7A 1US8A 1XLTC 2C97A 3MGGA 4ND8B 4AZTA 4FYXA 1QAMA 3C6XA 3WMWA 4TWJA 3GGOA 4AJNA 4ISCA 2JVKA 3ZI4A 2WZBA 1KJ9A 2FHPA 3P9XA 4B32A 5KOHA 4W1SA 1B6SA 3DM5A 3DCIA 1C0EA 4BPRA 3O9MA 4IV0A 4OBEA 1Y5LA 3T94A 1F0NA 2Z9DA 5LYJF 5HNKA 3IYLW 1EK5A 2PFGA 1B0UA 1CY4A 1YQ9A 3IFSA 5DF1A 2IE0A 2P9BA 5DX0A 1NBWB 2Z2IA 4KL8S 3OBIA 3O7WA 4UDYX 3RRNA 1NOJA 4ZALA 1C7JA 2DTEA 5KPDA 4P0PB 3U5TA 4D9BA 2IHYA 1SCKA 3BA1A 1MH1A 1WR8A 2R2GA 1Z29A 2GHRA 4U00A 1JDBC 4ZHQB 2SICE 2Y76A 2VJQA 3E22A 1PFGA 3REFA 4EHLA 3IPRA 3Q3GE 2N46A 1EFPB 3DDZX 3G2KA 4H7PA 3UATA 3JZDA 1YFLA 1RIFA 4MR8A 1R7RA 2CVOA 4HUQB 3UTDA 3EIEA 2Q6KA 5JLAA 2VJDA 2JIRA 1QB7A 2DMRA 4PHFA 5ICSA 1JRLA 1CQIB 2LIVA 2R00C 3ZZUA 1DGQA 4LC9A 2NXJA 1XZJA 2XQGA 2QTCA 4MWSA 3QA3E 3JQQA 3X0DA 3EXHB 3WL5A 4FFLA 4BLQA 4DCUA 4L95C 2POCA 2J5XA 4OFWA 5FWDA 4AULA 3IR7A 4BVKA 2Y68A 5L7YA 4OQLA 3TTXA 2QTVA 4CF7A 5LLSA 1KIFA 1LZLA 3A36A 1ULSA 3IMKA 2AKEA 2QD3A 2C77A 3E3AA 4G65A 4C5BA 1KDZA 3E2PA 2QNBA 3O3OB 3QBVA 1NW6A 4IMJB 1FJXA 2DQSA 1I2CA 4RTNA 2YHUA 3DE4X 1XDBA 2P1DA 4BFTA 1Q7RA 4FCWA 3SBEA 5DCLA 3EUEA 3O0DA 1NU6A 2H4FA 1PZNA 1XYVA 2AR9A 4WFKA 1LPPA 3LVQE 1MG0A 2WU4A 3MK31 4S05A 3JQ6A 3TL2A 1T1SA 2GR9A 3L4EA 4JGIA 4NZPA 3RSQA 3VAAA 3E8XA 4GF5A 2YWCA 4NKRA 3M1YA 5CITA 3HCNA 3ADDA 3JASB 1UWVA 3WAJA 3B1WA 4XPZA 4MW2A 4UUAA 4J43A 1EVJA 1JJBA 3KEGA 3KQQA 4KDRA 4EY4A 4LY6A 4GMHA 3WVNA 4NCHA 4W4TA 1W36C 2JJYA 2O2XA 2C95A 2O3TA 4DANA 3DGEC 3ENZA 3WA7A 2F3RA 2EG9A 1L7XA 1PKXA 2V0CA 4BVGA 2YV4A 1ZN7A 2W2LA 2WYVA 3JARA 1TIPA 1UXIA 2Q1TA 3GUHA 4OAQA 1ACLA 4OJTA 3W0LB 2O2YA 3ZU4A 2UYCA 3BUSA 3E2MA 5CVUA 2AXNA 2KB0A 4I9UA 2QM7A 4XGRA 5FJIA 8MHTA 1GLNA 2XNHA 4KBFA 2CZQA 5TMDA 3F71A 3VKVA 4DA6A 5FTLA 5K6AC 1MU0A 4OU4A 2WJHA 4ZI7B 3D43A 4OAPA 1W96A 3C15C 4NXMB 3T3PB 2XB2A 1ISFA 3OOEA 3EYWA 4NQZA 4EB6A 3GVIA 3L4JA 1GNRA 4ITUA 5KBYA 3P1JA 4OHRA 5EPEA 1W4AA 3RVNA 1FJGB 3M70A 5DNYB 4OMUA 3EBPA 5ALRA 2G6TA 1S2IA 2BBWA 1GJRA 1VXRA 2EKQA 2NTJA 3D3QA 2BMEA 2C59A 4K40A 5CLHA 3OKPA 3CNEA 3P2JA 3WLAA 3T5AA 3IP7A 4JB3A 4IAOA 3PXCX 4ZVMA 4KPYA 3VZBA 5HM8A 2NUPB 3F47A 1NIJA 4RF3A 3LPMA 1PSDA 4L9AA 1EM8B 3D4NA 2GNAA 4OXRA 3WB2A 2M6SA 5U9CA 3FKSD 4BZQA 4PEVA 4HDNA 5CXSA 3KSBC 5D7NA 1VMIA 4JI7B 1G9SA 3R5FA 3BICA 3KYCA 2OCDA 4D8XA 1Y4UA 3EAQA 4WBXC 2FJPA 1XCMA 4G4IA 3T6KA 4IUBS 2A7XA 2X7HA 1QO0D 4QGGA 3V7FA 4WNCA 3PQ8A 1FQJA 1IJEA 4U0JA 3NUQA 4D5EA 1NTOA 3KOOA 4MS3A 3DV0B 1K88A 1QXSA 2C4WA 2IX9A 3CZCA 3ICEA 4O4IF 2I0FA 2ZB7A 5HPYB 2WWTA 1GTZA 1I1QB 4UZFA 4MVJP 3DR5A 4PY2A 1BEUB 4DMFA 5JNUA 1W76A 1G55A 3CY6A 3V3TA 1MA3A 2WHPA 4AN0A 2RK6A 4HFMA 2QLLA 4UMFA 3RUFA 3UAGA 1H9CA 4FFVA 3U31A 3TDMA 3LHDA 4MKXA 3WL8A 1PLJA 1JILA 3FRJA 1PEAA 2QTBA 4NABA 3FVRA 3KNZA 4IDPA 2C9MA 5B1HA 3OZSA 4EDHA 3JQDA 4O08A 3VC7A 3CONA 2ZE6A 3D8TA 2QRLA 4LTDA 1QC5B 2WQZA 3O2QB 2B25A 2FQXA 1QHEA 1POXA 1X42A 4KXUA 4N49A 3W3ZB 4ESEA 2QM3A 2A0YA 1NXQA 1T1JA 1QKKA 1PI3A 4KR6A 1Z45A 2MYPA 2HKIA 3K70C 2Z8XA 2D1FA 4ZVSA 2HIAA 2UDPA 3ZV5A 3QVWA 4ZHSA 3FWYA 3OQPA 5COQA 5JPCA 3NP7A 1C1DA 3ZHTA 4JXJA 4A10A 2J6CA 1YIAA 2OQ2A 2YUTA 2W6PA 4BP8A 3HSYA 3TFOA 1JJ7A 2C61A 1PYDA 1RM4A 2O5RA 3N75A 1HDYA 1AB6A 5JXIA 1BXZA 4JVLA 4M21A 2J3IA 1DJOA 4KDCA 3OT1A 4NV3A 3ZI0A 3ZZ0A 2O2SA 2ZAOA 4LDQA 1LI4A 4JGGA 3M3DA 2F3TA 1KP3A 4FKBA 5HM6A 3ZIAA 1Q0RA 5H7XA 4QFCA 1RAEA 4PLTA 1YRAA 5HGXA 4NCBA 2Q0HA 1UAYA 4IJWA 4MDYA 4N54A 3FHTA 1E59A 2XRZA 2B2NA 5B1DA 3ER8A 1MRZA 4O4HA 4D3SA 1SXJC 4WASA 3AFHA 4ZCPA 3CISA 4YUVA 4AF6A 5K0SA 1Q0TA 2BC9A 1PR3A 2CEAA 1CUIA 3PCRB 4FZVA 4QYIB 4REOA 1B23P 4Z1MD 5HXAA 1EQUA 3EZ2A 3CWZA 1XIVA 5HGJA 2G9VA 4MEBA 1Y6FA 3OE5A 1CLUA 3FJYA 5D87A 5F1YA 1E0DA 2A78A 4UHCA 4ZMSA 5HZMA 4YLYA 2IOFA 4PPNA 3SEZA 5BMVA 4OL9A 2AQKA 2CCGA 4XFJA 1TEZA 1QIIA 1OYYA 2ZRDA 2WTBA 5B5SA 3D7NA 1GL7A 1MAVA 4JNCA 3C7CB 2VPZA 4RVGA 2PT7A 4TT3A 4PE5B 2V59A 5C35A 4LC0A 1EXDA 4NMHA 1JFVA 4B6RA 3H9EO 2GVDC 4N7JA 1NY6A 2OKGA 3EVCA 1P7ZA 2I1WA 3GA0A 5EXSA 4RVUA 3MSCA 4BCCA 4QLOA 1HMYA 4QG7A 3M4ZA 1XKLA 2B9VA 3WQHA 4Z3KA 5E6UA 1WTCA 2XDAA 3ENKA 2PXAA 4YN3A 1QQAA 1BFUA 1D5WA 3CX3A 3O31A 2YIMA 3QY9A 4L4XA 2R8XA 4X84A 5AH0A 3KAPA 4GE3A 4XEHA 1ZCJA 1RJ9A 5I3CA 1EVLA 2P6NA 3LU1A 1K3FA 3H18A 5IXJA 4HNTA 1NUAA 4EF4A 1ISMA 2PZJA 5J9FA 1Q22A 4LRTB 3AJEA 3GQVA 1SQFA 3DTVB 1BKYA 4ND4A 1LBSA 2AEJA 2HRQA 4IZHA 3F2IA 4JHXA 3MWKA 2LP4Y 4MVWA 2LDBA 2VNHA 3FWKA 2FZ5A 3EGXA 3U7FB 4WQMA 2GD2A 4ZPXA 3I1YA 1F9EA 1UBOS 1YO6A 1ZDMA 2C04A 4X7PA 2RGEA 3WYAA 1ZG3A 4UQOA 4FXOA 4B9EA 4YWJA 1ULAA 3NALA 1T2EA 3JZAA 4BCDA 1SXGA 1MJFA 3V32A 1CE8B 1J23A 4HHEA 4AO8A 2FWBA 3R7NA 2O6HA 4RV5A 4Q7MB 5BNTA 1KETA 1RVDA 1G20E 3PPXA 2JLYA 5HS6A 2HOQA 1LTQA 2IPXA 1YI1A 4MS4B 3TEMA 1CB0A 1WB5A 1G3UA 1YKGA 1L1RA 5KWVA 1VFNA 4NAVA 3TUJC 1XJ0A 5T4HA 2RI6A 3MPUA 4CIVA 3GI1A 1HO3A 3L1HA 2P75A 3NHJA 1JQKA 3KWJA 4JZYA 4I19A 4UU7A 4GPBA 1J6UA 1N75A 2GFHA 4HDRB 4LXQA 3KSRA 1YQUA 2YV3A 3AIMA 3A9VA 1K75A 3L4SO 3O1IC 2CLHB 4GM4A 4XM0A 4Y8VA 1WXGA 4GOJA 1JW9B 5G0TA 3D5TA 3LY5A 1A8QA 2CVHA 4RFLA 5G1PA 4FJ1A 3ZGZA 4F4HA 2QX4A 3W6OA 2HBZA 1XMQB 4D9MA 3SM9A 3V7YA 4AJ9A 1ZK4A 3G59A 3JQ8B 2W6NA 1KEVA 5JISA 5KVSA 2YJ3A 2AQ8A 2P7IA 2AOWA 1BX1A 2BI7A 1JDUA 1QHNA 2ZWMA 1I6LA 2KWIA 4KYIB 4LOHA 4I6GA 2Q28A 3QWBA 4RZHA 5FH9A 1Y1LA 4ZYVA 5ADUS 1CUGA 4YRZA 3W5CA 1RU3A 1D9XA 1W59A 1UXOA 2GPSA 2VRCD 4TV9F 1KJNA 1YRBA 2X3YA 3HA2A 4UREA 4X24A 4EBFA 3B13B 3ZQ4A 3GBPA 2RH5A 4K26A 4QEDA 3I9V1 1DXOA 3PR2B 4OM8A 3RSZA 3TO5A 4TS4A 2DPGA 4LYEA 3OLWA 3GQBA 1F6BA 1S1MA 4K05A 4OUDB 1T2VA 1O96B 2BJVA 2V96A 1GTMA 2J3EA 5K3DA 3R5JA 5ALXA 3WDMA 1T24A 2HCBA 4FGWA 4WN9A 1E2NA 3K0BA 4QOGA 1EX9A 4ZT2A 2R4QA 1RAFA 5E3JA 5DASA 5I4KA 5DNWA 3TYXA 4QU9A 3ZE1B 3AVQA 1EK6A 3EWSA 3E53A 1KK2A 2IA5A 2P2LA 4U6QA 3HKBA 2C2BA 4WSOA 3VVMA 1FNBA 2MU1A 5IJ0B 3NWPA 5JLJA 2IYXA 2ONZA 3EHDA 1WJGA 4HDMB 4V1CA 3D3JA 4PLPA 2OV1A 4UBMA 2I4IA 2ZBUA 4TVSA 4ZT6A 4X6UA 2HM7A 1U0LA 4GKJB 5CFQA 2GZ3A 5JDCA 3VR0A 5EZYF 3A6HA 3ZNPA 1HQYE 3KZOA 1CYEA 3K9QO 3VRHA 3KXLA 4GKBA 1UKZA 1YJBA 2WM3A 3R8CA 3IVAA 1K5GA 2CKDA 3SEQA 1XC7A 1N5RA 3VGPA 4BKQA 2H2GA 2B36A 1C9YA 1W5FA 3B9QA 4DLUA 4EFNA 1RQPA 2OBXA 4UATA 4PRLA 3HY4A 3JV7A 4XSVA 5IVPA 5JBQA 1I7DA 2WD7B 3G2MA 3SZ3A 2XA1A 1W4ZA 2XTJA 2LV8A 1OWPA 1XF1A 2I62A 2QUIA 3QE4A 3UGKA 2FW0A 1DI0A 3ZCVA 5JO0A 5ERYA 4ZCIA 1N5LA 4II3A 1M1YB 3EQ7A 5T6MA 4F2HA 3VI4B 4N5NA 3HMQA 1D04A 3USZA 4JKIA 5JJIA 3L7NA 2H17A 3QEJA 5B7GA 5JS8A 2OG2A 4EHIA 2JFBA 1G8SA 2FR1A 3TLXA 5FOVA 1NKTA 1S96A 3MJCA 4HO1X 3K4HA 1ORDA 2AL7A 2O0MA 3EVAA 3GRZA 3IQFA 3FMFA 4P53A 4PZ9A 4BZZA 4JJ6A 3GFTA 2XMRA 3SN6A 3DMPA 3NATA 4FGJA 3SC2B 4IQ4A 4QXRA 1NJFA 1JSRA 2HB6A 3CH5A 2O0LA 3NAQA 4HB3A 5ELLA 4GLOA 4B48A 4DBZA 1YS4A 1CB7A 4LYJA 1HT1E 3G5AA 1BKDR 1NI4A 1W35A 4DIFA 3QI7A 3IJRA 4JOQA 1G20A 2GUGA 5A0FA 4G0ZA 1A77A 3JYNA 1UXJA 2ZIXA 3ETLA 3UWPA 2FPRA 2ODAA 3I83A 3NORA 4PXYA 2P9JA 2ZGVA 1ZRHA 1ACMA 3LZ6A 3SQDA 2IT1A 1E8NA 5CDGA 1HG1A 4I0WB 5AM3A 2COEA 1GILA 2C3PA 3K1YA 3O4FA 4RF2A 2ZIFA 4WVFA 2PLRA 5H83A 3ZWAA 2FRXA 3H83A 2B8EA 1OPRA 1Z5UA 1EEXB 1MOZA 2XVYA 4OHCA 2Q3BA 2FOXA 4MGEA 1E2GA 4NMWA 2HCRA 4J16C 2CK3A 2QMEA 1KO4A 1JAYA 1CDOA 2FMIA 3I8XA 2HLHA 1XXHE 3IA2A 5AJZA 2H8GA 3IRUA 4H77A 5A6SB 4N8SA 6NULA 4E08A 5ELMA 4PLYA 4QFDA 5B3JC 4E4YA 4GZ3A 3B1ZA 3B8HA 5IN5A 1JXAA 2WHEA 3H2BA 4R69A 1P0QA 3H5LA 3UCFA 1U2ZA 1LXCA 2VBGA 4A0RA 1AXRA 1YZHA 3AP1A 5D86A 1W73A 1AS2A 1NVVQ 2ZS7A 1FIUA 2F59A 3D7KA 5I47A 3K32A 1TRHA 1QE3A 3SK0A 2HA7A 1UR5A 1AGRA 1D7OA 2R65A 3DEYX 3IP6A 3OQJA 4M4SA 5HIAA 4AKTA 1ZHOA 4IIUA 4Z3OA 3VR5H 1OUMA 5SZIA 1RLIA 4AP5A 2C8LA 2HMUA 2V7GA 2F43A 3R1IA 4GRDA 4HGPA 5LPNA 5DCYA 3LIPA 3PRYA 4N3AA 4YBZA 1Y80A 2PNFA 4I1UA 5E6RA 5A71A 3WXMA 4BO2A 1O6BA 5FLKA 2AR0A 3JAWA 1DAGA 1F8FA 2ZB4A 1EFUA 3N5KA 3RWBA 2Z6QA 2ZI9A 2RHBA 5AKHA 3RS4A 3RS8A 1K1EA 2IYRA 4UU0A 5DE3A 3IQIX 1BE6A 4YRGA 1U0BB 4JSRA 1Q1ZA 1M7BA 3INYA 4EZEA 2JFQA 4UVIA 2X19A 4F6LA 4N5HX 1VE3A 1DIAA 4H2DA 3V8VA 1R0BA 4IXNA 1E1MA 5A9TA 5HSGA 5EIOA 2COUA 4D44A 2H31A 2ZJ4A 2IITA 3RBXA 5TB5A 3W06A 1M8FA 4RY9A 1IUNA 2L0XA 5LBTA 4DMMA 5JZSA 1OIWA 4DMUB 4F0JA 2CV1A 1COWD 3NW9A 5IC5A 3UGJA 3A26A 2GD0A 3B5IA 4EQZA 4LWOA 1Y4SA 4NK4A 3HLTA 2Z2ZA 3EZXA 4YUXA 5C8VA 1SHLA 1LDBA 1UBSB 2FAXA 4EHBA 5ADWA 4JI2B 5CJPA 1KDVA 1A4RA 4IXDA 4I4CA 1RNLA 2FDRA 2XUOA 5F9HA 4Z4GA 2C2YA 3PHLA 1D2EA 1XU7A 2ZSBA 3E1KA 1QV7A 3OEHA 4KQFA 4MCJA 1JAIA 3QMMA 4IY1A 4OXYA 4TSRA 4XDGA 5EMHA 4EZBA 3K0FA 4FX2A 2IXGA 1BRTA 5C18A 2JEZA 1YHZA 1GZ6A 1T9GR 2G7ZA 3WO1A 1NVUQ 1S3IA 4IV5A 3H2HA 1R12A 5JASA 5DH9A 1Y6GA 4U7WA 8AT1A 5KO2A 4MKZA 2B0CA 2NSHA 2G09A 1YD7A 3CVYA 5FWAA 1GL6A 1QX4A 4IOKA 1JN0A 1ZCAA 2IEYA 3MVEA 4F9GA 3HUUA 1K4MA 5F33A 3CZPA 3N6XA 4CU2A 3E05A 3O93A 1SC6A 3IQGX 4H3SA 4R3WA 3HB9A 4U8HA 5CUQA 1GZHB 1N5IA 2P9QA 2YRWA 5AXBA 1TAHA 2YR0A 2OGZA 3ZUGA 4AZ3B 4ZAXA 1KMHA 3MG9A 2IPLA 5HE9A 3IUYA 3UWKA 1QGUB 4F6RA 5ESWA 4CHTA 3O74A 5KCZA 3KL4A 1YQXA 3HFSA 2VATA 5A0TA 5KWJA 5HJ2A 5LXTB 5K03A 3G17A 1P7PA 2PLNA 5E1OA 2R62A 2JBHA 3OQMA 3TIFA 1VM6A 3A14A 3CN7A 5JBIA 2CNOA 3QUQA 1MOSA 4PQEA 2QN3A 621PA 3B7PA 3OJCA 2XHZA 1EB8A 4LG1A 1DPGA 3DO5A 4MW5A 3GFGA 2G71A 4KN9S 4LRUA 4F11A 2PUFA 2Q3MA 5A7HA 5EHNA 3EVEA 4QL3A 2RAVA 4LSZA 1L8LA 4WY5A 4OMCA 2V98A 2P69A 2Y0PA 3I0NA 2GZHA 3I37X 4MW4A 4PZYA 1AQIA 3LDAA 2F9LA 1JTFA 4UBKA 1S7CA 2Z3VA 3LF1A 4O63O 3GLFE 3K2IA 4Q7LA 2I7TA 5K8VA 2GFIA 1P6XA 2WE7A 4ZI7A 1YQEA 2AA3A 5A4DA 2HA6A 3ZCQA 4CKBA 4JX8A 1Q20A 4QBKA 1X0VA 2HEGA 1C3OA 4TTRA 4DBVO 1CUFA 13PKA 4L8VA 4Q9JA 2A3RA 2Z8YM 3EZ7A 4LTNA 5SYMA 5IVKA 1Z8HA 5E2IA 1KVUA 2O50A 1Z7GA 1A9RA 1Q7GA 1CVRA 2G8NA 3NTQA 1G9TA 2JGIA 1ZUIA 1FFYA 5B3AA 2AWOA 3A0RB 2AKAB 2DFVA 2DRIA 2KS6A 3DMNA 1S8FA 4JC0A 3RVSA 4AZWA 5IRCD 3W5BA 1ZS9A 3E6AA 1MAWA 4OHKA 5H5JA 3WLLA 3SS7X 1MEEA 2NQ2C 1G8GA 1BMDA 3ZDBA 4AUMA 3Q6IA 3GH1A 4XM2A 4EAAA 4UD2A 4YWHA 3R3WA 1I36A 3SC4A 1PF7E 3ACDA 3GEGA 3QVVA 5EE0A 5KAMA 3K8OE 1WOYA 2XCIA 5EY5B 5LZ5A 3LWDA 4NNPA 4PSDA 4WNIA 1N4DA 4NR0A 4IG4A 1O0CA 3A8TA 4Q3LA 3CF4A 3E61A 1AZWA 4LK2A 2BSQA 2O3JA 4EQ6A 3C41J 3PVCA 2CD7A 2H5IA 2R6GA 3K09C 2XF8A 3SHOA 2DBZA 3N2ZB 4M0DA 3RB8A 4F3YA 2QZPA 3KO8A 2ZUUA 3PT5A 2RHMA 3QVKA 4ZVQA 3KKPA 5JG7A 2Q4EA 4TS1A 4ZIRB 2VF8A 4BMNA 3VR1A 1OBHA 3K1AB 2O7RA 4XVHA 5BRAA 1QVRA 3FPKA 4M3NA 5BPHA 3SC3A 2BR5A 3FCOA 3L46A 5FHQA 1LSOA 4LMPA 2CGEA 4INZA 4PIPA 3ZDZB 3NT5A 4RK5A 5SY6A 1NP6A 4JOSA 3UUFA 3GLIE 1UAAA 4NV1A 4MMYB 4HS9A 3TBFA 1E5DA 2BEVA 4PZ0A 1YB1A 3QU5A 1YCGA 1WQ1R 3M9LA 4N4AA 5CLFA 4AO6A 4HXFB 2D1RA 1YHNA 3U4QB 3OICA 1YFKA 2D59A 3OQHA 1J2YA 4GP6A 3NEYA 5IMSA 4DEVA 3L1UA 3OESA 1R74A 3OZAA 5BW4A 5LB2A 3V6MA 2OV8A 3C3XA 3RRZA 3SFVA 2XUQA 3ZPXA 4BUJA 3A9RA 5BT8A 1FSGA 4M60A 5E38A 3V46A 4J4BA 3KB2A 1N0UA 1T9HA 1XOIA 3HC7A 4NPCA 4RGVA 4RXUA 3RSLA 2MSNA 4D8WA 1N8SA 1S2GA 2MSCB 2CSUA 3AEZA 3IVXA 3SP1A 5AW0A 3X2FA 4OBWA 1TL7C 2BFWA 4HDSB 1NTRA 1RW4A 3GLGB 1U81A 5JNRA 5C8ZA 3NGXA 4YO7A 4R1OA 4CL8A 3WGZA 1MVNA 1KKMA 1NDHA 1P7CA 2I3BA 3B53X 4X20B 2F67A 4XGNA 1B3RA 1GXSB 4PLFA 2H5JA 2INGX 2QSJA 2SHKA 3H5NA 1UFRA 3IAM6 3PEEA 1PNTA 2O0JA 4HLCA 4UPDA 1TEVA 4LXYA 5BNIA 2WFLB 4AF7A 3SXJA 3W6UA 3ORRA 1ZVQA 4HRAA 4RNCA 1GO2A 3WIOA 1ZITA 4RMHA 1KQOA 1GG9A 2A9VA 2ZSAA 3N0WA 3L0DA 4CLXA 1PD1A 1QF6A 2IIBA 1TO6A 2JJQA 2O3RA 5IS2A 1S2OA 4OUKX 4PNHA 3DV9A 3F98A 3HRHA 2HZBA 4U2FA 5FOTA 4CQMB 5AVTA 2VBFA 1EJ0A 3KAKA 3N6VA 4V1CI 4P08A 1BYUA 4DGSA 4BTVA 4DMRA 2JIZD 4B75A 1L7BA 1ODFA 4QDOA 3LTEA 4JP8A 2QQFA 4U2GA 4F71A 2V97A 2G9QA 1GT6A 4DUGD 1DJPA 4A0QA 2A2ZA 2WW8A 1DX6A 2D2EA 2PA0A 1GR0A 1WPQA 1Z62A 2UYGA 1GPAA 1NVGA 2YZKA 4LOJA 1SD5A 2CFRA 2ZR0A 4HLNA 1R0SA 1Z4LA 3BRCA 4OQQA 2DXIA 2QZ4A 1QAQA 3D3WA 3EZFA 1RXVA 3BAZA 2PYIA 3L8DA 4WCFC 3A3OA 3TCXB 3WHIA 5KNLA 4IWNA 5FR2A 2EJTA 2ZBPA 2A9OA 1EFVA 1VZ3A 1L7MA 5DRTA 5C8YF 2LGJA 1KI2A 2FI1A 1Z4KA 3ZE0B 3GDOA 5EIXA 3CX7A 3ANNA 2C3OA 2WOJA 2IXDA 2FGKA 1WU7A 2RG7A 4DMHA 5KJ1A 1MG5A 2VJLA 2K7ZA 5JRZA 2RGXA 3LWZA 2XCSB 1NSFA 2V6FA 4FYHA 3UZUA 3JSAA 4WLUA 5CG1A 2YDYA 1FNNA 4L8WB 5TARA 1GRRA 4GI5A 4Y1RB 1BGXT 1KDPA 3HR8A 5EG5A 5J63A 1P80A 3Q9LA 1NT2A 3P45A 4KUHA 1KZ1A 1P1JA 3VR5D 1Z0AA 5JMWA 2C4VA 3OSUA 3PI6A 2Q8NA 3ZDDA 1SK8A 3CUUA 2A58A 1YB7A 4P7GA 1A5SB 3WFJA 3TJZA 4NH0A 4W8GA 1Z06A 2XTNA 2HSGA 5EESA 1OX4B 2XCOA 3CG0A 3FDZA 3OQ6A 4RYLA 1LS1A 2XE7A 3BIXA 2NAFA 3BWMA 1SUWA 4FYYA 1AKEA 1OV4A 3FMPB 1YCDA 5DB4A 5BWMA 1SU8A 5GJBA 1EXMA 4MAAA 2JCVA 2ZWVA 3IELA 1NF9A 3PCXA 2I34A 1OXXK 3H84A 1P4GA 1CQJA 5JH7B 2RIPA 3CSSA 4UU1A 4W5HA 1Z6AA 1T3SA 2XT0A 3HUTA 3WGUA 2H08A 4PGGA 2DHCA 1XQYA 1BO6A 5DBIA 4AJLA 4PYRA 1T0PA 2KQUA 3TTWA 3K94A 1H6CA 2VXBA 3IPXA 3OLXA 4OHUA 1VLZA 3JY6A 4K7JA 1H6BA 1PT9A 4AMVA 1HE5A 1JSXA 1T9ZA 1I3LA 1ZMXA 3CPSA 1IWPB 3HKCB 3M3HA 3FWPA 4HADA 4JH0A 1B1CA 1E4EA 1L7EA 3C4JA 4IXTA 4M9RA 4PHCA 5BN3B 5MN5A 3KJGA 1KARA 3C5HA 2BBOA 2J9RA 4MA5A 4W5TA 4ZOLA 5LQMA 1EB9A 1VTKA 2CVPA 2VPIA 3G89A 4BB9A 3EF1A 1ADYA 2WWWA 1S7GA 1GYPA 2X9LA 2ZLBA 2WU8A 4DUPA 5JH7F 3OZXA 1ADBA 2NOAA 4IMPA 3W78A 3QFCA 2I2WA 2JGDA 1V35A 3EGWA 2QRPA 3AFIA 3O2JA 4FOPA 4JWTA 1U1DA 1WZNA 4RX1A 4B3CA 4DIDA 4YECA 2O57A 3OBBA 4H16A 2XXJA 2ZRNA 5EJMA 4X1IB 3K70B 3K2EA 1Y8RA 2B92A 3HV0A 3DC7A 3IPLA 3IT0A 2YINC 3LP8A 1LNSA 1OAKA 2GN0A 3N2KA 3HBNA 1NJ6A 1Y7LA 3NB0A 3RS9A 5LP6A 1G1MA 4K9SA 1J8YF 2JEYA 2QVYX 3B9RA 2BISA 2PH1A 3HNOA 4IH9A 3KKKA 4J0JA 4N0EA 4QQ8A 3LQKA 4YCDA 5JDIC 2XCTB 5J59A 1G2OA 1V1RA 2HRRA 3RHFA 3S70A 1MN6A 2G40A 4RZXA 2QVXX 4TMFA 1K5HA 3WRVA 1B14A 1OLOA 1TM1E 5AXDA 3O8NA 4CU5A 4JMPA 1ZICA 3AX6A 3PNPA 2QJWA 5FTMA 5JSUA 1XYGA 2HHJA 2Q62A 1VJTA 1PT5A 1XQ6A 3GEBA 3PFNA 1F3LA 4C08A 1NC3A 4TMKA 1SK9A 2KLHA 3N6RA 1V48A 4EYEA 4KZPA 4N12A 3V80A 4KHZA 2HU2A 4QE3A 2ZBFA 2YRXA 4ZN6A 1J1UA 1KJIA 2VQDA 1L4BA 1W25A 2CDRA 3NYQA 2BKAA 2P3QA 5CPBA 5LL6P 3JD3A 4XRRA 1DQYA 4BY9E 2FFRA 1V8ZA 1VFPA 5BWOA 5A5EA 3ES9A 2MSLA 4DA7A 2V1XA 4O2LA 4L78A 4Q0MA 3ZIAD 2CHFA 1Q92A 3DONA 4L6IA 1N6KA 2P9FA 2YQZA 4U2DA 5IJWA 2YWDA 5HIMA 4RD1A 1S2LA 4MVJE 4LJRA 3PNOA 3ORSA 1Y1SA 2GZMA 5GOTA 4C4XA 3A0UA 4GXTA 4NAUA 3G82C 3OF3A 1BWPA 4RHFA 3WWZA 2ANCA 1QHIA 1KOJA 3FIUA 3GROA 1E9VA 2Y0DA 1ZH8A 3HJAA 1E3QA 3DVQX 1DCFA 1BJTA 1UFVA 2R0QC 3KEFA 4Z1MA 3BERA 3WDKA 2A8YA 4FWIB 3PHJA 3QNUA 1R27A 4OATA 2BFEA 4I1YA 2OCYC 1K86A 5I9BA 3SZGA 1H85A 3QELA 4K9OA 4RHCA 5CXXA 1M2OA 1THGA 1UZNA 2D0PB 2HF8A 4R9VA 1NR1A 2RHWA 4RIIA 3AM3A 3STWA 3ZWWA 1C80A 4KXQA 2Z5LA 1RYZA 3GFQA 1J2RA 1KAEA 2YUIA 1E6CA 3GMSA 5E6SB 1W75A 3EDQA 1DUIA 5EJ2A 5I4CA 4NY1A 3WK9A 3B38A 3TLYA 3WDSA 5AVWA 1U3TA 4OI2A 3VSBA 3BFPA 5IULC 1V71A 4NZ9A 5DIZA 4CKEA 4RTKA 4BNNA 1T0HB 2XD4A 3AL2A 5J5VA 4MVJG 3UH0A 4AK9A 3GT3A 1XVTA 3EODA 4X60A 3M2PA 3RG8A 4B7ZA 1GYRA 1T3HA 1RSZA 2Y9PB 2B0JA 1UF9A 2FF7A 4M9QA 1G8YA 2F1JA 3CKKA 4TYQA 4I66A 1H23A 4MKRA 3ETHA 2OK7A 1TI7A 2QL9A 3K4QA 4HXGA 4B4UA 5E7MA 3ZWOA 4JWKA 3O8LA 3WJ2A 4DJDC 3CGWA 2B4KA 2YWXA 1JAHA 3CEPB 1RS0A 3P8ZA 4MQMA 4C7VA 2B1RA 3TKAA 3ZLJA 1NMZA 4UEWA 1EVEA 4NQRA 4YHBA 3DFIA 1ZLYA 3HDVA 2AUTA 4JP3A 1R1DA 2NSLA 2HHHB 2G76A 2Z5FA 1VHTA 3ZDAA 3QSYA 3N0VA 1QDUA 1MB9A 3BH6A 2PZGA 3JD0A 3GJTA 2MJLA 4HLDA 4NBWA 3KQLA 1A7AA 5ALEA 1ID8A 2IZ5A 4Q3OA 4YP7A 5A3QA 4Y0VA 3QUTA 3SOZA 4U02A 2GTIA 1HSZA 2PXHA 2WIKA 2QTVB 2NUAA 3WWDA 3PQ2A 4YVFA 4Z7NB 1M0SA 3D6MA 4GWGA 4CTJA 1FDTA 4J6EA 4ZVTA 1EDZA 1G6HA 1VKRA 1JSZA 3P0RA 4Z49A 5IKPA 1KSGA 2Y4NA 1KEWA 1KZ6A 2ZVQX 4YYEA 3VPHA 3KPYA 3J7TA 3P4YA 2PUJA 2LRHA 2XUFA 1NU8A 4UVGA 2VC2B 2Y1CA 5ALPA 3QFRA 3RYFA 3CPHA 4NYIQ 2JGNA 3TLBA 3VVCA 3G9ZA 3O4JA 3NX4A 3I04A 3TZQA 5C46F 4EFMA 5BNWA 3GLTA 4M1ZA 5CB0A 3NBXX 3R41A 4CNBA 3AHHA 4XR4A 5KDOA 1WCIB 4RTMA 2Z1DA 4P1ZA 4IVPA 2IDKA 3AY7A 1ZBQA 3N8NA 5EIWA 1X1QA 3FZYA 4C07A 4MXDA 3W9BA 3U2QA 1RPZA 4EKYA 3DEIA 1G19A 3TZ6A 5C53B 1QHHB 1K0UA 4WFIA 5H3CA 5C7IO 5JV5A 4G9BA 1PW5A 2YFKA 3AR8A 4Q34A 1G4HA 5C7LO 1JV2B 1IHPA 1A9TA 3F6CA 5FQOA 4RF5A 2H9AA 3A4NA 5IT0A 4J4HA 3LUBA 3RVBA 4YAOA 4FIDA 3WGYA 3ZQKA 1E1RD 3D7LA 2QD2A 4MH0R 3S0JA 4Q18A 2NT3A 4IDGA 1MZPA 1T4CA 1J8QA 4A92A 2E55A 1IK4A 3KC2A 3PA6A 1SU7A 1UOEA 5AUOB 2GRUA 4FDUA 4IS3A 3CUTA 1AD2A 3NWBA 1P5RA 1V25A 1MLDA 3CRRA 2OP1A 5IC4A 4Y9RA 4LFBB 4L2IB 4DQVA 4MIYA 4WBNB 3AIKA 2Y0CA 4LBVA 3VHXB 3VV2A 2JGEA 3WNDA 5CAEA 4RLSA 5KVVA 1PS9A 2P3LA 4FT4A 4L4YA 4LKRA 3QEMA 3VYSB 1VL5A 3VZQA 4CM4B 4DCOA 4YPOA 3MUFA 2BKVA 1U0OC 4LK3A 1ZJ6A 5DBGA 4IG9A 1BGWA 4RGBA 4V39A 5D2CA 4RNDB 4JN6B 1PL6A 2J0QA 2IE8A 1ZZGA 1K66A 3LE8A 2I91A 2EKBA 3VU0A 1NYQA 2IYSA 2JFPA 3EPHA 1TZMA 2AHRA 3T95A 4QPDA 5F7OA 4F8EA 4XCVA 1NNEA 4MI3A 2CJWA 2ID4A 2NZ2A 3AW8A 4N65A 3FLEA 4TMZA 3NWJA 1QV9A 2F43B 4UHDA 5CDTA 3GP8A 4W5QA 3L9WA 1W6UA 4PHHA 2VT6A 1ZUD1 2FW9A 5LBUA 1ECFA 2JIBA 2KLBA 2Z04A 4YP1A 1T5BA 2MTBA 5CVJA 1TYEB 1M6YA 1XLTA 3H6GA 4QFBA 4XW2A 4EHNA 4F38A 2ZYHA 3M6FA 5JNLA 2O7QA 1DC7A 3BDIA 2Q1YA 5J23A 2C9BA 4OI4A 5AI9A 5DEOA 4I6EA 3AH8A 4RDIA 5IHPA 4B5KA 1I8TA 1N2EA 4BUZA 3GUUA 4N3CA 3DHVA 4J03A 3MLBA 2E4ZA 3M6VA 2BMWA 3CEJA 3OLCX 4HXEB 4NOKA 5JS7A 3HYLA 1CUAA 1P62B 1KYYA 1FFBA 3O75A 4WPGA 2XZPA 2IC5A 4ZTBA 3WLNA 1W88B 3B1VA 3WL4A 4NEQA 2XD9A 5ITSA 1E0AA 1Z2CA 3A70A 3F9RA 2ZJ0A 1JMVA 4NBKA 5I3ZA 4ZEXA 2H8KA 3Q8LA 3O8CA 1A7UA 1HYHA 1KORA 1DHRA 1LC0A 2Z1NA 3L0ZA 2WEKA 4FYPA 3K0CC 1W29A 3I04M 2W2PA 2HIHA 2QUBA 3E7XA 3KVRA 3OFVA 4S1WA 4L1KA 2O3QA 3CR8A 5TPWA 1ZEJA 3SHFA 4B2LA 1YVPA 2ATEA 2BFCA 5ER9A 1E79A 4CDMA 1BOFA 1U98A 1CY2A 2HJRA 3G8AA 2GZDA 3VGJA 4M7RA 3LTNC 2G3YA 2RHJA 1DFHA 4QUBA 2JLVA 3HJCA 4B46A 4V24A 2C5LA 5C80A 1VKHA 4MSUA 4PCUA 2QTHA 5EMNA 2WMYA 3QEBZ 1GZ4A 4GWLA 1BVHA 4BNUA 1ORWA 3H9BA 4IPTA 2VP0A 5PNTA 3WL6A 4D8YA 2OMKA 4R01A 1TKCA 4NBNA 4Q3AA 4WZAB 3NHUA 4AX8A 2Y93A 3AO0B 3SXPA 3PVZA 2I6TA 2G08A 1TJYA 3B1FA 3S5UA 3VZPA 1FX0B 3CN9A 4QJ4A 4YQZA 5ENVA 4LSGA 3I76A 5LQKA 3H2ZA 1W2WB 3FWNA 2FHSA 3ONFA 2R97A 1MW9X 1U2EA 2AEEA 1IQPA 4TMVA 1PNRA 4L9SA 1U7PA 2O2JA 4H59A 4JEMA 2XOEA 3A10A 3BG5A 2VXYA 1H4TA 3BDVA 3PLNA 4ZO6A 4F9TA 4MCAA 4OJQA 2NTNA 5JD5A 3IUPA 1HDZA 3ZZTA 3CXRA 2Q7DA 5ITVA 4MYUA 3QNMA 1USVA 2AN1A 5EMLA 1Z5GA 1ETUA 5JJ5A 3D54D 1BW9B 1SC9A 5DMHA 1B2LA 4I8DA 2NZ8A 3HCBA 2ZEJA 1FLNA 1M1NA 4EUKA 1JG1A 1IBKB 3L7AA 1CERA 3LYUA 2WWGA 4QM7A 4NSNA 1Y8CA 1Y3DE 2DTDA 2ZETA 3GRVA 1JR3A 3UK2A 4WFJA 1OA0A 1TJPB 3OD1A 1O94D 1TYZA 3MQFA 4PQRA 5C8YB 1QIJA 2VYFA 1SD2A 5LQAA 3THXB 1Q6ZA 4U2BA 1G8HA 1ZR4A 2PVCA 1TGYA 2IY7A 1FSFA 3ASVA 3O4IA 4L5CA 1V7PC 1WZIA 3FG9A 2ARKA 2PAFA 4UM9D 4L5YA 1KPIA 4CNQA 4DR6B 3FI0A 3W2EA 2HBYA 4C4PA 1CZKA 2RCYA 4TLDA 3M4JA 1NV9A 1IONA 3AF4A 1SD1A 4II2A 2XUAA 4TWBA 3CC8A 4MV3A 3RH0A 1WSAA 1DU4A 3BH7A 3HU5A 3V4ZA 1GCGA 2GSWA 3AINA 3GQBB 2DFKB 2WT4A 3C7DB 1RKUA 3CH6A 1ZBDA 3EZGA 4FC6A 4NX2A 4E5SA 5L7TA 2UUPA 3EAGA 1E89A 1GGEA 4M99A 3I2YX 2XKJE 4HAVA 4F45A 1N6IA 4X92A 3KKLA 2P40A 1HXHA 5BUSA 1Z4NA 3CH7A 3HYNA 4RKRA 1Z5OA 5EGSA 5JI2E 4RPIA 1W1UA 1NPYA 2XQKA 4TN1A 5IT5A 4MWCA 1EUYA 4Y6QA 3VH4A 3RU9A 2IDMA 4BYMA 3H19A 2UU9B 5FNVB 4OB6A 1ECCA 2BCGY 5KU1A 1II8A 4ARBA 5AKKA 4EVRA 2FZVA 3KTOA 4DV6B 1UPUA 3EXIB 3FTPA 4HMOA 5EIFA 1U0RA 3HZRA 1C41A 1Q83A 1O95D 4DIUA 3DUFB 1FRNA 4L28A 1UC9A 4Q3EA 1RI5A 1TVCA 2BH9A 3FWHA 4U7FA 5H82A 3RR2A 5KMGB 4OLHA 2ZJ5A 1KK0A 2J3DA 2REXB 2GAJA 1QNFA 3RUAA 2RSLA 4REQA 1DDOA 5AW6A 1F6DA 4FUQA 4P2BA 1JEDA 3CUEF 3G7SA 2ORIA 1RQGA 3Q3EA 2Q0QA 3HGMA 5F2OA 1ICIA 4PAQA 2UUAB 4UC0A 3TNJA 3OFKA 2IZ1A 3DDWA 5DTJA 3LVFO 1BXRB 2PKEA 2JF0A 3L6OO 2XT6A 4TVKA 3BQ9A 3E5MA 5K3CA 1H05A 2BFOA 4Y2HA 4DQKA 1Z7BA 1IATA 4UPVA 4ZYXA 1H5UA 1OT5A 4N7BA 1XK6A 2MSKA 2DWQA 5AHOA 4ZFNA 4CVNA 5J2UB 4FFDA 4TX1A 3ZHRA 4YGYA 3VM6A 4A91A 5AVXA 5HUJA 1TO1E 2C5BA 4R4JA 2NUTA 3V55A 4O8ZA 2H3EA 2IYNA 1IZ7A 1I0LA 1YZKA 2A0UA 2JGLA 3E22B 1G8PA 4A1FA 2C4NA 3LRPA 4JNKA 2OGTA 3V1UA 4F5EA 1VL2A 3ON5A 3E9YA 4KC0A 1VIYA 5HCIA 4QDJA 1UC4B 3AKCA 4F3TA 5CHYA 2EWWA 2OHFA 4IVNA 2AOXA 5ECGC 2J9YB 4QJBA 5INTA 4AKGA 4FCVA 3FYHA 1WKVA 5C3UA 1A9XB 2D13A 1QQBA 4NJOA 3DTTA 3CZQA 2IYOA 2E89A 4YJFB 1SVWA 1AA9A 3QEKA 3RODA 5EJ5A 4XEUA 3K7EA 1K9SA 1OGIA 1IAQA 3H5TA 5MFZA 4W5RA 1SR8A 2VEDA 3N53A 3NHPA 1CNMA 4XLLA 1NIPA 4OK6A 2UXCB 2AK3A 4TLMB 2PTGA 4XSGA 3UB3A 2YWGA 4NBVA 1DWOA 4KQ2A 4QHSA 4YV2A 5H02A 3A1SA 4ZEWA 1X94A 1SHJA 2B1GA 4QVGA 1QO0A 3FMOB 3BMOB 5CX1A 2Q7OE 3K20A 2P4UA 4IINA 2DLDA 1NNSA 1BTOA 2PWPA 1E9EA 1R0WA 4MUHA 1J49A 1P1FA 1QG6A 3R3VA 1NQWA 4BKOA 2GX6A 2V5UA 3H2JA 1QIDA 2VRBA 3QKWA 1AF7A 1AG9A 5E7JA 4YREA 4CIBA 1SM4A 5AVYA 3JVVA 5IJ0A 2NXNA 4TQ9A 1CZRA 2Q1XA 1UPFA 1XTSA 1SBZA 3D64A 3EQ6A 3FNGA 5D7BA 3U1TA 4CN8A 4JLUA 1QANA 2BGUA 3GJ0A 3IP1A 3NHBA 4ZOCA 2W58A 3DL2A 1UJ5A 5AKLA 1IL0A 2BL4A 2PWZA 5GOZA 1MC4A 2J67A 3SDZA 4KITB 3GLVA 2GJ8A 3I9FA 4KR7A 1RXEA 4GGPA 2BBSA 2DPLA 1U80A 2IK8A 5ALVA 3THYB 1NR5A 2ERCA 5SYAA 1P6QA 1XJWA 1D09A 1FP1D 1V37A 2AJCA 3TQOA 1UDCA 1JDVA 1EA5A 1GRVA 1F0YA 1NVKA 3BMCB 3DG9A 3NKVA 1NBIA 3HB1A 4FZJA 2ZVJA 4LZOA 4RV9A 3EA4A 1H5QA 1IBSA 3SFTA 4YRNA 1A7JA 4EGAA 2QXUA 4O2RA 4U7GA 2ONYA 3UQZA 3WIEA 3DBLB 5TQ0B 2G7MC 3S4YA 1FFGA 1ZXLA 3AYZB 1T4GA 2E4AA 3DT9A 1ZVVA