1Q1AA

Structure of the yeast hst2 protein deacetylase in ternary complex with 2'-o-acetyl adp ribose and histone peptide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
285
Chain Sequence
TASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITTPQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the yeast Hst2 protein deacetylase in ternary complex with 2'-O-Acetyl ADP ribose and histone peptide.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
molecule keywords HST2 protein
total genus 96
structure length 285
sequence length 289
ec nomenclature
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 1q1aA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1q1aA01
1Q17A 2H4FA 1V5GA 2Q5JA 2FR8C 3EYAA 2OO5C 1M2HA 5IMSA 2FN3A 3PKJA 2JI8A 1ICIA 2OD2A 4GPEA 4BVFA 4JUCA 4V1CB 3FZNA 4JUAA 3RIGA 1PNQA 2H2DA 4JUBA 4RJJA 2OD9A 4FVTA 2Q5QA 2Q5LA 2PGNA 1XLTC 5K3SA 2H4HA 3CF4G 2OD7A 2VK4A 5BWOA 4UTZA 4IG9A 4MPRA 4V1CA 1Q1AA 5EJ6A 4Y6QA 2JIBA 2WVHA 5K6RA 4D5GA 3JWPA 1NM5C 4FEEA 2EZ8A 2NYRA 2VBFA 4K9NA 4K9QA 3GLRA 4KPUA 4O8ZA 4BUZA 2H2FA 4R8MA 1UPAA 1E3TA 5MFPA 4RMHA 1DJLA 1YI1A 1V5EA 4GP9A 4J1TC 4HDAA 4JU8A 1YC5A 3U3DA 3PDHA 2A1UA 3RIYA 3FSJX 3K35A 4K9PA 5FYQA 4MPPA 5D7NA 2VK8A 1POWA 2C31A 3F6EX 2BRUC 1Q6ZA 1U28C 1ZPDA 5EJ9A 2QQFA 1PVDA 1QPBA 3U31A 3HWWA 1SZDA 4GM0A 4F4UA 1T9DA 4RMGA 2W93A 4L2IA 2Q27A 1U2GC 1T9CA 4RMJA 5DGDA 2JLCA 1YI0A 4UUBA 3GLTA 4UTXA 4MZXA 4FZ3A 2HJHA 2H2IA 3ZGOA 4JU9A 2H4JA 1D4OA 4UTRA 4K9MA 2VJYA 2PGOA 2FWNA 5EJ7A 1Z8NA 4Y6LA 2Q5OA 3FLMA 3HWX1 4COKA 2H2HA 1OVMA 4BVBA 4UUAA 1SZCA 1HZZC 5DEIA 5FEMA 5AHKA 5EJ4A 4QPZA 1YC2A 1YTLA 2EZUA 2WVAA 3CLRD 5K2OA 4JT8A 4C78A 1J8FA 4JUDX 4X3PA 1MA3A 1O97D 4K9KA 3F6BX 5DGTA 4UU8A 2EZ9A 4GG1A 4UU7A 4RJIA 4D5EA 2DJIA 2UZ1B 2V3WA 1OZGA 2Q29A 4JD5A 2OORC 2B4YA 4L3OA 3CLTD 3ZG6A 1V5FA 2EZ4A 4MPJA 2IHUA 2IHVA 1M2GA 1Y9DA 2VBIA 4BVHA 1M2NA 2AG1A 4JT9A 1PNOA 3JR3A 2VBGA 4MQ5A 3D4BA 3GLUA 2UZ1A 2JLAA 4Q9DA 4JUFA 1T9BA 2NXWA 4IF6A 3PKIA 5EJMA 2A1TR 2VK1A 4TWJA 4IAOA 1MCZA 1Q14A 3D81A 2QQGA 1M2KA 1U2DC 3GLSA 1OZHA 4BVEA 2H2GA 5BWLA 3IAEA 1YNOA 4BN5A 1UPCA 4GM4A 1O96B 1OZFA 4C7BA 1POXA 4GM1A 3EY9A 5MGNA 5EJ5A 1JSCA 4ZP1A 1YHZA 4TWIA 1EFVA 3ZGVA 2IHTA 3IAFA 4X3OA 4BVGA 4V1CI 1S7GA 2JI7A 4K9OA 2WVGA 2H59A 2FRDC 3LQ1A 5MFZA 4BV3A 1S5PA 4QELA 4RJKA 1N0HA 1BFDA 4UTVA 2JI9A 3E9YA 3OE1A 1PT9A 4RMIA 1U31A 1YBHA 2PANA 4QQ8A 5EJ8A 2FSVC 3CLSD 4G1CA 4KXQA 4J16C 2Q28A 4JSRA 1PYDA 4UTNA 4ZZIA 4I5IA 1PTJC 3EA4A 4KGDA 3D7KA 1T9AA 1YHYA 5EJAA 1PI3A 4F56A 4BN4A 2JI6A 5BWNA 4Y6OA 1EFPA 4K9LA 2X7JA 4FEGA 4BV2A 1PO7A 3CLUD 4HD8A 1UPBA 2AG0A 5K6TA 5MF6A 2EZTA 1M2JA
chains in the Genus database with same CATH superfamily
4QTUB 2XD9A 3EXG1 5L3SB 3FNHA 1FFHA 1B76A 1NBEA 1NDUA 4G0OA 4GX2A 4M99A 2Y1WA 4D8VA 2O8FB 4AVYA 1XP5A 1BWSA 4ZK6A 4JKIA 5H70A 1RZRD 4AL4A 4ZU6X 2I8AA 3RSGA 5I47A 3UUFA 1FSPA 4R9VA 3F6SA 1J22A 3ZZUA 1J2JA 1E1MA 2FQQA 4EX7A 4MINA 1P5RA 2LCFA 3PT9A 3VYWA 3GFFA 3DE1X 4Q3EA 4ZOLB 3HG7A 3PD7A 1ORWA 1NC1A 1U3UA 2BFFA 3L8MA 4MP6A 1NZDA 4YCLA 5HR5A 2UYYA 3PGXA 4NOKA 3D3EA 5TGZA 1ZK0A 1E3TA 1CUGA 3L9WA 1YB4A 4TYPA 3C3EA 4TKUA 1W4CA 3QVOA 4PR3A 3BMQB 3OZTA 1JF8A 4AKIA 3KLNA 1AHIA 1KY5A 2MHCA 4NI5A 4OGGA 5I9TA 3WMGA 2Z3ZA 1G8MA 1NQAO 3FSRA 4QUGA 3DE7X 2RKOA 1KMCA 1G8JA 1PVDA 1Y1PA 2GF2A 3EIFA 3IOBA 3CO5A 2ZYHA 1M73E 3B6MA 2O23A 3KJXA 3PFKA 4MLDA 4KP7A 4P58A 4ZOLF 5TV2A 4Y6RA 4EB6A 5CB6A 4EHNA 4PANA 3SYTA 4BMXA 2CXNA 1YDFA 3K9GA 4MVXA 3KYIB 1MOZA 5AHWA 2YMMA 5EG5A 1SB9A 2CBXA 3BQ9A 5IMBA 2VHXA 3BD9A 2VJLA 2OUIA 3QKUA 1DTWA 2YHSA 3WRWA 4C6RA 3H18A 2PMBA 3CLRD 1U5BB 5I4BA 2Z6QA 3TNDA 3EJWA 1X0VA 4JUDX 4WTOA 4B3FX 5KOHB 5CAEB 2C7RA 3CIFA 2JD2A 4YI3A 4CMHA 2LV8A 3DMTC 4IRUB 3HKEA 4O2RA 3JD1A 1IG0A 5CHYA 4JL5A 4B3IA 3AEKA 1X1QA 5FI1B 2IU0A 4HAIA 3GH3A 4QYTA 4LXYA 4LF4B 4KYTA 1QHHA 4G0MA 1CUBA 3PRKE 2OBNA 1HE1C 5FAKA 2G83A 4JY7A 5HCNA 2BGWA 4M37A 3K5PA 5KNBH 4RTSA 2XECA 3T5GA 1F5NA 2BCGY 1TGVA 2XF8A 2WPDD 3H5RA 4RH0A 5CMLA 4W5JA 5BW5A 4FYJA 2W6JA 4M1SA 2P5TB 2O5EA 1Z63A 3C1OA 4LFCB 2ONZA 3FJOA 4KOAA 3W2HA 1ZIOA 3K9FC 1DLIA 2HO5A 3KEOA 2RGDA 5DYYA 1VYVA 3HM2A 4PSKA 4DDMA 4L4YA 6ADHA 2WKPA 2AEMA 3NPMA 1YE3A 1U90A 2HCJB 2OAP1 4NYIQ 3VYRB 3WBJA 4YV2A 3KFLA 4NYMQ 4XIYA 2H1VA 5EHGA 2ATEA 1N4AA 1GNPA 2NYUA 1FZTA 1KJIA 2AFRA 1LFDB 1IWOA 3RYHA 1FDOA 1KR5A 2JH9A 2NX2A 2PX8A 2NU9B 3NXKA 1M1UA 1A04A 1KJJA 3DPUA 1UBTS 5TS2A 5K7SA 3WMRA 2H4FA 2RCNA 2YW9A 3HR4A 4XDZA 5BWBA 3I0ZA 4CMEC 2FPSA 1JKJA 2WYHA 1XR3A 3RARA 1YRLA 1Z56C 3UJ3X 4YRDA 1RHRA 2Q1UA 3W6OA 4DQ0A 1U1CA 2QB5A 1ILEA 1U3CA 4RZXA 3RVKA 1KI7A 5AKZA 5GZ1A 1O95C 4JI0B 3AESA 3H1FA 3PYMA 1WZUA 3DBIA 3ADDA 3DC2A 3SIWA 1JZSA 2Q6TA 3QEBZ 1RCFA 2AF3C 3NBUA 2FEAA 3TIXB 3CRNA 1ODSA 2BM9A 1P44A 4LTNA 4P7JA 5CITA 5J4HA 5JEEA 3QITA 1CD5A 1XJWA 3LFUA 1UINA 3WG9A 1FJGB 2DWCA 2G5PA 3FVWA 3Q3CA 4TLMB 3CSDA 3GRAA 3HY4A 4D3XA 1PX0A 1TXGA 1YUMA 4DMHA 5B6PA 3KDPA 2QLBA 4QTZA 5AVTA 4W5NA 3IC5A 1KKUA 2VQ6A 3OWHA 3TIGA 1K1EA 1K08A 3EEBA 5IABA 2AC7A 5IN4A 2ZB3A 1QGZA 2VQSA 3ACBA 4AIRA 3V1YA 5ERYA 3SIRA 4X97A 4PM4A 3RV3A 4EHJA 1BXGA 2A84A 3QEMA 4HX5A 1PWHA 1R5BA 3FPSA 4N0QA 5LIRA 4LQDA 4EYGA 5C5EA 4RMJA 4GO1A 2HK8A 5AQ1A 5GP1A 1VIVA 3VO1A 3ZGOA 2H4JA 2Q1YA 4K8RB 1G9TA 1N6OA 1SQGA 3EVGA 3LKZA 3VPXA 1Y34E 2VPXA 4BO8A 5JBQA 2FX5A 2E4XA 5DM70 2PUFA 1G7RA 2ZIZA 3BULA 4YJKA 1A9ZA 3M89A 1P6XA 3IHTA 3MWKA 5JAQA 3QW4B 4ER3A 1F4VA 3BEDA 3MERA 3PE4A 1F38A 4YGYA 3ZE1B 1J8VA 1WKBA 1W93A 1NW8A 4K9DA 2CDAA 5A0TA 4EUEA 2D4AA 3WL8A 1GL6A 4G5GA 4J7AA 2P11A 2X8AA 3ITKA 2GJ8A 2RHRA 3TMYA 2V45A 4RA6B 4W5WA 2E9SA 1VA5A 1FJHA 1Q0UA 2VDVE 3ZWCA 2MOKA 1AQUA 4IDNA 4AICA 5CFPA 1W5EA 2O2YA 2QY9A 3KZ1E 1QK3A 1L7EA 1G7TA 4GXQA 3ZGXA 1O89A 4NRDA 2KJQA 3RVDA 4XOIA 4EYQA 2AS0A 3RODA 3IVXA 4IDAA 5EINA 5FF9A 3RRZA 3AM3A 4JS0A 4I9HA 3VKWA 4AO6A 2PE5A 2LUOA 1LBTA 2CFCA 3LWDA 3MTAA 3FOWA 3T34A 1UC4B 2GPBA 2JDIA 5CVCA 1TD1A 4UUNA 3I2HA 4V1CI 4XH9B 3RQIA 5C53B 4EKNB 3T5PA 4FJ2A 2ES4A 3N75A 2ZRNA 1DRUA 4D02A 3ZWVA 1Q57A 2XQVA 4A5OA 3HKBB 4D9JA 2QN6A 1Q21A 5CB8A 2OHHA 2I91A 1YB6A 3PKZA 1T9AA 5KNCA 1OXUA 1ZVQA 1AE1A 1CQXA 2CLDX 1V3VA 2VRNA 2YJ4A 3OTQA 4R05A 5SYNA 5JAHA 5JNUA 1RAIA 5LA6B 1CJTC 3MUEA 3RVQA 4KWTA 1XWWA 2EL9A 2HMVA 1M2OA 3VVCA 2B1QA 3W2IA 2BD0A 3FPFA 4C08A 4YQZA 4DKXA 3L07A 3ZK7A 1GPNA 4DJDC 2ZKIA 3MUNA 2EKLA 4HX2A 5JQGF 3CV3A 1J24A 2XWQA 5KSYA 1AXRA 2NYVA 4HN4B 1XHLA 4ZCMA 4XFKA 3R7WA 4TZ6A 2ZJYA 2ZRPA 3WWPA 3FZNA 4M9SA 4DMKA 1P1JA 3GGOA 3FWHA 3GN2A 1PSDA 4K8OA 5B58C 3VKVA 1GL7A 5EYPB 4BYMA 2I1VB 1N2IA 4O2BB 4E2FA 4Q4DA 5EZ5A 2GRUA 1W49A 1H8HA 3EX7C 3KXDA 2OHXA 4PRYA 1SWWA 1A4XA 3K31A 5L45A 3H1EA 3H9GA 1FA9A 2H1WA 5IT5A 2HF8A 1K92A 4HZIA 2NV2B 1M83A 3P45A 2LDXA 1I2ZA 2ZBPA 3O9VA 2A35A 2FVYA 3U3ZA 1M8PA 1UADA 3FSGD 1IMJA 3AEUB 3PA8A 4MW7A 4MCIA 1VPVA 4FFLA 3WGHA 2REBA 4PYNA 2K6GA 1KEZA 1FXWF 3MTJA 2Q6IA 4HP8A 4J1TC 4ZU1X 4TSKA 1JNYA 2E4AA 3RPEA 4EW1A 2CFRA 2ATIA 3AG5A 3LP8A 2O8EB 1E63A 3TZ6A 3G9TA 3PHGA 4D26A 1UEIA 3RNOA 5F51A 1H6AA 2M6SA 3GLIA 2QL9A 3OLWA 4ENPA 2ZAOA 1KZHA 1RPJA 2XIJA 1N57A 1OIVA 3G88A 3O38A 4KYVA 4B2YA 4QA9A 4EKEA 5CGZA 4TYNA 4RAQA 1KNQA 1RJGA 3PZRA 4F5YA 1OYWA 1B93A 4FXPA 3H9CA 4PFQA 2XUFA 3A9SA 1QH1A 4K3VA 4OHPA 3TG8A 3V7WA 3WIVA 4G3XA 2X1HA 2PR7A 4FTWA 3WK6A 2Q2OA 3KVRA 2WWRA 3BOSA 4QUHA 4DM4A 1SKMA 2OZEA 3Q3JB 4URHA 5EPOA 4AKHA 1OTYA 3O31A 2J67A 5ESRA 1M34A 3AFHA 4JNKA 2XOKD 3INGA 1VB3A 2V8OA 3BRCA 3DZBA 4JBIA 1YS1X 3QVSA 2MR5A 1XE3A 1BXRA 1GQYA 4LY9A 1S2OA 1YKSA 4UM9D 3LK6A 4TV8F 1L5GB 3SS8A 1ZVVA 2W4MA 3UAZA 1S2IA 2D59A 4B4VA 4DYVA 1XCJA 5LLSA 5JNLA 4CKCA 2D3TA 3N87A 1Q74A 2FZ5A 4IV5A 3UNXA 4Y1RA 1GM5A 1VIYA 3ZE7A 1NRIA 2MSKA 4LC0A 1K7FB 4DMFA 4XB2A 1IBRA 4BUJA 3TIVA 1OI3A 3EDMA 2JGLA 3M2TA 3PITA 3K30A 4DCTA 1RBMA 3IP1A 1UJNA 3WRYC 2AE1A 4D0GA 1Q7TA 3CLTC 4OY3A 5BR8B 4TLAA 3NNSA 3TBHA 4EO4A 1ENPA 4CM9D 3ZOKA 3SEQA 4B5KA 1TT5B 4ZVMA 1GDDA 4DEYA 1HE2A 3Q7QA 5C8YB 1Q1GA 1JIJA 3QTBA 5CJ2A 1E18A 2UUPA 3LT1A 3WB1A 3O8QB 4JH0A 4LSWA 1PEDA 3NHPA 5FI3A 2JAPA 5CX4A 4OBXA 3WLFA 1I7PA 2QRMA 3JVIA 1OFIA 4LBZA 4KACA 5LLDA 4KQCA 1OWLA 1ZUNA 1PR9A 2X2PA 3CLHA 1ML4A 1MV8A 3IERA 1VIAA 4QT0A 3GJ5A 5L4LA 2ZULA 3O8LA 4LV6A 4OUKX 3FJ1A 3SDZA 3QZUA 4FSHA 2R8PA 4PCLA 2VTDA 3H2GA 3BORA 3GUUA 2EC5A 4HOYA 4DMUB 3MD0A 1BH6A 1LLFA 1R9GA 3TTTA 4QM7A 2C5SA 3GO4A 1D9XA 2XE7A 3U39A 2JJ2A 2I22A 1NPYA 4YDHB 4YAJA 1TCBA 1B15A 3VYSB 5I45A 5FNVF 3WHPA 4NOLA 2V97A 2FJ0A 5GZ3A 3KKZA 2OILA 1RABA 3Q8XB 2SKDA 4TKVA 2QTAA 3I64A 3LBAA 3MTEA 4IYJA 1DQPA 5CT8A 3EYAA 2XVMA 4F7WA 4G5XA 4HO1X 1AF4A 2AMFA 2G63A 2VHZA 1A0OA 1AZWA 1RLTA 2PZLA 2QIPA 2FMHA 2XIQA 2AJBA 1OD6A 4RZUA 3WIBA 4CQMA 1MH9A 4FFWA 4WWHA 4WDRA 4D9HA 4YB8A 3HVJA 1G16A 3D6AA 3A6JA 3ICWA 3P26A 4LYDA 4XEUA 3WMFA 8ADHA 3E8MA 4C05A 1X7DA 2RONA 4G9BA 1BX0A 3T3NA 1CUIA 1TEHA 5EKSA 2HA2A 3IQEA 3KPYA 3WLMA 1Q1AA 1GZ6A 2R4UA 3CLSC 3IGFA 2IE8A 4MR9B 2JIBA 1RQNA 2Q9BA 4O02B 4O4IF 3I28A 4RK4A 1BKYA 1L7NA 2XUZA 3O8DA 2ZUFA 3FCYA 3MB5A 4WZAB 1UXHA 3P9CA 2NADA 5BRNA 1B4DA 1BDBA 3IQFA 3KSAC 1L6IA 2G4CA 2GYYA 1W4RA 4KUEA 5EHZA 4MRSA 1JFLA 1AJEA 1SUPA 2YV4A 3VKUA 2FPUA 2XE4A 3G68A 2Z83A 3F3KA 4TT3A 2I1LA 1RLOA 3HP1A 4ZOBA 5I7AA 1RBQA 2H1IA 4B3HA 1E1RA 3ELBA 1H4QA 2WWGA 5CLIA 2JFHA 1CSEE 4OP2A 4RHCA 2JW5A 4P3PA 5K0LA 5BV8A 1HNNA 2IZ7A 1PZGA 3SMVA 3WOHA 4CKXA 2ODAA 1MAVA 1GUFA 3TXAA 2Y0PA 4XPIB 1A4UA 1V4VA 4MUJA 4OHVA 1PHRA 4TUYA 3A6EA 2JLXA 3A11A 2XZDA 3T3IA 2GPNA 4BJHB 3TS1A 4U7DA 3IDOA 4YT2A 2X22A 5MN4A 1LRKA 1XTKA 1II8A 4TMYA 4YASA 2CLFB 1KL7A 2HFJA 3GGDA 4DABA 1EM8B 1MB3A 1T15A 2G7ZA 5YASA 5AJWA 4ROTA 3SQLA 4Q02A 2X4DA 3K0HA 3RUAA 5KDLA 1QG2A 3NDPA 3L0BA 3I9V6 3QK7A 4AG3A 4B6GA 1FYFA 1TMOA 4MQFB 2WD8A 1YZUA 5JHHB 5KUTA 3AVVA 1KXZA 4K6FA 4DVJA 5HOEA 2ZYRA 1E3MA 4RESA 1TQ2A 1FZQA 2FZCA 1SD1A 4YRJA 3C7CB 3MTIA 1H05A 1XKLA 4FSXA 5DWQA 5HQJA 1CZUA 2WOOA 4LA4A 2I99A 3FOEC 1DC8A 1U2DA 3LWBA 1P2TA 1AGXA 1GKIA 1ORIA 2NQTA 2X2FA 3SMQA 1BE6A 4YRBA 3I6ZA 5CM8B 4AN0A 1NE2A 3IV6A 3L4SO 1A71A 5K8LA 3DTVD 4NV3A 2ANCA 4NZOA 5JASA 3SICE 4K1XA 1RSZA 5H02A 5I4IA 4BU0A 1XRNA 2GR9A 2RG1A 3DTTA 4KR9A 5IZCA 3HGMA 3OM9A 2PT6A 4NY1A 3F2IA 3IT1A 4YMGA 5B5SA 2F3RA 3ZOZA 4DY4A 2FOXA 3PQ8A 3LXUX 2OFFA 1E4EB 1E62A 1YQDA 5L95A 4R1PA 1ZMRA 4MVCA 3DCIA 3U4AA 1NT2A 3L8FA 3M1AA 1A9QA 4QDXA 3JU3A 4BN4A 2YFHA 5F5XA 4KQ2A 1BWQA 2GJ9A 1JIKA 3CLVA 4I4IA 4EHAA 5JD5A 1TF7A 4E22A 2ZI5A 2KHZA 4NFLA 5AKKA 4LF6B 1G5TA 5JE8A 3VO8A 5JXJA 4RH1A 3JQ8A 1LBIA 4MUHA 5LP1A 4IS2A 1X1SA 2AN9A 2DTDA 2I67A 3DZCA 4JYMA 1N5IA 3DZHA 3LT5A 2H2AA 1FC0A 1TZJA 3GIWA 4BQPA 2VXOA 3BREA 1XZCA 4KE7A 2QP9X 3BH7A 2NQ2C 1AQLA 1OX4B 3FKQA 4GSLA 2WF5A 2B4KA 5FWAA 3U44B 1XQ1A 3CTPA 4Q00A 1G59A 1P7PA 1X9GA 1RQ2A 1R6UA 2IV3A 1N32B 3PGVA 5LXTA 4U0KA 1QC5A 5TR9A 1C0EA 4AJPA 3ICVA 3O1HB 1BXKA 1YQQA 1TKCA 1FLDA 4NCBA 1YXMA 4KR2A 3H5OA 4MLZA 2PSEA 3R9KA 1DLJA 1VZ3A 2GHRA 1VI6A 2D2IA 1E8MA 1KDVA 1E6KA 3E15A 5DW3A 5ER6A 4HF7A 3LBIA 3WK8A 5LP6F 1MJFA 2I2CA 2HQBA 4EA9A 4UHCA 5L51A 3AOEC 3C70A 4CEJB 3HYSA 3P2JA 3H3XA 4D25A 2QAJA 1KMIY 4AJHA 5JYEA 3IKMB 1RM0A 4N0PA 1QB8A 4M0EA 5TT1A 2WFLB 2I87A 4JZYA 4Y0NA 4GPAA 3EFEA 4BNLA 1GPUA 1RR6A 2W6ID 2IYLD 4O1HA 2BGTA 2C31A 5FTMA 3A1DA 3TLXA 4J0FA 4BNJA 5LQMA 4ZVPA 1PUIA 4O5OA 3Q98A 4S0ZA 2WA2A 3L2OB 5KYTA 3T9CA 1BW9B 1FW8A 1JG1A 1UR5A 2C97A 2JLCA 4XJVA 5TPWB 3KYDB 5CM9C 1EX9A 3DF9A 521PA 3W06A 3ELDA 4B2LA 1D1SA 3BN3A 2O06A 3U3OA 3UGTA 4WJLA 3I6YA 1JFTA 1JN0A 4RL6A 2F6RA 4AX8A 1H69A 2DHEA 3FN4A 1MB2A 3WGNA 3WIEA 1QPZA 1W4ZA 1C5KA 2DFTA 2VF5X 1BWPA 2ZREA 3KYJB 3SZ3A 4ZPJA 2CSUA 3ZJ5A 3ADOA 4Q4HA 5DTJA 5KKAA 5A9TA 5CBPB 4D41A 2I6SA 3DMDA 3TGPA 1WD5A 5B2ZA 3G59A 2J3DA 1OBOA 1OZGA 1OZ0A 1WDLA 3QWHA 4G41A 5IANA 4FI3F 5CFQA 2IUSA 1IB6A 2AQIA 2F43A 2WU4A 5CIQA 4C0HA 4EY5A 4LTDA 2Z6AA 1OFVA 3EYWA 4IRMA 1RJ9A 2IYYA 3M6XA 3FMOB 4DLTA 3D4BA 5DTIA 2JLAA 4NZYA 1BWRA 2VTEA 3PC6A 3OU6A 3UJAA 7AT1A 1USVA 2O8DA 1UK7A 5JD6A 2CDCA 1D5CA 2PU5A 2CT8A 2VJDA 4EH1A 2RGNC 1V16B 2JJ1D 2A7QA 4MW0A 4L22A 3CCFA 3BGOS 1IY2A 3V8EA 1GZDA 5K45A 3X0DA 1LPBB 4ARSA 4ZZ2A 3AYXB 4RTJA 4DXDA 5EP1A 2KPOA 4D4KA 3FUUA 2P0EA 2IEBA 4QQ8A 4X1OA 2M1XA 1OU0A 5B55A 3DKIA 4WNAA 4F5ZA 5IKPA 3ED5A 1YRWA 2J5KA 1KOFA 2NXCA 4YCAA 2IGBA 3Q8WA 4E88A 2HXYA 3I9KA 3OPYB 3FYCA 4Q3LA 1SXJE 3PQ3A 3USCS 4ENWA 2C7QA 1SOWA 3HCWA 1UT5A 1JVNA 3QXHA 4KK4A 1KO4A 3WQBA 2JLBA 4ZWNA 4GWLA 2DKNA 1EXWA 3LQRA 4HFNA 5I9SA 1GGKA 4NZ9A 5IBQA 3W77A 2FPGA 3SS7X 3FDIA 5CCBA 3OAAA 5DLYA 1NF8A 1NP7A 4JUIA 1TTTA 5AUOB 1PZMA 2V6FA 2Y27A 1ZN2A 3ASVA 3AR7A 2Q5QA 4Q34A 3LLCA 1ACLA 4B3MB 4TKMA 3NGXA 3PNQA 2POCA 2CJFA 2G17A 5KTKA 2OVBA 2IU4A 1J1UA 3K0AA 4HI0E 1YDWA 3AV3A 2CNNA 2RE8A 2I7TA 2YJ3A 1GITA 1OYYA 1ZD3A 1I32A 3NORA 2BMDA 2L2QA 4A6XA 4L7VA 1P4AA 2BR4A 1Y6GA 3HBAA 1C9YA 3DJFA 3UJ7A 4YIHA 4PPQA 3WLOA 4IDPA 1XO1A 1YZKA 4UCXA 2TMGA 4LNUA 5GM1A 3IURA 1GGNA 2YFKA 5DBEX 3HR8A 2FVXA 1KIFA 2FW1A 1IPFA 3DVAB 4O8ZA 2GK7A 1U3GA 1DEHA 4GC9A 3PNYA 3PGJA 4KAFA 2HSEA 2X13A 4BBJA 2ZTMA 1KYZA 2MJLA 1MO6A 3UGKA 4KJXA 5GINE 3WS7A 3SJBA 2FSFA 2YH2A 3PNSA 4NDNE 3EZ6A 4CM6A 3LYLA 2Y1XA 3LWZA 4IXTA 1W34A 5HUQA 1AUPA 3TR6A 1MB4A 2QSJA 4OHCA 2FMUA 4BQSA 3JQ9A 3K20A 5HG0A 3X1XA 2EFEB 4HNQA 5ICSA 1RRFA 4IJWA 4O4LB 3LCVB 1G3MA 3GLTA 4L9SA 5C46F 4LZNA 2C4WA 4UCQA 3R7SA 3D0OA 1SXGA 3WBBA 1T36B 1TAGA 4DXAA 4K03A 4MVJF 3OZSA 2PJZA 2YBEA 4QPCA 1Z6AA 1U1EA 2VLBA 5SZJA 5EHXA 2B30A 1PL6A 3Q7TA 3QXXA 1MNQA 3R0XA 1JA0A 2QXYA 1J8MF 3AIMA 3HFSA 4FMPA 1TUBB 4JNCA 4AY3A 4YRIA 1U2QA 4DM3A 4DC1A 3QVTA 4GG1A 4HLCA 4UPDA 3UW3A 1JLHA 4F2GA 3WL6A 4OI1A 1BOOA 4WI1A 2PXCA 5KTSA 2E82A 3EEYA 2YR0A 2C4TA 3CUUA 2XNSA 4HMQA 1XRLA 1Y4AE 3V2HA 1QWOA 4M53A 3T94A 3U0BA 2AE2A 3R4CA 1FTYA 3E2MA 2BDEA 1UPXA 1AIPA 1K0FA 2IKQA 4TLLB 2MMGA 4I3GA 3LQKA 4TXLA 4BP1A 3AVXA 1I3OA 1H4SA 5JW6A 2IZ6A 5AKXA 1SNYA 4UBLA 1TO2E 3F4KA 4GM4A 4BQIA 4MKRA 4WNCA 1GPKA 4C7BA 4PZAA 2R6R1 2VBCA 4REMA 1OAAA 2VPPA 2X5OA 3HNRA 3MBOA 5K6AC 1Z39A 1M10A 5AVUA 3EIXA 5FDFA 1ISPA 4BFZA 2BEVB 4BVGA 1CQZA 1QS0A 2A0XA 3AW9A 3TG2A 5FJIA 1MIOA 2H2WA 2PQMA 1RWXA 2WHRA 3BGIA 3GJRA 4FYXA 4JDPA 4WXMA 2WJ6A 3OT5A 1MXFA 2IDKA 5ALSA 5AUNB 4KQMA 4D0SA 1NF9A 3JQGB 1KK0A 2DFKB 4S05A 3R44A 4ARIA 3BSSA 1YGYA 2BPOA 3A1NA 2DHDA 4C76A 2H8KA 3R8FA 1L4GA 1ZI8A 2D1YA 4HEHA 3CRW1 1JDSA 2ILVA 3F7OA 3ZK8A 1PK7A 4H2DA 4YH1A 5K8TA 4BPBA 1P9OA 1NVEA 2YQ4A 2PM8A 1ZQ1A 4PY2A 1PJAA 1VJTA 2GUWA 1A97A 4K26A 4NJMA 5F2EA 3WMXA 4W4TA 1M2HA 3N59A 3PIIA 1YS7A 4FMBB 5ILQA 1D2CA 2W2VA 3O4JA 3ZU5A 4HDMB 3AF1A 4BCBA 1KIMA 2WBLC 1BU8A 1GUAA 1Y5RA 1GJRA 2ZSDA 4OI4A 5GJWC 2FK7A 3EEFA 3ILYA 2QM7A 1PT8A 1EK6A 2WJAA 3CKMA 2CXXA 3GCGA 5DBGA 1JP7A 1RRMA 3T5DA 3IMFA 1PG0A 1UBNA 1CFZA 1SO8A 2Y99A 3PRJA 4Z1MA 4JA0A 3U17A 1E7MA 3D7MA 2JFWA 4Q16A 3HNPA 2RFLA 3W2TA 4NAUA 1LXCA 1LF0A 1H0SA 1RYMA 5IZCC 3UBTA 2EBUA 3KL4A 4CKWA 5FA6A 2H52A 2IA5A 4ZO9A 3FE2A 1XCLA 1YFJA 5JNVA 1MO2A 3P96A 3OY7A 3B9PA 2IZOA 3G2PA 3HBJA 1D8AA 5DYNA 1XOIA 2B69A 1TTPB 2DUUA 1SKYE 5KYXB 2YX1A 1X80A 4ZCQA 4F8JA 2WHPB 1DCTA 1ZJYA 1BYUA 1DSSG 2VHTA 1M33A 3DZ8A 4JJIA 4WFJA 1BG6A 4X63A 5EXXA 2AKEA 1FYDA 1Y8CA 1I4LD 4FU0A 4GMHA 2OAGA 4A82A 1LVHA 4OAPA 1KKLA 2WG0A 1EB8A 4MMXB 4NH0A 1GG2A 2GZ3A 3FIJA 3SQNA 2WTUA 4IP0A 4MRNA 3AY0A 3EGXA 2B92A 4KH0A 3WSTA 4FNGA 4L8FA 4IG4A 5FL3A 1VL6A 2P5SA 4CNQA 4OGWA 5ARDA 1K6EA 4ZT6A 4ZAVA 5HS6A 3PU6A 5KVQA 5KOIA 3EULA 1ZGAA 3OCUA 1FFBA 3LF2A 3WAKA 4MVWA 4UNPA 4AMZA 3F8SA 1QG6A 4AZTA 3N0TA 4RADA 5ED4A 1EG2A 1FDIA 1JE0A 1O0SA 2YHBA 4LE0A 1V4NA 5ALKA 3MINB 4CG1A 2GD2A 1NQWA 1G5HA 1DC3A 1ZHHA 5H81A 1T91A 1NJSA 3AR5A 4Y6GB 4UBMA 3WIOA 4R0VA 1T9HA 2HNKA 3CT6A 1XXHA 3IOYA 1QLJA 3KPWA 2HNBA 3G23A 1TK3A 5EWLB 1G5FA 3R8XA 1PFUA 1PKEA 2QTZA 5KIAA 4HLUA 4OREX 3FPGA 3AWDA 3BBLA 2NXNA 3FGNA 3UK7A 1PJCA 2NO9A 2PWBA 3F5QA 2NPFA 2WM2A 4GOJA 4L5BA 4QU8A 1V11B 2DU8A 3IO5A 2AX4A 3PF8A 3QYAA 1F60A 2XITA 4F6CA 1HSZA 4TKUB 1KYYA 1CUAA 2P7IA 1L5KA 2MINA 5KVAA 4WUTA 2JDID 3JD2A 3D8UA 3KSMA 4IZIA 3TRFA 4BKUA 4CG2A 5LQRA 1CUWA 2C42A 2JEZA 2BR3A 2EDCA 5CIWA 4ZKEA 2WY2D 1QVWA 3VC2A 4Z7NB 2Z04A 5H16A 4A73A 3LIIA 1YQ9A 1LSOA 4ATNA 2WYWA 4I9NA 3A05A 3EZYA 4EELA 4CW7A 2XV1A 4W1SA 2Z95A 3ONEA 1BYIA 2A1UB 1EUDB 2REOA 2B8TA 2WUGA 3QU2A 4FLEA 1Z15A 4I1YA 4P32A 4XSHA 4ZVNA 4KR6A 4X8OA 1GSOA 1QO7A 2QZJA 4MW9A 3H5AA 2X19A 5HZKA 3EDYA 4BJ5A 4JI6B 5JWOA 5JZBA 4B31A 4QQFA 5AYVA 1GNVA 1Q6YA 2IYUA 2ZWVA 4NU6A 2XCUA 1EUCA 2RHHA 4LI0A 4EG6A 4K9SA 5JXGA 2L82A 3EDQA 4IMRA 4CMAA 4BGIA 1T8YA 2P9JA 2VSFA 3IBYA 1PV4A 2CC2A 4EJ6A 4WN9A 1OI2A 3OF2A 5G0VA 1N6PA 1PR1A 4JLSA 4O3MA 1XZHA 1X0XA 2JJ2D 2YY6A 4KIGA 4QUDA 2QZPA 3OTHA 1Z83A 2GFIA 4IX1A 4L0QA 2GXSA 2NYRA 2V9ZA 4DIDA 1U8TA 5DN6D 5LQNA 2JIPA 2FUG1 3KR9A 1SOAA 3GGSA 3EGVA 5FT9A 5B4VA 2WT8A 4NBTA 2O8DB 1MQSA 1UZLA 3NBKA 1T8SA 2QNIA 1P60A 2OBXA 1PZNA 1IY9A 1K4YA 1ZD9A 2JGRA 1I10A 4P2BA 3AP2A 3PJEA 1C3OB 4DQLA 3AL0C 3UC5A 2J3KA 4HGZA 3W9BA 4DR6B 4HFRA 3FDZA 1JAHA 2H5EA 3C3PA 4GKBA 2YWGA 4JLAA 4ZYTA 4I14A 2IS4A 1LK5A 1ZG3A 4F3NA 4BZPA 4MV1A 1CEEA 1YHNA 4M0UA 4X5OA 3IQXA 4HADA 421PA 2E0IA 2NTNA 3JSAA 5KX5B 3CEAA 3R0JA 1SCBA 2AVNA 1LRLA 1QKIA 2VO1A 3TL6A 4C1NA 4ZI7B 4DSAA 2H4XA 4G0XA 1Q11A 4RTRA 3RUDA 3OCWA 4INAA 3BA6A 3R40A 2Y68A 3NG1A 5GONF 4BTLA 2N47A 3GARA 1FFAA 1XVVA 4PBTA 4U00A 2WQ7A 3MILA 4RLQA 3VFDA 2D2XA 4FGUA 3PTZA 4X3CA 4YONB 4E1VA 2HUNA 2PYIA 2DHQA 3FDJA 3LUPA 2R1TA 1VBFA 1SH7A 2HLNA 5C51B 2B98A 4U6SA 1X87A 3RTCA 4CHGA 5KAMA 3B60A 1WOYA 1YA4A 2DPXA 4E12A 1G5RA 1HR0B 2REQA 2IK8A 3FUTA 1NV9A 3UT5A 1W52X 1T2DA 4C7OB 1MVNA 2H1FA 4GOXA 4H16A 5EJFA 3T12A 4M8NE 3DBLB 3OQVA 3PDIB 2KLHA 3BD6A 3QWFA 4OBBA 3PGKA 3RTEA 1WUTA 1SPXA 2AFVA 4WZZA 1PJSA 1O96B 2IF2A 2C29D 2EYUA 3O26A 1EXNA 1W36C 4RH3A 3HKDB 2A5DA 2ZUEA 1YL6A 4G1VA 5CDFA 1E3WA 1CJBA 2PS3A 4O2BF 5K03A 5GVRA 5ELXA 2B3DA 3EJ6A 1WCWA 1C81A 5LZ5A 4JP8A 3F7NA 4WT7A 4PINA 3DZIA 4Y7DA 1ZC3A 4YXWD 1XNHA 2WV7A 3EIQA 4UZEA 3EPRA 5HK9A 1USGA 2AN1A 2Y1DA 3ETGA 3NBXX 5TSDA 3QKRA 2JRLA 3W78A 3O93A 2APJA 1MZVA 2BCJQ 2WYUA 4FKZA 4B0PA 1JVBA 4IGKA 1UQRA 5EIEA 3TAXA 2ERCA 1ZN7A 2CCJA 2OGUA 2Y6UA 3AUYA 4BAGA 1WU8A 3OZXA 3LCCA 3JQ9C 3R3VA 2R8EA 5BSHA 5HBGA 2KYRA 5KTMA 4IXWA 1Z3CA 1KF0A 3RKUA 3B6KA 2WTEA 4B09A 2LIVA 2PUCA 4YC7A 1OWPA 3PX7A 4UUQA 1N2JA 1H5NA 2G67A 4R3UC 3S55A 2C2XA 3OJXA 5I4CA 1KMNA 1UDXA 2N1BA 5KAPA 2B1JA 2AUMA 3BF8A 4N4AA 1K6JA 3A6GA 5JZSA 3QVWA 2G40A 4HWTA 2QMUA 4KLAA 5E8RA 4UMVA 4EVSA 3SN6A 1VI2A 4IDQA 4YEDA 4RYLA 2NU8A 1Y1RA 4PRKA 3H9JA 3QVUA 3KZMA 1A4IA 1JEDA 3NC1C 1Y5NA 4W7IA 5ECYA 4D6PA 5CA1F 3GZJA 4ADSG 5FOQA 2Z9CA 3HY3A 4F4JA 1BFUA 3DEKA 3SC2A 3OT1B 1T5IA 1E94E 3UAXA 2CE2X 1JB1A 3ZCQA 5ADHA 4W9NA 4GI7A 5DBHX 1R0ZA 4ZMBA 5FX2A 5LP6A 4YHHB 5FYQA 2IITA 4J0CA 3D0QA 4KN9S 5BQXA 5G02A 5E38A 3OQOA 7ADHA 3Q3VA 3QMPA 4E2XA 2FP4B 3MGKA 2DE0X 5JJCA 3NVKI 4RMGA 2HQOA 2H06A 1K97A 1ZUWA 3L4BC 2OO3A 1UP4A 2QG9A 3NX4A 4JOBA 4UTXA 2PT9A 1JYSA 1WXXA 4PYJA 5H9WA 3TH5A 4ARUA 4D57A 3PI7A 4ERNA 1HLGA 4YFYA 1SHUX 2GILA 3KOWA 3QNUA 1KY3A 1QO0D 1U3VA 5E6UB 3SYNA 3PYXA 3FWKA 1CR0A 3IP7A 4MDEA 1A2BA 2R8OA 4KXXA 1GGEA 2B82A 4ZDWA 5K3CA 4AJ2A 3VR5A 1NNSA 3LOUA 4FFDA 4Z9BA 4Q19A 5C9ZA 3OPYI 2BW0A 2W00A 2YY5A 4MP8A 1N34B 1YOBA 1DC7A 2GN9A 2G5GX 5CK5A 5K6AA 1M1XB 1U81A 1NBWB 4FKBA 3VV3A 5IUNC 2ON6A 1UMKA 2QLMA 1QYDA 4CWAA 1SQFA 1GYRA 1IBSA 2I6TA 2GEKA 3RSQA 3GL9A 1L1QA 1WDMA 4TS4A 1XDBA 1RHJA 2FZWA 3LYAA 1NT4A 1T5OA 1ZOPA 3DEIA 2QQGA 4M8SA 4WACA 2OXTA 3T9FA 4D3SA 1RWKA 1KJQA 2IZ1A 3ZGLA 3ACCA 2WTXA 1IVNA 1T5BA 3OWXA 3UCFA 1A8UA 1H2ZA 3K32A 4GYKA 4KO3S 4IDHA 4JX9A 3I01M 3GJYA 4Q03A 3ZCSA 3NS7A 4DCUA 2GK6A 3A0RB 3AINA 5F52A 4YFVA 2BKUA 1F6DA 4K05A 4IQFA 1P33A 1XTIA 1WHTA 5C34B 2OZKA 5G4LA 3BJZA 4PZZA 4MUNA 4QVIA 4Q7JB 1YVUA 5FULA 5AJXA 2HPZA 1NBHA 1UPFA 1XTSA 1P7ZA 2O0LA 1ZINA 3B9BA 4RD2A 3W8DA 3ERCA 2XCLA 1PO7A 3PFFA 2O19A 1EWVA 5B6IA 1F2TB 3LO8A 2QROA 2ZAGA 3I9LA 4J6EA 4AY2A 1VHJA 2CLOB 3NBYC 4V38A 2HRZA 4ER5A 1UJ4A 1WVMA 2AOXA 1E2HA 4QREA 4C4YA 2M1ZA 3F5SA 3HJCA 4MQ6A 3SY8A 3D8NA 1X2BA 1U2ZA 3CN9A 4B43A 3H4MA 3LLSA 1KEPA 4GPEA 4PC7A 3NVMB 5IT9A 3RC7A 3Q2OA 4HQFA 3RFXA 4GZ6A 3O8NA 1QIFA 3ROGA 5FOWA 1AHNA 1ACJA 5BYAA 4KX3A 2HDHA 2X3UA 1C7QA 3ZLTA 1KK2A 3FCSB 4D9NA 1OJ7A 2P9TA 1MHPA 5SYAA 1S4QA 1XZJA 5TVGA 2VA8A 5LBIA 5TJ9A 3E2PA 3FCUB 4KGVA 3UMYA 4FNOA 3JATB 3PC2A 4FCWA 4ZOLA 1V43A 1PSZA 3SQOA 4JEMA 3GJ7A 4B7XA 4OAOA 3MJRA 2DPLA 2HLHA 4KQKA 2PUEA 1E9RA 4DFDA 2CNOA 4B47A 3WZLA 2VTBA 4LY3A 2C95A 3QE9Y 3ICEA 4EEXA 4RF2A 2R66A 4F93B 4URVR 2ZSJA 4GUDA 1VGVA 4HQ0A 1XPRA 1C7RA 4P98A 1XTZA 1EZ4A 1BS2A 4KFRA 4OEHA 1GQSA 1V7ZA 3L6BA 4LJ6A 1RPNA 4OUDB 3WLTA 1GYPA 2H2IA 3CKLA 4XQCA 2O14A 1I7NA 3K4QA 2O2IA 4ENRA 3RU7A 2AYXA 3F3MA 1HC7A 1DO2A 1JPVA 2CXUA 1BSVA 3OUZA 1YR1A 4NBVA 4RACA 2BI7A 2CJWA 2VDKB 3I2KA 5CCEA 3UXMA 3OH8A 4IDFA 3UW1A 3ZUPA 4YROA 3IRUA 2RMKA 3WB2A 1PLKA 4TTSA 5T7BA 4OYHA 2R0QC 4AJ9A 2FLVA 3KKLA 2GYVA 4XM2A 1OTXA 2IXDA 1KWGA 4D5EA 1AURA 1PS9A 3HA7A 1J90A 3TSOA 1ECCA 5H1YA 4Y1EA 2NT4A 3QMWA 4BGUA 4IRXA 2FFQA 4D9FA 2C9OA 4HVLA 1XQ9A 2KB0A 3SS9X 1OXBB 4S1VA 5TMEA 4RM2A 4NF2A 1BQ3A 1XQ6A 1C9JA 1QHNA 2HGSA 1GTL1 1GCGA 2RI6A 4KMSA 4XVUA 3R6GA 5KSOA 1WMAA 2RARA 4C7XA 1NPTO 1NUUA 3D0RA 2IIPA 3KD3A 2QJRA 4DA4A 2X42A 8ATCA 4O5AA 3KFVA 4PGMA 1LDEA 2O8CB 1TVCA 2OK8A 3FTQA 3KVOA 1Z37A 4FYWA 4L5IA 4Y2JA 3WKEA 4ZYYA 5HJ5A 1NX6A 4HGQA 4GVPA 3VZCA 4LKOA 4WZBB 4Y98A 4QUBA 2BN4A 5G0TA 3SAJA 5TVKA 5I8WA 5JATA 1KP2A 2W5UA 4DBVO 1VC2A 1AV6A 4DDTA 1DKRA 2G3YA 1YBHA 1BQEA 4JYZA 1JHDA 4JSTA 5IAAA 5B4TA 2XZLA 4J0KA 1ZOSA 3ZX5A 4QOIA 2WINI 5FUBA 3C6KA 3IEMA 3IQIX 1CIJA 2IOFA 1BVYF 4RHUA 5LXTB 1E6UA 4D9MA 4B8YA 5LA6F 1G5PA 4F92B 4AMUA 2O8BA 4QDZA 5IJXA 1XDZA 2YIMA 3JQAD 2ZR9A 3RAGA 1D0IA 4Z3KA 1RJDA 1LQUA 1XQWA 2Q07A 3VHXB 5C3MA 2R1ZA 3QPDA 4AQDA 5GOTA 3R7DA 2FEWB 5JH7A 1SK8A 2NT3A 3SFTA 3VRHA 2OGTA 2NZUG 2R6ZA 5JCOC 4P34A 1JEEA 2PZKA 4I1RA 4JOQA 4HDOB 5LB4A 3WYEA 5B57C 3G0IA 4J6FA 1L5NA 3HJBA 1H8HD 3TQSA 1W8DA 5F3WB 3O4RA 1AA9A 3A37A 5M04A 2V1XA 3BG5A 3P8ZA 3HXOA 2PL1A 2NIPA 3FBTA 3NR2A 4KRXA 4QXAA 3ENWA 4LRYA 4EI2A 4DTIA 4XQGA 4GMDA 4N41A 3EQ9A 1BX1A 2XUDA 3F5FA 2HT1A 3BA1A 1XEAA 2CJYA 3SIPA 5BT8A 2VC2B 2I1QA 3EPKA 3SC4A 4JXJA 3GLHA 3OFSA 5LMUB 1SBCA 4I5FA 5J2UB 3VHXA 4RPIA 1XG5A 3WV4A 1WIWA 2A9FA 2WF6A 1YCFA 2FEXA 2WSMA 3DDWA 3NHLA 3QHPA 4FFVA 4I8IA 1KK3A 4LRXA 2GX6A 4QRIA 1DXHA 5AM3A 5L3QB 4A16A 2E1RA 4OH1A 3ADKA 3RSZA 4U7GA 1IZ9A 1LBQA 1UT6A 1XTQA 5G41A 5EE0A 5DNYB 1FPMA 4DXHA 4EWLA 1V47A 1HE8B 1PEAA 1U0GA 2DBRA 1PFYA 1JYEA 3NHKA 5IP5A 1PL0A 2RC5A 2WKWA 3U6BA 1UDWA 1SHTX 4MEBA 2W4IA 2BL4A 4F85A 3TLEA 2EGUA 3OPNA 4WXHA 2ZCVA 3EPPA 1MPXA 4H17A 2EIHA 2EBHX 5DEIA 5IVIA 3VH4A 4HBZA 4CM3A 5BR7A 4U2EA 5GMOA 5I8PA 4IDGA 4F91B 1IVYA 5JH7F 5A04A 2AL7A 2J4FA 3IDAA 5ALXA 2JGDA 3ORHA 3SZOA 2CJWB 4OJKA 4AJOA 3GD7A 4UUPA 3TDKA 1L7VC 3RG8A 5DWVA 3BC1A 4IQ4A 4JC8A 3BTOA 4LJKA 4TGLA 5J1TB 4CMJA 4EY3A 1Z68A 2UYOA 3LPMA 3I45A 4ZJYA 1YL7A 3FPBA 5BR4A 1ZC4A 2VZLA 1F0PA 3KRTA 2QOEA 2J6BA 1VKNA 2ZTSA 4H1TA 3ZGNA 4OQNA 3MG9A 2GUGA 2H1LA 3OZRA 4ZODA 1PT6A 5F2KA 3V1KA 3ZWNA 4RQUA 5K0NA 4JITA 1RWQA 1MAWA 4XDYA 3KAKA 2PR2A 4RGQA 1P2UA 2HWWA 4ZCTA 4BVEA 4Q5IA 4Z9XA 3TLGA 3T3OA 4DJTA 2OL4A 1SKAA 1MABB 1Y9EA 2WJYA 4IVQA 4LZOA 3UMBA 4EDHA 4PPFA 1PWXA 3EY9A 2W48A 4WECA 3PUJA 5LDGA 3TCXB 4H3SA 1NVVR 4DSZA 1TZCA 3A1TA 2ONKA 4DMGA 1SM4A 1V9SA 3N2GB 4G26A 4P9NA 4UOEA 1A8PA 1TMYA 2J3MA 1N2OA 2ZWMA 4M1QA 2OK7A 5JOQA 1W36D 1BFDA 3N2ZB 4R0NA 2AI2A 4YHBA 4INPA 1CIVA 1LWOA 5EWJA 5JJBA 3CLSD 4J16C 3SOPA 1TAHA 1UF9A 3IBTA 4HQ6A 5CLFA 2FPXA 1XNQB 4PAWA 4JGIA 3KJIA 5A2GA 3CVOA 1HOTA 4ND1A 1QGAA 1UUFA 1VPTA 2P75A 1GRRA 4LJ5A 1MR3F 5JG7A 5LC1A 3TSWA 1SG9A 4QC2A 2IPOA 4YK7A 2WHQA 5C1IA 1RYDA 2FE4A 1MQAA 2WTBA 1P2DA 1F2UB 2ZT6A 5E9AA 5FQNA 3CJQA 1PFKA 3UKOA 1X1TA 4DA7A 1CRZA 1RMYA 4R1OA 3V3TA 4K6KA 4L73A 1N33B 3Q7PA 2B4QA 3OIGA 4EQ6B 1CETA 3D5QA 4EVIA 4KN5A 5IMSA 1URPA 3I05A 5K20A 3HJFA 2WG1A 2RG7A 4LYYA 5KZMB 5EVCA 1A50B 3IPCA 1G3UA 2Y1EA 3NUGA 4JJAA 4ABYA 5CDSA 2ORYA 1ESZA 4LGVA 5CYPA 2JHCA 2OD9A 5JSYA 3DXZA 4M36A 1G64A 2FSIA 4J16A 3BWCA 4MR9A 2B4TO 1YKGA 4U6NA 3U49A 2QT1A 2NAFA 1Y3IA 3V1UA 4CHTA 2O1WA 5HKAA 5EIAA 1RLJA 5BOSA 2EZ8A 4QOGA 2A3RA 3NYIA 3GLRA 1ZNQO 2QRHA 3O2JA 4HRAA 3LTNC 1UPAA 4HDCA 3WWYA 2VDPB 3GJ6A 4G6ZA 3EVEA 5D3MA 1MO4A 1P62B 1J8YF 2XVYA 1T34A 2GNOA 3FSJX 3P94A 2B8EA 3IA7A 4JHLA 2JIMA 1XYYA 1QV9A 3THWA 4QU0A 1QMGA 3NVDA 4F4UA 5TPZA 4L2IA 3UC9A 3W6UA 3ANTA 2JFFA 1N1GA 3A6FA 2O2GA 4JC5A 8MHTA 1E89A 3KYCB 5DJ5A 3G0OA 4GX1A 4OA8A 4PSAA 2DX7A 1ONBA 2O7RA 4KIFA 2AXPA 3T61A 4D80A 3HJTA 1EVIA 5I3CA 2QXUA 2X2OA 1J9GA 3FLMA 3MJCA 4IVRA 4R51A 1FVXA 1SZCA 1YRQA 2D00A 2H9YA 2PS1A 4LWZA 3T6KA 1E1YA 3GDHA 4PFSA 4I1OA 4C30A 3RWOA 1MC8A 1O9BA 2HSZA 3LPDA 4KLZA 1JSXA 1GAJA 5AKLA 3T38A 5G4KB 7GPBA 2AN3A 1KK1A 1ESDA 1QUFA 3W3ZB 4OIMA 2YIVX 2FQWA 2FKNA 3BCUA 4KSBA 4E46A 2F1JA 2Q29A 1PQPA 1TT5A 1T6BY 3HA3A 3KWLA 1CWUA 1ODTC 2QF7A 5FBQB 1I1OA 4NAVA 3WGMA 5E7JA 4MPDA 1KP3A 1U7OA 4C43A 1CR6A 1RLUA 4IWYA 2I2WA 3AH8A 4UE3S 1N4DA 3C74A 3L77A 3PCTA 4Y8VA 3CX3A 2BTQB 2PLNA 1JZTA 3H1BA 2CFSA 1IU9A 3PGLA 1JTFA 1H8ED 1U02A 3GEBA 1TJPB 1B74A 3LGSA 1EX6A 1FRQA 4AYXA 4LV5B 1GPBA 2V9PA 3HDGA 3OSUA 4G97A 4UXHA 3HXMA 2WWYA 2JANA 3CNOA 4AZWA 3H5VA 3IVAA 4OQ4A 4HAOA 1ZJJA 1MKYA 2Y1CA 1FFXA 3AXTA 4MQLA 5AW4A 5JFTA 3EUEA 3HLTA 2NSHA 2TMYA 4QATA 2P9YA 3IOMA 3U6KA 1T8RA 3T3EA 1U8XX 4YCSA 5JNTA 2GAFA 2JL1A 1NBIA 4P0PB 3QOXA 4COOA 1JH8A 1P0FA 4KGDA 2R5NA 3E2IA 2YCBA 3KDAA 4OHKA 5KJEA 4L4SA 4RK0A 2D0OB 3K3PA 1GVNB 1OKKD 2Y05A 2YZNA 1ARZA 1O6FA 3FCOA 5LBUA 5L3SA 1B2LA 1UFOA 3MEQA 4C7KA 5BN1A 3FZYA 3GGCA 1YE5A 2XLCA 3G2JA 3LX6A 4I3FA 3I3SR 2AG0A 4NR0A 5D85A 2O2CA 3F6YA 2TYSB 3GELA 2YYYA 2JGAA 3GG9A 3GVCA 3LTEA 4FMDB 4MJXA 2DR0A 2VSXA 4KAJA 1W1UA 3EXHA 5TGTA 1V5GA 1YBAA 5DI9A 3T0IA 1L5SA 2CGEA 2C4UA 5EMJA 3NATA 4KMOA 4KBYA 2ZVQX 4C89A 4M8LA 3UBMA 2E89A 3EXHB 5PNTA 5AW7A 1RBYA 2HJ9A 3ZHYA 4FVTA 1JV2B 2XNDA 1FRVA 3EISA 2AA3A 3I53A 2VJPA 4MGZR 1JXQA 1RYNA 1EUCB 3M4XA 5DTMA 1PK8A 4H27A 4MGIR 3X1WA 2ZYUX 3P4XA 3I32A 4O8CA 5IKEA 1YDHA 2IY9A 4Q9HA 5P21A 2BHRA 2JLRA 5CFZA 2PRIA 3WA7A 3WBKA 4REQA 1M72A 3VR5D 2QE6A 5BSGA 3NQ41 3L7KA 3NEYA 3QBDA 2FN9A 2XGSA 4X61A 4CU2A 3ZJVA 1BVUA 5DE3A 4KUHA 1E2KA 1GZHB 2OG1A 2O2HA 4MGEA 4LWPA 3GAAA 4M6WA 4H77A 2DKFA 3GRUA 5FR2A 5JAPA 3T9BA 4NK4A 3IAM1 1M1YB 1J5EB 3WDKA 2VUIB 5AK4A 4H9GA 4UUBA 3ZDYB 5ITZB 2B61A 1J0CA 1D4OA 1VE6A 1R8QA 2CXQA 3DWFA 3ZH2A 3S3TA 1D2MA 2VNJA 1V7PC 2HD4A 2QMOA 4ID9A 4X71A 1VHDA 3HO8A 4YI5A 2HDOA 5BNWA 3GLGB 3OQ6A 4FINA 4JEHA 5J47A 4O4HA 1Y3CE 2EAUA 4FD3A 2DFPA 2C58A 2GZRA 5FYDA 3G7SA 4RVGA 2QUHA 2MIIA 5HP4A 2WSYB 1NC3A 3N76A 4FZJA 4LZLA 3H8WA 4PNPA 5HCIA 3UAVA 2JIZA 2G70A 4U9UA 3RRFA 3AVYA 1U0EA 1LPMA 1EAMA 1EFDN 1SFRA 2GO1A 4A15A 1TYAE 1C0PA 5B3JA 3A04A 2EW8A 3V5NA 4B32A 4E51A 4JGBA 3WGZA 3GRRA 1HDCA 3JR3A 2AFIB 4GOND 4F2DA 1T1RA 3X44A 3L8ZA 3HM9A 2W9XA 1JU3A 4IF6A 2I1WA 2NXJA 4DLYA 4AU1A 2PUBA 2RIRA 2W2QA 3UAOA 5EWJB 3UANA 3UAGA 4RF5A 5MN5A 3B3GA 1SWVA 2YXPX 3PPVA 5H3CA 2IUYA 3EZGA 1PTKA 3GFGA 3IAEA 4P33A 4CV1A 4Q7QA 1JEAA 1Z62A 2NO6A 1VFPA 3ENNA 3IFSA 1WETA 4QUAA 1RRVA 2X77A 4OFZA 4EG8A 3UK2A 4BNTA 1H5QA 4UFNA 1OH8A 5CU7A 4X3OA 3QQPA 2JRCA 3DW1X 1S8AA 2J0UB 4ENUA 1J33A 1SAYA 1DBVO 2QYSA 2X0NA 4EKYA 1FFXB 1MVLA 1UDCA 3DP7A 2WHPA 3SYLA 2H1HA 1E1CA 3A10A 5EVJA 5CFOA 1DIOB 2DF8A 1TJ3A 4XVRA 2VP3A 1GFSA 2RHBA 3OG9A 1A5ZA 1V4BA 4BUCA 1B0UA 5I9BA 3KD2A 3RFUA 3V00A 2F7SA 5F7OA 2ZE7A 1JR3E 1U9IA 3H11A 3KOOA 3TL2A 4Q9NA 4ACAA 3OU7A 4BAZA 4DZTA 3G8DA 3ZNQA 2AC2A 3PB3A 4XGNA 3AU8A 3HB9A 5K99A 1GU0A 4S2EA 3LUAA 3B13B 2C98A 4NECA 3RYHB 3UK0A 1NJGA 1KO1A 2EQ5A 4MKFA 1S2GA 4XLZA 2WF7A 4RIHA 3TLZA 1G3QA 3NCTA 4WXYB 1KAQA 1BA2A 2VJNA 3DKPA 3Q2IA 1AKTA 1CW2B 2W71A 1E9CA 2ZRAA 4PX2A 4Q9KA 2G0AA 2UKDA 4ND8A 1CCWA 4QBKA 4YCMA 4WKCA 8ABPA 3KSZO 2WJZB 2FZLA 3ZI7A 1G5QA 4A23A 4HTAA 3WWDA 2XR1A 3B1YA 3KE8A 2ZYWX 3DS8A 3VNQA 4HBGA 3X2EA 3R6TA 1T8UA 3ZS9A 5CFRA 3PCRB 4GLOA 5A9SA 1KEKA 4DNPA 4FC6A 4DG8A 2Q9UA 3O2SB 4HVTA 2VRBA 4PZUA 1XD8A 1DJPA 3ECCA 2PRKA 3LM8A 3CWZA 3VH3A 4MWDA 2RGXA 3AO0B 3I8SA 4U5QA 1Y8QA 1W1IA 5AVOA 1Q6ZA 1D2EA 4J2HA 1RLIA 4ZCIA 4A10A 2GK4A 4HAUA 3OJWA 5EUBA 1PR2A 3KQPA 5A5DA 3CR3C 1OH7A 4PGGA 1DIGA 1U2GC 2QHXA 3HU1A 4HT3B 4LI3X 3KM0A 5HIAA 2HSWA 2GYUA 4IHJF 3KUCA 3MBIA 2QTVA 1CRWG 1WABA 5ITVA 2AWNA 4AJNA 1A69A 1J0EA 4M8KA 1R6VA 3M3HA 2WWWA 4BVBA 1LFAA 2BM8A 3PXCX 3FPKA 2OFPA 1PR0A 3V4OA 4OGFA 1JDBB 3JAWA 4JT8A 2CZCA 2IP1A 5BVGB 5ITWA 2H48A 1XEWY 2OHFA 4O0LA 2OBFA 4Z4IA 4KFUA 5FBRB 3SDSA 1DFIA 1T0UA 3PQ5A 4UU7A 1IZ7A 1D6NA 3HS3A 3O1IC 3K70C 1SOMA 2V3WA 5JSQA 4AF7A 2G5CA 1DL5A 1B1AA 4M8IA 2NO7A 2EQAA 2QN7A 1Y1QA 5AOAA 4F2WA 1ZX1A 3JY6A 1T9GR 1RIIA 4AJEA 2OWDA 3RRJA 1CY8A 5KHOC 4YMTA 1EDOA 3E8SA 1TC2A 2NM0A 4D9BA 1UBCA 2BT4A 4O2AB 4RWZA 3OZIA 1UZMA 4ZXFA 2OB2A 4OAQA 5JI2E 3RSFA 4U2KA 5BWLA 1ABBA 1Q16A 4S04A 1K7YA 2GD1O 3H1AA 4S0XA 4E1AA 2C2GA 3FGOA 5UKDA 1XF9A 2PQ2A 3N9IA 1G6OA 4JFRA 3WK9A 1U7XA 1Z4PX 3DE5X 1W46A 3LBYA 3O0DA 1ODCA 1QGOA 3S6JA 2IPNA 1BS1A 1ZZGA 3Q3EA 4L8WB 1CY1A 3K94A 4LVNA 4RY8A 5LNK1 4OB7A 4GR4A 4RSHA 1EK1A 3RIMA 4MV0A 3IT2A 1DRJA 2W6QA 4K87A 4MJ3A 4CLOB 4PYOA 3M49A 4EL0A 4N6OA 1IY1A 1XJ0A 3HCCA 3KQMA 5I5GA 2F8SA 2FYTA 4ZAXA 4DN6A 2R62A 4HGNA 4PVCA 1JW9B 4OJQA 5KNLA 1M0TA 1HGXA 1RXYA 2CZGA 3EUFA 3DZGA 3OBIA 1KARA 1LBSA 1J2TA 2GHIA 1T4CB 1N5LA 3H2SA 3CKYA 4OXRA 2FMKA 1INLA 1D5WA 3P9ZA 4FFRA 3AWIA 1IVSA 3IE1A 4HRYA 1DIHA 3HYNA 3TOSA 1ZU4A 1JHVA 4PG6A 4M9CA 3F8WA 3OTGA 3NHFA 3WLJA 1EXDA 2WWTA 5I4KA 4H4EA 2AVDA 2FUG6 3A06A 2MYUA 1SCDA 1YZFA 1A96A 1WSWA 2QPAA 2XMRA 3WL5A 3DVLA 4MA5A 1XTPA 3NIDB 3FWPA 1HL7A 1KI8A 3DE0X 3ET4A 1IATA 4RK6A 4XR4A 1LW6E 1RQGA 1X39A 3RRNA 3P52A 4X60A 4YUWA 5MHTA 3BWEA 2ADOA 1V16A 4HGPA 4XIIA 4NHEA 2EKDA 5T6MA 1DV2A 4N54A 4NPAA 4TSFA 1PE0A 2QTRA 2H2FA 2OM6A 4B6SA 2FDXA 3PBKA 5JNSA 2D54A 1C80A 3MPUA 5LBTA 4B4WA 4CLDA 1N3LA 3PXBA 4KIWA 4H7JA 3L0OA 4JMPA 2GN6A 3WSWA 4CCSA 1QF6A 3KR0A 2V7QD 2QUIA 3A28A 1XAHA 3FFWA 3P0IA 4L76A 1C9DB 1EM6A 1KO5A 3IQHX 4YJFB 3QKIA 5G1PA 5AUPB 3A6PC 3M9XA 1PKXA 2QX7A 1NWCA 3UJPA 4BLQA 2EV9A 2VXCA 3QA9A 1WSAA 1M2EA 9LDBA 4NCJA 4KWHA 4MPTA 2F3QA 1W47A 3JZFA 1WXWA 3RVBA 3T0GA 4B6OA 5LJLA 1QP0A 3AB3A 2DB3A 2CBGA 2R8BA 2OA0A 2V54A 4KW7A 2WJJA 4JLKA 4PVDA 4S1NA 3OP1A 3U3XA 3SZMA 2PCLA 2RD2A 1AUVA 4YDRA 4WERA 3VKFA 5JD4A 4F84A 5IUJC 1NG9A 5KKNB 4PHTA 1KSGA 1HM5A 1PFQA 4HWOA 1PS0A 4HMPA 4HEA6 4R6XA 5E4FA 5BQFA 3RAFC 2J3EA 3RC8A 2OKGA 4IBOA 3COPA 3HUEA 4JA2A 4LX0A 2HY7A 3GPDG 4NBRA 1J1IA 4O25A 5E6RA 3LQ2A 3TNLA 4BX2A 2E5FA 1M2GA 5J2UA 1VBKA 2ASEA 4MQ4A 1CY4A 2G8LA 1HK7A 4DARA 2WD9A 4RULA 4OQYA 1N5JA 1QHFA 1RLMA 3RJMA 3ROTA 3DF7A 1PEKE 2EJCA 1KR2A 2Q6LA 5K0BA 1QZ3A 3DOHA 3N5KA 1BHO1 3T06B 3KS9A 5DXAA 1SIUA 4FZ5A 1RXWA 1Q3HA 2YOGA 4UREA 1USUA 2XYRA 4NFYA 4X64B 3MMSA 2QU8A 3FYDA 2QD5A 4O2AA 1Y5MA 3D4NA 3ECAA 1U8CB 2XUHA 1VECA 4UOZA 5CPFA 4BEBA 1D1TA 3V8MA 3FM9A 3QV1A 3W3AA 3V6LA 4EARA 2QS9A 4HAYA 1ONSA 3T7IA 2BEKA 1LK7A 3GY0A 4H0CA 1J56A 4WZBA 4G89A 4E2YA 4FEYA 2EIXA 4YMVA 3HMQA 1U3WA 2GZHA 3HQ4O 4Q0MA 3Q2KA 2PD3A 5EAIA 1RW4A 4ALIA 1N5RA 3PR2B 2F3UA 1F2VA 2GQ0A 5IN5A 4A0SA 2QSYA 2D5IA 4MRVA 1TEXA 2NTYC 1MW9X 1NNI1 4MA0A 3O9MA 4FWBA 4MTCA 1OHHD 3OQHA 3OTIA 2BKVA 4GBMA 4PLGA 4C4ZA 4NE2A 3L93A 2FH5B 2C9DA 1M0SA 1XTBA 4WH0A 3U3RA 4M7PA 4M88A 5EN4A 1G21B 1HTBA 3R5JA 5EHIA 3TMAA 4R71A 1G38A 1NLZA 4XIFA 1UAAA 3PX2A 3Q6NA 2QJTA 5KWSA 1Y6ZA 3WNVA 4X6XA 3ZWWA 1DQYA 4XFJA 1ADYA 1S8NA 1DBSA 2WAXA 3FRJA 3AONB 3GJ3A 2JCXA 4J0IA 2OCPA 1XLTC 1EINA 2ZFUA 2IRWA 4OQXA 1MHTA 1E1QD 4MDFA 3W5DA 2IYVA 1HO3A 1LEHA 3B1JA 3F6CA 4RD0A 3HHEA 3GI1A 1C3VA 4RFSA 5JXHA 1NVTA 4JWTA 1QCDA 4IXMA 3R3JA 5DHSA 4FQ8A 1HE4A 3PC8A 4BQFA 3TD9A 1XVLA 3RSOA 1WQ3A 4YMSA 4EUHA 3P2YA 1VL8A 2OXIA 3IDFA 1I9GA 1M7HA 1FIUA 1QAMA 3T1VA 1GILA 4K9PA 1B1CA 1FYWA 1OF1A 1R4NB 3HJNA 2A86A 5GGYA 2W42A 1C14A 1DO0A 2BGUA 2W4QA 1Y42X 3FTPA 4GM0A 1S8FA 3O83A 4KYIB 4F38A 4I5GA 2P9CA 4B9EA 4B40A 1T5HX 1TM2A 4DDVA 4ANFA 1XBTA 1VIMA 3OA2A 1CERA 3TQRA 2VFAA 1YTUA 5IZ4A 3B8HA 5F9HA 1W48A 2AFHE 2UYQA 5FB3A 1AOXA 2BGIA 4X0EA 4PG8A 4Z0PA 1DKPA 3JVUA 1ULBA 4KIUA 4WV3A 3REQA 5JYDA 5KPJA 1TECE 4FOPA 3I8XA 2HR1A 3AZOA 1QHGA 2ZPTX 4X84A 1VLMA 1NIJA 3Q41A 2VDUE 3ZCPA 3ZHXA 2CMGA 3CZQA 3FSEA 1G20E 1Y7PA 5JU6A 4NAHA 5EJEA 1LI4A 3ZI0A 3OZAA 1CUJA 5JISA 2W2LA 3C2QA 2VBIA 4OMDA 4D9GA 1N6IA 4G5QA 3WLAA 1VE7A 3QKSB 2QTCA 4MUXA 4RA9B 4TRJA 2EX0A 3IUBA 1YCGA 3UHOA 5B30A 2CLSA 2O5CA 2YWJA 4DMLA 3ZDDA 3IAS6 5HWSA 1TU0A 5AH0A 1EU1A 1YJXA 3R74A 2R47A 2JGFA 5DHAA 1DIRA 1TC1A 2CJXA 1U4NA 1QDLB 4P7KA 1IZYA 1MRZA 2VQ3A 3AGQA 1W73A 4QRHA 4WXRA 4BGVA 2BHSA 1KZ7B 2ISSD 4UHKA 5ICGA 1C9NA 1IDN1 2GWRA 3P9IA 4WNYA 3OE1A 3PQEA 1SG6A 1SUFA 2NUPA 4WPGA 4WOBA 5AO9A 4PZ9A 3U7QA 1AB6A 1E2JA 5M5BA 1YQUA 2I6QA 3OQMA 1ISIA 1GXSB 3F9RA 2J9ZB 4K3UA 1GKLA 1SULA 5JXWA 1XCPA 3RU3A 3U3JA 5C4GB 2BGRA 1GAXA 2PUWA 1T0PA 1U7DA 1FDVA 1RPZA 1KY2A 4RVHA 3RK0A 3WMWA 1WO8A 2IU3A 1EZZA 4TV9B 1FUIA 3DW3X 4DNXA 2V7WA 4KFSA 1MJHA 2XDWA 1WHSB 4Y30A 3SYKA 1TW3A 1C3LA 2O5VA 2C2ZA 3NAZA 1S3IA 2GBGA 5LZ7A 4B7UA 4RK7A 1FP1D 1UK9A 1ZH0A 2HWXA 3UWOA 4GECA 4D0NA 5DOZA 3GA0A 4H3HB 4H31A 2PO5A 5TQVA 3LV8A 5BPFA 5K8VA 1EGMB 2G77B 1TI7A 2CHFA 4GYJA 1HYBA 1QHEA 2PGLA 2EFGA 2ZJOA 3MFYA 5EFOA 1WQ1R 5LYJA 3VAYA 1W25A 2YWBA 4TWAA 3DBHB 2A94A 1P75A 3QKRB 4YV7A 3HSSA 1U98A 3LZCA 2JZCA 5FLYA 2PRYA 3DMFA 3W90A 4H1VA 1NBMD 1LA2A 1SBNE 2FW7A 3WYNA 1NW3A 4GNRA 4HEJA 4DCPA 2O57A 3P2IA 4BFXA 3H11B 3ESBA 1Y1LA 4B3TB 4M2LA 2MMCA 1XP8A 4G36A 4OXXA 1HNZB 3EZFA 3LAWA 4QJIA 3JALB 2N3ZA 3I72A 2QN2A 3R3XA 1T8PA 4UBOA 1X7ZB 2J32A 2CE7A 2VAVA 3C0KA 3MWFA 3S68A 2NUAA 1K68A 3GA5A 4YTEA 2QVZX 5TXGA 1A8IA 2CNLA 4PTLA 1JJFA 3KEQA 4C21A 3L0DA 4P22A 4BY9E 1B6SA 3ZBUA 4MHTA 3OFKA 4KTVE 2V4ZA 5K0FA 4HNUA 2CXHA 1G42A 5KU1A 1PV1A 4RUKA 1T8WA 4CEIA 3BRWD 4E5SA 3BZBA 3LL7A 2RHOA 3PDCA 3TBKA 2QG4A 3SSNA 4F5EA 4PBSA 1XAIA 4G4GA 3ESAA 4GDMA 2FPRA 2JCBA 2Z5VA 3EN0A 3IVRA 3VPBA 4DSUA 6REQB 3FTDA 1JQJC 2GJSA 3F71A 1YBVA 1F8UA 1CUVA 2DM6A 3ZVKA 1CJVC 4HNRA 4LOIA 2BSAA 2HIMA 3ZKAA 1E9SA 1VPLA 3E0QA 3I1IA 3I52A 4RS3A 4O0MA 5CP8A 4A92A 3MOGA 1MO3A 2Q0XA 3ZHOA 3BZUA 2DFLA 2Y4OA 3B9QA 4ZTUB 2BVNA 1JDVA 3KZNA 2JAOA 3T5BA 1USKA 4FFPA 4RU1A 2ADFA 2ZSHA 3M3DA 1CUXA 1EVZA 1L5OA 2X8JA 5TDHA 4UD2A 2VYFA 2VPWA 4MW4A 3G02A 4Q4CA 1GADO 2CV0A 4IINA 2GFHA 4PYMA 3MB8A 2I4NA 4GRAA 1IUOA 5CXXA 4KPYA 2M9MA 1P45A 1Q22A 3UJDA 4ZVUA 1RC0A 3AFOA 4OLJA 4MVYA 1OX5A 3JPYA 1O0BA 4UQLA 4LOHA 3L7DA 4RLHA 3L84A 2C5EA 1Z2CA 3F46A 1OVGA 1OFHA 3BK2A 3F9CA 3TYXA 3G79A 3OX2A 4LG1A 4X9XA 2V4UA 3E70C 1OWNA 2BKXA 5DP1A 3OX3A 3UCXA 1G6Q1 4G1FA 1EHYA 3KBBA 3LUCA 4BLUA 3PR3A 3OUUA 4QYMA 1PD1A 2H1SA 3VR6D 3VQTA 1M6VB 1WWKA 5KYXA 1QFXA 3QPVA 1YIDA 1DZ3A 1EE2A 1I7LA 1TVEA 1NW4A 3IDZA 4GKVA 2ZI4A 1GCIA 4JB0A 3ZX4A 1KVUA 1YAJA 4UVIA 1N9GA 1VOTA 2GLTA 2P0YA 3L7LA 4JLWA 4RVOA 4TKLA 4AKEA 2XYVA 1ESMA 3T3PB 4CFSA 2MINB 2MWMA 3M5PA 5IDWA 1JA1A 4RVDA 1K4MA 2JJQA 4N39A 4PPYA 2EX1A 3R5FA 3VYVA 2VA9A 4GMFA 5AKYA 1E61A 4TV9A 2PX5A 1RAGA 4ZI2A 4PSCA 5KQLA 2A5JA 3EARA 4S3MA 1B43A 1L4FA 4C0AC 4BP3A 2ZWAA 1YMVA 1EUDA 2Q46A 5FPPA 3UUGA 4LVCA 1HQDA 2C20A 1ZHFA 2CBZA 2E3JA 3DL4A 1SC6A 3HCBA 3ZTWA 3BXFA 4AQYB 4IXNA 4PO3X 2VBFA 5EQFA 3GPCA 5HMMA 1QK4A 2VP2A 2YRXA 4IMPA 4UVDA 5HKBA 4ENQA 3O4GA 2Z8ZA 2W6IA 1M2OB 1ZNWA 4F4DA 2HO4A 1BE0A 2CY0A 3HZZA 1DFGA 7MDHA 3R7NA 2Q1WA 1T2VA 2D06A 2JGKA 4CQJA 4L27A 4QEZA 1T1GA 1W5TA 3GJ4A 3NBZC 4ENSA 4KITB 1G6KA 1LX7A 1V3TA 5IPFA 5JFGA 1Q77A 2CXTA 2YJ5A 4P5DA 2R3SA 1BGVA 2BGNA 2D74A 4UD6A 4XYLA 4M1EA 2RGCA 1TLLA 1Y1KE 3P9SA 4I9FA 1G1AA 4XUCA 4RPLA 2D3WA 3AK4A 1SKBA 2D0IA 3L0SA 2XWJI 3PFBA 5HJEA 5JS8A 2VNHA 1B0AA 2ZRFA 4URXR 1XJ5A 3G6KA 3C14C 2BFCA 2LTAA 2YVQA 4HH0A 5KMGA 4M7RA 2HBRA 1DC6A 1WVGA 2KX7A 5ARCA 5H5JA 2N1MA 4IIYA 1JXOA 2ZW9A 4INZA 2WHEA 3LCUA 3QVVA 2JK0A 1KP9A 3GUYA 4BO0A 4H7EA 5A06A 1NVUQ 1Q12A 3PZBA 2D1QA 5L6LB 3I58A 4WXPA 2WNIA 3UZUA 3V4FA 5SICE 3GLQA 3J7AC 5DNDA 3TWOA 1ZP6A 4Y6PA 1R0YA 2RB5A 4MPJA 1FRZA 4PR0A 4R9SA 4Z3DA 4HNVA 3EQ7A 1COWD 3SM9A 5AW6A 4D43A 2GJAA 2ZCJA 3GFPA 1IN8A 3JYHA 4FR2A 3MJFA 1J70A 1QRDA 3BCSA 1X8KA 2NXWA 2ZBEA 4ZOQI 1NG1A 3GG2A 1X38A 6REQA 5DMHA 3VISA 4RHXA 1TCVA 5CA0B 1EK0A 1NMQA 4J29A 2H7VA 1FY2A 2XOXA 3OZVA 1Q2UA 4TN5A 4H4CA 1IEVA 2ZYTX 2VAXA 5G4KA 5TE9A 3NHYA 4K5QA 3UJ6A 1E79D 4BO3A 2VCEA 3DV9A 2PS9A 3FZQA 3PC8C 1N8SA 2XJ4A 3AOEA 1EFVA 2QM0A 5IHPA 1DINA 1E5QA 3GHHA 1WDWB 5AVQA 1H2BA 2C3UA 4UTVA 2WYIA 3LNCA 4UEKA 4Z5XA 2J5XA 2CUTA 2ZUBA 3M70A 2CW5A 3AM1A 2NU7A 2FDRA 3LNTA 1IOVA 5LKRA 2PG3A 3OAAD 3LHKA 2QTFA 2GLXA 4P4SA 5KTNA 4EG5A 3LOQA 3KUDA 3IP5A 1OXVA 2FK8A 2YASA 2UZAA 3UMRA 4JP1A 3BJIC 4LECA 1QH0A 3RS3A 3ABIA 2A2ZA 3V55A 1U4OA 5DB4A 1EHCA 1NR7A 3JQFC 3UO8B 3EF3A 3AHCA 4Z4CA 2GRJA 3G0BA 4XQ0A 3CGGA 4Z4EA 4LJ8A 1B00A 1MG5A 1MNAA 2OD2A 3CLRC 3RVRA 4B3CA 1SD2A 4YR9A 3DFZA 1DAOA 1YZNA 2G71A 3CQ9A 1NSYA 2E85A 2R6DA 1ZD4A 1SHKA 2FEPA 1SHZA 2IYXA 4GR5A 1JQLB 2O2JA 1Z4LA 1EFUA 3L1UA 1FVFA 4HDNB 3U60B 2B83A 3JALA 1NYRA 3TLMA 3NASA 3GROA 1NDHA 1GV0A 1IAVA 1YL5A 1RBZA 4UNNA 2GPAA 3ESYA 2ERYA 4ZO7A 2P62A 1FFWA 2O8VA 3DOJA 4X7RA 5JNWA 3UMSA 3V32A 1ZM3A 3FA2A 3QU9A 3EIHA 2XYGA 1JEQB 3DDHA 1G4UR 2Z57A 3QI7A 3VTZA 2W8BB 3JV7A 4E4RA 4QJ5A 3VJLA 5ANRB 4XWGA 3TW8A 2G5TA 3K9WA 4QBIA 5AXBA 3ZIAA 2ECPA 2CJPA 5DYIA 4BX0A 2BHNA 4BN0A 3FMGA 3FMIA 3ZZ0A 1IJEA 4DLVA 3HLYA 3H3FA 5EQTA 3ZHBA 3PIRA 3ZHZA 4QASA 2HXGA 4OIFA 3IYLW 5LB2A 3NPAA 1C1DA 3K05A 3KTAA 1SK9A 1II9A 2JCSA 1MT0A 1GNTA 3MOSA 3DC7A 3LFHA 2GM9A 1E60A 1E66A 3L6UA 5FLEX 1L8QA 4H1UA 1YJCA 4IIFA 4AN4A 4Z99A 3K0AB 5KPDA 1HT2E 1AX9A 4LOJA 1UK6A 2YV2A 4NLLA 4O08A 1ZCJA 3NWJA 3I8OA 4I6JA 3OVMA 3EQ2A 5FTWA 1F17A 3ZN2A 3ADBA 2ODPA 2WWIA 3KZKA 1Y5IA 4AP6A 3BXOA 1C3XA 4ZHSA 1XXHB 1DMSA 5KSPA 2FHPA 1NGSA 2Q5EA 4CCAA 1GNLA 2C7PA 3SE7A 3KNZA 2FOIA 4WOKA 3NDBB 4RPCA 5TY0A 3FPHA 2DY1A 2ZRHA 2JFPA 3THRA 2GCPA 3GF4A 1J4AA 3RFFA 4B6FA 5JROA 1H6CA 4B6PA 1KEUA 4QVKA 2BBWA 2R751 3WSVA 2F4VB 4RKQA 4BFYA 2QY6A 3QMMA 2DQZA 4GE3A 4RHYA 2IS1A 4L6AA 1RRKA 3G2KA 1KEEB 2FSPA 4TVBA 1KJZA 4NICA 1JHOA 4S24A 3B12A 4X93A 2BFFB 3HB5X 3TNYA 2UYCA 1VSTA 4LFBB 2DFVA 4NDAA 4Q6BA 1G63A 1N8NA 3L41A 4IW3B 1YVDA 4H7PA 4W9RA 1KDYA 1IY0A 5DASA 1T1IA 2NZ8A 3ROZA 4DNQA 1JJVA 1VBMA 3L43A 5FI5A 5G0WA 4K88A 1XKQA 4AWBA 3UF0A 2IE0A 4C4OA 3EVBA 3OOSA 3ER6A 3FMFA 2EXXA 1OU4A 4RJKA 5H80A 4AJ4A 3M9WA 2FMTA 1LPAB 5DM4A 2C54A 4BTVA 5FFNA 2JATA 4M89A 2QUAA 4QUJA 4MEAA 4CF5A 1N5KA 2P90A 2J31A 1YAHA 4EUSA 1JLLA 3N8GA 4AG6A 3RS0A 4C0KA 4L3VA 3SBOA 1XCMA 2PZJA 3NLLA 4NHOA 4G9EA 1RWMA 2BFAA 4WOJA 3RIEA 1NSFA 3FYUC 3HCDA 4Y6SA 4HFMA 2WV9A 2IOQA 3Q3HA 5AUQA 4BX3A 4LJSA 1Z4KA 2C0QA 4HLDA 3L7JA 1ZH8A 1EXMA 2FN3A 1PJ8A 1IM5A 2YN0A 3UMGA 1P1BA 1BMFA 1CHDA 2QI9C 3M1LA 3OLXA 2ZETA 4G84A 4JUAA 4NVRA 3SNHA 4LF8B 4Q24A 5E95A 4FGJA 4H3KB 3HZRA 3DR5A 1DXQA 3ZXUB 4J1SA 2VK4A 4ENVA 3KUUA 3PXDA 5JALA 4GPBA 4W5OA 3RRMA 3P0HA 2JIDA 3VO9A 3JQAB 1ODKA 3VU8A 1PNRA 4Q05A 3IILA 3Q7RA 3FTNA 3UOWA 2P69A 3OP4A 1XB2A 4MCAA 5TB5A 3OOHA 4GGOA 1RTTA 5CLQA 2OV8A 4FGSA 5CJJA 3WL7A 3M5WA 4WNAB 5L7WA 1LV8A 2W2PA 2ZJ4A 2O1XA 3Q4GA 4HPXB 5H3LA 1D2NA 1SCJA 2A0UA 2FZVA 2AH5A 2HK7A 2ENWA 1X42A 4M86A 3EQZA 4IJ5A 1EBUA 2AK3A 2IPLA 4MQMA 1BRMA 1G17A 3KZCA 3N2KA 4ZRDA 2QTMA 3UPTA 4G5OA 2YC4C 2YWFA 1SY7A 4E07A 3THYA 3TR0A 4J1NA 1VQ1A 2F48A 2PKCA 3WLLA 3BQNB 3QE3A 1Z8NA 2K2WA 4FDVA 1JGTA 3RANA 2GZMA 2G07A 1TKAA 4MV6A 1L3IA 2JA2A 3MTBA 2QQEA 1P19A 3Q72A 3CG0A 2HU2A 2FZGA 2V6BA 3SHTA 1QRUA 4HNTA 3UGJA 3I9V1 3UWDA 1CF9A 3AC0A 3C45A 3CWQA 1S02A 1W5BA 2R9VA 5AW5A 3S2UA 3ND7A 4TS1A 2IS2A 2H17A 2FPPA 4IMJB 2DJIA 3H04A 3E35A 4B3XA 2V7GA 5A5EA 1QNLA 2B7BA 2FMXA 2GNAA 2JGDB 2F1KA 4MKZA 1JALA 4YCDA 4QXPA 4F3RA 2EP7A 4S1PA 1C1YA 2VS1A 1CEQA 4R6WA 4RVFA 1N25A 3RNLA 2VYND 5LL6P 1T9BA 4WY5A 3V9PA 3VU1A 3V3KA 1H8EA 1L4LA 3L4EA 2ONJA 5ARBA 1TM1E 4PV7A 2WE7A 3DHVA 1SPBS 2HA0A 3OTOB 1XHEA 4QTTB 5TPWA 3VR0A 3KZXA 4L02A 3STWA 3L6CA 4H08A 3CVUA 3ZGZA 3TR5A 1E3LA 1NJ1A 3C5WP 1KHHA 3EPHA 2RH4A 4GWGA 3KHSA 2X6TA 1B0PA 4JLDA 3LQ1A 2XRFA 1WF3A 1V8ZA 3AFMA 1LU9A 4G5FA 4GT1A 3VJMA 5IJ9B 2J0QA 3INRA 4KQEA 1XPJA 2Q4DA 3QIAA 3W3AD 3WIDA 4XB6B 3VNVA 3QFRA 4KQJA 1OZAA 1ISSA 2X23A 4MDHA 3ZS8A 2HRDA 2PUTA 1UBEA 4RF3A 4CEJA 3BTSA 3IEXA 3A4YA 4F8EA 2C3PA 2QGZA 1AQYA 1WCIB 1WUKS 3JRWA 3M6WA 4B9AA 3FOFC 2I6UA 4V0MA 1U7WA 1W5AA 4GOMD 4JGGA 5C81A 4CM4A 3A1CA 4MWEA 1X70A 4Y2RA 1GSIA 2XXJA 3EC7A 3UK1A 2PFSA 1U9IC 5CNMA 1IHXA 3SEFA 1L8AA 3OUTA 4RTMA 2V3VA 3CHYA 3PKJA 4GS5A 1Z6XA 4IR7A 2PTGA 2X0JA 3KQOA 4YA6A 2XNDD 4BVLA 2ZB2A 5C5IA 3KB8A 3GD5A 5IHXA 1KC3A 2HDNB 3CNEA 4UTOA 3TJZA 1QTNA 1P7CA 1ID8A 4V0RA 3IOCA 1MTOA 2PH7A 2O1SA 4IH1A 2DWUA 4FW9A 5FPYA 4CQMB 5DK6A 1FFCA 3HVHA 3M1IA 5IARA 4F2HA 4KUGA 3HB0A 1DCMA 1N7JA 3DAHA 3NT5A 2ZANA