1Q1AA

Structure of the yeast hst2 protein deacetylase in ternary complex with 2'-o-acetyl adp ribose and histone peptide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
285
Chain Sequence
b'TASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITTPQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HST2 protein
publication title Structure of the yeast Hst2 protein deacetylase in ternary complex with 2'-O-Acetyl ADP ribose and histone peptide.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
total genus 96
structure length 285
sequence length 289
ec nomenclature
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 1q1aA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1q1aA01
2VBIA 4BV2A 4D5EA 4MPPA 2H2FA 4O8ZA 4V1CA 5FEMA 1Q6ZA 2QQFA 4K9KA 2H2DA 1UPCA 5K2OA 4UUBA 5MGNA 1PI3A 1V5FA 1DJLA 1OZFA 4R8MA 2OD7A 1YHZA 4FEEA 2IHUA 3K35A 5EJ7A 2X7JA 4RMHA 4TWJA 2FR8C 3F6EX 2UZ1A 1M2NA 2EZTA 4BVHA 2H4FA 5MFPA 4MQ5A 4X3PA 4K9LA 1Y9DA 4L2IA 4JUCA 4BUZA 3CLTD 1PVDA 4UTVA 4ZP1A 5IMSA 2H4JA 1POWA 4KPUA 4KGDA 4GM1A 2FWNA 2JLAA 2QQGA 2VK1A 1YTLA 3LQ1A 3ZGVA 1O97D 3OE1A 1Q14A 1EFVA 3E9YA 4GPEA 2WVGA 4UTZA 2H2GA 1YBHA 3FLMA 1QPBA 2JI8A 4UTXA 1T9BA 4JSRA 4GM4A 1YI1A 2DJIA 1PO7A 4BVEA 4RJKA 2VJYA 1OVMA 2FN3A 5BWLA 3PKIA 5EJMA 1E3TA 4K9PA 4HDAA 4MPJA 4COKA 1YC5A 4C78A 1BFDA 3IAFA 1OZGA 2VBFA 4JT9A 1OZHA 2VK8A 1HZZC 2B4YA 1T9AA 3FSJX 2EZUA 1S5PA 1T9CA 4GP9A 2C31A 1U31A 4FZ3A 4UUAA 4JUAA 5BWOA 4HD8A 2PGNA 3U31A 2A1TR 4JUFA 3GLRA 1MA3A 1U28C 3CF4G 4JT8A 5MF6A 1PNQA 4RJJA 4FVTA 1V5EA 2BRUC 2WVHA 2NXWA 4RMGA 5FYQA 1Q1AA 3F6BX 2PGOA 1YHYA 2EZ8A 5K3SA 1M2KA 4J1TC 4QPZA 3EY9A 2A1UA 2UZ1B 2JI6A 1EFPA 1SZCA 4UTRA 4IF6A 5AHKA 5EJ6A 1NM5C 2IHVA 2Q28A 2OD9A 2VK4A 1N0HA 4JU9A 4GG1A 4QELA 1MCZA 2IHTA 3GLTA 4FEGA 2EZ9A 5EJ5A 3HWX1 4TWIA 3GLSA 5EJ4A 3IAEA 1ZPDA 4Y6LA 2AG0A 4ZZIA 2JI7A 4UU8A 4JD5A 4BVFA 2H2IA 3JWPA 4Y6QA 5DEIA 4Q9DA 1JSCA 1Z8NA 3PDHA 4BN4A 1YI0A 3D7KA 1M2JA 3FZNA 1PTJC 4RMJA 1M2GA 3D4BA 4MPRA 2FSVC 1D4OA 4QQ8A 1M2HA 3RIYA 2JLCA 1V5GA 4JUBA 1PT9A 4K9NA 2OO5C 2W93A 4RJIA 4V1CB 3U3DA 2Q5QA 2PANA 3CLSD 3EYAA 4BVGA 2Q5OA 1U2GC 2H4HA 4JUDX 3CLRD 2OD2A 4F56A 4F4UA 5BWNA 4Y6OA 4GM0A 4BVBA 4K9QA 1XLTC 3HWWA 2HJHA 1J8FA 1ICIA 1O96B 2Q27A 1PYDA 1Q17A 5EJAA 4I5IA 1S7GA 5DGDA 2EZ4A 1UPBA 1UPAA 3ZGOA 2VBGA 3ZG6A 5K6TA 2Q5JA 5K6RA 2V3WA 2WVAA 2OORC 2H59A 3PKJA 3EA4A 3GLUA 1YC2A 4C7BA 4MZXA 4KXQA 2JIBA 4IG9A 3D81A 1POXA 3JR3A 2Q29A 4BV3A 1YNOA 5DGTA 4IAOA 3CLUD 4G1CA 1T9DA 3RIGA 4L3OA 4JU8A 4BN5A 2AG1A 1SZDA 4X3OA 4V1CI 5D7NA 2FRDC 2JI9A 5EJ8A 1U2DC 4RMIA 5EJ9A 5MFZA 2H2HA 4UU7A 4D5GA 4K9OA 4UTNA 2Q5LA 4J16C 4K9MA 1PNOA 2NYRA
chains in the Genus database with same CATH superfamily
2JFPA 3WA7A 1TC2A 3JQRA 3RKUA 3TKYA 4KNYA 3FHJA 2BFNA 3W3AA 1IVYA 1JLKA 1ZRNA 1EWKA 3Q6IA 3BQMB 4FGWA 3RUDA 3OAAA 2QKYA 1EK6A 4LY3A 4MPPA 2YZKA 3GPIA 5FA5A 2NU9B 4ACAA 4EFKA 4V1CA 4PLYA 5FEMA 1L4FA 3UAOA 4OAQA 3C39A 2NU8A 3R5JA 1D6SA 1TRKA 2QJFA 1XTRA 3OF3A 3RJ9A 2Z8YA 3E27A 4IXDA 5I9TA 1EU1A 2R6ZA 4C2TA 3MJTA 4G1BA 4OQXA 3IQFA 3AHDA 4F4IA 2O2EA 3OJLA 4EDFA 1WCWA 2AMJA 3LO8A 4UC0A 5D7BA 2EDCA 4AX4A 1OGIA 4DR3B 2YRFA 4HG2A 2VCYA 3AILA 3BCSA 4G24A 1I4WA 1LU9A 5C7OO 5GPBA 4O4IB 1A2OA 1LTKA 2FY8A 5L4SA 1JEEA 4HDCA 5INTA 1SQSA 2JD1A 5EINA 3TQSA 5FYDA 1E6KA 4QWWA 1NOJA 3RH0A 5BQ5A 2KHZA 1WVIA 2GCOB 4AY5A 2JH9A 1PSWA 2ONYA 5T4EA 2QPOA 1YZTA 2QYTA 3NVAA 4UQOA 4UHKA 5A06A 4OA8A 2FQYA 2J5BA 5LLSA 4KLNA 3CKYA 1I01A 2CJWB 2ZUDA 4TQUS 5ITWA 5ALKA 4S0ZA 1JW9B 1QOPB 4RZXA 4DJDC 2QNIA 2WWIA 3OWXA 4M8LA 5FTMA 4DSTA 4Y1RB 2WZQA 3RTEA 421PA 5IABA 4Y9SA 1RXVA 3KWMA 2ZCUA 3IDAA 4HJRA 1AK1A 4YGYA 2KJQA 3IEKA 3MGGA 5ESWA 3SF8B 1IHYA 5JRJA 2JS7A 2FHSA 1FP7A 3PC8C 3Q3EA 3N2IA 3K32A 4M89A 4MV1A 4YCLA 2I6SA 5FLKA 3CLKA 3GRKA 3VPDA 3X43A 1CBUA 1ZMBA 2L2QA 2Y4OA 2WFLA 4KQFA 1QGUA 4HVCA 2X9QA 1R0BA 2AFHB 3KIPA 4ENUA 4MQ5A 5JNRA 2QX8A 2DERA 1CFZA 4UEJA 1E7YA 3VYSB 4DPLA 2C5AA 2QQEA 3H86A 2NSDA 4HDQB 3O73A 4BECA 4EY8A 1E4OA 3B36A 3BULA 2PO5A 2HCTA 1Q0UA 1T6ZA 3DZCA 4RFVA 5JISA 3EPKA 4BMXA 1JQDA 4Q4AB 4YI5A 4BBPA 1WDMA 2WF8A 3OPNA 1J2UA 4ZCMA 1G42A 2ODQA 1XZEA 1T29A 3SYRA 3EAFA 2LIPA 2CJPA 4J0GA 2GTIA 4U3JA 3UT6A 4R1MA 3UBMA 1DKUA 3IIIA 4XVQA 4YUXA 1E7QA 4NABA 2I1QA 2FK8A 2COKA 1GL9B 4XW2A 3L4SO 4BTLA 2D0PB 4YYEA 2FRXA 3GLHE 5IVKA 2AXEA 1V45E 1BU8A 2M6SA 2ZAGA 3BS4A 3L9WA 4OFBA 4BE7B 4RH1A 5J47A 1JDZA 2DHDA 4BB0A 2D2VA 4WBXC 5ALDA 1E1LA 1G6HA 8GPBA 3H2GA 4FSHA 5ADHA 4LRYA 5DBFA 4LSGA 4US1R 3MFYA 4NH0A 5I7AA 4HMPA 2DKFA 2CFRA 1QS0B 3E9YA 4GUAA 2O7VA 2M1ZA 2XSZA 4I4NA 2ODWA 4IM7A 3V2HA 4W5NA 3WL6A 1R8SA 3V80A 3WQBA 1RXEA 4R51A 3R74A 5LQMA 3CVJA 3TIVA 5C8DA 2P2YA 2XDQA 3UWSA 3HO1A 3FJOA 2VRBA 1RIFA 3FI0A 3QNMA 2HXYA 3A3YA 1HE4A 3A1WA 3ZZUA 4U6SA 5BYBA 2O23A 2CK3A 1T2NA 5JEDA 5A1JA 1OJ7A 1WBJB 3DZFA 2OFWA 3EGEA 4GM4A 3SYLA 1KZYC 1TO1E 5G0VA 2NUPA 2I4LA 5C0OE 4RJKA 1JXOA 3QTBA 3ONNA 2JCYA 1MT3A 3MK31 5FQNA 5G0SA 1JEJA 1IBKB 1NDHA 2CDBA 3GFTA 5IDXA 4NCNA 2RMKA 1NQ5A 1TVKA 2Z95A 4H4CA 1QQ7A 2PWYA 4QPPA 3WGGA 3PXGA 1JYEA 3ZU4A 4ER0A 1G0OA 4UUOA 4DMRA 3AEQA 3ROTA 2EERA 4JUIA 5IN4A 3W5CA 2ZI3A 4JQYA 4DIUA 5A4JA 1EK0A 4ANFA 3K5PA 1DJMA 1PZXA 1UKAA 2Y77A 3KDPA 3V2GA 3ZNOA 2IYWA 3WLIA 2VDRB 5E1DA 2VBFA 1N57A 2IV2X 1R4ZA 1ESDA 1WZEA 2FG5A 3FPLA 3PLRA 1XZLA 3PZBA 4LSZA 4R8LA 1M0WA 2HM7A 2P7IA 3AJRA 3I1JA 3HWRA 4TVBA 4E33A 3CIFA 4IOKA 3FOZA 1BA2A 1PWXA 3P0EA 2ZVJA 3QXHA 1JSLA 2F62A 2HSJA 1Z5VA 3VVCA 4BO6A 5C32A 4JI4B 5ALLA 2VJMB 1U31A 5FBLB 2JCVA 2QTVA 5F5XA 2R11A 1J8QA 3UJ6A 2OM2A 2OXFA 2WF9A 4OHRA 5EXSA 1RQLA 1RADA 2VWGA 3JTEA 4JLNA 1DUSA 2IUTA 2QM8A 5HK8A 5HEKA 3VPGA 4M1WA 3HDGA 4HD8A 2I2XB 2ZUFA 4TQAA 1UFRA 5E2AA 4LV6A 2XMQA 1GKIA 4YRIA 1OY1A 4B4DA 1N36B 2FZKA 2JFFA 4NFSA 4OKSA 2ZSKA 1MA3A 1NVXQ 3BRCA 4WACA 1OPRA 3F3YA 1W0KD 4G56A 5IARA 2Z57A 3HO8A 3ANMA 1OGJA 3HNPA 5JROA 1JHXA 1WV0A 3I8OA 1IYZA 2Q3LA 2P9JA 1PZEA 3HGTA 4D3SA 4GBED 4B81A 5FD8A 3WB9A 1KS2A 3PXBA 4AJHA 3DE1X 2P27A 3PD1A 1V5WA 3DM5A 2QTCA 4RHEA 3UMCA 1Z34A 5KJFA 1PNQA 1E9DA 1ESCA 4BUCA 4QOFA 4ZYYA 1I2BA 3RDPA 2Q1WA 1FDIA 2O0MA 2XBLA 3H17A 3MINB 1M2VB 4L76A 5GONB 3EPLA 5BVHA 5TS3A 3TOXA 4OI2A 1VL5A 1P2FA 4FDTA 4ZGGA 4KYTA 5BN3B 2IPNA 4NOLA 4Q1CA 3RF6A 4D74A 3LVRE 4G0PA 4QUDA 3GAMA 5KMGB 4CUKA 2NUTA 5JZBA 4ERXA 3ZNQA 1E1RD 4BZWA 1E66A 1PSDA 2VIIA 4MRRA 1I7SB 3ESRA 4MARA 4MKHA 4PNEA 4YJ2A 3S1AA 1D2NA 1HL7A 1WD5A 4KWEA 4MO2A 2PJDA 3HDQA 1Z4JA 2HEGA 4MV8A 4XUCA 1R12A 1UPXA 2PNFA 4EMSA 5EGNA 1KAOA 3I01M 1LRKA 5HA5A 4OCZA 2G63A 1GIAA 3O4FA 2FPIA 3VMFA 4TUYF 3RFCA 1JEQA 4BC1A 5CDSA 1GDTA 2WOOA 1BMQA 3N2GA 2C9OA 4O4JF 4TV9B 4AN4A 4OH1A 4Y2XA 2BR3A 2QDKA 3HCAA 2Q28A 4QRDA 3G0CA 3WXBA 5J2TA 4MQFA 4MV4A 4B9EA 1T4GA 2FPRA 3MUOA 1ID8A 6AT1A 5HRCA 3LQ4A 1KJ9A 4E6EA 1E2UA 1G8MA 1FMLA 2H48A 3DDOA 3JZFA 1DKPA 1JPJA 1JXQA 4YDRA 1UZAA 2H57A 2IOHA 5CG2A 4KQIA 4DV2B 4E03A 2WG2A 1Q3TA 1R5NA 4DR6B 1Q44A 3GB9A 3L84A 1R0WA 3MS4A 1MH1A 1PDWA 2OC9A 2O0HA 4FKZA 4PXYA 3G1WA 1O6FA 2W6NA 4MGKR 1SB9A 4M9ZA 5EJ4A 5AH0A 2QTGA 3EGCA 1YVDA 4AJNA 1TX4B 4LW8A 4OHKA 1RU3A 1QQTA 1AC5A 3I5UA 2D0IA 3I9V6 3AR7A 4LVUA 4ZJYA 1AUQA 2NUAB 4MW0A 4FFLA 2ZYTX 1W47A 1XZKA 1E0DA 1Z82A 4MLDA 3TZQA 5IK2D 1RXSA 2VP3A 2ZYDA 1ATZA 4M3NA 1XLWA 4XJTA 1Z6AA 2GXQA 3LW8A 3VR4D 2ZJ1A 3SKVA 2GJAA 1P31A 4ZJUA 4M9XA 7ABPA 3Q3JB 2PWAA 2FZ5A 2OCPA 1G8GA 4FBGA 3ADBA 4OQPA 1RXCA 1TFUA 1ZNZA 4HNSA 4OP2A 2Z58A 3EMKA 4Z9BA 5GWXA 1KAGA 2OYRA 3ZHQA 3CUVA 4B45A 3H84A 3R7WA 3BWBA 1V35A 4Q05A 3AUTA 4GZ6A 3JQCA 3UC5A 1RLTA 2FCAA 3MBKA 4NEGA 4D25A 2GT1A 4B3DA 1ZXLA 3GEEA 3SXJA 3BREA 2Q6LA 4AIIA 3CJRA 1NGSA 1GA4A 2JFXA 4NZ9A 1UK7A 4PHGA 4BKOA 1XPOA 4E13A 1DXQA 1P8AA 3VI4B 3NTQA 5C4MA 3W05A 1PGPA 5LYJB 1AT1A 1E2IA 1QIHA 1P17A 4ILKA 5CH8A 4FOTA 3TAXA 3LBHA 1XXHE 3W8EA 2CZCA 4QJ3A 5BSVA 5CDYA 2HMWA 1LPBB 3WMXA 4A5OA 3MIIA 3KCQA 2YBDA 5SZIA 2M6KA 4KP7A 4LIPD 4N41A 4JSYA 1NPTO 3C3XA 3A9VA 4W8HA 3ZY4A 4YI3A 4LRSB 1Q5PA 2A1TS 2HQRA 5TSDA 1C9MA 3PFWO 3UV6A 4ASUA 3DBLB 4V24A 4O2RA 5JS6A 1XR3A 3IDSA 1LFAA 1QIEA 4IKPA 1U1IA 1UPTA 3HA7A 5FPQA 2GBGA 3T41A 1JS1X 5I4IA 1J33A 4PANA 4CGYA 2C98A 3ZXYA 3O5AA 4Q7JB 1NJ2A 3G85A 3MYYA 1GVHA 3EIWA 3EXEB 4FKBA 4EITA 4E3ZA 5AW1A 1L5YA 1J39A 1P7ZA 4RVHA 1KSJA 2CSXA 4L1KA 1O94C 1BRTA 1XE3A 2CXXA 2OGTA 3WGVA 4YIKA 1JR3A 4I9HA 5CLJA 2YY6A 4R2XA 3LO5A 2OD2A 2AZMA 2GK3A 4F56A 5L6LB 3KX2A 5DM1A 1VMEA 4CCSA 1N0UA 4DDMA 1SHTX 4A0HA 1MDBA 1S2DA 3B1XA 1WEKA 3LNCA 4J0QA 4JBWA 2EL7A 4DCVA 2M98A 1HL3A 1I3OA 3S2SA 1YVPA 1O9BA 1NVKA 1VE1A 3T5AA 5A9TA 3F71A 2EJVA 2C2HA 3F4LA 5JNTA 2UXCB 4GEKA 1I1NA 1H1TA 1QBKC 4HDSA 1CTQA 2WIDA 4FMDF 4OKNA 3QYPA 5B53A 3TLJA 4DR1B 1NQWA 2QX6A 2WK1A 1J97A 1UINA 2O4UX 1KAEA 3CGGA 3K0CC 4FNOA 2C59A 2J9GA 4B6SA 4PC2A 2V7PA 3AL0C 5JC8A 1CP2A 3NALA 4FD2A 4MUKA 5I4BA 1NVDA 4E94A 2I2BA 3Q87B 4BMOB 1NMEA 1Z13A 5IFLA 1VXRA 1KERA 5K3EA 1RYDA 2OMEA 4W5HA 4YJ2F 1S96A 1Q7EA 2VKTA 3JVIA 3KTOA 4YGXB 4I5IA 1P7YA 4YUYA 3JWJA 1FTNA 1EVLA 2C1ZA 4B3HA 1L7XA 2FPXA 1ZIDA 3D6NB 3K53A 5ALOA 3C15C 4YAJA 5A4AA 4PS0A 1LSJA 1MEOA 1U0GA 3EB9A 4LK3A 1P3Y1 1PJLA 3BMOA 1CQPA 2PX4A 4YALA 2GWHA 3PIDA 2G8NA 2FU5C 4ZDIA 2VJQA 3ZD8A 2QTMA 2I4RA 3NVDA 2QW0X 1GRNA 1V0JA 4YT5A 1EUDB 1X74A 4U7TB 3WNBA 2FHPA 1SBNE 4B33A 4FT2A 1YB6A 1YJXA 2WAMA 3QVUA 1VRCA 4HFMA 2FXVA 3S3TA 4XSGA 3VJKA 4DWVA 3RUEA 1SUBA 3O2QB 2HBZA 4P5EA 3VR3D 3TTTA 1LQUA 4U2FA 1RD4A 1V7PC 2FDXA 2YNMC 5AHWA 2FG7C 3MN1A 5DHPA 3SC6A 5HR5A 4ZYZA 5E6SB 1QB8A 1PWYE 4YIHA 2ZTLA 3L77A 3N87A 3IC5A 1Y80A 4DRZA 3HPQA 4Z7NB 4RF2A 3B70A 3NBZC 1QLJA 4MZXA 5ALXA 3M5CA 3EBLA 2Q4DA 4AS1A 4RPJA 1UMDB 1EWTA 2V4UA 5HF9A 4C87A 1QFMA 5FADA 4ZDJA 2VH5R 3MWJA 5AOBA 6ADHA 3X2EA 1DMRA 3FSEA 3GA7A 3MEQA 3WYNA 1CR1A 3GJZA 4MEAA 5JSKA 5FPSA 1HE3A 1YDFA 3VXKA 1SH7A 2UYYA 2AG5A 5BV1A 5LZ5A 1E3WA 4LOLA 4WT7A 4CCYA 4F5DA 4L50A 1NVBA 3P1JA 5DP1A 3PEYA 1JZQA 4XM0A 1R6UA 4NBLA 1K8QA 2R5NA 1UQUA 1S1CA 1C9NA 4U7PB 4GYYA 2O5EA 1FDSA 2EGHA 1HLDA 3NBYC 4D56A 5EJEA 3I53A 3KUXA 3QX7A 3PPXA 3Q7QA 4L3OA 1TVEA 3DLBA 1RYNA 3ESZA 1LC3A 1KI9A 1Y6RA 1FSGA 2PFKA 4PZZA 4R1NA 1B2RA 2BGMA 4OQZA 1GRCA 5IVDA 3U4IA 1IVNA 1BOOA 5KIAA 3D5EA 5B3KA 1IL0A 4LVOA 2BZ0A 2OYSA 3CISA 3IT0A 4LTMA 3W6OA 1NR5A 4GQAA 3T6KA 2FEKA 3HJRA 5KCZA 3TNDA 4M1YA 2O07A 5EYPB 3LF1A 2VNIA 1A9TA 3PC2A 2LCQA 3S2YA 1FP6A 2A5GA 3S81A 2BDTA 2XZPA 2Z2ZA 3GA5A 5K8UA 2QP3A 2D1SA 2RGAA 4ZRMA 2B7BA 3EDRA 5EWLB 5MHTA 2C5LA 5IXSA 1ENYA 3OTHA 1AXRA 3IQHX 3TF5A 2R7LA 1U2PA 1EQ2A 2HGSA 4WIAA 4V3CA 3HN2A 2I2FA 5J1TB 1DFGA 4IDGA 4RCVA 2M9MA 4F46A 2PL3A 1IPEA 5HKAA 3PR1A 4UMDA 3VQTA 2YASA 2FYTA 2A5JA 4JXKA 4CIVA 4UPEA 2JCXA 3ADDA 1IK6A 3K6KA 4X5OA 3KLBA 4GVXA 4KQGA 3L49A 5F51A 2OFXA 1F2UB 3ASUA 3TLKA 1GSIA 3DYVA 5HCIA 3RKRA 3TUZC 1FUYB 5DNYB 1MB4A 1QO0A 1KAMA 2ASVA 2VPWA 4O3MA 4JODA 2V7VA 4EO4A 5LQKA 2PPLA 2F3PA 4MHSA 4ZXPA 3KQOA 4L5CA 1TD9A 4O2BA 4Q1VA 5DV9A 3UOGA 1K97A 2OY0A 1FFCA 3RG8A 2Q3MA 2RDMA 3WLMA 1RQNA 1IUPA 1CVLA 2IXGA 3CX6A 4DLAA 1DJLA 4M7WA 3T4EA 3UW3A 1ZR2A 4UHEA 1ZLXA 3WR5A 3VH4A 3E9CA 1U4NA 3HMQA 3DNMA 3LXRA 5EXXA 3GNLA 1FRFS 2Z5FA 4GSKA 1I0ZA 5ENZA 3SG0A 1D1QA 3G7NA 4J4TA 3ELDA 3U4GA 1B0AA 1F06A 1XFDA 2GRUA 2HF7A 2X2FA 4RLSA 3ROEA 4ZYLA 3OTOB 3EH1A 1KE1A 3WL3A 3N74A 2I87A 4GPAA 3E5MA 1PVVA 3RK1A 4KHZA 3GLKA 4QNRA 4MVJE 1P39A 2IEBA 1OF1A 2DFNA 3R8XA 1ILWA 1PR2A 1P1IA 4IF4A 2QSUA 2ATEA 4XVRA 4RD1A 4FCVA 4MPDA 4J3NA 1BDMA 4G8CA 4ZPXA 1CUDA 2ABWA 3R23A 5JMPA 3DDCA 1R9MA 4EA9A 1UBGA 4QVKA 3CEHA 1PQPA 3A4NA 4DZTA 2IEIA 4ZMSA 5DM0A 1LRJA 2OOSA 4TRJA 5PGMA 3VNBA 1T9GS 3K6RA 3MCUA 4HFNA 3FVVA 3RS7A 2HIAA 4N7BA 1FMJA 5CVUA 2FWJA 3QEJA 3QW4B 2FMUA 4HZGA 5AVJA 2AE1A 3I45A 1CJBA 1YVRA 3VR2A 2O3TA 1A04A 1MT0A 4Z51A 1CVRA 4C76A 4J7XA 4WE3A 4H3KB 2QQ0A 3QU4A 1MRNA 3HDJA 4AZWA 3WX0A 4EEZA 1XZMA 4ZOAA 4RY8A 4CFZA 5AVQA 4Q0MA 1W5TA 1UFVA 1ZJ5A 1HYBA 3N2EA 1E18A 3F2VA 4KAFA 1T0UA 2C2WA 1HFJA 4NK5A 4ZVOA 5IH3A 3WFZA 3I64A 4R41A 4HNQA 4IUCS 4DUYB 4DKJA 2E89A 1HQYE 4JYCA 5K6AC 3QE3A 3KJNA 3VR0A 2OV2A 3MSCA 3NV9A 1GG9A 1KWGA 3ZWBA 3OSZA 4EB0A 1N7GA 1BG6A 3IT1A 3PRKE 1XAGA 5A0TA 2RGCA 1MAHA 3G2KA 3N70A 4MW5A 4NZMA 4XWGA 4C0LA 4PG4A 3FKSD 3DCNA 3OFND 4Z9YA 3IALA 3ZE0B 2FP3A 1O95A 3O31A 3SJAA 1E1NA 1V1RB 2IXEA 3FAZA 3M5DA 3GAZA 4XYGA 4TWAA 4DUGA 4CDRA 1TD1A 3ZVRA 2QPAA 1SD5A 2WU8A 4RY0A 4DOMA 1YNSA 4S04A 3EIUA 4RJLA 3KXLA 3S7ZA 3U3JA 2GN0A 4FGJA 3D6FA 3NH9A 5ESDA 2WSIA 4ENPA 3HFSA 2VSNA 1FTGA 2CF5A 3G8DA 1DDIA 5DVZA 3IYLW 1J42A 1SBQA 2F4NA 5ARBA 5C9ZA 3H2KA 3WAKA 4AJOA 1YZGA 4R2IA 1NN1A 3O8QA 4D45A 2DKNA 2CLKB 3M0EA 5JY6A 3BIXA 2OHFA 2FUNB 1RAHA 1VSVA 5BO5A 1JKFA 5J2TF 3MMXA 1VKRA 4H1WA 1UWCA 3AB3A 4X8OA 1T4BA 1Z2AA 4LJKA 4YVFA 1RR6A 2RGYA 1D8AA 3NTOA 1FFYA 1SCUB 4PYKA 1RWWA 3IUNA 4XTCS 4MPJA 2XODA 5HYVA 1XDDA 2V7QA 3E8XA 2ZRHA 3EUEA 1QX3A 2MYTA 3KEQA 4K3UA 4QBIA 2FSSA 4X92A 4DPKA 3T3NA 3OCJA 3CZRA 2OT3B 4HUJA 3BG5A 2JFGA 3TTUA 1FTSA 2W6IA 1R4MB 4NDNE 3WGHA 1YACA 4BU1A 3Q9NA 1ISIA 2D1TA 1E2DA 2Z4SA 3DHWC 2ADFA 5TPZD 1RAIA 2IUEA 3TQTA 1RRFA 3EEYA 5B6PA 5GADl 4IW3B 4BMZA 1L7RA 4AKEA 4ZOCA 3KVNA 1WXWA 4O4HB 3BB3A 4Q3CA 3QFSA 4MQEB 4HUQB 2KBFA 3SDZA 5G0TA 4DJFC 1XNQB 3B2EA 4KYUA 2IODA 1L7DA 4DN6A 1A2BA 1WDWB 5EWJA 3HP7A 3W3ZB 4OEHA 2CF6A 4BKQA 4E88A 2HMTA 3G68A 2OV4A 3PC8A 5EI5A 1JG7A 3RSHA 3MGBA 1F0YA 1XU4A 1NLZA 4TX1A 4F4FA 1J2RA 4RD3A 1FDUA 3ZTWA 3KYBA 3GGGA 1MVOA 1IZ8A 2QZJA 2ZU0C 1LZLA 3EZ2A 2ESRA 1LSSA 4NARA 2YVAA 2B2XA 1LPOA 4XIYA 2WW8A 3QKRB 4IXWA 4KV9A 3A36A 4BEWA 2Q7XA 2OLEA 2XRYA 1GGMA 3LF2A 3FH0A 5TV2A 1DRKA 5HE8A 4DA4A 3GZJA 1SB8A 2QB5A 4AO6A 1US8B 2HJVA 2FA9A 1E8MA 2ZJZA 3D0RA 1NI3A 2PUJA 3F5SA 2OPHA 5FTLA 5CB4A 3TG2A 2BW0A 3CLTC 1L6RA 1IE3A 1BDJA 1K7EB 1UBTS 3GRFA 3W4KA 4BWGA 2QRGA 4F92B 3UMGA 1RMYA 3AY7A 4IWXA 3CVOA 3ES9A 4EUFA 4MGZR 5F5LA 4JHXA 1OBCA 4E2WA 5DLYA 2QTLA 5IAGA 5EQFA 3OLCX 5AXCA 1Y9AA 2AIRA 4Y2SA 3A9UA 3GZNB 3HSKA 1T8WA 1IPHA 1KKMA 3Q7RA 2JGIA 521PA 5JBIA 3X3HA 3TUJC 3EQ7A 2HR1A 1E5XA 2Q1UA 3SMVA 1QU2A 3QITA 5TEWA 2KE5A 2HQSA 2OBYA 4O25A 2EFHB 4MS1A 4N5HX 1ORRA 4TS9A 3KL4A 2CXQA 3R3JA 1CUBA 1D4AA 1X14A 3L7MA 3QKTA 2BLLA 3DDHA 4Y67A 3QLUC 2EZ9A 1OQAA 2NVOA 4TRRA 3TZCA 4QGFA 1LB1B 2EEZA 1WNFA 3E9QA 4QPNA 3SE7A 1ST2A 1E5VA 5CVEA 3LT0A 5EERA 5F98A 1M1NB 2YJGA 1WP9A 4KGVA 3L8FA 4OPMA 2SNIE 4GSLA 4GMFA 4PGMA 3ZDZB 4O02B 2FQQA 5KNLA 1FRQA 1NUPA 3HFGA 4BP9A 3MG9A 2FW7A 3A1VA 2YDXA 3AUFA 5J2UA 5BW4A 1JV2B 4YMTA 4WFQA 1CQJA 4JD5A 2ZT6A 3JTMA 1IN5A 3AIKA 5ALMA 4FUTA 4ERNA 4INZA 3S7TA 3TQRA 4HZUB 1XNHA 3N6RA 3REGA 4QKQA 1Y7LA 5J59A 1MZPA 1USKA 1EUCB 1GRQA 4KWCA 3MM4A 1SC6A 2E85A 2VUTA 2GAAA 3H2YA 4K6HA 4M8IA 4RE6A 3UCFA 3W5UA 4YMWA 3SBDA 3HKCB 1NDUA 3DEKA 4E1VA 2NPIA 3QX8A 4R54A 4RGBA 3U5ZB 4BFLA 3IV6A 2GARA 4LS3A 5HBRA 5DM70 2FJ0A 3IUYA 3BEOA 4GEGA 4LJ4A 1JBKA 4URFA 3R6GA 2GFQA 5IC5A 3RUAA 2Q1SA 4A5SA 4C5CA 3JZMA 3K0AA 4NBKA 3TQIA 1HUQA 5CYOA 3K9HA 1IZ7A 3RHFA 2VNKA 1D09A 3VZSA 3S28A 3W6PA 5UKDA 3RV4A 2FI1A 2AFHE 5LZ2A 4TXLA 2W9XA 2CD9A 2O7SA 4YJHB 2ZRBA 2PGXA 1VYUA 5ERXA 1XU9A 4Y2GA 4E70A 3G2PA 4G85A 1XVLA 4TKUB 2BIFA 3MTDA 2QLNA 1M2HA 4ZFNA 2PSJA 3PYMA 4DQDA 2CJFA 3OD1A 3V8RA 2JVKA 2EJCA 2IHKA 2HSZA 4NS4A 3VZBA 4R9RA 3RIXA 2YOHA 1VZ2A 1N2XA 5EHQA 2REOA 4YMHA 5JW6A 1QTNA 3U7IA 4A26A 2HMAA 2Q5QA 2I2AA 3UB4A 4POAA 1SC1A 2OESA 3PHBE 5JRDS 4UD6A 3I01A 2IVZA 4D9NA 4EG0A 1D2AA 3HHPA 1GPKA 2KLHA 2W6OA 3HQ4O 4RV4A 4M22A 3C3BA 1YMUA 5LQJA 1C81A 4WJKB 3SQXA 2DFDA 4UDYX 2DHRA 1TU0A 1NHWA 1ZRMA 2XMSA 5KSOA 1CUEA 3LDAA 4WLNA 1A4IA 2AEEA 1QK5A 1VKHA 4L02A 4RGVA 4CM8A 2Q3JA 5AVVA 3MWEB 4CKEB 3DBHB 5LKAA 5F4BA 4ARVA 2AFIA 3OECA 3RR2A 1B6TA 2W8ZA 3R9WA 1I3LA 1PS0A 1W4LA 1KDVA 1ZG3A 1XCPA 3BXPA 3PS9A 1UZLA 3WIDA 1H2RS 3HWWA 2HMUA 4YQFA 3K5WA 2Z3ZA 4FGKA 1AF4A 2O2YA 5DBGA 2XLCA 2DQZA 3L5OA 2N42A 4DVGA 5BMVA 3OETA 1TEHA 3AXTA 5K4AA 4L22A 4Y1FA 3EGWA 3KT0A 4OL0A 4W8GA 4Q3DA 1KWKA 5ANRB 1ECGA 2Z2IA 3RNLA 5A5VA 1FP1D 3ASVA 1RYZA 3QU7A 3BIFA 1NBME 3H7IA 1A9XA 2ZIGA 2WTMA 1WOMA 1MH9A 3RAPR 2Z6VA 1OU4A 3PXAA 4UVGA 2X5XA 1EYZA 1U6IA 2C20A 3T3EA 4CEIA 2H1LA 3DMDA 4BLPA 2FDCA 4CGZA 4LJYA 1HDGO 1A71A 4QVIA 4LGMA 3LBYA 4EYEA 4NULA 2J45A 3UNXA 4BFZA 2Q4RA 2XQGA 1AXGA 1RS0A 3V33A 3HBMA 1DOHA 3ZCPA 3IEIA 1QHSA 4W5RA 2W90A 3E6AA 4P7BA 4EW6A 4NV3A 5K6RA 4Q1EA 3GJ4A 4JBGA 2RGXA 4WBNB 4I1RA 3ZIDA 3EVNA 3C14C 4LF4B 1YSCA 3KC2A 4ZZ2A 5DHSA 5B1IA 4DV4B 5P21A 1D2EA 3SYKA 3RC8A 1GZVA 3BC1A 3H9EO 1GU1A 3H5AA 4FJ0A 1OFIA 4UM7A 4YECA 3HTXA 1TM3E 1RWNA 1N5MA 1HC7A 4WLOA 3HJAA 3ICOA 2NTVA 4GXTA 2EGGA 2VF5X 1Z26A 2DPHA 2WKSA 1VI2A 2R6CA 2YINC 3A4YA 4P7KA 2CEKA 4LFCB 4BP3A 1U1FA 2V3VA 1R3DA 2L17A 4A91A 4LEIA 1M74A 5AWFC 4N5IX 5LZ7A 1G1MA 4WCFC 4AG6A 2P9QA 5L3VA 4Q19A 1OU0A 3T52A 4AFNA 4CG2A 4L6AA 4W1SA 3I5YA 1PJ3A 3JD4A 2WC1A 3RYHB 3TGWA 3LCRA 4NL4H 3N8HA 1L7AA 1LEHA 3SK0A 3WYDA 3VPSA 3P2JA 4EYOA 4Q03A 1EIZA 2FSUA 1EM6A 1RKQA 3H42B 1U99A 1XQ9A 3T54A 3WMGA 3X44A 4Z86A 2FZ4A 4RA6B 2Z2JA 2BGWA 3JZDA 1GCIA 3OI7A 1SHZA 2PS9A 3VO2A 5DYNA 2QOEA 1FOEB 2HFKA 1J9ZA 5FWYA 1I3KA 1TM5E 3WWZA 3M6AA 2Z30A 1THZA 4U9IS 1ML3A 4AMUA 3PFFA 4O59O 3DD1A 2O3JA 2SCUA 3QFRA 2VHTA 3FTFA 2FEMA 4JU8A 1IHXA 3NOQA 1NKTA 4OGKA 2UUPA 1WL8A 1KMHB 1PS8A 2Y6VA 3LPNA 3G2HA 3CF2A 3OEYA 3OE7D 3OZUA 4MI9A 1YK1A 1SG6A 4C07A 3AG6A 3HKBB 3TNLA 2Y9MB 1Z29A 3MUFA 3CKLA 1RHQA 3RVDA 2Y0CA 2B98A 2FLKA 1R27A 1O94A 4N3NA 3SD7A 2GTHA 4TZTA 2GKOA 1QMPA 2W83A 4OQ4A 3WLAA 1CEYA 1AURA 1H4VB 3DDNA 2RIRA 3I04M 3GJTA 5DTQA 3SBXA 3DV9A 4QBGB 5BSGA 2XKKA 2YWBA 1C0KA 3JRXA 3IBYA 4N47A 2QQ5A 3UYLA 1GUFA 5JZOA 4XB1A 3A1CA 1YIDA 5JSZA 2PX0A 1VHWA 1VLZA 2J9FA 3MHPA 1XYGA 1QPGA 2XNHA 2B3TA 3C6YA 4EVIA 3RVJA 1AKQA 1I30A 1ULTA 3F49S 1ZDMA 3VR6D 1NQUA 1QQ5A 1RRVA 3LLMA 3CT4A 3A6EA 4BAUA 1P4GA 4C7MA 2CLFB 4E32A 1WO8A 2AWNA 4ES6A 4M60A 3EZ6A 3ISJA 3UCEA 1GT6A 1KDRA 1GFWA 3QUSA 4M0DA 5U4QA 4LQCA 5E2IA 3INRA 4R9SA 4A6XA 4PC6A 5KYWA 3QG1A 4ESEA 4CI9A 4WEOA 1VJTA 2EKDA 2ZKIA 2WWWA 3PQ8A 3PQ4A 4LV5B 4BBAA 2BMFA 2ZIUB 3N2LA 1NR7A 3IQXA 4D0GA 3LVBA 5DBHX 1M83A 4QUKA 5E4JA 2R5FA 1EFDN 3UIEA 2HBRA 2VL7A 4FTWA 5KNCH 3QI2A 1M6NA 1ZGGA 2CFTA 1X9HA 3WRXA 4YRLA 5BMVF 1Y4DE 3TGLA 1GPBA 4LQDA 3W6NA 3KXDA 1FXUA 1PL6A 4JX9A 3E18A 2QMEA 1B0UA 4BMPB 1EDBA 2G8LA 1NL3A 3CW9A 1C7RA 3K4QA 3H97A 5F1KA 4GI7A 4XTRA 1J0BA 2XMGA 3LY9A 4HLNA 4X97A 3CEPB 3EK2A 3IKMB 4L5AA 2E4WA 3G59A 2XCQA 3LYHA 3QX9A 1EWRA 2H65A 3HB5X 3QKIA 2DUWA 4UBOA 4D3YA 1PEDA 4JZYA 2XBMA 2ZSJA 5E6RA 4TTPA 2FPUA 1J25A 2I0FA 3IRUA 4MSUA 1XWFA 2FR8C 3ZHCA 2PT5A 4KE9A 4MUEA 2HKIA 4F1WA 3F6EX 5HZGA 4TS1A 4R1QA 5CEEA 1AG9A 3DUWA 3EQ9A 1ORTA 1XTJA 1T9ZA 2R44A 1NNUA 2X0NA 4Q82A 1K4KA 3HKDA 1M5RA 1U0FA 3GLIB 4ARIA 4I19A 3DZKA 1PFWA 4F3KA 5HCNA 3R9IA 3S1LA 2H4FA 4NPAA 4C03A 1I4LD 5BWBA 2F8TA 4A9AA 2AV6A 3SHQA 1DT3A 2JAUA 1T0BA 3LDHA 4B7XA 1XKXA 2A9OA 2DLDA 2RGNA 3JATB 1JKIA 2C2YA 2I22A 3KLOA 3ZE8A 3K9LA 4GHWA 4LBZA 5REQA 1SQGA 2XKJE 3PUJA 4ETNA 2GPWA 5FWXB 3QX3A 1E5LA 1M1YB 2QRJA 1C30B 3HV2A 3IO5A 4KACA 4NCIA 2RJ3A 3H5TA 3KJZA 4N76A 2H4JA 4E21A 3GDFA 1SBZA 2BKAA 4M8NE 1TMKA 3AUJB 1F2DA 3C6XA 3MTAA 4KSBA 3O21A 3WYGA 1TCBA 1CUVA 3LUPA 3VJRA 3RTGA 4K40A 4KGZA 1AKRA 1KMNA 7MHTA 4ZVQA 4NONA 5C1BA 3G5UA 5KPDA 3H9GA 1XZQA 3I2HA 4HGQA 1NJFA 3CU5A 1MJ5A 2RD2A 1K5GA 4IDBA 4JX8A 3VVLA 2FWRA 4EJ6A 4RPGA 4G01B 1MQSA 4UU1A 4Y2JA 4R6XA 4ZAVA 1M1ZA 1L8AA 4CJXA 1S8OA 4XJXA 3O2JA 3W2GA 3LX8A 4QU9A 4IOLA 1A5SB 4JQZA 1YR2A 4YH1A 3T7KA 4DJJA 2F8SA 1TIKA 4BQQA 1K98A 3LUJA 5H80A 4PAOA 2MSKA 2OLKA 2PSDA 3O90A 2VZEA 2BFAA 3OPVA 3I73A 5H83A 2IXAA 2Q8NA 6REQB 3VH1A 1UR5A 3LK6A 2P5YA 3O1HB 2HA7A 3E0QA 5EP4A 3FCAA 3CONA 3FHOA 4QHSA 3PPIA 4IV8A 1LDBA 1LLUA 2FMXA 3HCFA 3K8QA 2IYTA 3SSOA 3OZBA 1OX5A 2AJLI 2Z56A 4IEEA 4LOKA 4QEDA 4IFEA 4D3FA 3AETA 1THMA 1VMDA 3UAXA 4HO1X 4RD0A 3JARB 1Q7BA 1GA6A 1RYHA 1SOWA 4PFKA 4U2EA 4Q7EA 2VJYA 1OVMA 4F4JA 1ELOA 4H0CA 2J4FA 3EZNA 1LD3A 1P1BA 2A9JA 3C7TA 4PLGA 5EJMA 2DFTA 4QTZA 3RIHA 4DV0B 2QV7A 3IIMA 3EQ6A 3NT2A 3IEUA 3SS8A 1C7QA 2LPMA 1NVGA 3RVQA 4PPQA 3RYFA 3TQFA 3I23A 4WOKA 2YX1A 3VZCA 4CQMB 1H9AA 2NXCA 5AOVA 3DL7A 1U8YA 1YOVB 3A3OA 3KZXA 2ZIFA 4KQJA 4NOMA 4OJMX 4DQKA 4EKYA 3EG5A 2PD3A 5JLAA 1Z39A 4LHVA 3PJFA 2F1KA 4ZI5A 2GN4A 5ALEA 3IBSA 3VM6A 4GRDA 4LN1A 4TLLB 2AR7A 4D4LA 4BWYA 1QOQB 3B53X 1DNPA 2P9TA 3SSMA 4HH3C 2NAPA 2CFOA 2B8EA 4XA8A 5LZ4A 1TXGA 4P35A 4EA6A 4ENTA 2UXDB 3GX1A 1UBRS 2EFDB 4A1FA 4C6SA 2EZUA 4IV5A 3JAMA 5JSFA 3ANTA 1N2GA 2C31A 2EW1A 5I9BA 3RODA 3LUDA 5GAJA 2IEZA 5CG1A 4RZ3A 2JAPA 2O0LA 2ZRAA 5LP6A 2OGUA 2W6MA 1EE1A 3AF4A 1H2FA 2X14A 3U7GA 5I3CA 2ZUCA 3D4NA 2PLNA 5B1HA 4H1HA 1JDVA 2FSIA 5FV7A 1KZ6A 1RWXA 5FHRA 3RASA 1P29A 5JCJD 3IIKA 2WABA 3OHPA 4S1NA 4S1PA 2J48A 5E1BA 4XEUA 4C21A 2BFWA 4MVJD 4PGAA 5EESA 4D0LB 5C52B 5ALWA 4H3SA 3VYWA 2H00A 4F84A 3DAHA 1K5DA 4FOSA 1ZWLA 3E35A 1L5VA 4NIMA 2DR2A 1U0OC 2O3SA 3IE0A 3DPIA 2PBLA 2WWHA 4GOOD 1KFBB 1DS6A 1TCCA 3UHPA 4G5SA 4QDZA 2DPXA 3E8SA 2EAUA 5COBA 2G1KA 3IP5A 4BO9A 2BM1A 4XD7D 4COOA 2FPGB 1E6WA 4JBYA 2AEFA 4LJ9A 2AX3A 2H5JA 2VDJA 2F3QA 3P26A 1H8HA 3OVMA 4UHFA 2X5NA 2NTEA 1TT5B 1YHYA 2EZ8A 3AH8A 4TTJA 5ALFA 3GOHA 4ZU1X 3SJCA 2HEIA 5K6AA 1BXGA 3I1YA 1E1QA 1DEXA 4CNQA 1A96A 1EJ0A 1I6KA 1K75A 1W96A 2JF0A 4D42A 1LSOA 2A1UA 5AUQA 2JFNA 2OZLA 3DZDA 3HR4A 3OM1A 3TZBA 4RF5A 3OLXA 4O5AA 4YAFA 3WDKA 2COUA 2QBYB 2VHWA 3FPKA 1Q1EA 5AKIA 1MJGM 1PK7A 3CT6A 1D03A 4N3CA 3CUKA 4RPHA 4KQMA 1OLSB 3DJFA 3LH5A 1N2CA 4OHUA 5CBPB 1OX4B 3C41J 3DFFA 3DKKA 3JZAA 1KQFA 1B6GA 1QHEA 3ELWA 1ZSVA 2V74B 1KY4A 3E9NA 4YJKA 5FOXA 4BLQA 1RC0A 4JU9A 1X2EA 1TO6A 1QM5A 4G84A 1GU7A 3W2HA 5DT2A 3NS7A 3D7SA 5FV4A 3GLTA 5JAZA 2PR7A 3VTZA 5KVSA 4GGMX 4IIGA 4E1BA 3UJPA 3G0OA 1XZDA 1WBDA 1FEZA 2XUPA 4HEQA 1A9RA 4ZHSA 2DPGA 1AKWA 1N0WA 1Y4AE 3DO5A 1G19A 3GR6A 4YP7A 1K8YB 2Z8XA 4N8SA 4M6WA 2H0RA 1JPNA 1ULSA 1U0HC 1JDJA 4NLLA 4MRAA 1KQNA 4A2QA 2J5KA 4JAVC 3NWPA 2R7KA 1G66A 3BRWA 1X8XA 3I37X 4UFOA 2O19A 3HL4A 1YONA 5LUAA 4RXMA 3NBQA 1O89A 4ZJPA 4MKRA 5KU7A 4PG6A 4X6XA 2ZR0A 5JMOA 3FSGA 3HFRA 1J0CA 3AJEA 2E48A 4BFTA 2HHLA 4CU2A 5H1YA 5G1PA 5B1SA 5LXTF 5FP0A 2WICA 2CC2A 4G5XA 4Z54A 3W4JA 1X7ZB 1NP6A 2HK6A 1U5BA 2JIPA 4CYMA 1XWWA 4LXUA 5CURA 4CMEC 4FWTA 1D0IA 1WPRA 3O9VA 3KV3O 1Q12A 5E0OA 5B3AA 3W4IA 4ZIRB 1MFZA 4GO1A 1FXWF 4ZHQA 3W0LB 2VSXA 2Z2XA 2YBEA 1JVBA 1E5QA 1Y1KE 3DKVA 3LZCA 1EQAA 3JASA 1K1EA 2PL5A 4B5KA 2FRVA 1E7MA 1H8EA 2HWXA 2CNWD 3I9V1 3QXXA 3VAZA 1RQXA 2OBXA 2ZWMA 3KSDO 5AI4A 3TKAA 4PX5A 3UV3A 2Z6QA 1YTUA 1GD1O 1AVTA 1TCAA 3NYQA 3SICE 1WKCA 3VHXB 2O3RA 3VC2A 2JBWA 4B6PA 1IEWA 3I2KA 1DADA 3D4BA 1FYWA 3EXFA 3GU3A 3QV1A 4KAAA 3IOMA 4L3WA 4MPRA 3TTVA 1F8YA 3WMWA 1QK3A 4FYJA 4IS2A 4QQ8A 3R7SA 8AT1A 3UGJA 3BXXA 4LC1A 3A8TA 4ID9A 4CM4B 2EEPA 3M2PA 2G07A 3FOEC 3NIDB 2WYOA 3B48A 5EIAA 4F7DA 3RB8A 2XEDA 3PYXA 4WPGA 4MK4A 1KQPA 2RJNA 3TN7A 4FP9A 4EB8A 1TQ2A 3PLNA 1RLUA 4Y9TA 3SVLA 2WD9A 2XQKA 2ECQA 3NYRA 3KE8A 4LXTA 5KDOA 5LP6F 1VIYA 3CLSD 3IAM6 2X58A 5I7RA 1FCJA 2GZ3A 4F9EA 4OQEA 4KQ6A 4EHBA 4DJAA 1X7YB 1AMNA 4OI0A 3IQIX 3TAUA 2QLBA 3QEBZ 1HO3A 2Y0PA 3IS3A 1EHIA 2QMQA 3C45A 1ZLYA 5EL0A 5KTRA 4XJVA 5EMJA 2CE2X 3LW7A 1T1EA 4KB5A 4XPIB 3UMJA 1FDVA 1F4PA 1U7UA 1VXOA 2GCIA 4LZOA 3SZLA 1GN9A 4AULA 2NU6B 4JVLA 2B8JA 4QJBA 3CZ4A 2NVUB 1KYWA 2IXBA 2JIMA 1XA0A 1RWQA 4IDAA 2R0QC 4QM6A 4A92A 2FWIA 4R69A 2A3NA 2P4HX 3G9UA 2BC9A 4LJ6A 2XCIA 4OUDA 4MS3A 5TXGA 4CEIB 4BVBA 4RVDA 2P2LA 3X1DA 2WTXA 3EQZA 2C4WA 4BGIA 3BPSA 3D3NA 1RQ7A 3KQWA 4CM5A 3UHOA 1JQEA 5A04A 3PA6A 4MVXA 1C3OA 2I4IA 2Z8ZA 1KBOA 5KKAA 1ADFA 4B2IA 3O83A 1Q50A 3OLWA 1IJFA 3PITA 1R0LA 2VDWB 1ZJZA 2JLQA 1ODCA 3F6SA 3OPYI 2IYSA 3A06A 3DTVA 3R5TA 4GR4A 3GRCA 2JGEA 4CWAA 1OKKD 3R0VA 1EZ1A 3G9QA 1IBMB 5DGDA 3PVCA 4BXOA 3WHLA 2P8SA 1QV7A 1GR0A 3SZOA 4NYMQ 1OILA 3IUQA 1DKMA 4P3XA 1KO1A 4GPZA 4LOHA 3CPJB 1P62B 2GJ4A 2XUDA 1RE0A 3O91A 3A1UA 2AE2A 2ZSIA 1F9AA 1OUMA 3DS8A 3URMA 5KYXA 4EM6A 4O29A 4F6CA 3K6SB 1EK1A 2WE7A 1XTSA 4MJLA 4DXHA 2V3WA 1C8LA 2FX5A 1G5RA 3FFTA 4HRXA 4TLMB 1RM3A 5ALTA 4J0EA 2OQIA 4P4TA 3UC9A 1T36B 2AD5A 1S9HA 4YEDA 2A0WA 1OHHA 4LF7B 1ZCZA 2J3KA 1ORDA 2HRBA 1HDRA 1D6MA 4J7AA 3C8HA 4PSDA 4QUAA 2REXB 3F3SA 3C4JA 3K0KA 4DLPA 3CZ5A 3SR4A 4BLWA 2J9ZB 3CVUA 4G9EA 3TD2A 4BQFA 1OWMA 2R8ZA 3STYA 2GX6A 1VKNA 3QYFA 4N40A 3S40A 5HIAA 5JTTA 1VGVA 1E60A 4JLVA 4QM7A 1KTVA 4L4RA 2YXNA 4QDOA 4C7KA 2AVDA 1LJUA 5EP1A 5CB0A 3QF7A 4YN3A 5TC4A 3UPUA 1ZX1A 1JQ5A 4YAIA 4NNOA 1HBJA 2GEFA 4LQLA 5BSEA 1HNWB 2R7MA 5FBWB 5ALGA 5FA6A 1XJCA 4LXIA 2EKLA 2H4YA 1UUFA 3U4QB 3KQPA 1DQYA 3R3YA 4M9RA 1LPNA 5B1YA 4PLHA 2IUYA 13PKA 4BV3A 3HUEA 1CEEA 4B6EA 1OI3A 2MJLA 2QG6A 3C3AA 3KYIB 1FNNA 4H1UA 2ANBA 1EJ2A 1NUHA 3M33A 4OK6A 3SQLA 2PKRA 3L0DA 2EP7A 1L4UA 2ORYA 1Y8AA 2VT7A 2JRCA 4GL4A 1KI4A 5KTTA 3PF8A 4XYEA 4G5QA 5I4CA 1VL8A 3BFJA 4LDJA 1AZLA 1W0JA 4WZAA 4KSCA 1ICEA 1Z22A 2ST1A 3D6JA 3NORA 4YACA 3FNEA 1P0PA 1GCGA 1KBQA 2VLIA 5ADUS 4D8XA 1RBMA 1WS6A 1LK0A 3LKBA 3Q0EA 4QTUB 4WINA 4BPRA 5DTJA 3QG5A 5KPJA 1ZJYA 3HABA 1M6VA 4I46A 5F35A 5K8IA 1II8A 4AF7A 3PQ3A 3EW9A 1ZUWA 4XIFA 5DI3A 4YRNA 4HNUA 4KQEA 4N01A 1V7CA 2SICE 4RZ2A 1J5EB 4LCBA 3UG6A 1Z35A 3LXXA 3ZI4A 3TW8B 3F9RA 3U49A 1S7CA 4YRBA 2RHJA 2C1XA 1G9TA 1O8CA 2ZB2A 2BR4A 1HF3A 4GLLA 5CPBA 5EIWA 2VQFB 1T0PA 1AQIA 5EHZA 1Z06A 3QXGA 2OB2A 1CJVC 1CRQA 1N5OX 3QZUA 4LTNA 4DANA 4EX7A 2XUKA 4JLKA 5CAEB 2C9DA 2ZBQA 1L7MA 3LUGA 5G53C 4UTNA 1JDBC 3CO5A 1RI4A 1QIGA 3H7AA 4LDPA 3R75A 2WHRA 2GCPA 4ISBA 4KX3A 3L1IA 3AZOA 2CV2A 1Z2NX 4M7OA 3PXUA 2C9MA 5LMCA 2GFHA 2W4MA 1J2JA 1PZHA 4EEXA 3ETGA 3HSYA 4H1TA 1W5EA 2KYRA 2KB0A 3FDXA 3NTUA 5A3QA 1E89A 3KG2A 3F97A 5AJXA 3EHEA 1XZAA 3I2FA 1YS2X 4XGIA 4C4TA 2OCIA 5FEUA 3PEVA 3KD3A 2QZSA 3OY2A 2PSHA 3Q0TA 5BVGB 2J0EA 4Q37A 1T0HB 2NO1A 1LW6E 2UV8A 1QDEA 1UPCA 4WDQA 2B78A 1CZOA 1Z3CA 3KQSA 4MGEA 1G8HA 2W2KB 1ORIA 1SUDA 4FNMA 1P5JA 2IYRA 2HOQA 3VKHA 4M9SA 3K0FB 3H3JA 4IJ5A 2DF8A 2AN4A 4LPKA 1DHRA 4TRNA 4KVZA 3I4LA 2JGFA 1I9GA 1J07A 3JQ9C 2PYDA 4C0SA 1DWPA 4Y2TA 1XMIA 2XAAA 1L2TA 1OZFA 2NVBA 2O1EA 2Y71A 1G6KA 1XBTA 3FHCB 2CL5A 1F2TB 3CRZA 3KOXA 4GOKA 1K7YA 2OD7A 3PCRB 1X80B 5DBIA 1J1IA 5DHQA 3ZVMA 2PRYA 3K35A 4EL5A 2G80A 3CEAA 2NPFA 3ADPA 4WSOA 5JXJA 2GBLC 1MB0A 2JFVA 1TYZA 1GVNB 2WMNB 1MC1A 4JBIA 4NAUA 3RSFA 3K5HA 4BJ1A 2P4SA 4TMXA 4I4LA 1DMSA 5EHGA 5DW3A 4OGGA 1H22A 1PQYA 4NOJA 5AR1A 1J8DA 3SFZA 3E9ZA 4L5YA 2QMOA 1CUXA 2X86A 2WD7B 3AY6A 3BD8A 3FUWA 3ITDA 3LSYA 3SHVA 1SCNE 1ZISA 4I3GA 4URHA 2OXTA 5IBRA 2NMVA 2X8BA 4JR2A 4ED9A 2DKOA 2Y1FA 1AN9A 4KDCA 3FJYA 2PR2A 4WCFA 1X7WB 1YVEI 2YRWA 5DGIA 1IHUA 3KEGA 1ZGJA 4IHJA 3DMTA 3OUTA 4KVFA 5JMTA 1C9EA 5HE9A 2WSBA 5L3QA 3R3SA 1Z6XA 2HLHA 3H1BA 3OPXA 2EFYA 4DLWA 1E7SA 1CX9B 3ZCSA 3N8GA 4M2LA 1C4XA 1EGMB 2ODTX 4DBLE 1DQPA 1GQ2A 1IZZA 4YXWD 4KN5A 3ZDEA 2PU7A 2AL7A 2ZJYA 1L5HB 5BORA 2FJPA 1WUIS 3DFIA 2WT9A 2WUFA 1ZJ6A 1GY8A 1UPFA 1I2CA 1FF9A 1VJGA 4P86A 2P9YA 4BNXA 1PJTA 2P1RA 3CRRA 1MB9A 3CUSA 2WAYA 4GM1A 4MJXA 3AUKA 2DX7A 4R5HA 3HEBA 2BKLA 1M54A 1LVHA 5EC8A 2E49A 3ETHA 4JOSA 1A5ZA 4YDHB 5EJFA 5AM5A 1COZA 2OCYC 1T0JB 1C3JA 5E9QA 3UUFA 2O14A 2OHXA 5IKEA 5JVDF 2JG3A 1N2BA 2PLWA 4IKOA 1T5LA 2QUJA 1N6OA 3BTSA 3ZHRA 3FIJA 1ZXBA 1D6JA 2A35A 3B12A 3DMRA 3K1AA 4GKKB 2R97A 3KT8A 1I94B 1QNLA 1TMYA 2A9RA 4J0HA 1VFPA 5LB4A 3PK0A 1RPNA 5JCOC 1DQSA 3OM9A 1E20A 3V4PB 1G5QA 1IIBA 1TGYA 4KFSA 3VZQA 4AI6A 4L5BA 4XZ3A 2R1VA 4JDPA 3T4UA 5T5QA 4TYPA 2C82A 2F90A 3RK0A 3WOHA 3MT8A 4D44A 3O4HA 3MILA 2HIGA 4BCBA 1QH8B 3IPRA 5E2BA 3RTBA 2ZI7A 3NHJA 1FDRA 1Z0JA 2IK8A 2XQFA 4MJ3A 4N3AA 1XMOB 4RQUA 4J75A 4X90A 3DOUA 2VPYA 5E4FA 1GNVA 3NIFB 4MP3A 2EVWX 3ETEA 5D84A 1KEVA 1QB7A 4AD8A 2I3ZA 3FWKA 1UODA 3H6GA 5D5HA 5DSZA 3FTCA 3FX2A 2H9AA 2JW5A 1I3NA 2JFHA 1E3QA 4YX9A 4RL4A 1W2HA 4N9WA 3QNUA 3UZUA 3TX2A 1RPTA 5FR1A 4WKPA 4UQPA 1CZUA 1MV5A 4PBRA 3RS4A 2IH5A 5DH9A 3SVTA 5LVAA 1W4CA 2XIJA 4EF5A 4FI3F 1XQYA 4EY7A 2QVGA 1E0JA 5TNXA 1OFVA 1AO3A 2E37A 3KQNA 1DZIA 2FQWA 5FO1A 1DARA 3V1UA 4C0BA 5AT1A 1V6SA 4YMGA 4MW6A 2E7ZA 1SXJA 1DFIA 1W88B 3RVPA 2YJZA 4NJEA 4M1EA 2IYLD 4GOND 2CL0X 2ZITA 4BFWA 1NSFA 4I4TA 1K8ZB 3EASA 3HUTA 5BSWA 4I2NA 4EHLA 2XWPA 1RKBA 1LTHR 1SVIA 1B3RA 4WFKA 2RKWA 5KNBH 2AOUA 3UMYA 3MRVA 4MITA 3HCWA 2H18A 2KI5A 3USZA 3I9KA 1GTL1 3KKPA 3NG1A 5DX0A 5K2MA 4MIKA 2VDPB 4ZOLB 3MWKA 3PC7A 4B43A 4BKUA 2GVDC 1U81A 4DXAA 1HDOA 3WLPA 3WYEA 3FCCA 1WMFA 2B5WA 1HFWA 4I66A 4JI7B 3M89A 2XQIA 3NP7A 4TRMA 3SR3A 4YYZA 1T5TA 4BQSA 2Z9DA 2IYNA 1SMKA 3MTQA 5T41A 2I3AA 3L7LA 5CJPA 2O57A 1T2FA 4FWIB 5LPNA 4D8YA 1Z08A 2OSBA 4FZRA 1XRQA 4CFSA 3KQUA 1QHIA 3D2BA 3GPDG 3QVOA 4DFDA 4RZSA 4JOBA 2R6FA 4IX1A 3AFMA 3TJZA 1PLJA 3D4PA 4C29A 4CEHB 1MPTA 3ZV5A 3D7LA 3ISVA 4RJJA 1XO1A 2GZHA 4A23A 1L4MA 1NG9A 5HDQA 2NXWA 4HDMB 3FBGA 1OREA 3F78A 1DEKA 5ELLA 1QNFA 1ILEA 4PHHA 3OOJA 4UZEA 1N1GA 4FYYA 2GI4A 3AQIA 3OX1A 4DIDA 3PSAA 4IHJF 5DLQC 2WSMA 3R3VA 3H9CA 3U3XA 1XZJA 1CJUC 2JGRA 3F1KA 3OPMA 3EGXB 1T6YA 4KXWA 4QGBA 5DGCA 2UZ1B 3ZIAA 5TLSA 2HYIC 5JS1A 1QH1A 3F7NA 4ZAWA 4EPWA 1N6IA 1CY4A 1GNRA 2IYZA 2JVIA 2B9EA 2NW6A 2QG9A 3KELA 3KOMA 1PR5A 3AUXA 1VE3A 3TE7A 1L7PA 4CKWA 4B4KA 3AIOA 1NM5C 3GLFB 2X2PA 2YHSA 3BXFA 5C8VA 4NBTA 1COWA 3MAJA 2C5BA 5HOQA 4RW0A 1X70A 1PG2A 4FFPA 4R3UC 5EZYB 1CEQA 3ONWA 1RP1A 1UDAA 1DKLA 1VDMA 3M81A 2ZE6A 2VN8A 1XCGB 5H68A 2GUGA 2ZR8A 3PWZA 3OZIA 3F6CA 3PSHA 4NU6A 1JYFA 4I55B 4OREX 5EJ5A 3EGDB 1U2DA 4YCDA 1D8TA 2R1TA 3PLAE 3RHTA 3B60A 3G2NA 1TRHA 4FLMA 2Y68A 1F48A 3LFUA 2XB8A 2XD9A 3NT5A 4LDQA 1WXQA 5TQ0B 1MEEA 1ZPDA 3FOFC 4OSPA 4PHFA 3NAMA 4Q9JA 1M6HA 5JWOA 3P4XA 3MHTA 4Y6LA 4D98A 1E2PA 3KRTA 3SNHA 2XADA 4LJ5A 4LKRA 2X3UA 4X66B 1DOAA 3AL3A 1G8JA 1JFLA 3LMKA 4RK1A 1SA0A 4FUQA 3DQPA 3K8YA 4FR0A 5EIBC 3CPSA 1QX4A 3K8OE 5H3HA 3ZWWA 5FPKA 3ETCA 4QG7A 3ROPA 2VHQA 2CDAA 2B1QA 4FSDA 5EKUA 4CL2A 2E6UX 5HGXA 4ZQBA 5JI3E 1H0SA 5TPWB 4D79A 1O0BA 4EBFA 1DDOA 3MPUA 3ND7A 5WRFA 2Q7DA 5J5AA 5JCXA 1JDPA 4GMXA 3DAGA 1WIWA 1Z2EA 2PEZA 5EJ2A 1SEVA 3I9LA 3FAKA 1ZZGA 4U2CA 1T1SA 3KQKA 4PAGA 2H63A 3GELA 5CYGA 2WQ6A 1LKZA 5CDTA 1C7ZA 3TR0A 1M2JA 3QVGB 3IUBA 2CVFA 2PUGA 2P65A 4HQKA 5KX5F 1UBCA 3NOOA 3M2TA 4WXHA 5ECDA 1SOMA 1YBAA 5DWDA 2PBFA 3AR4A 4QBKA 3GLIE 4B3MB 3WL7A 1NZDA 3W06A 5JT1A 5JH7F 3EAGA 4R83A 3L0OA 1QF7A 1V1JA 3OJFA 4O0LA 2I3DA 4TTQA 3TZEA 1CF9A 2RK4A 2WKQA 4CLRA 1K4YA 2MWMA 3GNSA 2G25A 1G9SA 3AP1A 4TPKA 4URZR 3WO1A 2RH4A 3ITEA 3OQJA 2IS4A 4MHTA 1HT2E 3ZE6A 5CIQA 1AGXA 5EWMB 1M1YE 3DE7X 4MMXB 2E55A 2ZRMA 3AWIA 1Y89A 3RRMA 4CG3A 4UFPA 5JYCA 3HXOA 5IT9A 3TI7A 1PHRA 2H52A 2FWBA 3NYWA 4DHEA 4FW9A 1GUBA 5KYGA 4X94A 3V55A 4RJIA 1B4DA 4RVUA 1HH4A 3WOVA 1HFKA 1UC8A 4PONA 3AERB 1IOVA 4G63A 4V2UA 1PS9A 4WY2A 5ABPA 2BZ1A 4EMUA 2B4TO 4EO7A 3ZZTA 4RKRA 2JFBA 2NUBA 3HNOA 1MJGA 1JUDA 2JJ8A 3O8CA 1IBCA 1NSTA 2AEMA 5IC6A 4RTMA 4LFBB 4UOQA 1BAPA 2HSGA 1O6ZA 1KC1A 4J0JA 3ZOZA 1JH8A 3RSGA 4H7KA 1JRLA 2OWEA 3DLPX 3WL4A 2DQKA 2BMVA 3JWIA 4C1BA 2QPLA 1FSSA 2X0JA 2Z4RA 4W7HA 4XLTA 1PEKE 1RQ2A 2BBSA 3NR2A 4RANA 4BGUA 4GM0A 4IRXA 5CA0B 3U4CA 3PR3A 1YDHA 4L07A 3JAKA 1F4VA 1W581 5GIPE 1Y3AA 4RFLA 4BEJA 1HDCA 4Q15A 4BN0A 1NI4A 1GKKA 1IB0A 1XNGA 1EUYA 4A2CA 3CX8A 2RH5A 1BHQ1 1DWOA 2IFTA 1AV6A 2WJVA 1M8FA 1B8OA 2H08A 3CSDA 2B4AA 4ME6A 3OG9A 4HGOA 1WCYA 5IWCA 4EJSC 4GXRA 2QN6A 3SLRA 3L7KA 1QV6A 2EG5A 2G71A 4PQYA 4RK4A 3CXRA 5TEVA 5JD5A 1MPXA 5LR6A 4HADA 3PZRA 1U8CB 2CKDA 3AC0A 3P2YA 4IDQA 2EIHA 5T6BA 4ALNA 4N54A 4HGRA 1CUWA 2Y6UA 3B7WA 1ODIA 1JFFB 4IQ4A 4TZKA 3M6VA 4Q4JB 4BCCA 1SXQA 2PMCA 4II7A 4WMLA 1EEXB 3JPYA 3UK1A 4G9BA 5KWEA 3KFVA 4B82A 2HK7A 4KIGA 1CCWA 4G8BA 4HYYA 1YUBA 1NE7A 3FUVA 4D26A 4KAJA 5IFKA 2INGX 2PQ6A 1KAHA 3ADOA 1VGRA 3QWFA 3OHSX 1TAQA 3NBXX 1XEXB 5DASA 1MAVA 3RS2A 1KKUA 1B73A 1AZWA 2XMDA 4B80A 2PWBA 3UJ3X 1GGVA 2QUBA 3MCWA 3CKKA 1RM4A 3O03A 2Q2QA 4C7OA 3LCVB 1RKVA 3PGLA 4BWVA 2GMWA 2CWDA 2WJGA 2DFLA 4GP6A 3HCNA 2FWPA 5F2OA 4KDFA 2YRXA 5DKFA 2YNMD 2E4VA 4JJAA 3IPXA 3JPWA 2YJNA 1ZAYA 2MYNA 2J31A 4GWGA 3D81A 2BKEA 3GGOA 3LQFA 3RIEA 1K3FA 1L7OA 3F4BA 5AHOA 2QRPA 5G1OA 1XAJA 3FR7A 4NX2A 3T5TA 4EUKA 3WC4A 4JP8A 4AJ4A 3OHMA 4H7FA 3UTDA 5HJ7A 1R0ZA 2PRZA 3FTPA 3FR8A 5LZ8A 3K0BA 5CDFA 1UFOA 1YZNA 4OXNA 1S2MA 1CDOA 1NOIA 4H7DA 1ZD9A 4DF3A 5JAIA 2IBSA 5HXAA 5G4KA 4RK0A 3UH0A 1KQGA 1SUEA 1Z68A 3V46A 3OMLA 1T6BY 3T1QA 3UMSA 3GFFA 2ZWOA 2HJRA 3R5HA 2P2NA 2BCGY 4FPXA 3ECAA 1PCXA 1NBMA 2XGSA 3NUGA 3PVZA 4HBGA 3GUHA 3UH1A 3S2ZA 5TARA 1YXMA 2AG1A 1PR6A 2CVHA 1T2DA 1Z12A 4V1CI 2OCAA 2ODPA 3KJEA 3D3JA 1KP3A 4ARCA 3Q8WA 5BPFA 2FRDC 1S3IA 2NX2A 5EJ8A 1DKRA 5H59A 1KZ1A 4LRXA 5C1IA 2FEWB 4Q9AA 4X3CA 1USWA 4UEWA 4WBSA 3CNQS 1KJQA 4MVJG 3TL2A 5EJ9A 3E9EA 2JHGA 2GJKA 4L4UA 5BYAA 1C4WA 1CSEE 1E9EA 3GEHA 2YZMA 1FQKA 4G1MB 3LT4A 2YIVX 5IUNC 4PYIA 3WL5A 3B8HA 4OLHA 3ZEIA 4K9OA 4NYIQ 2Q5LA 1GGFA 4M99A 4Q93A 2XOKA 3IHWA 3DE6X 2VZ8A 1Q92A 2BGRA 2W2QA 3L8MA 4Q16A 4JLSA 3G8AA 2V8OA 1UDWA 1Z3IX 3CMCO 3D8BA 3NETA 4K9MA 5DK6A 3VHQA 2C96A 3SZRA 5M5BA 2VXCA 4DYHA 2C7GA 2VBIA 2RBKA 3ICQB 4BV2A 1N5LA 2FG6C 4L27A 2G0TA 3C0KA 3VYVA 4EJSB 4CZ2A 4JI5B 1HPLA 5EE5B 4AU1A 1WUJS 4BO3A 3DBRB 1AS3A 4B3JA 4KH1A 2HNAA 3ND9A 2BCJQ 3ZY2A 5LM3A 1WAMA 2BGKA 3WWYA 2EJWA 4C88A 4FB4A 4R8KA 1UANA 1RYMA 2H17A 3AFNA 2QE6A 3DYIA 1N4DA 4MPTA 4O4IF 2WV9A 3FBTA 4W1RA 4D1YA 4NCJA 3U7FB 5DIZA 5FF9A 4XLZA 1ZJJA 3DVSX 3HJGA 1SGWA 3RT7A 5L3SB 4C04A 3HZOA 4X71A 1XDGA 1ZEMA 4GP7A 5IP5A 3E22B 3D1LA 4LBYA 4GFDA 4A8JA 3I9FA 3PFCA 3THWB 1IXYA 1ZK0A 4KMOA 5K45A 1JYSA 1T13A 1ZFNA 3OZEA 4F1KA 4Q34A 2QE7A 1D2CA 5CD9A 1TTHA 4E22A 2C4MA 1AKEA 4UXIA 4L73A 3BIOA 3VU1A 1ACLA 1Q77A 2FDRA 4OQYA 3U40A 5AI8A 5IJ9A 1JMYA 1U9JA 2RH9B 2WQ7A 3ZV7A 2FF7A 2JLRA 2Q0HA 1ZCBA 2NXEA 4EVSA 1QHXA 2HZBA 4QBHA 3VMMA 4X1KB 3WXMA 2VDNB 1KQOA 5BN3A 2PZBA 3BBPA 1NW5A 3OZVA 3FRJA 2QYHA 4YNBA 1E69A 3FZQA 3ANSA 4E4TA 3MOIA 4R1TA 2W58A 4ZA2A 4Q24A 1GG2A 4N8DA 1GAEO 4DMMA 3KTFA 3HCBA 3OCWA 4Y2HA 4BNHA 4E5VA 2ORWA 2A33A 4LJ8A 3U0VA 1GM5A 1HKHA 4YV0A 1WUHS 1X8KA 2P2SA 2E4XA 3DZHA 2A4KA 4LOIA 3U7EB 3TR6A 1LJ8A 2L19A 1Y7PA 1EFPB 3N0WA 5KU1A 2H06A 2WSSA 1JA9A 4G5HA 1BXZA 2CBGA 3P9QA 4TTTS 2C3PA 2BMAA 2IYXA 3N58A 7REQA 3NDRA 2J3MA 2HX1A 2QR5A 4YT4A 4L2IA 2ZRKA 4OBEA 4B8YA 3ND5A 1EQUA 2GPTA 2WM8A 1SXHA 3H9QA 3P0FA 4HYEA 5M34A 2D1YA 1SZJG 1W7AA 1UKVY 4I9UA 4O2AB 3BUSA 1SIUA 5I45A 1OVGA 2AMVA 3OMWA 1Z4OA 3C1UA 2ZYHA 5IMSA 3BTUA 2QM7A 1MORA 4L0CA 4PYOA 1FTWA 3PQDA 5ER9A 3ZGLA 5JDIC 2IBTA 5K9ZA 3EDOA 3AVYA 4X44A 3DG9A 1G8PA 4A2PA 2DU8A 1ONNA 3M4NA 3D02A 4QFBA 3R6TA 5EXPA 3WHKA 3ZZNA 3EIEA 1CEXA 2QQGA 3P32A 4DQVA 4INPA 4LY9A 2MCFA 4BB9A 4DLNA 5L4LA 2ZYRA 2E2WA 3M6LA 4JY7A 1E3SA 1AUXA 1E8DA 1LS1A 2IF2A 4YQEA 1OW3B 2WLSA 2QRVA 3LA8A 4V0NA 2ZI5A 4XUDA 3EQ8A 1Y6JA 4M4SA 5J40A 5IAKA 2CBZA 3WLJA 4G0XA 3ICWA 4RSRA 1W4AA 3Q7PA 5I48A 4KIFA 2ZQ5A 3B6KA 1HG1A 1VLMA 4HB4A 2JJ1D 5LNK6 4TKMA 2Q4OA 3I72A 5DLEA 5C35A 2JJYA 1W1UA 3K72B 4L57A 1P44A 4NWIA 2PBRA 4QGHA 5JE8A 3ZCXA 3STXA 4Y7CA 2XB2A 2UZIR 1EFAA 2P5UA 3OWHA 1M8JA 1VL2A 3N75A 4I5EA 2ZRCA 5IBCA 2H2GA 2BLNA 2XWQA 2ZB7A 4FEYA 4IJ6A 4WCVA 4REQB 1UL1X 2OHVA 3NP9A 3WLFA 3FLMA 3HYSA 2VWHA 5JSUA 2JK1A 1T9BA 3VNUA 1GZHB 5KDLA 5I01A 1TDJA 3NHUA 4XQCA 1HFEL 3A3KA 3U7HB 1JKJB 1K6XA 4D8VA 1CY6A 5KKCA 1EFRA 1F12A 5JJLA 4G6ZA 5K99A 4AQ7A 3GLVA 3GMDA 4BNLA 3Q3HA 4WVFA 4MXDA 3EFOA 4FU0A 5JATA 1FU8A 1BCSA 2G40A 4JB0A 4NFHA 3KSMA 5DX8A 3KYCB 4BFUA 1FDWA 4WI1A 1FZQA 2WFZA 3DL0A 4FQ8A 1UBLS 3DE4X 4J6EA 4JBXA 5EE1A 3RRNA 1WMAA 3JQ9A 3LLCA 3M4YA 2I33A 4IICA 4CL8A 5KB3A 4R0MA 1IN7A 1H2WA 1SWVA 3K9CA 4KOAA 5CMLA 4DUZB 3HZRA 4LVCA 5CEJA 1E2FA 3R41A 5B30A 4DA7A 1TIBA 3HK2A 2CNOA 1F1BA 3KDAA 4K05A 2R6AA 4QJIA 3MJHA 3RBAA 3VYTB 1HY3A 1PU2A 3JXEA 4RXUA 2GBLA 3ESDA 3DBIA 1R9GA 3LCJA 2YYAA 4FHEA 1C9KA 2GAJA 3V6LA 4CLXA 1CF4A 3IPCA 2I80A 4G2TA 4IIJA 1J23A 3HNRA 3GT7A 1EVJA 4P4GA 4JYBA 2PYZA 4DSUA 5FI0B 4U9HS 4KO1S 2ONJA 4LI0A 1DV1A 5BWOA 2Z5GA 4NXNB 3DUFB 2LIVA 3MUEA 2Q3HA 1JTEA 3MTBA 2NZ8A 4HHEA 1WEHA 4CLOA 5BQOA 3ABOB 2IHZA 2RGGA 3T95A 4KMMA 1QYRA 3BHJA 3FIUA 2DTDA 3E61A 4GPIB 1JJVA 2QTRA 3WIVA 3MAAC 3G5LA 4DGQA 4EJFA 2OLJA 3K9FC 1ZW6A 1SO8A 4AQYB 1ZVQA 3V4VB 3A58B 4DLUA 5K3BA 3V1YA 4MUJA 4Q3OA 5HJ2A 2GNPA 5GONF 3RRFA 1DRVA 2YV4A 3IQEA 3DYBA 3W77A 1Q7CA 1QCYA 2ENUA 3BXHA 5IX8A 1BXKA 4PLFA 1ZH8A 3UMFA 2GPNA 1YQWA 2GESA 5A4KA 1QKJA 3UJ8A 1OA0A 1UZNA 1KMQA 1H93A 1W19A 2GWRA 1ZUNB 3GJXC 4MLZA 4YJGB 1P1KA 4JR0A 1DQRA 4AF6A 3HCRA 3DBOB 1R6BX 5SY9A 4PYQA 4DG5A 4MRMA 1GYPA 1MXFA 2H9YA 2NU7B 3ENVA 1EJBA 2GDZA 3HC7A 1VCNA 3QVLA 4YRDA 3A6GA 3ZU6A 4RGQA 3AJ8A 4CV3A 2VI5A 1H0RA 3U61B 4KWHA 3Q4GA 5TQ2B 3MBOA 1E2MA 1FFEA 1INLA 1BHSA 3NPMA 4TV9F 4AWXA 5HCUA 3N1UA 2C5SA 1SZCA 1QE0A 3P52A 5JD6A 1A9QA 1RABA 3G2OA 2FVYA 3OOYA 4YCBA 2RG1A 1N3BA 1FJGB 3FMOB 3U48A 3NAQA 4DMLA 3S8EA 2YMMA 1SXGA 2XTAA 2Z1NA 4QOIA 5AW8A 1O5IA 1TM1E 2C4NA 1L9XA 1YQXA 2BISA 1MO3A 3F7MA 3LKDA 3E9RA 4G37A 2YWDA 4RV5A 5JCOA 1X0VA 2MSNA 1SKUA 1OROA 2H1WA 2PT9A 4L8WB 5JSQA 2FGKA 3JQGA 1A8SA 4GI1A 4GG1A 5E6UB 4AJEA 3PA8A 4Z0TA 1KIFA 1YKGA 3DC7A 4ZEOA 5ICMA 2D6FA 3ZWYA 2IEAA 1EZZA 1EFHA 2K6GA 3EUFA 2JBHA 4GOMD 4YHHB 1Q11A 1EKXA 1YWGO 3UAGA 2FN8A 2FFRA 3K09C 2I4OA 3MWYW 5ERGB 3ZY6A 1JG4A 4KMSA 3HWX1 1R0RE 1A4UA 3TGPA 3CEMA 4RXTA 3O95A 4FHZA 2CHQA 3G49A 3B1VA 4KKXB 3QY0A 2BBWA 1U4SA 4QU0A 1YBVA 1NUSA 3I2IA 3EVTA 3IXQA 3K1JA 1F51E 4WJZA 4Q66C 1GSOA 4K6KA 3GQBA 2R79A 4UTOA 4X93A 3V1TC 4F12A 1FNMA 1SWWA 2JFUA 4HQOA 4TGLA 2V0CA 1A9SA 4JHLA 2VPIA 1W6UA 2O8DB 2D2XA 1AN0A 1DEOA 5ALIA 1X19A 4K8RB 2J0QA 4Y0NA 4RFSB 1NTOA 3RU3A 1GGNA 1Z7GA 1WZ2A 1L5OA 1RWOA 1Y4SA 2O2GA 2ZK7A 2VAXA 4ALJA 4WCDA 1ZS9A 5A5GA 3UUWA 3AFHA 3IVXA 1SKMA 2I8AA 2IQ5A 2I4NA 2Q9BA 3NO4A 4OM7A 1G16A 5D3QA 2H5IA 5AYVA 5LQNA 3L0BA 4ND1A 1KHHA 4EG8A 1LNQA 4EPRA 3I28A 1NZJA 1I14A 2O06A 1G20A 4KFTA 2ID8A 4QUIA 2VTVA 3SLGA 3JQEA 3C1AA 1AHNA 1TYDE 5K0LA 1KYYA 2HJ9A 3RVKA 2HREA 4MR8A 4WESB 4XASA 5JNVA 2WKRA 5EYPA 5ALZA 2VHJA 3H1PA 5DBEX 2ILVA 2OM6A 3M9WA 1E9VA 1MOSA 4KZPA 3TW0A 1VHJA 1CUZA 3D7NA 1T35A 1T1JA 4P08A 1Y8QB 1OAOC 2D62A 2Y1EA 3AEYA 4O3FA 1EE2A 5DB4A 4OSEA 4XARA 1GYQA 5AD1A 1JEYA 3GYGA 2P0AA 1K88A 1PE0A 3OJXA 3P71T 1EB8A 4NG4A 4AF8A 3CEJA 4LE0A 2QUKA 2XYVA 4GLJA 1QVZA 3CW8X 4XDHA 1QVRA 1KSHA 3DKPA 3QENA 2EOAA 5AW4A 4XX1A 4HDNB 2V9CA 2YZ2A 5CT5A 3MRTA 3JS5A 2I2CA 2OTCA 3ORSA 4WFJA 4BL5A 4YBRA 2QTZA 3IODA 5C1OA 3T8YA 2VHXA 3DNPA 4EAQA 2V7TA 5FIUA 2FW6A 1JEAA 1IN6A 1RRKA 2N46A 4QGGA 1DJQA 5LDDC 1N32B 721PA 3AFIA 2FK7A 4LE1A 3KTAB 1UK9A 1DRUA 1V7QA 2UU9B 4TTAA 4BPBA 4M36A 4K8OA 1USGA 2E4ZA 4G5YA 4ZOEA 3L1HA 5ELMA 4EG4A 2WU1A 3X1ZA 4NFLA 3QVVA 5A6VA 4CKCB 4V03A 4F06A 2QTHA 4KVGA 3ZDBA 1CDEA 5FTJA 1R7RA 2J3EA 2R751 4I14A 3MT9A 2BFFB 5KQLA 4YP1A 3SWWA 1KEWA 1U8EA 3HCPA 1J99A 4OVKA 4C4RA 1D5CA 2WUVA 2ZTVA 1CUAA 1J2EA 1GZ6A 4WLEA 1YB7A 3GNQA 2FOLA 4W6QA 3U80A 1X92A 1M6YA 1XLTC 2GZAA 5A4MS 4U7DA 4ZVMA 3QBVA 4UULA 1M2OA 1NM5A 2H7XA 1E8NA 2F1HA 2RG7A 2MTBA 1H05A 3SS9X 4AS3A 5FH9A 1JQAA 2XKAA 4IEFB 1XHEA 2PUWA 5FBVB 1BQ4A 1SVSA 2X4IA 3HYRA 4S12A 3KQLA 4OATA 2DECA 2NGRA 4FMCB 2HU7A 2XGGA 4REMA 5CT6A 1FFXA 1PJZA 2WHPA 2V58A 4RAOA 4WA8A 4DR5B 4RQTA 2WY2D 2B21A 3V8VA 5C3MA 1W8IA 5FFFA 1Q3HA 1OB5A 5EGSA 3U1VA 4DT1A 2WM3A 4RKEA 2XUZA 3IB6A 3N2YA 2VH2A 1P5FA 2PGLA 5DYGA 5U4XA 2PKXA 1E4EB 4HGPA 5KYNA 1N5KA 3U7QB 2J41A 3DMHA 3Q40A 3V8BA 5C8XA 1NU6A 4ALLA 5FNVB 1PZGA 2YN2A 2MSCB 3RVLA 3FDZB 2WWFA 4PCAA 1UMCA 1B42A 4LZLA 1S9DA 1FS4A 5BQPA 1QCZA 2F17A 2FNAA 2R25B 3QEAZ 1LS6A 4OOFA 3RVMA 3VU0A 4QXQA 4BZXA 2B7LA 3LP8A 1ETHA 1SBHA 3VPAA 2NTYC 4B71A 1RRGA 3F3KA 2CNNA 2EF1A 3QEMB 2XB6A 1G41A 1L7BA 1W4ZA 1XN1A 3PB3A 4FDUA 5ALUA 2W2LD 1TZJA 2C4KA 4GR9A 3CE9A 2FZVA 4BQOA 5JJ5A 1SUWA 1MRSA 2XT0A 3GLQA 3ND8A 2HA2A 2R62A 2VNHA 4HR7A 3VZDA 2CYCA 1XZCA 2H4WA 2ZYIA 3OICA 2ZBPA 5A6SA 2JIBA 3C3JA 2IIPA 3M3DA 3PQ7A 3W6UA 4QT0A 3ZJUA 4OAOA 3L04A 3SZ3A 4EMBA 4UXHA 1U8UA 3MRXA 4DV7B 5DCLA 1DVRA 1NG1A 1TIPA 5IXJA 3KAQA 4QECA 4JR1A 5DGTA 4TN1A 5AHXA 3EUWA 5AVZA 1W46A 1R4NB 1U8AA 5JJBA 3WYBA 3O8RA 2WYHA 2NLOA 4UBLA 5GM1A 1SIWA 3LBFA 3VJMA 621PA 2FMIA 1K63A 2CMHA 2BEWB 2YVUA 4ATNA 1DKQA 4XGRA 1G4HA 3A4IA 3H9JA 1TEVA 2Q6VA 4UUPA 3OA2A 5JQGA 2JDID 5AIBA 3VU9B 1T1RA 1K89A 1U1GA 1KRXA 1BE1A 2ZVQX 3NHPA 3OUUA 1OH7A 1IBLB 1XYVA 3DB2A 2X9VA 3PICA 4HRAA 3QKSB 1N7JA 3KFLA 2GCNA 3HDHA 1OT3A 4HLQB 1G18A 1X9IA 4QOEA 4RHTA 4ZAXA 3TTWA 3DWFA 2JI9A 3U4MA 5D3MB 1ZITA 2PSEA 3GD5A 4ABTA 2JIZA 1ZXXA 2B2CA 2E4YA 3GEGA 4ZAYA 4PX2A 2P75A 4NY1A 3T06B 3AI2A 3OY7A 3PQ5A 3WGNA 4R2JA 1N9GA 3CR3C 4A0QA 3IH5A 2WB2A 1E3DA 3DKRA 4MI6A 1CZLA 3ZNPA 1IY8A 2LXNA 1Q91A 2WD8A 3FYDA 2D8AA 3ST7A 3GLFE 1KFEB 1YCFA 2PKCA 3SOZA 3MCVA 1KYZA 3HACA 1SOUA 2JLYA 2GRAA 5SYAA 3KYJB 1XZBA 2YFQA 3CVWA 1L5NA 3OJWA 2Y99A 2P69A 3AR6A 3U9LA 1J5XA 2E5LB 3K1TA 2FPOA 2MIIA 3HXTA 5IYZB 5HMMA 5JAUA 2WU4A 3I1IA 2GYVA 2H7YA 4LMBA 1U1DA 4OJTA 5M3BA 4B4OA 3NHKA 4ILEA 1QH0A 2QXTA 1TAUA 3Q7EA 3AVQA 3TD9A 1HM5A 4U2DA 4QFMA 3SX2A 4LNUA 4F6RA 4GNRA 2FSGA 1X77A 2JASA 3K73O 2K2QB 5IEJA 3ZPXA 4IV0A 4K9KA<