1Q1AA

Structure of the yeast hst2 protein deacetylase in ternary complex with 2'-o-acetyl adp ribose and histone peptide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
285
Chain Sequence
TASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITTPQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the yeast Hst2 protein deacetylase in ternary complex with 2'-O-Acetyl ADP ribose and histone peptide.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
molecule keywords HST2 protein
total genus 96
structure length 285
sequence length 289
ec nomenclature
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 1q1aA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1q1aA01
2VK4A 4RMHA 1UPBA 4RJKA 1UPAA 1YHZA 3ZGOA 2FR8C 2JI6A 2H4JA 1O96B 1M2JA 5EJMA 4UTXA 2Q29A 2JLCA 4KGDA 4JUCA 4JU8A 2VK1A 3JR3A 3JWPA 2H2DA 2W93A 4Q9DA 5K3SA 3ZG6A 4RJJA 2A1TR 3EY9A 3GLUA 4JU9A 3GLTA 1Q6ZA 4L2IA 4FEGA 4JUFA 4BUZA 4K9MA 4MPPA 1QPBA 1DJLA 5MGNA 1POXA 4IG9A 4V1CI 3GLRA 1YC2A 3D81A 1V5EA 2PGOA 5DEIA 3FSJX 4JUAA 2WVGA 1Q1AA 3CLRD 3CLSD 3GLSA 4R8MA 3D7KA 4MZXA 4COKA 5K6TA 5MFPA 4UTZA 2OD2A 5FYQA 4GM0A 2H2HA 5K2OA 1ICIA 4BVGA 4V1CA 4GG1A 1PI3A 3CLTD 2EZTA 5DGTA 3K35A 2H4FA 1YBHA 4ZP1A 5D7NA 2JI7A 3FZNA 1SZCA 4UUBA 4BVFA 1D4OA 5EJAA 4Y6OA 5EJ5A 5EJ8A 2EZ8A 4TWJA 1T9DA 2UZ1A 2H59A 4Y6QA 4J16C 4D5GA 4RMJA 4MPRA 2A1UA 2QQFA 1YHYA 3CLUD 4UTNA 1EFPA 4MQ5A 2V3WA 3PDHA 4X3OA 2OD7A 4BVHA 1PVDA 5IMSA 4QELA 3EA4A 4K9LA 3HWWA 3LQ1A 2QQGA 4C78A 1Z8NA 1YC5A 4UTVA 2AG0A 2FSVC 2OORC 3F6BX 4JT8A 1V5GA 2Q5QA 3PKJA 1BFDA 1M2GA 4QQ8A 4JSRA 1M2KA 1U2DC 4GM4A 4KXQA 5MF6A 4JUBA 2H4HA 1JSCA 2JLAA 1Y9DA 2FWNA 4MPJA 4RMIA 2NXWA 5AHKA 1E3TA 2JIBA 4UU8A 1PO7A 2NYRA 1Q17A 1OVMA 3E9YA 4JT9A 2H2GA 4G1CA 2VK8A 1YNOA 3U31A 1NM5C 4K9PA 4UUAA 5EJ6A 5EJ9A 4IF6A 1HZZC 2VBGA 3ZGVA 2JI8A 2VBFA 4UU7A 3FLMA 2Q28A 4TWIA 4K9NA 4RJIA 3D4BA 2BRUC 1EFVA 3EYAA 1T9AA 4UTRA 5FEMA 1J8FA 1MCZA 5EJ7A 2X7JA 1PTJC 2Q5OA 4BVEA 1S5PA 1PNOA 1M2NA 4BVBA 2AG1A 1O97D 1U28C 2C31A 4K9QA 5BWOA 1ZPDA 1YI1A 2WVAA 4Y6LA 4BV2A 4F4UA 2EZ4A 2OO5C 2Q5JA 2UZ1B 1Q14A 3U3DA 1PYDA 3RIYA 3OE1A 1U2GC 1V5FA 2IHVA 2VJYA 4C7BA 5BWNA 4BN4A 1OZFA 1XLTC 2JI9A 3IAEA 4JD5A 4K9KA 5EJ4A 2B4YA 1S7GA 4HDAA 3F6EX 1SZDA 4FVTA 2Q27A 4D5EA 4BN5A 4F56A 4BV3A 4KPUA 4V1CB 2IHUA 4L3OA 4J1TC 3PKIA 4FZ3A 4JUDX 4GPEA 2FRDC 1UPCA 4IAOA 4HD8A 1YTLA 4X3PA 4K9OA 4I5IA 3CF4G 1POWA 4QPZA 3RIGA 1PNQA 2WVHA 1OZHA 2EZ9A 3IAFA 4O8ZA 2FN3A 1M2HA 2Q5LA 1MA3A 2OD9A 4GM1A 4RMGA 1PT9A 5BWLA 1U31A 2H2IA 4FEEA 2H2FA 2PGNA 2VBIA 1OZGA 4ZZIA 2PANA 4GP9A 2DJIA 5DGDA 1T9CA 5K6RA 5MFZA 1YI0A 2EZUA 3HWX1 1N0HA 2HJHA 2IHTA 1T9BA
chains in the Genus database with same CATH superfamily
2WMOB 1BYUA 3JCZA 2XTNA 4GEKA 2QVGA 4JB3A 2NUAB 2H31A 5EXXA 1JNXX 1Y5LA 4L6AA 4Z1MA 2Q3HA 2NSDA 1DLJA 1CU1A 1UJNA 4PAWA 5TSDA 3TKYA 1QOPB 1Z4LA 4MA0A 5KYXB 1EI9A 4FW9A 4EKIA 4WW0A 1NFFA 2NU7B 3H7IA 2WR8A 2WBLC 5A5EA 2LD4A 2YFHA 4M1KA 3S8MA 2NQ2C 1XMOB 2WHPB 2ZQ5A 3O1IC 4IIFA 2WWVD 3D9QX 2C97A 4NK5A 1J00A 4HTFB 3GGCA 1V7QA 5DV9A 1X38A 5DYIA 5F33A 3WGTA 3OZUA 4PZPA 1EVQA 1W73A 4HQ0A 1XD2A 3EEIA 4F3NA 4EA6A 1XL1A 2C7QA 2FK8A 3AL3A 4ES6A 3B3JA 3WADA 4DNPA 3RU2A 2I6QA 2ZIZA 1HYGA 1LGYA 3AR5A 3K1AA 2Y27A 1WVMA 1M6VA 4JLKA 2QRLA 4Z9YA 5FPSA 1Z26A 4XDZA 5DLEA 1G98A 1JJIA 2W6CX 1JVNA 2XBUA 1E64A 3EFHA 4OJQA 1UK6A 5KJ1A 1ZEJA 4UZFA 2ZR7A 4ZDWA 5HZMA 4JXJA 2QT9A 2WTXA 4V03A 1XA3A 4IDNA 3WL5A 5IMSA 3EXHA 1DARA 2GBGA 1JR2A 4CLRB 3SS7X 1S2OA 3E7WA 4J1SA 3K1YA 3LOQA 5JH7B 3LFHA 2QG9A 3WC4A 4PX9A 3OE7A 3OVMA 1SWVA 2LTAA 1ZZEA 2GAJA 3VZRA 2I03A 4R1UA 2GHQA 2HHAA 3U5ZB 3OF5A 4F38A 3BRSA 3S8YA 3L7YA 1LW7A 3P9ZA 1HR0B 4G5OA 1M6VB 1I2MA 1W2HA 2I2AA 3EDYA 2GJKA 1GRCA 1XMJA 4N5NA 3RFUA 5L40A 1JPJA 1UPFA 5AXCA 1TAHA 1I3OA 1YDGA 3REQB 1JILA 5LQMA 4GR5A 1MTOA 4RHEA 3SHOA 3UBTA 1QP0A 1PFGA 2WSMA 3HDQA 1EHYA 4MR7A 3CMCO 3OT1B 2D5CA 4UTPA 3OQBA 3G6KA 3EN0A 1U0RA 3D1JA 1UDXA 4P7GA 4QBTA 4U5XA 1M1XB 2HRZA 3RYFA 2GF9A 3MYYA 5BOSB 3TG2A 1PK9A 2O6HA 1PQUA 3NBZC 3IHTA 2DU8A 2ID7A 3CZMA 4UBJA 1HWYA 3G0DA 1SIWA 3HLYA 3V33A 4Y9SA 2QGNA 2QRQA 4B47A 5K0ZA 3P9XA 1BE6A 4ZOQI 1EZZA 4V0LA 4L28A 1Y8QB 3QUCA 3CB2A 3KL2A 5B4UA 1FU7A 1RXWA 1ONSA 3BL6A 3CWQA 4FXPA 5FOXA 4L8GA 1J2JA 1NUUA 2ZK7A 2I62A 4I5FA 3U9TA 2OECA 2VLIA 3KU1A 3L1VA 4CM3A 5TV2A 4CTOA 3RJ5A 2YWCA 3V6LA 4KJZA 1OLUB 4GOOD 1WNFA 1SXIA 3ZU6A 3SVZA 5KMGA 5AESA 2IPAB 1ORDA 2IXGA 4I19A 4MGHA 3QEMB 1Y8AA 3LHIA 4LXIA 4FEEA 2QVYX 5CH5A 2P6RA 1SPXA 3IRVA 1CRZA 1C9MA 1XZ8A 1IEVA 2B5OA 2IZ1A 3R3YA 3HR4A 3KVYA 3WHPA 3SEZA 1CDDA 2HSZA 3I42A 4GMXA 2WWWA 5KTMA 4ZCRA 3THRA 3RU9A 1PS9A 3GGPA 4FK8A 4PAOA 2YUIA 4L8LA 3AJEA 1QHHA 1XEWY 4PWYA 5IT4A 2X9VA 1A9RA 4B3RB 4KUEA 3AHDA 4JJZA 3R09A 2AFIA 1T0BA 3HA5A 1YB5A 3HZOA 3SP1A 5CX1B 3RC8A 4LQCA 1NVVQ 2HA6A 3FTPA 5KTRA 1Z2DA 4H6PA 2HF8A 4ZAXA 4U3JA 4DT1A 3MHPA 1Y5RA 3TDKA 2FWRA 4JUAA 1TTTA 1ND6A 3QVMA 1TVKB 1E92A 3AR7A 4UM7A 1IVSA 5B1YA 1W6RA 5HZHA 3KLMX 3M4JA 4ZZ2A 3QOWA 1OIXA 1U0TA 1PQPA 2BUBA 1CP2A 2HHCA 1VB3A 4R05A 4ZAVA 4P38A 5LD2B 2UXCB 2QUHA 4RNCA 1ZGAA 4ZALA 5CB4F 4C6TB 3IVAA 5I5EA 2MSEB 1DJMA 4CODB 5AVKA 1PGOA 3BQ9A 1IK6A 3NPMA 3MUEA 5EIAA 4J16A 4LYEA 4PSKA 3VOSA 4CDMA 1JAXA 2PWAA 2V7XA 1XPJA 2VT6A 1X3SA 4LOIA 1UK9A 3PGKA 1LLDA 2J5KA 5DBEX 1P45A 1M6NA 1SCKA 2QE6A 4MRNA 3FHOA 3HPQA 1QG0A 3M4XA 4RETA 1M2GA 4M1QA 3EGIA 2HTEA 2JGDA 4X61A 5E9QA 4ZT7A 2BF7A 2C5SA 3IOCA 3INTA 1KI6B 2M32A 4XKJA 3DO8A 3RUCA 3G17A 4BNNA 4DKXA 4LZAA 1J1ZA 4EL0A 1E3WA 3S40A 2XXAB 1G7TA 3E9YA 4J2TA 3V97A 1P3DA 3N7TA 2IV2X 1OHHD 5AM0A 3SZMA 5BQOA 1ZD2P 1YKSA 2VBGA 3IXQA 3OT5A 1KZ4A 3IDQA 5AOAA 3S99A 4KHPB 2GPWA 2J3HA 4BXOB 4QU9A 3HJRA 3L7IA 4C30A 1VIVA 3L07A 2DBRA 2YMMA 3KYCB 1W5BA 3FCYA 2YY5A 1Y1SA 3W0LB 3H87A 1KAGA 5JNRA 4BVBA 2BFDA 4OLAA 3TIVA 4OHKA 5FT9A 3RVJA 4J49A 3GT4A 1GLVA 5CFMA 3RLIA 4FFMA 1PYDA 4FDUA 2BFEB 4QFCA 2XYHA 3PFWO 1IDOA 3PQ3A 3LC1O 3BFPA 2DKNA 4JEIA 4EDHA 3R0ZA 4RANA 5IKXA 1RWWA 2X3YA 3LLMA 3OZIA 5GVRA 2MSNA 1ZIPA 3H8SA 4PO1A 3T5TA 2WWIA 4Z4EA 2G1AA 1MB2A 3IAM1 4JUDX 3OPNA 3UMGA 1NASA 1WBJB 5C1OA 1T6ZA 1RM5A 1NSFA 2VUIB 2YC4C 3F6RA 3MS2A 4K3VA 4MR8B 2ZUBA 3H5LA 1VJCA 1PLKA 3A14A 1I5OA 4XWTA 2IYVA 4KFRA 2HEIA 1N1MA 4WLEA 4HMOA 1DIRA 5ESXA 1RZRA 3SS9X 2HOQA 4DIUA 4HYTA 5EP3A 4ZVPA 2W6QA 3W8RA 1GTRA 1T6YA 3KUDA 3MZ0A 4H0NA 4BVJA 5LU9A 1LD3A 2HA2A 1KEKA 4F4JA 2FDRA 2IXAA 3EPJA 1QFJA 1R0CA 4CQNA 2Q3DA 3JQQA 1OLXB 4N5LA 1IN6A 3JTMA 1EIZA 2YIJA 3QNUA 1Z25A 3AFNA 4EQ6A 4JYZA 4H60A 5KNCH 1M6EX 1FLVA 4LGVA 2GF0A 4UDYX 4EVIA 4CMIA 2FQQA 4N3CA 4D57A 4HAYA 7MHTA 3HXTA 1HDYA 1PL0A 1Y7TA 5D87A 5IM4A 2RHLA 2DPYA 1ZUIA 2WSLA 4LSZA 3VDMA 5DNYB 3SHVA 4P35A 2CLSA 5L7YA 1SBQA 1E0AA 1YFKA 3LV8A 1G5HA 2R84A 4M8NE 3E5HA 2FYTA 1G4UR 1JG7A 2SHKA 5LUBA 1NVGA 1RJGA 3KKEA 3T7KA 5JW6A 3G9QA 5I6DA 3BCRA 3IUBA 4YJGA 3SJUA 3DE3X 4IP0A 1F1JA 4REOA 2Q49A 3LPCA 2I6UA 2XA2A 1K63A 3K32A 1G8YA 3B3AA 4YJHB 3LK7A 5THXA 3ZU2A 3BWVA 3KYDA 4CZ2A 5K0TA 4J8PA 4MW5A 3S2FA 3C6ZA 3NV9A 3STVA 5IDXA 1J49A 3R6DA 3MMPA 1TZ2A 1LWNA 4BNHA 2P9CA 1QRSA 4OXQA 3U49A 1GG8A 2N1MA 3EA4A 3P0EA 4ID9A 4C4AA 1FSPA 4ERXA 1EE9A 1CZKA 4MS4A 5BUZA 2ISQA 1UFRA 1ND5A 2CHEA 2VJLA 4W1SA 1T6BY 3CT6A 1NQOA 3FPSA 2V1UA 3BMCB 2VDWA 1QLWA 3UCXA 1W46A 2H1WA 3GDFA 2CUTA 3F3YA 2AOTA 3LAWA 5G4KB 2MYUA 4EG6A 1J0CA 4LMAA 2QI9F 2PQMA 4Q18A 4F60A 2HI0A 3GHYA 3AR2A 1HNNA 1T2VA 3KR2A 1Y6RA 3CO5A 4G5XA 1XDWA 1ADFA 1NQ5A 3PXAA 4I4NA 4QDKA 3TSWA 1TCBA 3OX1A 1SZPA 2K6GA 4Q1BA 3DLBA 4LE2A 3MD9A 4P34A 2NTVA 2C0QA 3E3AA 4IKOA 4K87A 3HL4A 2PUWA 1REQB 3EQZA 4OQDA 4Y9UA 1V71A 1I2CA 1R9GA 2FMFA 2D1YA 2A0YA 3M9WA 3PHHA 1Z17A 1JAIA 2VTDA 3H9GA 4ZO4A 1OBCA 5AI5A 1BEUB 2HDOA 3DVQX 3EXIB 2EOAA 3KV3O 3ZZNA 5KTKA 2OXEA 3QSYA 4EYOA 3G2KA 3OEED 1A4XA 3WIEA 4V0OA 4NBRA 1GGMA 5CAEA 3JQDA 4CF4A 1GD1O 1LBTA 4JI0B 3L3BA 4BV3A 3OBIA 2H4YA 4BKPA 1JWLA 4BFLA 3L8CA 5T4FA 2QAGA 2YC2C 2BEVB 3W5DA 1PWXA 1EIWA 2WHXA 1R0YA 3BFJA 1MQ9A 1ZCBA 3AEYA 3VPSA 2I1WA 2Z1MA 1DUVG 4M8LA 4X8LA 3RUDA 2WU8A 3LZ6A 1EAMA 3LUGA 4Q4DA 3WIUA 4D80A 1YD7A 4CMGA 5L3ZA 2WT8A 2FRXA 1GVNB 2VBIA 1WIWA 1RXIA 1KMHA 3K0SA 4DJJA 2AC7A 2TSYB 3HBMA 4HUQB 1K7YA 4KRYA 4Q15A 4PGHA 4WJLA 1AC5A 4RY8A 3GZNB 1XRPA 3LM8A 4LUCA 3WLPA 2ARKA 2FQWA 4F72A 5C8YB 1HFEL 4INAA 5CIQA 1CT9A 1U2ZA 1K6XA 3TE7A 1N9KA 5B36A 3MMNA 1R8SA 5JWOA 1NW3A 4OSPA 4ZDIA 4HFJA 2I67A 3KQYA 1XYGA 3KKPA 4ZQHA 2AXNA 1MPXA 2J59A 1IQRA 4C20A 1R64A 4HQLA 2D13A 5CEEA 1C4WA 2JAXA 5DT9A 2W6NA 3V34A 2G0NA 1E1CB 2AJLI 4FX2A 1Z68A 2BGWA 1BKYA 1NR5A 3WAJA 4QDZA 3E3LA 1XTUA 2GAOA 2V58A 2XCTB 2EC5A 4POOA 4S2UA 5AW3A 1ENPA 4FGZA 3R2JA 4KRXA 4QU5A 3GEGA 2W2LA 1SMKA 3NQ41 4R2XA 3ZWQA 2CXPA 1JA0A 5JI3E 1EGQA 2PMEA 1NYTA 2ZUWA 3ACCA 4G84A 1EK6A 4IQGA 3OBBA 3L6RA 4GUAA 4QPCA 4BFTA 4V24A 3RFCA 3F9CA 3VKHA 3AILA 4ZD6A 3EWIA 5FI0B 4JA0A 4KHZA 4N3GA 5KDLA 3VU9B 2JZOA 3GZ4A 4RJTA 3ZY6A 4HLUC 4Q6BA 3DBHA 2W9XA 2P6MA 2DPXA 3AI2A 5CXXA 3U7EB 4F45A 4RGBA 4II7A 1ZN2A 1XHLA 4KYVA 4O3MA 1ZM7A 1V37A 2ZITA 4CWAA 4KAFA 1FPQA 3CMMA 3GI1A 4QNMA 3RHSA 3E58A 3FKSD 2C8VA 1PJLA 2L0XA 3H2ZA 1W88A 3W5IA 5J40A 4JVNA 1BDMA 1X80B 3KWFA 2RAUA 3K1TA 4JB8A 3GEDA 2OCBA 5A9RA 3WRWA 1X0XA 1UIRA 1AIPA 2IELA 1P4RA 4K6OA 2CL6X 3OJ0A 5CDHA 4A8JB 4OMCA 3PYLA 2WHEA 2FVXA 3KB1A 3NVDA 2WA1A 4HI0E 1LF5A 5LP6B 3ME5A 5CB8A 3KQKA 4JI8B 2G76A 2VWQA 2OO3A 3GFTA 3IKJA 3QEKA 3QKIA 3UKDA 4YJ3A 4L22A 1E20A 2BI7A 3TDNA 4CF7A 4WZBA 1PZNA 2IP4A 1VZ2A 5BRNA 4EF4A 1N7HA 2I7TA 5B7NA 4X93A 3FCUB 2X41A 3WNCA 1NTRA 1I1NA 2OY0A 2QM7A 2VSXA 2XUAA 3IO5A 1WHTA 3MJCA 3PPWA 4Q34A 3U9SA 4IGEA 5C52B 4L3OA 4AK9A 3I58A 5CYFA 4XWOA 2C0PA 4IAOA 3WIBA 2IEYA 1NXOA 2X40A 3IBCA 4BOYA 2WSYB 1POWA 2Q4TA 3ZZTA 2DH6A 3GMTA 1ESNA 1UMCB 3LS2A 2V9ZA 3L0SA 4H17A 3HGTA 2JC3A 1ORWA 3REGA 5BWLA 2YR0A 3IYLW 3K4HA 4HLUA 3OFVA 1NBHA 3NM5A 2DJIA 4WT7A 3UAVA 1BJKA 4R98A 4I1VA 3UYKA 5DP2A 4IW3B 3WSWA 3ZBTA 3KOZA 4D2IA 2V8OA 2RARA 2C59A 3I9LA 1T9BA 4QO7A 5AVJA 1NXQA 2BSXA 3TIGA 3H4MA 2H4JA 5ETJA 2FZ5A 3KT6A 1WD7A 3QFSA 1QHIA 3ELBA 4D9CA 4WTOA 2TECE 4BNGA 4RDXA 4DR7B 3O74A 4E5NA 1FMTA 2AW3A 2CEKA 2RI1A 3ZE7A 3UGJA 1U99A 2ZKLA 4MA5A 4N1AA 2CK3D 2D7JA 3H11A 5CTJA 1EH5A 4O1HA 4D8VA 4FXOA 4ER6A 5LNK6 4ESOA 5CA0A 4LC9A 2C58A 4E33A 4GS5A 4CMKA 3NKVA 4E6EA 1F2TA 3H2HA 5DB4A 2HQBA 4YY3B 2J07A 2HA5A 4YRFA 4CKBA 3WBFA 4MDEA 2CY0A 3JYOA 5TGDA 3HVJA 4PX2A 4RQBA 2C3YA 2ZRBA 1X1SA 4WXPA 2IZOA 4U0JA 4WESB 4PZLA 1BA2A 3HY4A 5D3QA 2G08A 2WM8A 3DEYX 4Q3BA 5E2BA 4M22A 3VYWA 2OYSA 1HNWB 3PD7A 2XMGA 3AV3A 2XX3A 4KQEA 3KPVA 1I7SB 4HNGA 3F67A 4CU2A 2FX3A 2AT1A 1QRTA 2BELA 4BAZA 3AP3A 2JD2A 4KLNA 2ODBA 1V8FA 2FG5A 5DSXA 4RWZA 2VHEA 3I8OA 1UFOA 3DHEA 3O6VA 3NANA 3CRMA 4BNWA 4ZT3A 3ABZA 2KSQA 1KQOA 5LB4A 2QPLA 1ECPA 1HTBA 3ILXA 3TAHA 621PA 5D6OA 5ALOA 1N4AA 4K8RB 2QM8A 2XDQB 3IAS6 3GQVA 3H4IA 4ND6A 2XA1A 3PJRA 1MAUA 3O4RA 4K0RA 2I1QA 4ZT5A 4EQZA 3RARA 1U2EA 2OQVA 5DI3B 3DZGA 2CCKA 2B4TO 3E2MA 1QGED 1XRRA 3SYRA 1Y7LA 5K45A 1KPGA 1CF2O 3Q85A 1JLHA 2IE0A 1CR1A 3X1ZA 6CHYA 1XKTA 4U7WA 3GEMA 1PX0A 3QMMA 1GGNA 2XBLA 1KYXA 4MYDA 3PUYA 2UVPB 4QUGA 2YCBA 4HLNA 4J0GA 5ADVA 4XFDA 3UHJA 1QYCA 1I2ZA 3I01M 1TVMA 5EZYA 1S4MA 3KLNA 2X76A 4BQEA 5JAPA 3GGSA 1VCOA 4GX1A 4AMGA 2DCUA 3HUTA 2P40A 1XZJA 2FWJA 5DBHX 3JQ9C 3VR6A 1B43A 1L3CA 5NULA 1FP4A 3ZZ0A 2UU9B 2ZUDA 1QHYA 1J8YF 2RSLA 3IC5A 1MD9A 5CR9A 2D5AA 1BE1A 2Z2JA 3NNSA 2D0PB 3LC2O 4ZT4A 4MYUA 3SKYA 1Z0FA 3Q8LA 3UJ7A 1ULHA 4AP6A 1M73E 1U4OA 1WHSA 3CNQS 4D7AA 3D4LA 1VIMA 4N82A 5EQFA 3F7TA 4DY6A 2C88A 1C3OB 3IUQA 1H0HA 1NU8A 3PQDA 1UJ6A 4NZOA 1JIUA 4Q9KA 2HLNA 5D00A 2JS7A 2P9JA 3ENZA 4QYIA 5DHPA 5BN4B 4F8EA 4RTOA 1AKRA 3GLIB 2YVLA 1B2LA 1CR2A 2ADOA 2EDCA 2ZT8A 3K8QA 1UP6A 1MO3A 2BMEA 2DR0A 5KYNA 3KX2A 1I7NA 4LYHA 2OGUA 4PZCA 3DKRA 1Y1PA 1XQ1A 4TGLA 3G2LA 4RF3A 3KSAC 1MJGA 4G0PA 5JMTA 2IHNA 1HURA 2WU4A 4KO1S 3CTMA 3WLSA 4BB5A 5DLYA 2WB4A 3P9RA 1SZJG 4FR2A 2MIIA 3CJRA 5FYDA 1I3MA 2DUUA 1QPZA 2RDMA 1B4DA 4MP8A 1IZ9A 1S6YA 2CXXA 2GT1A 2QPOA 3D2AA 3CKMA 4D82A 3LVQE 1ZW1A 2C20A 4IMIB 5C53B 2HBQA 3QVUA 4JQCA 4RA9A 1E7MA 2Z2KA 2XECA 2BGNA 3FSJX 4KE7A 2O3TA 5CPFA 4Z7JA 3PEFA 4IXWA 5JAQA 5J5VA 1KFEB 1T5IA 2G1UA 4GOMD 1KAQA 4HEHA 4HKTA 3VJMA 2HCRA 5HIIA 4MQEB 3W5UA 4ZOLB 4K6HA 2R6ZA 2E4ZA 1WUJS 4EPYA 1WHSB 2VHJA 5CGZA 1PLLA 4C0WA 1SRQA 6REQA 5T5QA 3F73A 5GIPE 3M9LA 3P52A 2PM8A 1JB1A 1R3UA 4RK6A 2CDBA 2A59A 3L4BA 5BMVF 2QGZA 3M6WA 3HHPA 5EUBA 2ZUTA 1ZVJA 4XQ9A 4UE2A 1INLA 1GL6A 1KAMA 1WNTA 2PV7A 2YY6A 2HPHA 4PRKA 4RZIA 3IT1A 4PLVA 5ARDA 1TZKA 3B8HA 3GGJA 4FPXA 4NL4H 1NLFA 1VKHA 4ISBA 2V3WA 4XVHA 5EHQA 3WGYA 1R4MB 4C6HA 4EY6A 2YASA 5J2UA 4AMZA 3U81A 2H51A 4JJ7A 3GJZA 4MWZA 4TKMA 4IJWA 1K8RA 3VGJA 5CG2A 4CKZA 5BYBA 3FYDA 1T24A 3FUWA 4JEMA 2MMCA 2H4HA 4B48A 5JSYA 2IOFA 3IEUA 2HNBA 3ND6A 3PA8A 4L1KA 4X0EA 1IWOA 4WSOA 1H9BA 1U7OA 3GLHA 2QUIA 3FHCB 4JVLA 4LOKA 3PFBA 1ETHA 4B9EA 3DT9A 4EZBA 1PCXA 2QNIA 4Z7OB 1PJZA 4RCVA 3WNZA 4FMBB 1NMZA 2C00A 1DCMA 2WQZA 5JPCA 2HLDA 3T94A 4Y2QA 5IJ0B 5JMWA 1S9HA 4KQGA 4QDXA 3UYLA 2C4MA 1PNOA 2CXQA 1V0JA 1NOJA 5I9BA 2ODTX 4H7JA 4MYCA 2OV2A 1E6MA 1EVIA 2KE5A 1B8NA 3BBPA 1JEEA 4JD5A 1W7AA 3BYZA 5TQ0B 1M2OB 3UMFA 3RVBA 1XZMA 2VJKA 1H8ED 3GLQA 4G4IA 4P80A 1YKFA 1FLDA 2RBGA 1CUGA 4KV7A 1NUPA 1JAZA 1KDOA 3ADCA 3L4BC 2AH5A 2QQEA 2DWOA 2VTBA 1UKZA 4ZZ3A 3DBRB 5BQXA 2ANCA 2FJ0A 2QN1A 5IXSA 3RASA 4C6SA 3B85A 3RVSA 1XVLA 4QPZA 2R1VB 2RBEA 4PPGA 3U4QA 2Z9DA 5CVTA 1NP6A 4KLZA 2P1RA 4ROSA 1EM6A 3V46A 5IP5A 2VSNA 4C7JA 1YU6A 1U31A 5I4CA 1AXGA 5L3VA 3V4ZA 4IXNA 2YXNA 3L41A 3VKUA 4CHTA 4LF5B 4E5MA 3UJAA 4W5OA 4RLFA 2O2CA 1VE3A 2OLKA 4MVJI 5JCOA 3EE6A 1U2RA 3H2GA 4RY9A 3UK7A 2Z83A 5E2AA 1J25A 1CR6A 1HOXA 1H6DA 1SKAA 3VAYA 4BCDA 3M49A 3FOEC 1R5BA 2HIMA 3NHPA 2D0OB 4NX2A 2WJ3A 2ZTHA 2FPGA 4NESA 1NT2A 3FE2A 3LA8A 4INOA 5I9MA 4TKLA 2E82A 2FPSA 4G41A 4O2AB 4RPHA 3K72B 3Q5GA 1ZQ1A 4I2VA 3U7QB 4BP3A 1C9KA 2Z0MA 4BNFA 5ARCA 3EPHA 1C0EA 2X0NA 1YZHA 2GFIA 1PFUA 3BORA 4YAOA 2HMWA 3R9IA 1LSSA 3S1AA 521PA 3FDIA 1Z35A 3TRKA 1N0IA 1X94A 3K53A 4I4TB 3KZKA 4I4CA 4J75A 2ZATA 2H16A 3ITKA 1HQDA 4G81A 3GCXA 4J90A 4KR3A 1AXRA 1I0ZA 2WAAA 1FYEA 1K4YA 1NVKA 4ZO7A 1XFDA 5P21A 4AKIA 5E7QA 5H80A 1WV1A 5KNDH 4L0CA 1V1RA 2YBEA 2YQ4A 3ZHCA 2X42A 2HEGA 5LP6A 4X6LA 1NVWQ 2BFFB 2MSLA 4IIBA 1PV4A 4FUQA 3X0DA 5ILOA 3DOHA 3PDHA 1JR4A 4LAFA 4CM8A 3FOCA 2OCXA 5IF9A 1ZNWA 3SOZA 2QBYB 4DRYA 3GC6A 1W0KD 4AMVA 2J0EA 1KGDA 1ODLA 3KPJA 3PLRA 5FUMA 4NHEA 1SM4A 5EGSA 2RKWA 4A26A 4AJKA 4ZI2A 3LO8A 4B79A 5JYCA 2GEBA 3V7NA 4KR2A 4KXUA 3MILA 3EUAA 2R751 2R25B 3M1AA 1RYDA 1QFXA 2QSZA 1Y6GA 3OQIB 1OR8A 2P4UA 2V7QA 5CA1B 1IXKA 1I4DD 2C1EA 4TSFD 4U2FA 3EZLA 3F4BA 4Z0NA 721PA 3FOZA 1MB4A 4U6QA 1U8AA 3ETCA 4LZZA 1T9GR 3SF0A 3U7RA 4DILA 4DLZA 2YN4A 4WNYA 3WI7A 1TYBE 1GZHB 4LYGA 1WZEA 2VHVA 1VLHA 2GD2A 2G5CA 1NVXQ 5JXWA 4B83A 4AJPA 5I7AA 4B2LA 1JLMA 1WXWA 3LWBA 1OOEA 1NVBA 2RHJA 4N40A 4RS4A 1XP5A 2FZKA 5E95A 2ZI6A 4FEAA 1B3RA 4F4DA 3PVSA 1SHTX 2FFBA 3HM9A 4KFTA 2DG2A 5HMLA 1CDZA 1U0LA 5LMUB 4F93B 1SGWA 2JGKA 4HZUA 4XQGA 4L5CA 2IDKA 5EP2A 1V11B 3BSYA 3RSSA 1XHEA 3LW8A 1E1CA 1DO8A 3NHRA 1AKYA 1UEJA 2W00A 4S12A 2QMQA 4B1FA 4QQRA 2VI5A 3HM2A 1KMQA 1LZLA 1PU2A 1U7TA 2GVDC 4QECA 3ZDXB 4BJ1A 1MAAA 3WISA 4ZJZA 1XN1A 3DC7A 1CG6A 3WMEA 4LGMA 3R9XA 2OXRA 3HZZA 3X1MA 4YECA 1UJ2A 4QEKA 4FX5A 1SBHA 2AYYA 5FH9A 5KVAA 1RPTA 3MBOA 3AM1A 3IUMA 2QRZA 5F5LA 3LKDA 2HK9A 2H65A 1E9EA 3GZNA 1QAOA 2WIFA 2Q6VA 4DG9A 5FOTA 4CM9A 5A5FA 2H11A 2IXTA 3ANNA 3QKSB 2CLFB 1VDMA 4X91A 3F7OA 5DYYA 4HO1X 1IRXA 4XCQA 3R7SA 5LYJA 2OUKA 2GLTA 1U0OC 2DUJA 3B1WA 3VNSA 3K0HA 1SBIA 3UJNA 1RQLA 1KH2A 4QHTA 4PSAA 4MV1A 5I4IA 1JU9A 3FBWA 5H0IA 3WG9A 4D9BA 3VNRA 4XWGA 5KSWB 2DHCA 2REXB 2C5EA 1I10A 2PMFA 1CE8A 1JJFA 4M21A 1JTEA 3N5CA 3RUPA 3K9GA 3OA0A 5H70A 1MIHA 1N8TA 1XD8A 2OV8A 3CX6A 1FJHA 3CHYA 5FPYA 4OQNA 5B3JC 5BORA 1FJGB 3QBDA 4N39A 1B6RA 3VR6D 3FWPA 3RVMA 3X2EA 1VGRA 1LPOA 4Q00A 3ZHQA 3RUEA 3BGVA 1PZMA 1XZCA 4HYYA 4DC9A 1BW9B 3E7DA 2XNHA 2XLBA 3SNKA 2PH5A 1YHYA 3KSZO 4CL2A 1X1BA 3C3AA 3ZGXA 1PZGA 4HTAA 4LOLA 3IKMB 4LY9A 3RSLA 4A8PA 3P7MA 3AYXB 4P08A 4BNMA 2KMLA 2Z2ZA 2B7CA 3DEFA 5E4TA 4DQ0A 4KLAA 5A06A 4LV5B 4L9RA 4LCEA 2C3PA 3R24A 3PKJA 4US1R 5AK5A 5F35A 3LY9A 1PJ4A 1G5RA 4ILKA 4JYCA 3OQHA 4X3CA 4DJEC 4IZOA 4OP1A 3JQBA 2B20A 3MJ4A 2AFHE 3T54A 3U3XA 3LHKA 1H23A 4HNAB 1OVGA 3VHRA 3PUWA 3UWOA 1SCIA 2SCUA 1X7GA 4I5DA 1EVLA 2VDWB 4DQXA 3U19A 4KXMA 1PAUA 4ARSA 1NJ1A 2FZLA 1A76A 3ZNOA 4QYTA 2ATVA 3KKKA 4OF4A 4Z3KA 5DVZA 1O9BA 4WEOA 3BJZA 3WO1A 3HQ4O 2WAOA 2G70A 4GDMA 2XVXA 4N7BA 1CUIA 4RL4A 2F2TA 3EZXA 5DHQA 2PX6A 1E5VA 4EMUA 1KNXA 2R7LA 2C31A 5DBGA 2PQ6A 4ZZ0A 5KSOA 2PUTA 2XI4A 3H8VA 1QZ3A 2YQ5A 1GCUA 1L5SA 1PQ4A 2BMFA 2CJWB 2JCBA 2R44A 1KK1A 1GRRA 1EWKA 1L4NA 4IV5A 5BVGB 1GKUB 4A5OA 4BEJA 4GVPA 3LGXA 3I2HA 4LPSA 4BO9A 3LSTA 4BO1A 2B21A 3H7AA 1XN4A 3ZS9A 1I0LA 3A3KA 3D6JA 4BX3A 1N5DA 2CMHA 1BXRA 5K0LA 3JVVA 1TAUA 2AKAB 1TVEA 3JQ6A 3VNQA 1E3SA 1QZUA 3HL0A 3ZLBA 3TXYA 1M10A 3GUYA 1NPYA 2AC4A 3JD3A 3BCHA 2G04A 2DCMA 4H3KB 5L45A 3RS4A 1XG5A 2QRUA 3H5RA 2RGEA 3RKRA 3V4RA 2JCVA 4QU0A 4CMIB 2JIQA 2NXCA 3N2LA 4GP9A 1OZGA 3RVNA 3NYWA 3Q6MA 5CX4A 5ICEA 1WXGA 4DMGA 5CCDA 3DZDA 3JQBC 3N87A 3T5DA 4IIDA 5ALEA 5JDCA 3DQPA 3EW7A 2AI1A 5LD2C 2HA0A 4HAZA 1Q1NA 2EF0A 2HLPA 3WMXA 1GQSA 2WIDA 3K09C 4M37A 5F2KA 3TKAA 4EB0A 3JPWA 4TTVA 3DHYA 2XTZA 3AR3A 4V0ME 2SECE 2IZ0A 3FXAA 4XYGA 1N2CE 1O08A 4LQLA 3IEKA 5K0FA 2BKUA 3JWHA 4W63A 1FUKA 3OQ1A 2ST1A 4CKCA 3ED1A 1PR4A 3A6ZA 1KGSA 1YR1A 3DP7A 1V7PC 5KVVA 1OFGA 2QDKA 3BZUA 1H2RS 4KNWA 5EUMA 4MR8A 4A36A 3MJHA 1QHFA 1L5KA 4BC0A 4BKMA 2JLZA 4UAGA 4ZVUA 4QTUB 4X84A 4EGAA 4BVGA 2WG0A 1RLUA 4MQ6A 3GJ7A 4W8HA 5EMMA 8GPBA 4C7OA 4L4ZA 3FOBA 1ORRA 2CL7X 5HF6A 1KYIA 1L4UA 1H3EA 1JKFA 3CRZA 1X1AA 3V1TC 2BBSA 4O2AF 4PNEA 1NQWA 1L7DA 1I4EB 4YGYA 3RDPA 4YI3A 1AK1A 4D3DA 3M6MD 1TYCA 3FVVA 1EUDA 4NV0A 2W8ZA 3E1KA 1AGPA 3TZEA 4RMJA 5BNZA 3IQIX 1ZGHA 1A96A 3B6JA 3JALA 3P9QA 5HKLA 3U7HB 4QELA 2JHFA 3OY2A 3KHKA 4JFRA 5LXTA 2P6OA 1PWYE 3KKNA 1RXSA 3UUWA 1OKKD 1CUVA 3SLGA 5DRTA 1XMIA 1RHUA 4MI1A 4QUHA 3A1VA 4JLBA 2PKRA 3OZCA 1WQ3A 2JD0A 2QYTA 2I3GA 4KBYA 3PFCA 1FJXA 3ODPA 4BU1A 4BNYA 2Q41A 1KI6A 1OU0A 2D5IA 1LFDB 1DO2A 3N05A 2JATA 4GICA 4RGQA 3SEAA 3SYLA 1IPHA 4L5BA 4Q02A 1TO1E 1Z0AA 4GVLA 3AHEA 4LFCB 1Z22A 4QAQA 3BDAA 4R69A 4DIMA 3E61A 3P2OA 1XNRB 1ZGBA 2V4MA 2JHAA 2GD0A 4QDJA 4UCWA 5DXAA 2X0FA 3RTBA 4UEJA 3GA7A 1EBBA 2ZBGA 5EZ6B 3CEJA 4ND8B 2EWWA 4Q4JB 3UK6A 3AF6A 3IIKA 2R8BA 2C78A 2QROA 2QAIA 4C6TA 1ISSA 1DIHA 1P2TA 1XTIA 2AYZA 4WMLA 5CU7A 3RABA 3ZKWB 1V6SA 2AOVA 2W6JA 4P93A 4AN0A 4A2QA 3QVOA 5FPTA 5B37A 1IOLA 1YB7A 4GPTA 2P3OA 4RHCA 1DJOA 4ZN6A 4MQLA 4W8GA 4LCBA 4ILEA 2AMLA 2JHGA 3PT5A 2YN0A 1TVKA 3M6LA 1X8KA 2UV8A 1QZZA 1QUFA 5C46F 1IVYA 4N3NA 2PU7A 1Y3AA 1C3JA 4U7HA 4D74A 3DL0A 3R20A 3UWSA 1QYWA 4KGZA 4P0QB 2X2OA 1T2EA 1SN7A 3I76A 1AF7A 1QXSA 2ZBQA 4B3BA 3SBEA 2FA9A 2ZJ4A 4NY1A 1UBCA 2Z95A 4UZSA 3VOTA 4QYXA 2QX9A 4E5KA 3ABSB 4ALKA 4E08A 1ZJJA 5ES3A 2XWQA 3A32A 1Q21A 2XQVA 1Y4ZA 1M2WA 2BDTA 2HRCA 5CXQA 3QXHA 4Q5IA 1YUNA 5LP6F 2WD9A 2GM4A 4OXYA 4WZBE 2YDXA 4N47A 4CYMA 4EIWA 1RYFA 5FPQA 3OWOA 1H8HA 3HABA 1MRNA 5CNIA 3QF4B 2PL3A 4HGRA 4IEIA 1X92A 1RBZA 4HB0A 1U11A 2PKWA 4GMDA 4C9BA 4D3FA 2JF0A 2WB2A 4Q03A 2GJ9A 2BP7A 1DJQA 3OKFA 5KMGB 3I6MA 2NU9B 2XJ9A 1LWOA 1KTIA 5DM60 3WK5A 2OFXA 1P33A 1NV8A 3QW4B 3EZ9A 5K4AA 3G5UA 4RVGA 3QENA 1HE8B 5BWBA 5KBYA 4KGXA 1E62A 4O4JA 4PHHA 3T1NA 5TEVA 1Y8QA 821PA 3ENWA 1M74A 2DHRA 1W44A 1E2DA 3LGSA 1HXHA 3CIOA 1NVTA 1VCMA 2BTQA 3I1YA 3L06A 2PVSA 3B7WA 2C07A 1T4GA 3CR8A 5K0EA 4CEJB 1N3LA 3H5NA 4CQLB 3ZTWA 4HMPA 5A9SA 3K96A 5HKBA 1FS6A 2IH4A 4Z9BA 3QFCA 2DFPA 3PC7A 4EVSA 5TRTA 2EFGA 1NYRA 2H3HA 3TLBA 2C2WA 2VSYA 3GT3A 1PVDA 4RX1A 3IXLA 2HWWA 1SIBE 1IUPA 2W37A 3H42B 1PYGA 4WOKA 1KZGB 3GPBA 4YMWA 4ZWNA 1EX9A 5E9AA 1VMIA 5K0CA 3WWEA 4DB4A 1GDTA 4K7JA 1GG9A 4R54A 3VR5A 3PI6A 1SXHA 2IRWA 1KTVA 2VK2A 1UBUS 1M9NA 4UNSA 2C3MA 1YZVA 4OHYA 1CDOA 4KBGA 1YU9A 5P8WA 1QU2A 3CXRA 5KYTA 5REQB 5L51A 5IUKC 1JWBB 1R6DA 5IRCD 1Q17A 1SHZA 1FNSA 4G5RA 3TW0A 2HFJA 4HPJB 3ABOB 1FTQA 4QXPA 4RJIA 3K9WA 3V8MA 2HNAA 3DE1X 5J63A 4NU0A 3HB9A 1FE8A 1U0HC 2RAVA 5GZ1A 2ACKA 1PFKA 4FNOA 1RCTE 1VCHA 1ZD5A 2VKTA 1MQ8B 1VFPA 3MWEB 7REQB 1SHKA 3BK7A 1LVGA 2X2FA 1RWVA 3ZY2A 1OYYA 2ZTLA 1GL3A 3I12A 5B6IA 4F56A 3Q6NA 1P1HA 1W85A 1P2DA 2ZYDA 1RAEA 1JB9A 4NONA 5IC5A 4EUKA 2IYEA 3OKAA 3QNWA 4XSVA 5TARA 2CDRA 3NCTA 4GZLA 3SEQA 2HU5A 3RS0A 1ZK4A 3FWZA 1VHJA 2OSBA 4J4HA 2XJ4A 3HVRA 2DLCX 2G9QA 1ZI6A 4KIJA 1FP7A 1A27A 1BGXT 3P9CA 1P1FA 2BM8A 3EB9A 1WUHS 4HTFA 2FQYA 1QF7A 2WHPA 4A1OA 2YRFA 3G1UA 1KMIY 5J4VA 3K6SA 3KTFA 4RD4A 2H2IA 4LF9B 1YFLA 1XMQB 1V41E 2O6LA 2AX4A 3GG2A 4JL8A 4CQLA 2IQ5A 5BSVA 4Z4GA 3EF3A 3F1KA 2OC9A 4JP2A 4LYDA 5EQTA 4D4LA 1YB4A 3CYFA 4ZREA 2RHGB 3M6UA 3HR8A 4FZJA 3I28A 4IDBA 1CQXA 3IPAA 4YWJA 4AO7A 5K8IA 2WYHA 5ELMA 1K98A 1JLLB 2V9CA 2P8JA 3A3OA 3N8GA 2RGYA 4UHEA 1UPXA 4AD8A 5AQEA 1DEAA 2NU9A 1UMBA 1LNSA 3H5AA 2AFRA 4L75A 3VPBA 2GPAA 3GFSA 3QWHA 1J09A 4TZ0A 1TM3E 3EG5A 1RXYA 2JAOA 2O8NA 3W6OA 5B1SA 5F2OA 1SU8A 1Q7RA 3CX3A 4DLSA 4DR5B 5CVUA 1KEPA 1V4NA 4UCQA 5HBGA 4AX8A 2OFWA 4L4RA 2FPPA 1U9CA 4MZXA 4N8DA 4I8IA 4C6RA 1KFJB 1QE5A 1YO6A 2FW9A 2H2HA 1MRZA 4ZGWA 3G8BA 1HYQA 4QBIA 5FL7A 1LU9A 1Q12A 2D6FA 1R15A 2GILA 3V8NA 4EBFA 1G18A 2A8YA 2GB4A 3OCZA 2ERYA 2XE4A 2FOIA 3F1LA 4GGOA 2J5QA 5A7FA 3RPEA 5ALPA 4FLMA 2C4NA 3UJBA 4ZYXA 1KKMA 3KTAB 4OHFA 1WA5A 2FJUA 2OBFA 3B6ZA 4M88A 4C0LA 4BX8A 4ARCA 2ZANA 1WDTA 5L3QB 3I32A 4RK1A 3TECE 1AV6A 4KAXA 4IJKA 4CCYA 3ILYA 4KITB 4M0DA 2ZBPA 3ICEA 2Q5QA 2BLLA 3Q9NA 2EFJA 2TRSB 1XT6A 3ITNA 2ZB3A 3IAM6 2XNCA 4QQ8A 1A72A 2QLMA 3DMPA 4PRZA 5FIUA 2C0CA 2IA5A 3ZJ4A 4INZA 4HT3B 5ALWA 3DQQA 5K3EA 4E46A 2DRIA 3CNEA 2IS4A 2GN0A 4B6SA 1OIVA 1JX6A 1QH9A 4KNYA 3ST7A 3F9RA 5CBKA 1FUYB 2QX7A 2Z58A 3AY3A 3DOJA 4FYJA 1EGAA 2W5UA 3U9LA 2O8DB 4UNNA 2HMSA 3EVZA 4HP8A 1FU8A 2I7CA 3N0VA 4GYKA 4D3SA 2VBFA 4LHEA 3AIMA 3E82A 2FUKA 3M0EA 3C6XA 3Q3JB 3W9SA 3ULKA 1P72A 1XQWA 3BA1A 3C7TA 2Q2WA 3OZVA 2PFSA 3C6YA 4IX9A 1Q84A 4Q3EA 2Q5OA 4QUJA 2GZDA 2JFFA 5F9HA 3A6GA 1K7EB 3ET5A 4CDGA 1ZPDA 1YI1A 3J7TA 1II8B 5BYAA 4JI3B 4MMZB 5EUQB 3BOSA 2IUEA 3F8TA 5JADA 4FWTA 1IN4A 4EEKA 2JRCA 1JHQA 2G0AA 2XZDA 2Z9CA 2ZSKA 1BD4A 2WYWA 2AWNA 4U7FA 4CR8A 5EERA 4V1CB 1H93A 5E1DA 1SC4A 2CVFA 3ZDFA 3S81A 4QARA 5H4HA 4TTTS 2FUG1 2IU4A 4KDRA 5FUXA 4LKOA 5TT0A 3V4LA 4YIHA 1VJ0A 2ZT6A 4RPCA 3MCUA 2O14A 3A31A 3EHEA 5ANRB 2NZUG 3E7PA 2D8AA 2PY6A 3NGXA 2PXCA 1K08A 4EHAA 4KPEC 3WWPA 1FX0A 3GRRA 5I7VA 3TBFA 1M6WA 4Q4HA 1HZJA 2PMWB 3KOXA 1DMRA 1ZYUA 4HBZA 3H2IA 3ZU4A 4C0AC 4TKZA 1HSOA 4E03A 3ZQ6A 3L77A 2E55A 4FI3F 5ARBA 2Y1DA 4DA0A 2Q9AA 3KPUA 1Z2OX 4IQ0A 3TTWA 4AZTA 5ALFA 4YV7A 4QGAA 1LDMA 2XYRA 3KC2A 3L7JA 1KXJA 3I8SA 1M1UA 4PZUA 1Y5MA 2B9VA 2R8ZA 2XE8A 3N2EA 4RNDB 5HX7A 1OH5A 5HGJA 1Z18A 1US8A 1BAPA 5E0KB 1MABA 2QW0X 5CITA 4RU1A 4GX5A 2Q8PA 1UBJS 1BS2A 4CNBA 2I8AA 3N75A 4WKGA 3LFTA 3HFJA 2QYHA 2A1UB 2X5XA 3JVDA 1Z0DA 4GC9A 4GMFA 2OFOA 5HKKA 3HI4A 2WFLA 5ALNA 1H0KA 1D2EA 3A9RA 1AZSC 1DBPA 1C7JA 2HR1A 4IR7A 1MFPA 4MEBA 1TT7A 4EWLA 4F9GA 3ZGLA 2Q8NA 4D9KA 3HJAA 1LCIA 3B2NA 4YIKA 3NEJA 2HWUA 4A27A 4EHJA 1U3FA 3TQOA 1MPTA 3IHKA 2ATIA 1G4HA 3IEPA 5DGTA 1VHDA 2H1CA 3GP3A 2C2XA 3QI2A 3LC0A 4BAGA 5IAEA 2HNKA 5FBRB 4B3GA 2JL1A 4G0ZA 3FZEA 1ZRSA 2YW2A 3HHEA 4LRSB 4DA6A 4D96A 1GCGA 2MYTA 1V9SA 2SICE 3ANYB 2QRVB 3GDGA 3KFXA 2GBCA 3LVFO 3GYGA 1QDUA 1Z8FA 2O3QA 2XB4A 5AW4A 3PQ6A 3U4GA 2V65A 2G3YA 1KP9A 4NE9A 3E03A 4OY3A 5HE9A 3ZWVA 2GCEA 3GFFA 3K3PA 1ZUD1 3KKZA 2ZJ8A 3NKLA 4INPA 4JR0A 4UVHA 5TVGA 4HGNA 1ZA2A 4IIGA 4AF6A 1N77A 2O5EA 1BXRB 1V3TA 3SFTA 3UVEA 3R44A 4YRKA 3W5BA 1ORTA 2GETA 1H1LA 5EXPA 3TNJA 1M2KA 2VRBA 1N2HA 2VZEA 3KD2A 2Q1XA 2VYVA 3N3BC 5JG7A 3OFSA 2DUMA 4D4HA 2JLAA 3AWIA 2D06A 3KQWA 5AIAA 4IOJA 5AWFC 3WQSB 2R8RA 4HAXA 4DW8A 1W5TA 2QMZA 1T8WA 2CJWA 3BQNB 4RK4A 3FY4A 4EG3A 4TLBA 1FNCA 3DXZA 4F2DA 2G5TA 5JISA 2DYKA 3T99A 4H4DA 1R0BA 1XEXA 5TE9A 1UM8A 2A9VA 5BW8A 4CIXA 4P86A 4Q93A 5BQPA 4J0DA 4WX2B 4YP6A 3MT8A 1GPKA 5ILQA 3ZX4A 1PNVA 3C7KA 4HDQB 2II6A 1W59A 1P2UA 4JGGA 2RAFA 4RIEA 4WK4B 4BGIA 4EVRA 1S96A 4LW8A 4UHJA 1JNYA 1U28A 3CF0A 4NYMQ 2R48A 1BD3A 3SHWA 1J99A 3ZC3A 4IL5A 2CMFA 2D3TA 3JU3A 4HNAA 5ER6A 3TS1A 5AVRA 4AFNA 3GA5A 2Q27A 4HZIA 2PS1A 4HWTA 1FDWA 1DFHA 4QXQA 2OEPA 3R3ZA 1L5FA 5A4JA 1E2GA 2V45A 4KODA 2ZJ1A 4BNVA 5EHZA 1Y8ZA 4P82A 5CMLA 2LVBA 3VR0A 4R8LA 4LBZA 2VPIA 1JJVA 4J7CA 2EVWX 2YZ7A 3DDZX 3T3HA 4AW9A 4RMGA 2J3DA 1L7OA 3LPNA 1YK1A 1UZLA 2A7QA 4KWIA 3STHA 4NCHA 3EG9B 2EIHA 3W8FA 1A4UA 4EYGA 3AIKA 2IYFA 3T4XA 1CR4A 4UBLA 4OSOA 3ETHA 1N2JA 4EUSA 2GZAA 1EP9A 1N8KA 4NCIA 2KI5A 5CHYA 2Q1YA 4XTCS 1P3Y1 3OU7A 1IE3A 2A5LA 1K0FA 1AK2A 2I2CA 2Z8ZA 1CYDA 2QMEA 2RH8A 3AF2A 3HRKA 1MB3A 3MEQA 1M0WA 4HWRA 4MUGA 2XSZA 4L4UA 4XGQA 4B7CA 3GZJA 4EMBA 3D54D 2JFYA 5E4FA 5FULA 4Y8VA 1PV2A 2PZBA 1BDJA 5KAMA 4DCGA 4WCDA 4DSZA 3UWMA 5JQGB 4MPPA 2WQ7A 1YZGA 3J81k 2XKBA 2Z2XA 1MVLA 4GR4A 1VLLA 1QMPA 4G0NA 1IEXA 1ZH8A 2WIJA 4B3CA 3TZBA 2QG4A 4ENRA 4M9CA 4Y1EA 4A4DA 3HEMA 1KK2A 1QGAA 1W6UA 2E4XA 2M6SA 1K68A 2BI4A 2VXOA 2YWGA 1Q3KA 1NRXA 3O21A 2CE2X 2C77A 2N9UA 2NYAA 4MO9A 3ECCA 1HYHA 1NW9B 2Q4OA 4BPRA 4EB8A 1XLVA 2QLJA 4RM3A 4X54A 2F48A 2EZ8A 4DREA 4P3YA 5C7YA 1KZ9A 1W76A 1KSFX 3KE8A 5LIRA 2CDNA 3CU5A 4R83A 3DNPA 2YXDA 4AMBA 2RBKA 2XA9A 3OIWA 2BBOA 2PKQO 3ASZA 1KO4A 3B82A 4I66A 4EHBA 3I2FA 3K9LA 2YJNA 3L0CA 1I2AA 2V9PA 4HWPA 4OCZA 4PYKA 4AUNA 3TX2A 4L4XA 2DGDA 1ZNXA 1GPNA 2DFKB 2JIZD 2GCOA 1C9EA 4ARBA 4D3YA 4DLAA 2FOLA 3CZ4A 3M6AA 4R9SA 1Y9DA 1NX9A 3OU6A 4XQEA 4F8YA 1ZDMA 2QTTA 2C5LA 3K0AB 3ND7A 2AS0A 4TMKA 3DFIA 2OAEA 1XJ5A 3FIJA 3MC1A 1ZIYA 1NUAA 2IUYA 4Z49A 2V6BA 3VTFA 2F17A 1ZIOA 2JI8A 4E15A 2RH5A 3PC6A 3STYA 2WM2A 1E6CA 4RIGA 4BQPA 1UOQA 2HIGA 5DP1A 1YOVB 2DHDA 1XV5A 4BATA 4BWYA 2OT3B 1PTJC 4CIAA 1BQ3A 3A9VA 421PA 4DM3A 1U5CA 5AVUA 4L76A 1O97D 4NEHB 2VJMB 1A7AA 3B2EA 3AGPA 3BK1A 1H3FA 3WNDA 4BMDA 3QUSA 2E2WA 3HG7A 3GFGA 3ONFA 3AW8A 1QLJA 4DJ5X 4C7BA 2QR2A 1P62B 3D8TA 1AV7A 4AJ1A 1JSZA 4A16A 1ZRMA 2BHRA 2GXQA 4PBTA 4TTIA 4BN5A 1KHHA 5H8WA 5KOHA 4LDJA 4DXDA 3X2SA 4I6EA 1FSFA 1R8XA 1OFUX 1ZUHA 4IKPA 4QOFA 3WMFA 1JHMA 3AEKA 1J5XA 2ONYA 2G9RA 2J0UA 3Q3GE 4JLWA 5ICGA 7GPBA 3N74A 3SIXA 1R0LA 2EW2A 3QXXA 1NGSA 1ZD1A 1P7WA 3BN3A 3R6GA 4GOXA 3E2IA 3O8OB 4HATA 4WKBA 4GM1A 2LUOA 3T5BA 4OHWA 4QUKA 4ZAYA 2ZS8A 1BHQ1 1OUMA 3QM1A 3EMDA 4RE5A 3NBXX 2I6FA 1LDGA 2ID9A 3WOVA 5JNWA 1VRCA 4PW0A 1A04A 1ORIA 1CUWA 4G3XA 1B0ZA 2COKA 2IODA 3A9CA 3P9PA 4TXLA 5K2MA 2SKCA 4DA7A 2XZTA 1NIPA 2Z8YA 4N6OA 4C89A 1DX6A 4GXRA 4I3GA 4CLOA 2G9ZA 2W71A 5T7BA 4BO3A 5B30A 1H3NA 4Q7EA 1TADA 2C5HA 2H0RA 1UK8A 3BAFA 2OBYA 3CBGA 3OCJA 4EB3A 1PT8A 5HRUA 3QYPA 3RSQA 4D92A 1PTJA 3ZQUA 4O2AA 3FTEA 3LW7A 2O4CA 1BOFA 3RTDA 4ZVTA 2VDUE 5EN4A 2OXIA 1AKTA 2WOJA 4Z5XA 1AQ6A 2O5VA 3E05A 1KDVA 4DAOA 4ER3A 2AJ8A 2M2IA 3NI2A 3Q9SA 1W47A 3IT0A 4ZVSA 3I2YX 4G1FA 4M9QA 3U80A 5A0TA 1U02A 4PPQA 4AX4A 5K3FB 1LDEA 2J0QA 4PQYA 3RYCA 2CLMB 2CJXA 1VJ5A 2L2QA 2PYZA 4MPDA 2IZZA 4A3SA 1TUBB 3UATA 2F55A 3VVCA 2VHUA 2VHXA 3HA7A 3V4VB 5KNDA 2Z5GA 4EDFA 1SAYA 3D5TA 3V2HA 4ER7A 1Q1EA 3KSUA 3T34A 4WASA 4ZEMA 3IOYA 5IC6A 4X00A 3QE3A 5JATA 3QUBA 3FSGD 1JBEA 4TM7A 4HVTA 3EYWA 2B5VA 2HWYA 4JI1B 4Q3DA 4PYNA 1PSWA 3GBVA 1XDBA 2SBTA 1K97A 2X58A 4OLFA 4JLSA 2DT5A 2DBYA 1VXOA 3UAGA 1ACMA 2OBMA 3DTVB 2VTBB 2ZVPX 3SPXA 4CIVA 2A0KA 3LSYA 2J0SA 1PF7E 5F1KA 1DEXA 3DVRX 4FCWA 3FTFA 2ETXA 3L7KA 1XU9A 1KR5A 1YRQA 1LPMA 4DMCA 1UH5A 1G9XA 3KFVA 3QRWA 4C14A 4IDPA 3SXJA 2J3EA 4IDAA 3TLCA 3GPCA 4BNUA 4EG8A 3QHAA 4K9PA 4KRGA 4NFHA 1CF4A 4AJHA 3MHTA 4RSMA 4BHTA 5CDFA 3W1EA 1T6XA 2QM0A 3BREA 1P7VA 4H0CA 5JSZA 5I9IA 1JDNA 4QKQA 5KYUA 3AF0A 1FPMA 1D9XA 4A0RA 3HJGA 2X7JA 1RZ3A 3MWDB 4MUMA 2K5UA 5DCLA 4RVOA 2YWJA 3REFA 2AG1A 4BJHB 2VRWA 3O95A 4YUXA 5BWOA 4ZMRA 3UJHA 4F4UA 1S2DA 1ZVQA 5FORA 2ACEA 1Y6QA 1GFWA 4LF8B 2GSDA 2WF5A 3PNBA 1J1UA 1TK9A 1VZ3A 1KI7A 2HZBA 2BDUA 2YHUA 3MCWA 3ZDRA 3NTXA 5JHHB 3A28A 1E96A 2OR3A 3NB0A 1ZCFA 5F12A 1WTAA 2HQSA 4CV3A 4Y1FA 4OQZA 4G2TA 4ZVQA 1PD1A 3E22A 1G9SA 4IGIA 8ATCA 2P2LA 3SU8A 1EINA 3FVQA 2WFAA 3CF2A 3SE0A 3ELWA 3V42A 4B73A 1YR3A 3SHFA 2AUNA 1ZR4A 1T25A 2WVHA 2YZ2A 2FJPA 3O1HB 1QU3A 4G0OA 4XRGA 4R1PA 5J5CA 1J0BA 1ECLA 1I24A 3HCFA 3TW4A 2WHYA 3VKFA 2VATA 5HS4A 1MUUA 5MFZA 3Q2OA 3PIRA 4P5DA 1GDDA 4QDUA 4LNUB 3H0EA 3IUNA 1DPFA 1Z5GA 5AXDA 1Y5IA 3W6PA 2BTEA 3CW2A 4YAWA 2XZLA 1OFVA 4UUNA 5KKAA 4IILA 2WT4A 3AVQA 5IW8A 3W7BA 2IFTA 4JFAA 3AY6A 4Q9LA 2RGUA 3QEAZ 2XKAA 4MGZR 4ZAFA 5JAOA 4ZC8A 4F71A 3KDAA 2YNMA 4B4OA 3WK6A 4YCAA 1UFKA 3IL2A 2I2XB 3T7CA 2H63A 3P71T 1CKEA 4IHQA 3LUJA 2R47A 4QFMA 3WYDA 2WT9A 5DASA 3IQWA 3U6KA 1KZHA 3BZBA 2YHBA 4BFSA 3T9CA 1W8DA 5AW6A 3RJMA 4X20A 1MHPA 4DV3B 2ZRHA 4GI2A 5LB2A 1NVDA 2P75A 2VDLB 1UM9B 2PCLA 2YYZA 3WB2A 4RD6A 4EY5A 4YV1A 3ZCRA 2C2OA 2A30A 1QNFA 1F8XA 3LYLA 4R2JA 5G0SA 3UT5B 1SCJA 1UM9A 3O4FA 3QIAA 5AI0A 3HC7A 1S3SA 3R41A 5I01A 3RTAA 2Z3VA 1F5SA 5HKOA 3A4TA 3HCRA 2E4WA 1CEYA 1PSDA 2PCJA 3E6AA 4UEQA 4MCJA 3QXGA 2V0GA 3MIIA 2WF6A 5DDIP 5C8DA 5F73A 2NACA 4MZDA 4YLEA 1LNZA 5HM8A 1GUDA 2FW1A 4G89A 3MWFA 4UM8B 4IUBS 2C03A 2VNSA 4NE7A 4W82A 1Q95A 1YF3A 4XEHA 3ER8A 2KPOA 3O8QB 2XSZD 1KIAA 1OX5A 4HN9A 1WLYA 4GEGA 5GV7A 4YTEA 4ZHQA 5C37A 4KXQA 3TTYA 4P4SB 3BZWA 1YZKA 2C82A 3KPYA 1IATA 3B70A 4OVKA 3AEUB 3TOXA 4D4GA 5ICCA 5F4BA 3ZJ5A 3A2KA 3FETA 4K86A 2PRSA 2X5OA 4JL5A 1JR3D 3ZJVA 1WCIB 3WP0A 2CFRA 5GY7A 1CVLA 2GYWA 3LLUA 4D8YA 1SVKA 2UZ3A 1R88A 5CDGA 3GU3A 1TEZA 4ZV7A 3A8TA 1TYAE 1L5VA 3RWBA 3LFUA 4DV0B 1ZJWA 4IIXA 4G63A 2GYUA 3GW8A 3EVNA 4C01A 3E22B 4CXMA 1F6BA 4HQ6A 1F6WA 1BDBA 1OI4A 5DCYA 2IITA 1C8KA 1QR6A 2YV4A 4BRSA 3DZ8A 4X66B 1V3VA 2OENG 4GI3A 4M76B 3N2YA 4W5HA 2UAGA 2RB4A 2QP4A 3A1WA 2K7FA 1WWKA 3PICA 2G25A 3HCEA 2I34A 1Z6TA 2JCGA 3I9MA 3OIFA 3UHOA 3WLQA 4CM4A 3RJZA 3KVOA 5HF8A 3DONA 1XF1A 3I30X 4LTNA 2FW8A 1QR2A 4G85A 4P2BA 4QIHA 3VYVA 5FUQA 4RKWA 1CB7A 4BV9A 4QGSA 1YA8A 1U3GA 4K9OA 4RZQA 2HYDA 2NO0A 3J7AC 2IBMA 1NFRA 1IQUA 1MX9A 1JW9B 1L5QA 1JE0A 4BL5A 3AVXA 2PNFA 1Q16A 4MAAA 4EJSA 4CL8A 2OO7A 2OB1A 4Y2YA 1FJ2A 2JAWA 3E27A 4IMPA 1LPAB 1S2GA 1FSZA 1RLOA 2FSVA 3GJQA 3NWEA 2H7YA 4MRAA 1L5LA 5JVDF 4M8SA 4QLAA 1E32A 4BLUA 4UNRA 3WYFA 2QE7A 1JTVA 3ND8A 3I34X 3PPIA 4NICA 2E1RA 3LQ4A 5AHOA 1M7HA 4B34A 5A2GA 3DTVA 2B1RA 4TS4A 4ENPA 1NWHA 2XMZA 3BWEA 1MC1A 2VP3A 3GEPA 2RHTA 2CC2A 2FKAA 4C4TA 4P5EA 3JR3A 1ZXXA 2BN4A 5E6SA 1WRBA 2JKYA 5KYYA 5L95A 1KY4A 2FOXA 1Q6ZA 1JG1A 2LDBA 4LV6A 4YCBA 1WMSA 2ZVJA 4Y0NA 3L8EA 2Q0HA 4I08A 1E3JA 2P4EA 3R3UA 4ZA2A 5CLFA 3EIHA 2Q6LA 1RYNA 2IYAA 2QP9X 3VTZA 3RT1A 6NULA 1A88A 4DLVA 2Z1NA 1QVRA 3NVMB 4KVAA 5LU8A 5CUQA 2JB9A 1WPGA 3AM5A 5TF4A 1DP4A 5T6BA 1E58A 4LFAB 4YUYA 1FW6A 3KZNA 2JLXA 3FMOB 3NTLA 1L8QA 2BI8A 3HO6A 2NZJA 3I2JA 3LYAA 4GU5A 4MARA 5F52A 1JG4A 4ZXPA 3LLCA 1AMOA 4E51A 4W6ZA 4EJ0A 1RKVA 1N3BA 4C21A 5JZSA 1II9A 2Y6VA 5ALIA 4UQLA 4J0CA 1S2MA 3GBPA 2VP9A 4R1SA 1SXPA 1FTGA 2MDTA 5SICE 1YIDA 3EQ8A 4OLHA 3H1FA 2NTJA 2J45A 2P68A 3G6WA 3VYRB 5IX8A 4DCMA 3VNBA 1NWCA 2GNAA 3EDCA 1P5ZB 5JFOA 4CLOB 1A7KA 4TVBA 3NG1A 3WLFA 3UK2A 4E94A 1TAQA 2D54A 3LJKA 2A35A 3PTAA 1WUTA 3ON5A 2Q0XA 2ZROA 1RT9A 5LZ8A 3UN1A 5C8XA 4POAA 4WXRA 2FWNA 4CEJA 4WK6A 2Y0PA 3ONWA 5FKJA 1WEKA 3OZWA 1GZ7A 3KG2A 4U39A 4E12A 3SBXA 4E1VA 1FTSA 2IP2A 3OCCA 4G36A 5IUJC 1CUZA 1DQYA 2DVMA 1Z5NA 2P0AA 3QEJA 1WOYA 3QMWA 4PYOA 3VJRA 3K0CC 5HCNA 1F7VA 1CUEA 3TSYA 4JIMA 4FE3A 4A8JA 2PA3A 4OJKA 4EJ2A 1SVNA 3A9TA 1IBSA 2JVIA 2WMDA 9LDTA 4UTRA 1O2DA 3SR3A 3IA2A 2WJYA 3AUJB 4KPYA 5LZ5A 1G20A 3SFZA 4DLPA 4N3AA 4OOFA 3HXLA 2W8BB 4JGBA 5KWEA 4AKEA 4NP6A 5K3SA 1M75A 1NZFA 1QNLA 2BCGY 3BIWA 4I4LA 1J24A 1EEHA 1RAFA 1RTKA 3NHLA 3DAFA 3ZEIA 4F9EA 2CLLB 3BXXA 3VO1A 1U2PA 3LZCA 3EXG1 3KUKA 2BGLA 2AEMA 1ZWKA 2UYHA 1BWQA 2FB9A 3GJRA 3PSHA 1IQPA 2P9BA 2PK3A 4FCCA 4NABA 5DTRA 1KE2A 4GPEA 5FUVA 4EY7A 1K5HA 5KO2A 1T0UA 1F4LA 3QU5A 2Z56A 4S04A 2HJSA 1V8PA 2P69A 4YI5A 4MRPA 1WQ4A 1F7UA 3WGLA 1XJ0A 3E7FA 1W29A 4PN3A 2OQRA 3MAGA 3IP3A 4JP8A 5IHXA 1OXBB 3KEFA 1NLMA 2JLRA 3E23A 2E37A 1MOSA 1TA0A 1JEAA 1MJFA 1EP1B 3C15C 3IP5A 4GP7A 3U7GA 5BV8A 1N36B 1HOTA 4JP3A 3GROA 4ZCLA 3UOAB 1FLNA 1SA0A 1QF6A 2PRJA 2HF2A 2OPHA 4X95A 4EKEA 3T15A 3QOYA 2Q3LA 3TTTA 3WBBA 1WU8A 1L9XA 1UP7A 2A3RA 3DWGA 2NUPB 4PC1A 2PL1A 3U09A 3HDVA 4ZYLA 3N0XA 1CY1A 2PH7A 3ZHYA 1YZ3A 3PC3A 4DB2A 1CQIA 2DWQA 3BJRA 1YUMA 3M5WA 4L2IA 4PZZA 4A2PA 3I64A 4M9SA 5DCWA 3TIFA 3U62A 2V7BA 2QV7A 3GFQA 1ZC3A 2MSWA 4J7AA 5IT0A 2E49A 4RW0A 5IH7A 3HMQA 4JT4A 4G4SP 1W36B 3C5CA 4M8KA 2XV1A 4V0KA 5LDGA 2AA3A 2Z2YA 4OIMA 3UGQA 3R76A 4Z51A 4I1RA 1B14A 1CQPA 2WUVA 3R3HA 5AIBA 1ES9A 1IAQA 5CJJA 2QL5A 3W3AD 1N57A 3LWNA 3ZDAA 2CJYA 2ZWAA 5FFMA 5YASA 4XCVA 3RUFA 2GO7A 1CNEA 2Y2UA 1AKUA 3D4IA 4OQXA 5AOVA 4YUAA 1IOVA 1THZA 3R6TA 3ZWAA 3E9DA 4DSOA 1FDTA 2IPMA 2I4LA 5SYNA 4BQFA 3OZAA 4DWJA 1GKIA 3AEXA 1H65A 3EZ7A 4FJ0A 2AN9A 1RI4A 2P2ZA 4PSUA 2H2WA 2IJGX 4K88A 2BGIA 5G2OA 5K8JB 3UO8B 2GM3A 3C6BA 3F5MA 3M33A 4LISA 1U1EA 2O2DA 4NENA 1H6AA 4Z4FA 4FIZA 1Z5ZA 1JVBA 1DRKA 3THXB 1AXEA 1UJMA 1JSCA 4PPFA 2PX0A 2J09A 2PJUA 4W9RA 5FO1A 4RY0A 4P81A 4GNRA 2H1IA 3RF7A 4C5CA 4ESHA 4UFPA 5H5JA 5JNVA 5ADWA 4NH0A 1J2RA 3P19A 3ZHXA 2IE8A 3D8RA 3BSFA 3KM0A 3LA6A 3PHCA 3CR7A 1JE1A 4LJ5A 2IZ5A 4BS9A 3U31A 4RJLA 1REQA 3GARA 4H7IA 3BDIA 1G66A 4K9NA 3T3MB 5KNBH 4NFYA 3UC5A 4YJ2A 2BRUC 2V59A 3B89A 4I9UA 1PVOA 4EG4A 5IKOA 1ZM9A 1HEYA 4MCIA 5HBRA 4HXGA 5LLDA 2GLXA 2WC1A 3QVKA 2HF9A 4GFDA 2LV8A 5IKEA 3K9BA 4H3VA 5JWHA 3U4DA 2Y1EA 1AY0A 1JXAA 3U4IA 2QMHA 2AEFA 3RSGA 4DV6B 5EYPA 5TMEA 1A4IA 5HKKD 5ES4B 2BZGA 3VUEA 3KOOA 5BNWA 1T15A 4G0VA 3BMCA 2E4UA 4WZAB 3I5MA 4BRUA 4HOYA 2C7RA 1ZCAA 1Y8RB 3G49A 2C94A 2DTXA 1RQXA 3GD7A 1J0EA 4ALIA 4BU0A 1HDOA 4X3PA 2GHTA 4Q3NA 3CE6A 5K01A 4AQDA 1EFVB 5CT4A 3R75A 4UOZA 2J6CA 1UWLA 2VYVD 3P9SA 4HJRA 4Z3DA 2FX5A 3CIFA 4HV4A 3LP8A 2ODAA 1M2HA 4NIMA 1XEXB 2B3DA 4TQ9A 1VI2A 4IDGA 3VSAA 3F5DA 1IWPB 1XO1A 2HHJA 4XLZA 4F5YA 1T8PA 5BYKA 4QUIA 5BN5B 4Z2YA 3D3EA 4LOAA 5DK4A 3RT9A 3M5DA 4JLMA 2Z9BA 3HI6A 2O7RA 4OP2A 3L7AA 4Y2TA 3FNRA 2CXRA 3MBKA 4WOPA 2VJQA 5IT9A 3ZCXA 4RPIA 1QV9A 4IRUB 3LVRE 4FJ1A 3B6EA 4C0XA 3GLFE 3FPGA 1M34A 1XVUA 2YJ3A 4GLLA 4NS4A 4PTYA 2FMTA 4O5AA 4RXMA 1JH9A 1NE2A 3TTXA 3ZWCA 2WU0A 2F3UA 1EFPB 2X4LA 3NCHA 5CM8B 3WE7A 3ZHOA 4AYTA 5AOCA 1T0HB 1NXSA 4FNMA 2WI8A 5ALQA 1RHRA 2VNAA 5FBVB 2CBGA 1YC2A 1V5EA 2DQKA 4EAQA 5JAIA 4FHCA 3JASB 3USCS 1C7ZA 3D43A 2MMGA 4ARZB 2ABWA 4EQ6B 4X9XA 1H6BA 1XVAA 3WLOA 1LTHR 3MERA 3HU3A 3WS7A 1OLXA 1CZHA 4IWNA 4WZAA 3GV0A 4GLBA 4RO0A 3UCEA 2SCUB 4R1TA 1XEAA 2QSUA 3ZNPA 4EHHA 2O7SA 5GWXA 4UUBA 1TQ8A 2ZWPA 1YZQA 1Z5PA 3MD0A 3R5HA 4I9NA 5IVDA 1YRLA 4UDOA 4L8VA 3PG5A 2IW3A 2RJ3A 5SY9A 3LTNC 2D5BA 5CT9A 3VBCA 3P9KA 1LA2A 4BQRA 1NI4B 4IDOA 3N6VA 5IWAB 2UZ4A 1MABB 4FBMA 1AZLA 2EKPA 3S29A 1P4HA 2WF8A 3OTWA 4KSYA 1P0CA 2RD2A 4GE3A 4P53A 5EWJB 2LCIA 4IDEA 3HY6A 5CK5A 4ZMSA 4RACA 2NSYA 2B92A 4D41A 1HBJA 1TDJA 3OOSA 2HPVA 1N5MA 3W7VA 3F49S 2Y1GA 2EYQA 3QLVC 4U5QA 2B98A 3VPCA 3SQXA 1TTPB 1HI9A 1OKKA 2NZVG 1GITA 3BH6A 3OOJA 1TX4B 1XQ6A 1ZX1A 2VPTA 3WICA 4NDZA 3TPCA 4ENSA 5CLJA 1YA6A 1I8TA 3WZ2A 3PC4A 1E7SA 4KYIB 4U7DA 4FTWA 3CWCA 1ZOPA 1OV6A 1Z6PA 2CDAA 2HU2A 4BXOA 2VN8A 4M86A 4WKNA 4M0EA 1YWGO 2C57A 1AUOA 2CMDA 3CPHA 3MB5A 4WY5A 1W581 4FFBB 4W7IA 4ERNA 3LD9A 4A2WA 4P0TA 3QKSA 1KJWA 2A0UA 3I9V1 1E3WB 1WM1A 2R00A 3MK31 3G2QA 1C30A 3VR2D 2Q5HA 1T2DA 1CRLA 3MGGA 4FCTA 1FMCA 1H0SA 1KR2A 3FH0A 1PR0A 3CW8X 3GRCA 2IY9A 2XYVA 2JGDB 1L9KA 3QG5A 4MQMA 4MYRA 2PO5A 1GGKA 1BJTA 4XJVA 3WLRA 1ZP6A 4FGUA 2C29D 1L8OA 4ZEOA 1XAHA 2CE7A 3ESDA 3WGNA 4C0KA 2F3SA 4RD2A 1UXJA 4O2BB 4TLMB 2HXYA 4OB8A 2Y92A 3AVVA 4A0FA 3BGSA 3FCAA 4EZIA 1TMYA 1AUPA 1HETA 5EY5B 2FSSA 3NX4A 1KVUA 3O2NA 4RVSA 4TLAA 4C87A 1P2VA 5K6RA 4HR7A 1ZSYA 4A6DA 3FI0A 3IV6A 1GNLA 3V1NA 5IK2D 1HT2E 1WW3A 5DTQA 4HZUB 4HN4B 3RIXA 3VC2A 4ZICA 4Z4QA 4LFBB 1P29A 2NT3A 3ONEA 1NJ5A 4CR6A 1WP4A 2J9GA 1VRVA 1YVEI 4IOLA 4R3NA 5K3AA 4JJIA 2I4IA 4OLBA 1VCNA 4PQEA 5ADUS 3PCXA 5JC1A 4KV9A 4FHEA 3A4NA 3CR3C 2EGUA 3OX4A 1VSVA 3P2EA 3E5RA 1RIFA 3RD5A 9LDBA 3ISTA 1MU0A 4HK4A 2F1IA 3LXXA 1YFZA 4U7TB 1LPBB 4B3HA 3CUTA 3ZVLA 4WBNF 2EFCB 3OTIA 3V8PA 1T1GA 3GLRA 3D81A 2WP0A 2VEDA 2PGLA 3PXDA 4IHJA 4K6KA 1MNAA 2XGMA 2XNDA 3CO0S 4U2CA 2OC4A 3C1TA 1XTZA 5BPFA 5U9CA 4Y1GA 5IDYA 3HDTA 4ETNA 1DIOB 3ZDYB 5JC8A 3KZCA 1ENYA 3Q8KA 1SCUB 3IXMA 2XUKA 3M3DA 1CY2A 2ZAOA 3O9VA 4J91A 4MDHA 4UEOA 3L4JA 1TD1A 5I8PA 3RADC 1BWRA 2JI7A 2OAQ1 3EULA 5T3UA 2VPXA 1FW8A 4Y6OA 3G0IA 3QA3E 1IOZA 1WDLA 3TW8B 5AW9A 1I14A 2H59A 2Q7XA 2QJOA 3MA0A 1UXGA 1EYZA 3EOBI 3GUUA 3GLGE 5C31A 2FUNB 3LRPA 4ZYZA 1E9DA 1U7XA 2CNDA 3LPMA 5IJWA 2QBYA 3KXLA 2FG7C 3E8SA 1DXHA 1MR3F 1TF2A 4ON9A 4DBZA 1EXDA 1T8UA 1UZAA 1P73A 4DPMA 4YQFA 2I22A 2XODA 4Z9FA 4FHFA 5E6UA 3S2GA 1JN0A 3W2TA 1GADO 2B7BA 3DJYA 1DFGA 1LK5A 4M99A 1OAKA 3R7LA 1EK5A 2JGLA 5FOSA 5SV2A 4ZK6A 5IAOA 1HE5A 5JXIA 5EIBD 3NYQA 4XRRA 4PO3X 3CLUC 3W9BA 5ALSA 4CM5A 1NULA 1S8OA 1RR6A 1YQ9A 4ZI7B 1IB6A 3DTYA 3IQXA 4UAVA 3ROZA 4B7AA 5EJ6A 1CJCA 5EJ9A 5EMJA 4OBEA 4NBLA 1UJ5A 2N47A 3IAS1 3LKZA 1GNSA 2Q28A 1O6FA 4RPLA 3NRCA 5AR1A 5IM5A 4ZAGA 5EJEA 2RMKA 1N9GA 4N9QA 4DQKA 1A8QA 3H9UA 1JHXA 3AUUA 4D1YA 2VRCA 4EX7A 2B1QA 1VYVA 5T4BA 4DAEA 2ET6A 4JJ6A 2ZE6A 3WSTA 4EHKA 2H7CA 3I61A 3JQ9A 3Q0EA 1S3FA 2J41A 4QJBA 1BMQA 1IULA 1XKXA 3MUNA 4KH1A 5EZYF 1V9CA 4EO4A 3H1AA 1PZHA 1P6QA 3MLAA 5EI5A 4BY9E 5A2QA 4EAAA 2Y1FA 3DB2A 2P9YA 3H1EA 5EKSA 4EHFA 4MVJA 5D8DA 2H7VA 2GK3A 3FCXA 5AHXA 1L4KA 3VTKA 2PR2A 4CRWB 2MYPA 3T3DA 4KR7A 4KLCA 3KJIA 4MUIA 1J06A 3I9JA 4FILA 4NNJA 4Q3KA 5CVCA 3C70A 3T3IA 1XKQA 2IHBA 2XB6A 2VAVA 3BRWD 1HK7A 1HG1A 5DGDA 3F3MA 4NZMA 4PG4A 4CN8A 2B3TA 1M54A 5REQA 3A3NA 4O6VA 3QTBA 5B2ZA 1CW2B 3R4CA 5EIFA 3AO0B 2FG6C 1P4AA 3DOEA 2HXSA 1VPWA 2VYQA 1L4BA 2B4RO 3DBRA 1X8XA 1RYZA 3K1AB 3RKUA 3PRJA 2ZREA 2GI4A 3I6IA 5C2JB 5KTYA 2J1LA 3I2IA 4ZEWA 3TD6A 5EP4A 3KQMA 3MOGA 4UTXA 4G5SA 1XRQA 3I6YA 5CFOA 3L7LA 1MB0A 1C8VB 4JMPA 2AN1A 5HHTA 1ESMA 2NU6A 4ROTA 5JR3A 4TVSA 4HXEB 1D6MA 2GFQA 2R87A 4X8OA 3U4HA 3CUUA 2P90A 5HIMA 3T1OA 5FUWA 5HZKA 5C34B 4HS4A 2WG1A 2XAUA 4CUZA 4GOND 1XWWA 3H9JA 2YJTD 4R9NA 3UWPA 3TD9A 3R3VA 3D2LA 1UMKA 3NHAA 4KW7A 2CNNA 4X97A 5IJ0A 5KYXA 2DY1A 2VNIA 1NX6A 3LBFA 4V0RA 2X7XA 4ISCA 3DYIA 2DECA 1OH8A 3GJTA 5B2EA 1I80A 2HAEA 4M1ZA 3OIGA 1IZ8A 3OI7A 3DVAA 2O8EB 4YRZA 2WIAA 3AH8A 3GIDA 4ALLA 2G5GX 4HX5A 2VQFB 1EESA 3ROTA 4B44A 1USIA 2AJCA 4BPBA 2Y3IA 2WW8A 3H2SA 1NY6A 3TNFA 5KTSA 4QFBA 4IFTA 1NKTA 1QVAA 1W35A 4HGQA 3LBYA 4Z0TA 3SC2A 4UTVA 2HJVA 3NHUA 4MAFA 3PBKA 1QO9A 3F6BX 1J8MF 3CRQA 3JQFA 4Q9HA 3EEFA 5DH9A 2QXYA 3H4TA 1G1AA 1Z36A 2C2HA 3OX2A 1OBFO 4GR9A 4QICA 2PRKA 4WINA 4WOBA 4MAMA 4JVMA 5CNMA 4CV2A 3NYIA 1BVYF 3AY0A 5F2NA 5JRDS 1LK7A 2QJRA 4WE3A 3RWOA 5ECGC 16PKA 2OBNA 2XKJE 5BR8B 1G17A 4ZCTA 3D6TB 3PQ8A 1P3JA 4BMVA 2AX3A 3B6IA 4MK4A 3C7CB 2G1PA 1MCZA 3PUVA 3OC6A 1G7SA 1T34A 1UDWA 4H4CA 1NYLA 3KJFA 1YACA 3GMSA 1FP1D 1MW8X 1SC1A 1G291 2WSSA 3VDXA 2WVAA 5LQAA 1WPXA 1U65A 3PNMA 1CZLA 3SX4A 2ZB2A 1ZJZA 3BGIA 2EX0A 1E3DA 4HMQA 4B46A 1MAVA 2AOXA 2QYSA 3SC4A 1JRLA 2H0QA 4MKHA 3FNIA 3VR5D 2O2XA 3E8XA 4A6EA 3DE0X 3TEJA 4HH0A 2X0IA 2OXFA 1PK7A 2HZ7A 2WSBA 4J1QA 4ND8A 4LBVA 1WB9A 2ZJ2A 3TLKA 4DG5A 3B51X 3CQ9A 2INGX 4AJJA 3RVDA 4AMUA 2QN6A 1JBQA 4F12A 1DJNA 3IUEA 3BEDA 2C42A 2Y6UA 4OI2A 4E6PA 1C3XA 4ZEVA 2G8NA 1QCYA 1KVQA 1B7GO 1Q19A 3AF1A 4OHMA 3D3WB 3RYTC 3QKTA 1VE9A 3HGQA 4DEYA 2OYRA 1WSDA 3B1FA 4WERA 4DM7A 5LCXA 5DN6A 5CFPA 1SB8A 3WWYA 1A8HA 5A62A 3WGJA 1W4CA 3G9UA 3O3OB 1FZQA 4MLCA 4XOIA 2R7AA 3C97A 3V55A 5JXHA 4O4HF 4LXHA 3AW9A 4NH4A 2NVUB 3DMRA 1UANA 3V4OA 1LEHA 2BEWA 4UU0A 2XRYA 3DDWA 4DADA 3AR9A 5JZ9A 1OI3A 1S7CA 2PQ0A 3U7FB 3KAPA 5DISB 4B45A 1LVUA 2VBCA 2AZ4A 3AT1A 4UXHA 2ECOA 3I0ZA 1IN7A 4NULA 1DCKA 5E0OA 3ZDEA 2W83A 4BP1A 1T1RA 1WKBA 2GJAA 3DBLB 5EHGA 4K03A 1MO5A 2BCJQ 2WZCA 2IL1A 5FV7A 2AE1A 4PFQA 1M2VB 1CY0A 5ECDA 5EZYB 1PR3A 3OOWA 4QGFA 1Q7EA 1SR8A 2PGJA 2EHDA 2IYQA 4FYMA 4RELA 3AUFA 1NFQA 1OLOA 3JQCA 1CD5A 1UDCA 2G8LA 3KKOA 4W1RA 5K3BA 5BUQA 1PI3A 1P4JA 3V4SA 3HBAA 4MIYA 1BVUA 4QBHA 1XJWA 1EVKA 1J6UA 1AVTA 4ETMA 2KQUA 4IXDA 1QP8A 4BQSA 5LZ2A 3WGUA 1A9YA 1CY7A 4OGLA 3GFVA 5IG2A 4JLVA 4S0XA 1QK4A 1U9IA 4G0YA 4MUYA 1ISJA 4RLQA 1UCFA 5KHOC 2H2AA 4DQVA 1E98A 4ENWA 2RK3A 3NP7A 4DOMA 4EI7A 4LHWA 4X63A 4YRIA 5KYUB 1DQSA 4KREA 1LBEA 1CNMA 1I9GA 3I53A 1UWKA 3P1JA 4KXXA 4Y2VA 4BNIA 2VR1A 4IFEA 3EFOB 4OHOA 4KSCA 2BV3A 1WBBA 2C98A 1VCIA 1JJBA 3AJRA 2ILVA 2IW1A 3R0XA 5HJEA 3LDGA 1N5OX 4C4OA 2KHZA 3C4QA 1PKEA 2SKDA 3ESZA 3HU5A 4WESA 3ZY5A 5ICSA 1QHEA 1VKZA 2RFLA 2XNDD 4GXTA 4RJ2A 1BWPA 4RYDA 4DJFC 4PONA 4F6LA 3B5IA 3BKXA 3CGWA 1Y3HA 1YS4A 4MLPA 5F21A 3R8FA 1PFQA 2CZCA 2R96A 2W2XA 3FWNA