1Q1EA

The atpase component of e. coli maltose transporter (malk) in the nucleotide-free form
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
367
structure length
367
Chain Sequence
VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose/maltodextrin transport ATP-binding protein malK
publication title A tweezers-like motion of the ATP-binding cassette dimer in an ABC transport cycle
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 93
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2003-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1q1eA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q1eA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1q1eA01
2NGRA 3LLMA 2PH1A 2QAGB 2BMDA 4P32A 4BLRA 4DK1A 4LUVA 3SFVA 3CQZH 5FH9A 5JS8A 2IYQA 2CK3A 1JEDA 2JXMB 1EWIA 4DR4L 5IDVA 1X6OA 3LBIA 3RVBA 1OIWA 1TF5A 2P5TB 5IT9c 2FF7A 4DR2L 5CJPA 2OLKA 3QXXA 2CLSA 1HQCA 3QXCA 2ZRMA 2HV8A 1Q81C 2XNDA 3RRNA 3X1WA 4JSYA 1Z47A 2OILA 4A0RA 1OIVA 2B8FA 2VHUA 2ALYB 4BRUA 3CRRA 2J1LA 3CZPA 4GNXC 2CK3D 2GNOA 2V8OA 2IS4A 2YWHA 3GO5A 1DAHA 2QI9C 1UKVY 1KYIA 2HCBA 1G5PA 5EXSA 4YDHB 3A37A 2VF7A 2ZRGA 2CKZB 4RVCA 5C2JB 4KYIB 2P2LA 1GOTA 2W83A 3HR8A 3OEED 2A9KA 2HXYA 4G0NA 2OCPA 4XSHA 2OHFA 2QM7A 3GJ0A 2UUAQ 1N3BA 1II9A 3GJ4A 4Q4JB 4OHVA 4D4MA 5FL7D 3SQXA 1IY0A 3G6EA 3R8FA 1IYUA 4A6PA 4DV6L 3EZFA 2B8TA 1GM5A 3MWLA 5M5YH 1CRPA 2WZQA 4P74A 1T9HA 1VG9B 1NVUQ 2KI5A 1OB2A 4DKAC 1N9WA 1M8PA 1MO4A 3E0EA 3Q7QA 2GVDC 2BJVA 3DDCA 4BLPA 3DZ8A 2IHYA 4MRVA 2JJ2A 4MITA 4RZ2A 4JLPA 1G21E 4JI8Q 4PAOA 2WBLC 3QF4A 2LMCB 1GD7A 3AEZA 2W0SA 1TPZA 4PC3A 5JJIA 4QL5A 1H65A 1T6NA 2WKQA 2VSOA 4A3LH 2F1RA 1BYUA 4YLGA 1DAFA 2BKUA 4A8JA 1Z0FA 4OI1A 3W3ZB 1QHNA 4TMVA 1XNRQ 2GJAA 1QG4A 4M53A 4LF4Q 3TIFA 4BFXA 4A3EH 3UDFA 3KZ1E 4LV8B 4RFVA 3THWB 2OO7A 3H3VI 1P72A 3G4SA 1V1QA 3PEWA 3IO3A 5BW8A 4CGZA 5KO2A 2WJVA 1ZUIA 4WJ4A 3KKMA 1KL9A 2PEYA 3KXLA 4IXNA 2QBYB 2IL1A 2CBZA 5FBWB 4JCVE 1FP7A 3QPWA 2ZJPA 5M3MG 3GP8A 1VQOA 4DR3L 1NF3A 1F48A 4M1KA 3BD9A 4TMXA 3UK6A 2UUBQ 3NH9A 3OAAA 2FX3A 1UEIA 3I3SR 5CDFA 1SXJE 3Q8XB 4TYQA 1X54A 2H57A 2BVNA 2VP6A 4JJZA 4PHHA 2H18A 2NZHA 1KTVA 1KOFA 1GUTA 3LH5A 2MSDB 4IPHA 1OYWA 1OIXA 3LW7A 4XD7A 3JVUA 2ZRCA 2OAQ1 4GNXB 1VHLA 2WWXA 4X65Q 4TMKA 5LBIA 1CJMA 1KZGB 3NENA 1H95A 1XZQA 2ZRLA 2FMXA 1L2FA 3FHWA 3F2CA 3X1XA 3K8AA 2PCJA 3OOCA 3H0GH 2VTKA 3I4NH 1QRAA 4JI2L 2GJ8A 3UDIA 3L82B 3RS4A 4PG3A 5AUQA 3RSOA 5UKDA 4J15A 2PLRA 3ZZTA 1Y3AA 4Q4LA 2ZM5A 1P2VA 3MAAC 3A8TA 1XX6A 2QL6A 3BZCA 5L3RA 4AKIA 3M7NA 1ZYUA 3A1UA 2QSYA 2F4VQ 1IY1A 1N6KA 1DAGA 5LMUQ 3CNLA 3GEIA 1PYBA 5EP1A 3MG9A 3WMFA 2V1UA 4EQ5A 3U4QB 1SN8A 1ZINA 3W8RA 2O0KA 5GAGC 3THOA 4CW7A 4EPWA 4TL7A 1F2UB 2GF0A 4PAQA 3NVAA 4P4SB 1AE2A 4TLBA 2CXXA 4HSEA 4MGYR 4FXPA 3U3RA 2AWNA 1VQHA 2E74C 4X65L 2OFXA 4AYBE 2IHEA 3BB1A 3U6BA 1ODFA 4YCVA 2VHTA 3EWSA 3SBDA 2B21A 2ZYVX 2RGDA 3V4FA 5L3VA 3HR7A 3Q8DA 1HE8B 4JKIA 2F1MA 4DR7Q 1T3HA 1U8AA 2FOLA 3WYGA 4D25A 2XXAB 2NVXH 1JJ7A 1BS1A 1W47A 5IT5A 2HUPA 2FFAA 3E1SA 4RJLA 2PJZA 4HB2A 3J7ZC 2WKPA 3FKIG 3L8YA 4OBEA 3SZRA 2Z0MA 5HKKA 3LV8A 1TF7A 3B6YA 3PO3G 4W5JA 2L5TA 2OBNA 1PH3A 2A6EC 4KHPQ 5GADl 4AKHA 4TMWA 3K9NA 3NHBA 1OXXK 3PITA 3CM0A 4LC0A 1I50H 1PH2A 4WZAE 1RYFA 1Q8KA 3K0FA 4L16A 4P3YA 3DM9B 4NBSA 3KDFB 3AQQA 4JYAQ 1SVLA 2XITA 3VNVA 4XH9B 3GTQH 4BA2I 3THYB 2BMEA 2WHXA 2ZANA 5HKKD 1CJUC 1GHJA 2IHFA 4Q9IA 4K0KL 4Q4HB 4LY6A 5TARA 3MLEA 1L0WA 3EIVA 3NEYA 3F2DA 4HJAA 2PI2E 1T5EA 2OSBA 3AB3A 2K4KA 1RKBA 2O52A 1KGDA 4PAMA 4ZIRA 2CHVA 1H8ED 3CCMA 4BY7G 2X2FA 4BZQA 1EESA 4X62Q 2XX3A 1E2HA 3PUVA 1HZCA 3AQ4A 2ZU6A 1Z2CA 4L9WA 1CFMA 1AS2A 5JJKA 1CLUA 2P0EA 3EARA 1P62B 5J4VA 4JG2A 2ZJ8A 4EJSA 3V4RA 4XWKA 1XEFA 1DAEA 2IYWA 4L4UA 3B9PA 1HY3A 4U5XA 4PO9A 2Q2IA 3LO5A 2YKGA 4N1AA 1XMOQ 4C0BA 2XJ4A 3I4OA 3ZH9B 3BU2A 1G3UA 5GAEC 3JZAA 3K1JA 4JL6A 3WMGA 2QPAA 1X3GA 4RY2A 2V4ZA 4GLVB 3NTUA 5FOSA 3MWYW 2YU9H 5J47A 1GUOA 4FI3C 3I61A 2QA4A 3PJRA 3TQCA 1NKTA 2ORVA 3ONWA 4QM7A 1ZKOA 2F52A 3R20A 1E2KA 1OKKD 3O8CA 2F3TA 2G9NA 3WNBA 1ZM7A 1N5LA 4IVRA 3LVRE 4QNMA 1R0YA 1EWQA 3UE1A 1LABA 1UWVA 1T3LA 4LUOA 3S16H 1TUIA 2X8AA 3RYTC 4B75A 2JLYA 2J0QA 3SYLA 5EP2A 2ZTCA 4QG7A 4A3GG 5A5GA 1FUUA 1NP6A 2JGNA 4NP6A 5EZ6B 5EZ5A 2D2CC 1B0UA 2LKCA 3EIQA 4AD8A 1FP6A 1E24A 3SHFA 4MDEA 1NSTA 4UP9A 3KJIA 3MJHA 2IYZA 4LHXA 1G9XA 1SMXA 2MSEB 5J40A 3OEHD 1GNQA 2K33A 3KTAA 3EPKA 2H16A 4KVAA 3TH5A 3R9WA 2DHRA 4JLMA 3SC3A 4FMDF 4OONA 2EIFA 5DE3A 2B7BA 4A2QA 2H5EA 1TXYA 2R7DA 3ERSX 1SZPA 2A30A 4JMPA 2JATA 2MO0A 3QKSA 1S4QA 3OIWA 2JASA 1FL0A 4GKKL 3NH6A 4B3RL 3KQNA 5EXTA 4PPFA 1K6MA 4V0MA 4CEJB 4ILEA 3W6PA 5JCZA 2WTUA 2GBLA 3K81C 5FOVA 3L0IB 1US8A 4JI6Q 3LXXA 4OQNA 2J3EA 3R8CA 1VYUA 3HPQA 3OYYA 1BMFD 1F6BA 1QF9A 1IYVA 2BBOA 2JA6G 3KJGA 3TNFA 1COWA 5JECA 1GKIA 2EJGC 4PSAA 4DHEA 1JQJC 4US1R 1IHUA 1GUSA 4L5TA 2ASEA 1FL9A 2D74A 3GLGB 3C5HA 4M4SA 1QZGA 4KLNA 4A3FG 3QXJA 3AF2A 3FE2A 1ZCAA 2QTVB 4O3MA 2ATVA 2UXBQ 1NL3A 1U9IA 3K53A 4QC2A 3AVYA 5HCNA 4CEIB 4DDUA 4DC9A 4GL2A 1ZNZA 3M85A 3CCSA 1VPLA 4OQXA 3PEVA 2F43B 3QNUA 3CCLA 4JK1C 3H4MA 2I1QA 4CRWB 5L3QB 1CSQA 2IYUA 4DR1L 1IQPA 2ZSFA 1QUQB 3C15C 3WYFA 1K8RA 4FMBB 1FQJA 2B92A 1XPUA 3BH7A 4YHHL 4BZXA 1TEXA 1XTKA 4WZ6A 3K0EA 4ACAA 3PO3H 2A7QA 2HJGA 3VU9B 4DUYL 4TYPA 4B3TL 1IXSB 2CE7A 3W34A 4X64L 4DV1Q 1HZBA 2I1VB 3ZZ0A 2ZJZA 1G7TA 2W0MA 3EZ6A 721PA 4F7WA 1Z6TA 3FGNA 1P9RA 2V6JA 4X8LA 1CKMA 4LJ6A 4DB4A 4MA4A 3QVUA 4XTRA 1GP2A 1KDRA 1O7LA 2KHIA 4KYUA 4NONA 1DARA 4LBVA 2W6JA 4LHZA 2IX3A 3U60B 2ZJRA 4GP6A 4HUQA 5CJ2A 5FUXA 4FDBA 2QAGA 1E9EA 2BH2A 4G3XA 5E95A 2C98A 4A4IA 2G0NA 3M9BA 3C8UA 1W46A 1KSJA 3H86A 5FI0B 3D6TB 1W0KD 3DPUA 3G5UA 3P27A 4IDPA 4JLKA 4MGZR 4OYHA 1E1QD 4R7ZA 1R7RA 5ANRB 2ODEA 5GVRA 1A0IA 3CF5A 4D0LB 2FXQA 1KMQA 3SJZA 4M1TA 3VKHA 2PMKA 4MYHA 3AFPA 5C18A 3A8JE 5IYDG 2KWIA 2WAYA 4IOJA 2OQ0A 4TT3A 1E22A 5BYKA 2I5HA 4MNOA 3CX7A 3U4ZA 4D4JA 4YWLA 2GF9A 1ESMA 4IPCA 1TAGA 5EJEA 2YNMA 1NKSA 1Q1EA 1EFHA 2RGGA 3MWKA 2NMVA 1KHTA 1VQ9A 2GEUA 3C16C 4NCKA 2G6BA 1BOFA 1HH4A 4NL4H 1T8UA 1VG8A 1IBKQ 4PXAA 3GCGA 3GTPH 1NMZA 3T1YL 1R8QA 2F9LA 4MRRA 4A3MH 1MO5A 3M4QA 2CMKA 1GKHA 1EQQA 2QMEA 2ZEJA 3PF4A 4TZ6A 4IXMA 1IL2A 1X3SA 4PANA 3TQFA 3U5ZB 1RC8A 4E5UA 1H8HA 3S1MH 1KRSA 1N0VC 1V9PA 1U0JA 3P4YA 3TR5A 1W0JA 5HE9A 2OBLA 3L0SA 3BH0A 1QJOA 1IXRA 1FTNA 4RD1A 2P6NA 3RS2A 3RS5A 2FN4A 3OIYA 3TSWA 4GPTA 3CCUA 2JLRA 3AKCA 5TY0A 4B74A 5KU1A 4IEEA 1HPCA 3QF4B 1PMRA 1XZPA 4ESHA 4TTRA 1SVMA 1SVSA 2ZTDA 2VH5R 1TF2A 4CDGA 1QVAA 2QPTA 3T06B 2O5JC 1R8SA 3PQCA 1U8YA 1N33Q 1NJIC 4G5RA 1GVNB 1DG1G 5K8TA 5A35A 5E7NA 3N5CA 2JQOA 1VCIA 2E2IH 3HOZH 2Q9AA 1G18A 1PUJA 1KSGA 2A6HD 1JJCB 4R98A 5DHAA 4OI2A 2P5SA 1BVSA 2IS6A 4YY3L 5EXXA 1YZTA 1AQYA 2H92A 3T53B 3AVOA 4G1UC 2ZE5A 1MRSA 3S17H 1YU9A 4M22A 4WIAA 2X2EA 2BWJA 3TVDA 1IN4A 4CVNA 1HQYE 1JEEA 2BKEA 3EWAA 4MRNA 4NXMQ 1P61B 4YMVA 4PZ8A 2WSSA 2V7QA 2WJJA 1MIUA 221PA 4JJKA 4L5SA 2K5VA 3I5XA 5C1BA 4A1FA 5JSZA 1S3GA 4IDOA 4Y52H 4NH0A 5JEAH 4JI5L 2ECKA 1OFHA 2A8VA 3FMOB 4HIOA 5DLQE 5JI3E 2QPOA 3UE0A 1EX7A 3AP1A 4NYIQ 2ZUBA 2C35B 4RCZA 4RZXA 2EFEB 4ZDKA 5B64A 1SKQA 4ZCLA 3B1YA 3VHLB 5GROA 2OE2A 4BFTA 5JHHB 2BCJQ 4GZMA 4QFMA 4YMSA 1N8RC 5C44H 2FWRA 3BJIC 4KODA 5E7JA 5ELOA 1KIXA 5KSPA 2X1VA 3ADKA 1WBDA 2ODBA 1WB9A 4OWTB 5BN5A 1UBEA 3K0AB 1F5NA 4Q01A 4IOCA 1PH8A 5AUNB 1GUNA 1M7HA 1VQ8A 1E9DA 3MSXA 5FOTA 1M90C 4UXJA 1A82A 1WFQA 4BXXG 3VR6A 1SGWA 4W5WA 1I5FA 3ZJYC 2YTVA 4FWTA 4LUZA 4H1VA 2B7CA 4LJ8A 1W36B 4ZI3A 1J5EQ 4EJSC 2C96A 1P16A 1FR3A 1OW3B 2FZ4A 1W3SA 4IFDI 3T35A 3WHLA 4B44A 2GHIA 4BY1G 3M3YH 2PMDA 1FNNA 4IRUB 1OLOA 4IDNA 4KN7C 2NO7A 2QN6A 4TLAA 2C9OA 1XRJA 3KKNA 5BXQC 1W7AA 2VEDA 4Q00A 1D2MA 5GJWC 2JA9A 1F2UA 4P4SA 4PZZA 4HJ5A 5J4YA 4PX9A 4DAMA 1E0KA 1E2IA 4Q9JA 5HPYB 3CP0A 1SVOA 2R6DA 4M21A 3UMRA 3SU8A 5K36H 4AYXA 4UNNA 1YZKA 1ZC4A 4LWCA 3QKRB 2LXJA 3BORA 1EGAA 1RW4A 1XMQQ 1DG3A 1EQRA 4KJZA 1G7RA 1E3PA 4DR6Q 2C04A 4F91B 3FDIA 2EVBA 3ECCA 2A78A 3CB4A 3L7ZC 2GZHA 1RRCA 3TREA 4IVQA 2Z43A 4NMMA 4PHGA 2ZSDA 1G8GA 5JBQA 3GLFA 3K7UC 3M4OH 2IW3A 4LGMA 4LK1C 2C2HA 4S2EA 4DV5L 1KI4A 4I1VA 1DEKA 3I4MG 1PLKA 4J0QA 4CYMA 5B58C 2IXGA 2UZ3A 4G7ZC 1Z9FA 1ASYA 1N6IA 1U8ZA 3H15A 3RZDH 2Q2TA 3LNNA 2YV5A 2VIIA 4W7SA 3EASA 1PZNA 1G6OA 2GN5A 2ZRPA 3ZVNA 1R9TH 3K0FB 1WOCA 4JLVA 3B78A 2PCFB 3CCEA 2HEIA 1K9MC 4QBFA 4DV0Q 4RD2A 4UQOA 1OFTA 3DHWC 1GNRA 3MWJA 2I3BA 2D7DA 3SQWA 3WHKA 5L3SB 2NPIA 1YZ6A 1H9RA 1RIPA 1OXUA 5FTJA 1PLLA 1GILA 4JI0L 1E79A 2FJUA 3BFVA 1GO3E 1B9NA 3FHCB 1XMQL 4H9GA 2GBLC 2P65A 2OG2A 4ESVA 2UXDL 2QAJA 4DR6L 1G3MA 3AGPA 1XD9A 2ZE7A 4JLNA 5FPSA 4FWIB 3I73A 1FYCA 3U7GA 3FFBA 4LBYA 5C0XG 2VYFA 2ZRFA 4QGGA 1JXMA 3EC1A 2GK6A 1L4UA 1T4GA 1UDXA 4ZIRB 4NPHA 2H5XA 1X8KA 4C0HA 1NN1A 3GJ7A 1TTTA 4LDJA 4DAYB 4TZ0A 1N0WA 2K14A 1ETUA 1KI1A 5L8VA 3IPYA 1V43A 1XJQA 4EJSB 3RS3A 1E0SA 1M6NA 1Z07A 2WWIA 2CVHA 1ZRHA 2FFBA 2ZAMA 3GLHB 2RHDA 2F1IA 4BFWA 2PT7A 2B6HA 1ZYRC 1AS0A 1MJCA 4JBJA 2CEAA 4MZ9A 4B3FX 5IYBH 1XJCA 3P4XA 4LHWA 4MUAA 1K3RA 4F92B 2QGZA 3NIBA 3F5FA 4Q03A 5KUTA 3TUJC 3K09C 2Q9CA 5H1SE 1KNQA 1WP9A 2WWHA 4OI0A 1ZW6A 4QHSA 4EPRA 2WAXA 3IEVA 2QROA 4A3BH 4L15A 4HJ8A 3A5UA 2RGXA 3CZQA 1U5KA 4M1OA 5HE8A 3ZS8A 4QJFA 1ZM4A 1GNPA 2OWOA 4X66L 1IBLL 1MR3F 2AX4A 2HYIC 3N70A 5JWHA 4YCWA 4M1WA 2UXCQ 4L8JA 4V02A 4B47A 1VCMA 2XSZD 3B9QA 1IAQA 2EFCB 1YE8A 2ZR7A 5EQTA 4DDWA 4HAUA 2PBRA 1ONBA 3NG1A 1NMGA 3VR5A 2CL7X 1UE7A 4PQYA 2BDOA 4FW9A 2Z83A 4GMDA 2FDCA 2JA8G 1OJLA 4QGFA 2IX0A 2G0TA 2LCFA 3T1QA 2UUCQ 5TB5A 2DUDA 2O5IC 3KTAB 4LC1A 3FKSD 1SULA 2AN9A 2B29A 1AM4D 1OB5A 2JLQA 2VW9A 4LOAA 4PTLA 2FA9A 4BXXH 1TU4A 2F55A 1IBRA 1I6VC 5FLMG 3GJ5A 3QKSB 1GL9B 3F2BA 4RG1A 5CITA 1K8OA 2K7VA 4NCIA 4IEIA 1Q22A 2XB2A 1NMXA 1MT0A 3RN5A 1LS6A 2LKDA 3U6KA 3SFZA 2A6ED 4X6AH 1CBUA 1XMVA 4HLQB 4L8GA 5EE3A 3ZLJA 3VR1A 1MOZA 3B8HA 2IWRA 1US8B 1Z28A 2DPXA 1IM2A 2ZRAA 3P26A 1E1TA 1E2NA 4LF8L 2KB0A 4AQYQ 2ZRIA 3S2HH 1DAMA 4P0TA 5DIFA 5TXGA 3A74A 4E22A 4NYIR 3BRWD 1PYSB 2AUKA 2YZ2A 1M34E 5FI1B 4A93H 2IEZA 3AGQA 3GLGA 2A5YB 1WYDA 4DV2L 2UUCL 1TUEA 5M5XH 2BE5C 2ZE6A 3DZDA 4K81B 4NYJQ 1HT1E 4MRPA 2JA5G 3NWJA 1YNNC 2VNUD 4URXR 3IEUA 5EP4A 5GJCA 3KXKA 3RNLA 1C9KA 4GOXA 2R7ZG 2F43A 3Q85A 2ZSEA 3KXIA 3CRKC 4WXRA 5L3QA 5JZVA 4DUZL 1Z6GA 1YNXA 3BERA 2R93H 1VG1A 2Q2UA 4DK0A 2V9PA 4DR2Q 4BBSG 1RJ9A 3A4MA 3CX8A 2HYDA 2E2HH 2R6FA 1MO3A 2ZU0C 3VU9A 2EWVA 4Q4HA 3ZZUA 4A0GA 4P72A 2RCNA 1D2NA 3FTQA 3EW9A 4AQYL 2D4HA 4PZYA 1I4TD 1ZVQA 3KFUA 2ZRDA 4HIKA 5M5WH 1KD1C 1SKYE 3LNCA 4LFAL 3K9GA 3P32A 1JJ2A 2V4DA 1U98A 2ODWA 2QM8A 2CCGA 1AKYA 4AYBG 3CPEA 2K32A 2QENA 3VHXA 4I4LA 3GTOH 4TQAA 2DFTA 2QY9A 2WMOB 3IBYA 2WP8J 2DNEA 3UIEA 1YI2A 2ZJYA 1VQGA 3NDPA 1ZU5A 1XMSA 4DIDA 1N6RA 3OFND 4HUQB 2REBA 4EUNA 2CCKA 1G6PA 3CCJA 1PH7A 4DXAA 1YHAA 4AWXA 3VFDA 3I5YA 4DV6Q 1SXJA 2IY5B 1MKYA 4RZ3A 4KBGA 2W2XA 3THXB 2AUJD 2AKYA 4C3IH 1IN5A 5DH9A 1G8FA 3S1NH 3DM5A 2G88A 1P73A 2OZEA 3KLWA 4JS0A 3UATA 3Q5EA 4D2IA 4WA7A 4RMFA 1FMLA 3IIMA 1NY6A 2DBYA 1U90A 3BXZA 4V0OA 1C9OA 1NN0A 3NEMA 2QMHA 2YJTD 3KB2A 3CAMA 1GTVA 1E2JA 2P3SA 1ZIOA 2R62A 3UWKA 2WAQE 2VO1A 4LF7Q 2H1LA 3RLNA 1SFOH 1MH1A 4TKOB 3MEFA 3CC7A 1E2FA 5DN6A 4A9AA 2XTZA 2QMOA 4KHZA 2QEXA 5LD2C 1EIYB 1SQ5A 4XJXA 1HR0Q 1YZQA 1E2GA 1SVKA 1Q3HA 3AF4A 2RF4A 3CRVA 2N1BA 1BBWA 4ZPXA 2XNDD 1XD8A 3U3MA 4QGAA 4G7HC 4LPSA 1E94E 2QA5A 2VA8A 1CI3M 2CWAA 1SHKA 3AFQA 3BWDD 3MFYA 3W8NA 2V1XA 2RAPA 4LV5B 1KY3A 4RD0A 4Z8YA 3QBTA 4C0SA 4EPYA 1G5TA 5K8IA 1YR7A 2IYSA 5EP3A 3IIJA 1MRNA 3L2OB 1GHKA 4GI7A 4DR3Q 5C3EG 3STBD 2XNSA 3EPHA 4XIGS 1HNZL 2RH5A 1EYGA 5DYIA 4OQMA 4Q1BA 3BIFA 3G48A 3A4NA 1Z06A 1KSFX 4LF7L 2JA8H 5IY0A 4EQ6A 3SOPA 3GPLA 1BYIA 1HR0L 4O0AA 3H0KA 1YRAA 1E9CA 2QT1A 3EIHA 4EFMA 2SHKA 3KOJA 1YJWA 2CLCX 5J5CA 4HZIA 3L2PA 4BEBA 4A82A 5EE9A 4PO8A 3MCAA 2JJ2D 2CNWA 3PIPA 1IJFA 2F9MA 3PO2H 2J59A 3U50C 1XBTA 2AK2A 2VQSA 2VF8A 1NVXQ 4NU0A 2FH5B 4DCTA 1VIYA 1H9SA 4OQLA 4V0KA 2WOOA 4ZV4A 1OE0A 4JI2Q 2DFLA 4MRSA 2QU8A 4QXAA 4RFSA 4BFSA 2BMJA 4TYYA 2EYUA 4I1OA 2NZJA 1A63A 1WCMG 1E32A 3LQQA 1GRNA 3MGCA 2JK8A 5DISB 1Y1VH 3T1OA 3LVQE 4DEYA 5M3FG 1JNYA 5B57C 1HYQA 3RSLA 3A1TA 5JSZB 4JVSB 1MABA 3ZVMA 3B1ZA 4F4IA 4DCVA 4LF6L 1SMYC 1ZP6A 3C5CA 3TW8B 3BBPA 1DOAA 1SVIA 3E2IA 3FPPA 3AF0A 5KSYA 4GN5A 2P67A 1GG2A 3LXRA 1NBMA 2JLVA 2ONJA 2BBWA 2O8CA 2WFWA 4KBFA 2QNRA 5GJBA 4BBRG 5CIQA 1PVOA 3HOWH 4LV6A 3K0AA 3LRPA 2JA7H 1DO0A 4AI6A 1UEBA 4DCUA 1KI2A 2R6GA 1Z6XA 1FJGL 3PEYA 3F0TA 3OAAD 5AUPB 4OQFA 2MFIA 1IONA 4Q47A 3ULLA 3GDEA 4HDOB 5LD2B 2CFMA 2ORWA 4LYHA 4MKHA 4TWZA 4BBSH 3GJ3A 3W9YA 1A8VA 1NBMD 4D0NA 4DV4L 2QRNA 2FZLA 1E2EA 1IYJB 3TVTA 3I55A 1KI8A 1P3JA 4XD7D 1VQKA 3QJYA 1Z63A 1E1OA 1OT3A 4GSYA 4A3JH 1HNXL 2NQ2C 1LV7A 1YZNA 3WNDA 1ZM2A 5FTMA 2C77A 2Z6KC 1Z6AA 3T51B 1BKDR 2HXSA 1AH9A 2Y0SE 1MV5A 2D3WA 2EQBA 4MKIA 4V03A 3W1BA 5FR2A 3LW8A 4QHYA 2C03A 4D26A 1XTRA 1XXHA 1W36D 3K70C 3NE5B 4DKXA 4DSTA 4NYJR 2AHOA 1ZBDA 4ASUA 2IXFA 2VLIA 1YQTA 1J70A 1Q12A 2K75A 3TKLA 3QKRA 3ND9A 1VQDA 4KFTA 5FOUA 4DT1B 1UKZA 2WICA 4XVRA 4K0KQ 4IO9A 1XTDA 1UE5A 1Q57A 1KRTA 4DLTA 4HIMA 4G5GA 1AS3A 4EIWA 1W2GA 5FPKA 2LSSA 2EU8A 1R6BX 4ZKEA 2PQAA 4B2LA 2NTYC 4TN1A 4Q1EA 5KSOA 1EFTA 4D0GA 5JEAJ 4U7DA 1Z6YA 4FCTA 1WXQA 3GLFB 2GXQA 2YC2C 1VG0B 2A68C 4MGIR 4Q1DA 5IP7G 4A4DA 5BWMA 1NJGA 3NC1C 4URVR 2ZVPX 2NIPA 1KI3A 2X19A 3FMFA 1IW7C 4DUGA 3TGPA 1AA9A 1UKEA 4BASA 2VUMG 1XTJA 4LYFA 2E9SA 2ZS8A 3ICEA 1KJWA 1XWIA 6Q21A 3WRXC 4M1YA 3E5HA 1DCZA 4MTNA 5EXPA 5L3SA 2PZFA 3NKVA 1VQPA 2F1HA 1KNXA 2ZJAA 3HGBA 1Q21A 4YCUA 3CIOA 1V5WA 4POAA 4O0MA 3QOFA 4NYMQ 4POFA 1DVRA 2G77B 4GDFA 4DB2A 3KFXA 3TS0A 3NBZC 2IX1A 4Q1CA 4GFDA 1W4BA 4JI3Q 2HT1A 3DM3A 5KNCA 3AVQA 1A2BA 4D4LA 1YZLA 1ZNYA 4TL9A 3ER0A 5C3EH 3E9HA 4R1JA 2ZI6A 1Y1WG 2GJKA 3B6EA 2QQEA 5E3HA 4EDHA 3LA6A 4GLAC 5F2EA 1Q46A 3ZJYA 1QHYA 3UMSA 521PA 1ANKA 3R9IA 4PZ6A 5DGXA 2BC9A 4I81A 1CULC 3QUSA 1NN5A 3U3OA 3KQLA 4PQRA 2RGEA 3IRBA 3GLHA 4OGQC 3TZUA 1A6XA 1S1MA 2NO0A 3Q7PA 5DI9A 4E07A 4JOIC 2V3CC 2BIFA 4DSNA 1E1RA 1K8GA 3GLIE 4YDSA 1NY4A 4W5HA 1Z22A 4B32A 1DS6A 3GJXC 4QQBX 4BLOA 1LY1A 1CKOA 2R65A 3K70B 3TW4A 1EG7A 2YWFA 3BFXA 3HP1A 4C0AC 4I1UA 1PUIA 1VF7A 4JI3L 4GKKQ 2XOKA 3QBVA 4PQFA 4B3RQ 1CR1A 4A92A 2R8RA 3A4LA 5M3MH 4JV5L 3TSOA 3RR5A 1E4YA 1WCMH 1HNWQ 4ALPA 1KO1A 2BOVA 2IC5A 1E0JA 3EN2A 1UEJA 2WJGA 3H3VH 1ZJ6A 3RLFA 4ZDJA 3VA7A 1UDWA 4JKYA 3TAUA 4HLDA 5KHOC 3EPLA 2HF9A 4FINA 1EOVA 3CCRA 3LDAA 1Q0UA 1NN3A 3NEJA 3FKQA 4NCHA 1QHGA 4ZDIA 2Q9BA 3A1WA 1GIAA 3PUYA 4TQUS 2GAOA 2WPDA 1NY5A 4LWZA 5IF9A 1U81A 5KNBA 4A3CG 4O25A 1E96A 3TK1A 2GXAA 4KFSA 3NDBB 2O8BA 4YXWA 1D8TA 1SXJC 3S14H 3QI2A 4OK5A 3N2EA 3FHOA 3ZIAA 1LW7A 1I94L 2ZJQA 4IJMA 2ONKA 4DLSA 5JHGB 2W2VA 2JIZA 5FLXc 2Q3MA 1VTKA 3S1AA 3QVVA 2ZS7A 1LFDB 4LJYA 1AZTA 2Z5FA 4Z1MA 2K50A 2QP4A 5D3QA 2VQEQ 1HNWL 4B3XA 1NMYA 5JFGA 3CRMA 3T5GA 4DR1Q 4TL8A 2WJHA 2EVWX 2WPDD 2CHQA 1TQ2A 5BR8L 4YHHQ 2O8FA 4P4TA 3GTJH 1R5BA 2XB4A 3A8KE 3UANA 4DUYQ 1P9WA 5IWAQ 4YXWD 4B3TQ 4B3CA 1EWRA 4X64Q 1BDOA 1G1MA 1RYHA 1EIFA 1Z0IA 3NC0C 2UKDA 3OIVA 3FP9A 4H44C 1Z08A 1OFUX 2F3IA 2L0XA 3U44B 4POGA 1FNMA 3PUWA 4LF9L 1ZUNB 2ZUDA 3B2EA 2FV8A 2GA8A 4HAVA 2AKAB 3NBYC 4B3ML 4IDHA 4RD6A 3WP0A 4II7A 3E70C 3U4VA 1AKEA 2F1JA 1ZD9A 1E7ZA 3KJHA 1R0ZA 1Y63A 2D06A 1ZCBA 2NZ8A 3ZVRA 3LFUA 5TV2A 5K8UA 2CCJA 2QE7A 5FBVB 1HE1C 1COWD 2Q0HA 5F3WB 2I4IA 1CJVC 4LFBQ 3U7FB 2VQEL 3T34A 4TL6A 1JB1A 1Z7TA 3K09A 5JMTA 3FKIH 2BA1A 2QF7A 1XEXA 4OHXA 1Q1QA 4Q4AA 2FPLA 3SYNA 1RJ9B 1DTSA 5IP7H 1Z0AA 2HIVA 2J46A 5IWAL 1KSHA 2WV9A 1JECA 4JBWA 1G4AE 3T12A 1JJGA 1CR0A 2QP3A 1X86B 1I2MA 1UADA 1P2TA 1Q86C 2XTMA 3AVPA 3EZ7A 3K0CA 4TQ9A 5FJ8G 1WA5A 2A5FA 5FBLB 4WZBE 5BN3A 5KNDA 3WMEA 4FCVA 5B30A 2QQ0A 4UKDA 3CRW1 4RD4A 2NVTH 2WVJA 3ZQJA 4LJ4A 1OHHA 2N3SA 1IN7A 5IYCG 1KAWA 2GJSA 2C99A 4XWOA 2PX3A 3B1XA 4FMCF 1KI9A 3T1YQ 3PIOA 1VQ4A 1IN6A 3UDGA 4LFBL 1TADA 1TQ4A 2RHMA 4NTZA 2J45A 4O2RA 3U3JA 4A15A 4WVFA 1P8LA 2EYQA 2VP2A 1O78A 3THXA 4BY7H 1OSNA 1SXJB 3W5OA 1TL7C 5EE1A 2R92G 1FGUA 4TLEA 3UMFA 3LWNA 3HDTA 3Q9LA 4BFYA 1XB2A 1L8QA 2W6JD 1X55A 1UBFA 4N0EA 2UU9L 1S3SA 1PH4A 1H9KA 3S1QH 1QVCA 1LNZA 1KAGA 1KK0A 4HLUA 4N0DA 3FOZA 1HR0W 2PLFA 5KDOA 1J6QA 3ADCA 2B8WA 1CTQA 1N6HA 5EAYA 1HURA 1LTLA 4WBSA 3OF5A 3K8YA 2W6IA 2FU5C 1OF1A 1D9ZA 2GCPA 1D9XA 4KV9A 1QZHA 1G17A 1Y69U 1VF5C 1JPJA 2BJWA 2HLDA 4IDQA 4HYYA 2A19A 3AP3A 2GCOA 4GN3B 1YEZA 1OYYA 4TT3D 2AWOA 121PA 1OPXA 1CSPA 1A62A 1Z8FA 2JDIA 2JAQA 4NYMR 1FUKA 4QY7A 4YY3Q 3AF3A 2H8KA 2OCBA 1L1OA 2ANBA 1VMAA 4PHFA 4LPKA 5CM9C 4GOPA 2CVFA 3SJBA 3CPWA 2GVZC 1T0JB 2NN6I 3QY0A 1YKSA 1GSIA 2XJ9A 2ZR9A 4V0ME 5GADC 1PV4A 4OHWA 2EJMA 4DK3C 1Z83A 2KA7A 3T56B 4A3GH 2V55B 5FPTA 3KX2A 3HYRA 1AJEA 4JI5Q 3PXGA 5JS7A 3GTMH 1V8QA 1KQSA 2IUTA 5G41A 4IOMA 421PA 2CQOA 4DLRA 4R4OA 4L5BA 2J7KA 5CDFE 1AE3A 4HB3A 2QTHA 3SBEA 3C7KA 2O5VA 1L4YA 2QSZA 3OIUA 1YZUA 4HLCA 4EQ6B 4GP7A 2FNAA 2L15A 1H8HD 3W3AA 4ZCIA 2BV3A 3FHTA 4HAWA 4R2HA 4K8OA 1QHHA 3RRYA 1NVWQ 1W0JD 2ZJOA 1AZSC 3EAQA 4B6FA 4B34A 1MO6A 1I2DA 2MMCA 2QG6A 4JI1L 4FMCB 4IOLA 4GLXA 1JMCA 4B48A 5JEDA 3GEHA 5GJVC 4M2LA 1CTMA 3K7AH 2J9RA 2J7PA 1H9SB 2IS2A 4C0QC 3HYTA 4P71A 2O8DB 4RFSB 5B2ZA 4TTQA 2JA6H 3TS2A 2ZRHA 5DYGA 1YNJC 4DK6C 1VYVA 3I62A 1YHBA 1AGRA 4UP8A 4BUJA 2PJRA 1Z0JA 1MABB 1NLFA 1UAAA 4OO1I 1XJ0A 1PH1A 4R2IA 1DE0A 2IK8A 4YMUA 3S15H 4EFLA 3OTOL 2Z4RA 4A3FH 2C9YA 2J7PD 2WKRA 1NBWA 3CPJB 2N8NA 2A5DA 2O8CB 1C1YA 1RRGA 3CD6A 2WSSD 2V7QD 3J7A5 3EIEA 4DNIA 1W2HA 4UNQA 1O7IA 1CJTC 3IUYA 5LPNA 2OESA 4C7OB 1S9HA 2OUKA 2WIBA 1NVVQ 4D6PA 4KITB 4ZI2A 1VQJA 4B76A 1RRPA 1NMFA 4JVLA 1NI3A 2ZETA 4TSFA 1WF3A 3IKJA 2ATWA 4QGHA 3WBJA 1S1CA 1DGSA 1VQMA 2C8VA 4NXNL 1BH2A 1NLZA 1P6XA 2BH8A 1T5IA 2NO9A 1F2TB 3LAWA 5FOXA 3I92A 4DV5Q 1FPMA 5FJ8H 3CNOA 1Y8OB 3X1DA 5CB8A 2ZI7A 4LZZA 1JAIA 1VS0A 4P4UA 5FBQB 4DLZA 3VR2A 2D0PA 1ONLA 2ANCA 4Y0VA 4C9BA 4V0NA 4RD3A 1Z2AA 1XXHB 5A0FA 3QIAA 4B33A 2O8EB 5FUYA 3FMPB 2AHOB 1N6LA 4URZR 3ULJA 3KJEA 2ZJ2A 3AV0B 4IFDG 4BLSA 4YWMA 5JJLA 1U99A 2KBEA 1NLYA 4DT1A 2DGYA 4ZCMA 4C2UA 5C4XG 2XGJA 4JI0Q 2W58A 4DCSA 3QG1A 4JVNA 2DWQA 3DMDA 5H70A 3ADDA 2UXDQ 4ERNA 2OXCA 2O0HA 4L5QA 3BG3A 4AKGA 1ASZA 2YTYA 3AVUA 3RLOA 2PQAB 3CXCA 2QP9X 3DVLA 5IYDH 4HEJA 2KBFA 2OCAA 2O8FB 2RB4A 3W5JA 3OE7A 4BE7B 1AK2A 4NKRA 2ERYA 5KPJA 3AUXA 2Q8IB 3HKZE 2DFKB 1LF0A 3PR1A 2R2AA 3FMIA 4EKDA 3O8RA 1DD2A 1Q82C 4UPAA 1U0LA 4PR0A 3EPJA 2H17A 2WJYA 1SROA 2BEJA 1S3OA 1LUZA 1HA3A 5JLJA 3NXSA 2YWGA 1G291 1CF4A 5C46F 2I5MX 3FB4A 4F4CA 4NB3A 3HOVG 1K5GA 3A5ZB 4IFBA 3RRZA 5DSZA 3TJZA 1QZXA 4BECA 2JJ1A 3PG5A 2BM0A 2JCSA 3KQHA 1IJEA 1D8LA 4H02A 2GVAA 2GKSA 1NTGA 1TU3A 1E0AA 2IA5A 4IHQA 4M9SA 4QJ5A 4BEJA 1VHTA 2AFIE 2BM1A 3U7HB 4Z54A 1OH5A 1R0WA 1JR3A 2VSXA 1N0UA 1J8YF 1GITA 2WSMA 3O8BA 4JBYA 3HU3A 2WAQG 3KDSE 4Q7KA 4X66Q 1IBLQ 3W90A 3AVWA 4GKJQ 2WIAA 1XTQA 1K83H 1OV4A 4OWWB 2GETA 1AN0A 5FPHA 2JJ1D 3NBXX 5J4LA 3F3YA 1E79D 3CKLA 2ZSBA 4B2IA 1GWNA 4H13C 1C4OA 3HFZB 4LNQA 1UJ2A 1VIAA 4YC7A 4A75A 2IYTA 5SZHB 1P4SA 4BFVA 4KLZA 3FWYA 2ZPTX 4Q5IA 4YQFA 1G3QA 5AJXA 2Z6KA 1G8YA 4PPNA 2JEBI 2IEYA 1J8MF 3AKYA 2ZT9C 1FTSA 1J7KA 1U94A 2FPMA 2YINC 3P20A 4QOSA 3CWZA 5D3MB 3VR3A 2W00A 3SDZA 4A6XA 2BHRA 4JL8A 4JI7L 4B73A 1B70B 1E9SA 2ORIA 1HQMC 2EQSA 3K0CC 1ZNWA 4AYTA 1HTPA 1UE6A 2LXKA 4C2MH 3GFOA 4Q9KA 5C4GB 4LFCL 4GKJL 1RL2A 4B2PA 4OHZA 2NVYH 5HR5A 1M1YE 1TWGH 5AJ3Q 4P75A 1B9MA 4RZUA 4KU4A 1IZ6A 2QT0A 4TYNA 2QTFA 4OHYA 2HT6A 2OTLA 4LF8Q 3K70D 1IBML 1N36L 5CIWA 1J2JA 2MMGA 1CJKC 3S2DH 2QRZA 2KCCA 4JI4L 4AK9A 1E2DA 1GAJA 3SYKA 1RRFA 1OXSC 3FVQA 2ZUCA 3AYHB 4HJ9A 1A2KC 1LB1B 4XOIA 4DV2Q 2XAUA 3A7AB 1FVIA 3QG5A 1E9BA 1N6PA 5DLQC 2ZXUA 2O8BB 3DOEA 4GRAA 2BBTA 5EE5B 3A6PC 3GJ6A 4M9QA 2XZLA 2ZQ5A 4X8HA 1LS1A 3A1VA 3M4PA 3S1AB 4B3SL 4QNRA 5AJYA 3QF7A 4DUZQ 5HY6A 4HLUC 3K80C 1F60A 2A68D 4HB4A 3CF0A 1KK2A 4HAXA 3JC66 5KSZA 2GXUA 5GAHC 5EE0A 5H1YA 1XCGB 1YVCA 1GKUB 4IOAA 2A5JA 1IW7D 1Q90A 1BBUA 2GEDA 5AJ3L 4BY1H 3CF2A 1TQ6A 3NHAA 4A2WA 1O3YA 4CZ2A 4IJHA 1VECA 1JPNA 3LBHA 2QZ4A 4ITRC 4A3LG 1S2MA 1QVFA 4X8MA 1VYTA 2AR7A 4RSGA 5JWOA 4LFAQ 2CHGA 3PFIA 4G01B 3U44A 3J81j 1DELA 4A3EG 1P75A 2Q21A 3L8ZA 3QPUA 4JVMA 4AYWA 4YMTA 4OJQA 1Y8PB 2KCTA 4JLOA 2F6RA 4IFDH 1E99A 1L1OC 1CIPA 2OAP1 4G5QA 2REXB 4GOPC 4FN5A 3MD0A 4A36A 1B7YB 4YWKA 2YC4C 4TYWA 1EUJA 4JOIA 1Z0KA 1N32L 4MQBA 4LX0A 1NVVR 1ZC3A 2RKOA 3HPRA 5HCIA 3G0HA 1S96A 2RGCA 5CLLA 1XNQL 4PC6A 3K9HA 3DKVA 3ZVLA 1UF9A 1VQAA 1F3OA 5FR1A 4KMUC 4DWJA 1G8PA 1M2OB 4QM6A 3ZQ6A 1AGPA 2Y0SG 1YR8A 4C0JA 2HHHQ 4Q4AB 1XEXB 2PEZA 3I4MH 2VQFL 3LWUA 5G53C 3BFKA 2MNAA 3CX6A 3MJRA 2J0VA 2REOA 3CMAA 4US0R 3FPAA 4R9UC 1SLJA 3AKDA 1N2CE 2IYLD 2PCLA 2N46A 2V6IA 2D5DA 2DY1A 4DLYA 1FOEB 3A7LA 3DOFA 3EXAA 1Z5ZA 3OZXA 3S24A 4TVAB 1CKEA 2KBNA 5ELNA 2IF0A 1IXZA 4LBZA 5A4JA 2OFOA 3SI7A 2OCEA 1XPRA 1HEIA 2UVQA 5LMNL 1KMHA 1A7JA 4LJAA 5EUMA 3FMCA 3MXUA 1K8AC 1G4UR 4BWYA 1XTIA 1QHXA 1RFLA 5C0XH 4EX5A 1AIPA 2VP9A 5AR1A 3PCOB 4DV7Q 1B8AA 2ZRKA 3U7EB 4OX9L 1Q20A 1YJ5A 3FYHA 1PH6A 2ZITA 4KI0A 3H84A 4LF5L 1E2WA 2HHHL 2EWWA 3CC4A 5F9FA 1FMJA 1W1WA 3RABA 5FTKA 1R10A 4P33A 2ZI5A 5C4MA 1TEVA 2A2ZA 3IQXA 4XVQA 3QPVA 1HNZQ 4HZUA 2EDGA 3QENA 2V54A 3EQLC 5JEEA 3BH6A 1E69A 5EUQB 4ZDWA 4AKEA 4D80A 4Q7JB 3KQUA 3GFTA 1VQBA 1FX0A 4Z8XA 1SXJD 5KYKA 4LJZC 5HGQA 2JEOA 3BC1A 1HT2E 2DR3A 3OESA 2HDNB 2JEAI 2ERXA 2J41A 2GCOB 3ULPA 3OEEA 4YONB 4MH0R 4F93B 4S35A 2ID0A 5BQ5A 4DV7L 4DR5L 1S8FA 4I7ZC 1JI0A 1L7VC 1L1OB 3HOXG 4Q02A 1UBGA 5FL7A 1MKHA 3V9PA 4GOPB 1II8A 1JT8A 1ZD1A 2RGNC 4UXIA 3RAPR 5DN6D 1UM8A 1NIPA 2GZAA 2IHBA 2EFGA 1KI6A 4TMTA 4JT4A 1NG1A 3RZOH 1IY2A 2NOAA 1YBYA 3U58A 1O87A 1NE3A 1ZUHA 2GAAA 4LF6Q 2YYZA 1X8LA 3IDQA 3X2SA 4DLXA 3BK7A 3M4YA 4DEXA 4ON9A 3DKPA 3H1TA 4PHTA 1JXOA 3TAHA 3GLGE 1YR9A 4HAZA 1KJZA 4ACBA 1CKNA 4DPGA 1QHHB 1GL7A 2ZI9A 3B7GA 5AJVB 2OLJA 2F7SA 5FLMH 1X9NA 4LW1A 1GDDA 1XP8A 1X8JA 1YR6A 1FJGQ 3OHMA 4R4TA 5CK4A 5FUVA 3SJAA 4CEHB 4FCWA 2WB1E 2VP4A 3TRFA 3TR0A 3WXMA 2VP5A 4BRWA 1ELOA 2AXPA 1JR6A 1UFQA 3ETLA 2PZEA 2O8DA 4KXFB 1G8HA 1ZD8A 3EBEA 4DV4Q 2Q3FA 1MJEA 3PIRA 2J87A 2E87A 4Q9LA 4R71A 1KXLA 5TDHA 3SR0A 1HNXQ 4DLUA 4EPXA 2YOHA 3QSYA 2CNWD 2VHCA 2UUAL 2WM9B 3B85A 1VDZA 3UWOA 4A0HA 1WE2A 3GTGH 4E09A 2GWHA 1KAOA 1Z6HA 2MQHA 2PI2A 3K0XA 2QUZA 2I5LX 2JA5H 1W5TA 2W2TA 1LTQA 1GKYA 2OM2A 2ZVQX 2JLZA 3KUDA 1P7CA 4ZO4A 3A0JA 2JLUA 2R7ZH 3PGZA 2FSFA 4U00A 1N6OA 3PCRB 3RN2A 2IF2A 5CB6A 4C7OA 3HU2A 3SNHA 3CBQA 4EPVA 3D3QA 4Z51A 3QXSA 1SRUA 2KE5A 2JLXA 4JI8L 3IBGA 4GZLA 3WP1B 1IOZA 3IQWA 5DI3B 4HDCA 1QDEA 4LI0A 2AMCB 1TNDA 2G83A 5H68A 1F2TA 4QBHA 3F1ZA 3GLIA 1VQIA 3WRYC 1XNRL 5DHFA 4NE2A 4LF4L 4TLCA 4PZLA 1S72A 4TTPA 1OXVA 3RS0A 1QVRA 1T8TA 3K0SA 3CLVA 4PZ7A 1J90A 3CNNA 4FIDA 2O8EA 2WMNB 4AG6A 4QBIA 3CMEA 2R6CA 2NVQH 2YTXA 2E2JH 2DWPA 4XWAA 4OK3A 3EZ9A 3GTKH 2GTPA 5BN4A 2IT1A 3TUIC 4IPGA 3V00A 4U02A 1VQFA 3I1FA 3RC8A 2I0QA 2UUBL 1SE8A 2PNHA 4UP7A 1ZAKA 3LD9A 3NBFA 4GMXA 5SZJA 3KKQA 1DPFA 3I72A 2VY3A 5JI2E 2WJIA 1KJYA 3W5IA 3PUXA 4QKQA 3HKSA 2KJQA 4MYCA 3T1VA 2ZSAA 4ASUD 2VL7A 4APVA 1SR3A 1RE0A 5SZKB 4KKTA 4G7OC 1P9NA 2GCNA 3M6AA 4HATA 2ZIAA 1E2ZA 4UNRA 4CT4B 2K5NA 2FGKA 4C3HH 4X8OA 1W48A 1C0AA 3BE4A 4KO8A 1PLJA 5FTLA 3UDXA 4HAYA 1LACA 2PL3A 1GRRA 4R4QA 1KI7A 1X6VA 1KZ7B 3DO6A 2JJQA 2AXNA 1VQ5A 4PC7A 1TU2B 5JRZA 1FZQA 2Z4SA 2OTJA 1XU4A 3D8BA 1N5JA 4Q1FA 2ZTEA 4QJ3A 3WWVA 4IW3B 3KF6A 1E2VA 3D4RA 1E9FA 2E75C 3A36A 5FUWA 2P6UA 1U0HC 5KOYA 1Q1BA 3C14C 5AJZA 1X3FA 2HF8A 2C5LA 4A3KG 4DUGD 2PMZE 3HOXH 1H9MA 1KO5A 2F4VL 2JA1A 4JLJA 4LJ9A 1WQ1R 2ZI4A 5LMUL 3B60A 3F8TA 3AB9A 1HCZA 3W1GA 5IP9G 4JV5Q 1ESNA 1G7SA 2C78A 3LX5A 3RANA 3W6OA 5JRJA 2A69C 2FGJA 3IHLA 2CE2X 2A3RA 1KK1A 3KLRA 4DCNA 2HCJB 2HQLA 2NZOA 1H8EA 4PSKA 4DSOA 4HDQB 5JCPA 1XEWY 4GN4B 3ND8A 4D82A 2AK3A 1XEWX 3KYHC 5AJWA 3J81c 2ZRBA 3ICQB 3REGA 1E2QA 3L43A 4LCBA 1NBME 2DYKA 4DR7L 2JJ8A 4AIIA 3G82C 4GS3A 4DDVA 4IJLA 4HUTA 1WRBA 3O47A 5KPDA 1X65A 4LRWA 4V0LA 5D3MA 2VBCA 3KF8B 1A5TA 4UJ3A 1E3MA 1I94Q 1G16A 1OFIA 3BZKA 2YVUA 3WNCA 2OT3B 3CRLC 4M9ZA 1WBBA 3E9IA 4KHPL 1D6JA 2EFHB 1SKYB 2IYXA 2BA0A 1NIJA 1Z0DA 3TLXA 2IYVA 2OBMA 3IGFA 3QEOA 4A0FA 1OKKA 5M3FH 2JE6I 4A3IG 1E1RD 2CL6X 4JSTA 1TWAH 1YITA 5BR8Q 3R7WB 4JYAL 3CW2C 4KLKA 2GXSA 2CW0C 5SZIA 1R2QA 1VKJA 3C4JA 3T1TA 1DBSA 4URWR 1E6CA 1XF9A 2OEPA 2J0UA 2ODNA 3CPHA 3QKUA 4Q7LA 4BZPA 4GZYC 1SHZA 3T5DA 2XOKD 4IVPA 4FD2A 4C4PA 2XEXA 5FL3A 4BBRH 4XTCS 2B3GA 4LF9Q 3CC2A 4QJ4A 4EPTA 1P2SA 1XXHE 4UNPA 4A3MG 1J99A 4B3MQ 2G1KA 1HZ9A 1X3EA 1M7BA 3VAAA 1QHIA 3DEFA 3OEHA 4BGDA 4X62L 4QIWE 4QGUA 3G71A 1EX6A 4Q48A 3MXNB 4QL3A 3I8SA 1KIMA 4EAQA 4G5SA 3DXJC 5CM8B 1IN8A 3KJOA 2O0JA 3TQYA 1UPTA 4BFUA 1DO2A 4PFSA 1FW6A 4IKEA 3CCQA 4LHVA 4URYR 4UXHA 1XMOL 1XD2B 3AP2A 4BLQA 4NHOA 2BCGY 8OHMA 3ZIAD 2WOJA 5E4FA 1KO7A 3UPUA 4B71A 1HTWA 1BMFA 1HUQA 4P73A 1JALA 2JIZD 2NO1A 5J4HA 3LBNA 4K46A 4Z1MD 2DNCA 4BA1I 5LMNW 4A76A 4JBKA 3HOZG 1NSFA 3LLUA 4BFZA 2KCMA 2X77A 4M0LA 2YOGA 3J81i 3EA5A 2JLWA 3GFPA 2B63G 4C2TA 2E5LQ 4OK6A 4B35A 3U61B 5J4KA 3VR4A 2G3YA 3GD7A 5AK0A 2WWWA 3EA0A 5ELXA 2AKWB 2Z0SA 1QG2A 1RIFA 1DAIA 2ZJ5A 621PA 5AWFC 5JEAG 2IYYA 1E2LA 4AY2A 1ZM9A 4A2PA 4C0KA 3STBC 4NDZA 2ASBA 4A3DG 2NO6A 4JLBA 4ABYA 4ARZA 2MSCB 4OKSA 4JC0A 1KKMA 2GRJA 4RKFA 4XSGA 1JE5A 2UU9Q 1XNJA 3I8XA 4DDTA 3OW7A 2ZR0A 1EK0A 2VUMH 4DJTA 5C44G 2QE7D 1VQCA 2ZROA 2EFDB 4UNSA 4DLWA 4OI4A 1TKWB 3B82A 3BOSA 4GBMA 4B43A 3QQ5A 1A1VA 2EJFC 1KC8C 1G51A 4DV3Q 3GLHE 1YRBA 3LY5A 4KKSA 4MUBA 3PV0A 1E4VA 1HV8A 3BJUA 1N6NA 2TMKA 2VPPA 3IHWA 3JZMA 2IUUA 4KFUA 1S0UA 1KDOA 2E5LL 1TWFH 4JYCA 1EWHA 2GZDA 1KMHB 2OXRA 2N42A 4A3KH 4JI6L 3VDYA 4JLAA 3N6RA 1D2EA 3WDNA 3HKZG 4MKGA 4NCJA 3CONA 2ATXA 4PC1A 5IP9H 4PPQA 4CIDA 1BIFA 1XJVA 3DMNA 4JLDA 4LHYA 4A8JC 4MKFA 4R4CA 1W0KA 3GQBA 1Y1WH 1E1QA 4NZYA 1D5CA 2H7VA 3BGWA 5GVSA 1XMIA 2CJWA 2Z6VA 1OHHD 2A5GA 4JYBA 4BQSA 5K8LA 1RPZA 3KB1A 4HJ7A 1YHNA 3EZ2A 1UBCA 4KSCA 4HZUB 2UXBL 2J5XA 3A8IE 3IPXA 2C95A 3I2ZA 4FMDB 4IFDJ 3KUCA 1JJVA 4JL5A 4DV3L 5K36G 1P2UA 1FX0B 4IOKA 1CR4A 4M1SA 3SGIA 1ZIPA 4TLDA 4UY8C 1GRQA 4DNTB 2NG1A 2ZRJA 2D2FA 4JIMA 3TRZA 4HIDA 1JAHA 3SEAA 3AVTA 2QGNA 3UKDA 4OWXB 3IFTA 3BB4A 4JI1Q 2AFHE 1NRJB 4Q18A 4WAUA 1N5IA 1EFRA 2RGBA 3DL0A 2HIXA 3I4LA 4DV1L 1T91A 1W4RA 2EXDA 1GVPA 1KO8A 1JBKA 3ZD6A 1OH7A 1G7CA 4URUR 1VQEA 4A3IH 1II8B 2W6ID 1CS4C 1W4AA 2QEQA 2HLDD 2VSFA 1K73C 2RHQB 2DWOA 3WBKA 4AH6A 1N25A 1KI6B 2IXEA 3EC2A 1YVDA 4M1MA 3EX7C 1HZAA 4PC2A 2OCYC 1NJFA 2FEMA 2JDID 1W36C 2BE5D 3QEJA 5IK2A 4AC9A 1TX4B 1NNEA 4Q4JA 5CYPA 1EFRD 4B3GA 2NN6G 2FFHA 3UG7A 1LYLA 1OTCA 2VHQA 4A3CH 3OTOQ 3AKEA 1KDPA 3J81k 1G19A 2K52A 1KDTA 2P6RA 1BO6A 1G64A 4H0LC 1CKNB 1GL6A 1UKYA 5C0XJ 2ZTSA 2FPKA 2R7FA 1ZMXA 4CEHA 2CLDX 5IE8A 1CRQA 4H1UA 5G40A 3T61A 1WI5A 3IILA 1HH2P 1M74A 4HI0E 1E98A 3HOUG 1WJJA 5IK2D 3SN6A 1TWHH 2E8GA 1SVWA 2NPFA 1GUGA 1VQ6A 2WWFA 4D4KA 1T5LA 3J80c 3HJNA 1GJXA 2XTIA 3CCVA 4C30A 4NXNQ 5G3YA 3CPFA 4KCGA 4DBLC 2K5HA 5KTYA 4A8JB 2A1AA 1YIJA 3AEVA 1G20E 3THWA 1IBKL 4P31A 4HR7B 5TVKA 5IYBG 4KVGA 4QHTA 2R44A 3B1WA 1PH9A 3K9LA 2QBYA 1FQKA 2B63H 4NPSA 4LJ7A 1N34Q 4PPGA 2N78A 3PSIA 4A3BG 2B8GA 4DNRB 1ZNXA 4IFEA 4OO1G 1XTSA 2LWIA 3C41J 4LYAA 2ZE8A 1LF5A 2VRWA 1BKBA 3ASZA 3TE6A 1G5RA 4GOJA 1I4LD 4Q66C 3U9SA 5H8WA 3AH8A 5DI3A 1Q3TA 1CR2A 2ZAOA 4A3DH 3L0OA 1X56A 4Q7MB 4F38A 1JB7A 2DN8A 1Z3IX 1N33L 1Q7YC 1P5ZB 3GLIB 1PHJA 2GDJA 2JLSA 4L9SA 1W49A 2FSIA 2RGNA 5C4JH 3IIKA 4WJ3M 4PMWA 3KL4A 4GNXA 4PV1C 1YHQA 1WDTA 3GEEA 1R0XA 1XDBA 1GZSA 3MUFA 1TQDA 4WOPA 5E7MA 1KHIA 1E9AA 1W44A 2R9VA 1M7GA 3B1VA 3SHWA 5IYCH 1N34L 3I7FA 1G6HA 2Q3HA 2GEVA 4TSFD 5FPYA 3ZS9A 1YJNA 3HOYG 3PF5A 4B3DA 5HTKA 1UE1A 1Y14B 3PUZA 4NXML 1PJRA 4LUCA 4C3JH 5LB4A 3QKTA 4C0LA 2FG5A 2KENA 3Q72A 4KAXA 4W9MC 4Q1AA 3AVVA 4JBMA 2E1RA 2GK7A 1XPOA 3CWQA 2PT5A 2R92H 2EW1A 3EG5A 4JBXA 2CDNA 3A58B 4WXPA 3CUEF 2J0SA 1DXMA 3O8DA 4MYTA 1VQNA 2QGQA 4JZKA 4C3ZA 3U4QA 2ZYTX 1I6HH 3AUYA 3GMTA 2AL7A 4D81A 2PPBC 3PVSA 4A93G 4KSBA 3J80i 2HJVA 3T15A 3SE0A 2YOFA 3BS4A 3B13B 2BEKA 5CK5A 1L2TA 5E7IA 4BLTA 5IRCD 2WWYA 5GQOA 3TEHB 1E9RA 1P60A 2D7CA 5DNYB 1D7QA 3D31A 5LDDC 2FSGA 4B3BA 5BYJA 4QBGB 4HB0A 1PA6A 2ZJBA 3M0EA 1EFCA 2IYRA 3KKOA 3ZGXA 4GOKA 3RRMA 4I1SA 4DRZA 2XXAA 3OE7D 3ZDQA 3NELA 2IWHA 1XCPA 3M1IA 2GILA 1J5EL 3HWSA 1QBKC 3IO5A 3Q3JB 5JWRA 3KF6B 2OFWA 4Q21A 2XZOA 3ADBA 2R93G 4US2R 3JAMc 4Q9HA 4CF7A 4AURA 4DSUA 3MRSA 3RC3A 4JI7Q 2FE4A 5FTNA 4PSVA 1HJPA 3REFA 3KQKA 1PH5A 2E76C 2OQKA 4B6EA 3VX4A 2ES2A 4LFCQ 3B5JA 2Y8EA 1CEEA 3KDFA 1W5SA 4LYJA 4DZZA 5C0XI 3H94A 2IS1A 1I4DD 3OW2A 1PFSA 4XVUA 3AM1A 4MGKR 3THYA 2DFNA 2YHSA 1IBMQ 2NN6H 1N36Q 1GFIA 1U2RA 2VP0A 3LGJA 3CH5A 3PENA 3D7MA 3I56A 4NCNA 5DO9A 1R4AA 4JI4Q 821PA 2VZAA 1EXMA 1TMKA 1X1RA 2Q6TA 1EFUA 5KDLA 3RDPA 1JR3D 4G5OA 2ZREA 2GESA 2AD1A 2ZI3A 3L0PA 1DAKA 4KN4C 2VHJA 5KDDA 1LVGA 2XGTA 3P1JA 1II0A 2QORA 3W6NA 3TBKA 3BAFA 4DVGA 3RWMB 3HOUH 2ZM6Q 3FFAA 2PZGA 3SJCA 4ME3A 1LM0A 1R5OA 2BMFA 4Q19A 3LQRA 2V1CC 4B3SQ 4OL0A 3D0FA 3CF6R 4TMZA 4CT5A 5FOWA 3ZYCA 3R7WA 2ZS9A 1U9IC 4N3NA 3AVXA 2CL0X 3MMPA 4DV0L 3QE0A 3VQTA 1G3RA 3TUZC 2VL6A 1E2MA 4M9XA 1OH6A 2ZRNA 3VKGA 1S9DA 2N49A 2PX0A 1WMSA 2XSZA 2J0UB 3PEUA 2D2EA 4OJKA 1FFHA 1XMJA 3QXHA 3CR7A 4O2LA 1Q44A 5M04A 2RMKA 3X1ZA 2WB1G 3T1HQ 4LSGA 1C7YA 4YMWA 2YWEA 4IPDA 5FBRB 5P21A 2OV2A 3S1RH 4RCYA 2DB3A 4OO1H 1T3SA 1G41A 1DADA 1K8MA 1E2PA 2ZM6L 3FKSA 4IQZA 1N32Q 4EFNA 3U3KA 2XZPA 4JT2A 4M8NE 4R4IA 1CXZA 2Q2HA 1XNQQ 1EFWA 1YZGA 3RWOA 3GTLH 2FSHA 3JAMi 4I99A 3RS7A 1W4CA 1ZM3A 4PO1A 3TMKA 1QHSA 1GUAA 4KKUA 1CUKA 5LB2A 1CP2A 5IHPA 3LX8A 2QAGC 2RHSB 1XD2A 3GLFE 3R9XA 2K5UA 1ZU4A 4RCNA 1G3IA 2VQFQ 5J3BA 2R6AA 1RVDA 2ZYUX 5FFMA 3A1SA 5F9HA 4GNKA 1QVGA 3VKWA 4LK2A 3Q5DA 3VNUA 3KFVA 3T1HL 4BPBA 2KHJA 2PNRC 2XTNA 3CR8A 3HOYH 3SS8A 4F4JA 1H9JA 3PO2G 2UZIR 1A4RA 5C4XH 1I3QH 4CEJA 2CWPA 3HU1A 5AUOB 5CYOA 5LMNQ 2FEOA 4O2DA 4OXPA 2UXCL 2IUSA 2D62A 2F3RA 4UJ5A 1VQLA 4AG5A 1R5NA 2A69D 1JQLB 1N5KA 1Y1VG 1T0HB 4AIMA 3KKPA 3N2IA 4DIEA 4RKEA 4OX9Q 5HZHA 5F98A 1Y8NB 2KSQA 5TMPA 4LF5Q 2QMUA 1JR3E 3VX3A 3RHFA 1KKLA 1X1SA 4ARZB 3RNUA 1VQ7A 3I32A 2CCZA 4L5RC 5CLQA 3JVVA 4Y7NH 3U2QA 2C9CA 2WWGA 5HZKA 1K5DA 3WYAA 1OXTA 2G1JA 3HOWG 4KFRA 4CEIA 1KK3A 1K0RA 1KO4A 2AD5A 2JA7G 1AQUA 3CW2A 4LBWA 4GT1A 4DLVA 1TWCH 3HOVH 1RZ3A 4Y0AA 3AF1A 1IXRC 4DR4Q 2A6HC 3DLLA 1WCV1 2BDTA 2GJ9A 2RGAA 1QUQA 2DCUA 3CRQA 3H0GG 1YJ9A 3KJPA 3I4NG 3OPOA 2ZYWX 4WW0A 2D0OA 1XCMA 4MYUA 1CU1A 2VS1A 3OFNA 4E03A 3TSZA 4ZKDA 2IBMA 3BDOA 4DR5Q 1OH8A 2BBSA 4MDFA 3GJ8A 1Q1ZA 1XFAA 3VMFA 2MO1A 1KY2A 4A3JG 1S40A 3UXMA 4LJ5A 1B23P 3CO5A 4QRHA 3X1YA 1NG9A 3WY9A 3VTKA 1W2BA 3NBHB 2CJWB 5G3ZA 3ASYA 3CH4B 3BB3A 3H2YA 3UG6A 1VCOA 3ZD7A 2FFQA 2GVBA 1Z29A 1M1KC 1VCNA
chains in the Genus database with same CATH superfamily
4X97A 3VUFA 2IYQA 2R87A 4B6JA 3HN7A 4WINA 4R01A 4MVJM 4ME5A 3NBMA 3W2FA 1LJUA 3DFIA 1J5PA 5EXSA 2HI0A 2CKZB 1JLSA 2DY0A 5C4JB 2R97A 2QM7A 2VTDA 3D59A 2F0SA 5G3LF 4EAAA 1UEAB 1QNFA 3MQ2A 3B6JA 2QLLA 1MO4A 2JFNA 2MDTA 3O91A 4BLPA 4B87A 2G6TA 2PZ8A 5I4BA 2F1RA 3RREA 4RADA 3W3ZB 3DBOB 3THWB 2OO7A 3KKMA 5TSDA 3MMZA 1XZBA 2GT1A 4KJXA 1ZGHA 1H1LA 3GP8A 2RFLA 4JYMA 3I3SR 3KAPA 4QIHA 5EGSA 4PHHA 1YACA 1OC2A 5AM3A 3JVUA 3CSUA 1U0GA 3GYBA 3BHNA 1SUCA 1M5RA 3NR2A 3O3CA 1DAGA 1MEJA 1PYBA 5EHGA 5KKAA 3MG9A 4ZQIA 3W8RA 3BRCA 2GF0A 4NS1A 4YAUA 4X7BA 1VQHA 2E74C 1BQQT 3DBLA 1DBWA 4X1YA 4GBED 4WBXC 5GP1A 3GG2A 1YBAA 2FOLA 1U8AA 3JAML 3DMHA 1QQ6A 5GONB 3J7ZC 1FQOA 1JG6A 1JB3A 3K9FC 1ABFA 4C1NA 1YNJD 3CM0A 4KR0A 3H5WA 4WZAE 1Z4PX 4Z5XA 5C1PA 3VNVA 2HQ1A 3L5KA 3TBHA 2X5XA 1JSLA 3P2OA 3I0NA 1F2MA 4TM8A 5BN1A 4JG2A 4XWKA 2NVWA 4AWBA 4C0BA 3GZNA 4NY1A 4QFCA 4N6GA 2WQ6A 5J47A 3R20A 4FUQA 4BL5A 5EJMA 4Q3AA 4U68A 4A10A 3KOMA 3NGLA 2CB9A 2OQ2A 3EPPA 3OEHD 4OONA 3WLIA 3ZCSA 2A30A 2JATA 2UAGA 3JPYA 3JSXA 3NHLA 3PDJA 3VH2A 3OYYA 1DHTA 2BEWB 4WKCA 2WNSA 1W0CA 1GQ2A 1TW3A 4RIEA 1GPH1 4RGVA 4MV1A 2A84A 1CHPD 1VPLA 3PEVA 1S2DA 5AW5A 3EIXA 3TCXB 1WU8A 4FMBB 2J3DA 4NV0A 2D0OB 4RVFA 4H17A 3IS3A 1HDRA 2IOQA 3BKWA 5GZ3A 3RM3A 5FUXA 4JEIA 4XXHA 5T1IA 5E95A 4XR9A 1PFWA 2X1HA 3DPUA 5LUAA 1T0UA 4MYHA 5HQ3B 1E22A 5T6MA 1JIUA 1W8DA 4NAHA 2PUDA 1RFGE 1E7RA 1KHTA 4PRZA 2IIPA 3K3PA 2IU6A 3GCGA 1T5HX 1B2TA 1MO5A 3QLVC 1Z5OA 2I6XA 5AVOA 3I4NB 5LQKA 2VDOB 1U0JA 4PWYA 5KVCA 4RD1A 1QJOA 1RXCA 2FN4A 1CVIA 1CDDA 3D3WA 1IOWA 2O5JC 2JFGA 5EWMA 2Q9AA 3HADA 4ZFNA 5G41A 1CRPA 5GY7A 1RMTA 1H1LB 3H5TA 4CFZA 3GHYA 4DM3A 2QYSA 4Y52H 5LQRA 5JI3E 1DM0B 4HS4A 4IUYA 4RCZA 2EFEB 1N8RC 2HHAA 5BN5A 1RAFA 3A7EA 2E37A 4LUZA 3NVMB 4RCOA 3NC4A 1FR3A 2UUAB 1NJSA 1AMUA 1WVIA 3AYXB 1OLOA 2NO7A 2EKPA 4DCMA 3DEIA 4C3VA 1EY4A 3FUWA 3DBLB 1EGAA 4ZLTF 2B2UA 2WQZA 1EQRA 3FDIA 5KYWA 2Z43A 1KXJA 2XAAA 3K7UC 4YDRA 3STUA 3LLCA 4QJBA 3UV7A 2XQGA 1ASYA 4IJ5A 5JDIA 1BHQ1 1G9SA 2FQQA 1GG5A 2ZRPA 4OM7A 2BP7A 4RA6B 1Z25A 2I3BA 4KXNA 2I7TA 2ZE7A 3VR6H 3FFBA 5U9CA 3NQIA 2NTNA 2YFYA 5TS2A 1DKRA 3NHPA 4DQ0A 2QN2A 1V43A 1XJQA 2OYSA 2XLCA 1POXA 4ABTA 1CK4A 4LHSA 4MUAA 3P4XA 1U2EA 4U2KA 2IZ0A 4CXMA 3LQ2A 3UWPA 1VRCA 3H2SA 4DIBA 5C5LA 4N8SA 1L5SA 4DDWA 1NMGA 1UE7A 3C6YA 2BDOA 3GNQA 1OJLA 1DLJA 1FS4A 2C2ZA 3H05A 1TAHA 4BWFB 3D3NA 1YQWA 3UI2A 4XZ3A 3K8QA 1MQ8B 1GNTA 2ZRAA 1AJEA 3TX6A 2W70A 1EVEA 3CUYA 2QJFA 2YZ2A 3LI2A 2N3ZA 1EVIA 2L69A 3ZV7A 1DPGA 1YNNC 2XTJA 3EEFA 1VJCA 1L5VA 3IEUA 5EP4A 5GJCA 3VU0A 3DSRA 3GDHA 1TYAE 3IVRA 2ZU0C 3FTQA 4PYOA 3QU7A 4BYGA 2FHTA 3CLUC 5E9JA 4TQAA 4D41A 3EUFA 2ZJYA 1YDEA 2O05A 4YX9A 2PJUA 1JPVA 3ZDBA 3VFDA 4L07A 1AKUA 5EQ0A 5CB4F 5C51B 4XJTA 3CC7A 1N78A 4JI6B 3M89A 3PJGA 1PTJC 4ZPXA 4U2FA 1CI3M 4CETA 4L95C 5IKPA 4D9HA 1KY3A 4WLEA 1G5TA 2IYSA 3EWNA 1F9SA 3EPHA 3VKUA 4GQAA 3SHLA 4YASA 4AZ3A 3D3WB 2HHLA 4JX9A 4EJ2A 3DV0B 3LWBA 3KZMA 1C8VB 2TS1A 5EWMB 2BZ1A 4DV1B 2CNWA 2VF8A 4HRXA 2FRVA 3I2KA 4LCJA 3GPLA 1OE0A 2P9CA 3NPMA 2GPAA 1E3SA 3S4YA 4ARBA 1WHTA 2B8NA 1MORA 2Q4RA 1KKUA 1WMFA 3VKVA 4XB2A 3IURA 2P41A 1TR5A 2ODTX 5BN5B 1YQGA 4TXNA 3OSZA 4QFDA 1YKFA 1I4OA 1DZ1A 4DV4L 4S24A 4L2IA 2XSCA 2DWCA 2ABWA 3V1YA 1YZNA 2VYND 2DFPA 1AH2A 2Y0SE 1SSOA 3W1BA 2XUAA 2IXFA 1ZL2A 2O7VA 3OHPA 4EQOA 3DTVD 3FYSA 1KRTA 2PXXA 3D2BA 5KYWB 1N33B 5KSOA 3A27A 4KUEA 3WQRA 3IJ5A 1RLTA 4R9RA 3V9AA 2A88A 4YAOA 2XDYA 4HDSB 3KU1A 3PFCA 2BP7B 1KJWA 5EXPA 1KNXA 4YCUA 1DJOA 4IUPA 2FN8A 4HQLA 4DRYA 2L11A 1HXHA 2BGGA 2OYRA 3GEDA 5IP5A 1QHYA 2PH3A 1UJNA 3U3OA 2V9ZA 5EZSA 3ZDDA 1NPYA 1VPVA 3TW4A 4FC7A 3P2JA 4Y6GB 2EP8A 4RV5A 1PS9A 1U7ZA 2E2HB 4QULA 2NUAA 5IJAA 3LDAA 2XVYA 2I03A 5IF9A 4LWZA 2WSIA 3OD5A 3S14H 4BATA 1ACLA 5JNTA 1PWEA 4Z1MA 4RF3A 4RSHA 1KDYA 3ANNA 4I65A 3W5UA 2VVTA 3ZXIA 2YN2A 5JSQA 1ZRSA 4CCAA 4DMCA 2QE6A 1EIFA 3K5IA 3Q2OA 4ESOA 3FP9A 4CL8A 4W63A 1FU4A 4LGYA 3MYRA 3E70C 3AZQA 3FUTA 4XOUA 2I4IA 3M1LA 2QF7A 4QB4A 1IB6A 4B4UA 3N0WA 3P0RA 2X58A 3H18A 2XTMA 3OE4A 4C1NK 5EOVA 4FP5D 3DAPA 5BMVB 3CRW1 5G4LA 4XWOA 1CDEA 1A97A 4Z4EA 2C4MA 1P8LA 2VP2A 3THXA 5JQGB 2W6JD 4BNLA 1KAGA 5HFAA 1OASA 5BRAA 1SQ0A 2OM6A 1G17A 1VF5C 1IJBA 4BB5A 1XE3A 3IR5A 3AP3A 3I8ZA 1OPXA 2R7ZB 5DT2A 4AMVA 3TOXA 2IEDA 3CNQS 3SJBA 1T0PA 2GZ3A 3AINA 2PUJA 4OHWA 3UT0A 3EVAA 3UFBA 4Q12A 3D43A 2O5VA 4F71A 1GGKA 4EGAA 4GP7A 1ZS9A 3MUNA 4NVRA 5E2IA 1YIDA 4S1NA 4BVHA 1KR5A 4FXDA 1MO6A 4FMCB 2R4UA 4B48A 3GEHA 4YAJA 4DC1A 1HFWA 1NQVA 2F0GA 1WHTB 4G26A 2JEYA 2IK8A 2V6BA 4UARA 1NBWA 1IHXA 1I51A 2HA6A 1XX8A 3J7A5 3V1UA 2PSDA 1O7IA 1CJTC 3NWEA 3PNBA 2FP3A 1NMFA 2GK4A 3LC0A 1VQMA 5A3SA 4NXNL 5FOXA 4OEHA 5DX1A 1AUOA 3VI3B 2ANCA 1KH1A 3QMPA 4Y6RA 4MV9A 2UXDQ 3PNPA 3O5AA 1SYBA 4K87A 4G81A 3UB4A 2G9QA 4XLZA 2KBFA 4X61A 4WI1A 1QCCA 2Q8IB 1LF0A 3CUKA 5BSVA 4K5VA 1HQKA 2I5PO 4FS8A 4IZIA 2B9VA 4WLUA 1X1QA 1FNCA 3V7UA 1IJEA 1TU3A 1VP3A 1FEZA 4Q7KA 2WIAA 1XTQA 4X65B 3PQ6A 2XGMA 3H3FA 1E6UA 4H7PA 3FPSA 1G8YA 3DJFA 3KF8A 4OA8A 4DIOA 2GEBA 4L85A 1GPMA 4E1VA 1M1YE 2NUAB 1T5XD 4LMQD 1KOJA 4K0KB 2OTLA 4LF8Q 2RDFA 5JYDA 2F90A 5BSKA 3F7OA 3KLSA 1KZHA 5J22A 2QVCA 1PQWA 3EYAA 1U28A 2P9QA 3E5RA 2LS01 5HY6A 1JGTA 4HB4A 4XB1A 1Q90A 2FUNB 4HN7A 4IJHA 4KQHA 2FXIA 1QVFA 2IZOA 5JAMA 2OEOA 4OJQA 3HL0A 3CE9A 1Q0ZA 3VM6A 4W5OA 2QWXA 2C82A 4E5DA 3FDZA 5JOQA 2KOLA 4LYDA 3CMAA 4RKLA 4EY7A 3L8MA 2D5DA 5B6IA 4P54A 3DOFA 4NR0A 4I1YA 3PRYA 5EUMA 1UNSA 2BHNA 1QHXA 4X45A 5AR1A 3BSWA 1H9AA 3UMCA 1YJ5A 5LL6X 3OO0A 3RABA 1R10A 2XT0A 2IOHA 2NSDA 2B5OA 3B3QA 2JAOA 4M8LA 3S15B 4TUYA 3S28A 5CDGA 3E9ZA 4QOGA 3KWFA 1J1IA 1I7SB 4B3TB 1FNVA 1YI0A 1L1RA 1ZSNA 3HB9A 2P90A 1ZITA 4O63O 2VJCA 1V45E 5LZ9A 5D7NA 4ZU6X 1C8CA 1YBYA 1NE3A 1BSVA 3FXAA 4S1VA 4FFRA 1Q7BA 4R8NA 4ZREA 4ON9A 3EGVA 3U0BA 4ZQHA 5AJVB 3PVZA 4J16A 4GD3Q 1GDDA 4DA9A 4CEHB 3MS4A 4GI2A 3A14A 4H1HA 4XQEA 4U3JA 4EYKA 3LY7A 2JIMA 1IK4A 1M2HA 1JC7A 4QE3A 3S2ZA 1HNXQ 4DLUA 3O2QB 2FG7C 5CV4A 2WM9B 1XDDA 3GK3A 3ZY2A 3O21A 1A5ZA 4Z2AA 4G5XA 2F3WA 1NBWB 1I6LA 5E2AA 1GKYA 1X7DA 2NZUG 4CPDA 4U00A 3PGZA 2IF2A 1SIBE 3D3QA 2EJUA 4F3YA 4ZYTA 3IQWA 5DI3B 4G0VA 2AMCB 1DXYA 1OXVA 1X39A 3LRTA 4DNQA 4D56A 2WMNB 2YTXA 4XWAA 1HL7A 2GTPA 3OJWA 3HEBA 4FLEA 3RC8A 3LD9A 3NBFA 4GMXA 2ATEA 2KJQA 1YAJA 3PNVA 4CFYA 1OJ7A 5I4CA 5CM2Z 2C5AA 2Z58A 3ACCA 4KO8A 1ET6A 3JQ9A 1LACA 2PL3A 2I65A 3A9TA 2AXNA 1EYDA 3C1TA 2IITA 4FDUA 4KQGA 3PEFA 5TQVA 3NGXA 4I8XA 1A69A 2ZXOA 3LE8A 2K04A 5IP9G 2YJ6A 4CMBA 2H29A 3IHLA 3MPOA 3KLRA 4DCNA 5JCPA 1C8LA 5CBKA 5K0CA 4QEZA 1RXEA 3KF8B 4I7EA 4H18A 4KJOA 4KHPL 3G3EA 1X7XB 3G6KA 2R5NA 2JE6I 4YAKA 4JYAL 5AM0A 3SK5A 4UE2A 4EP1A 2ODNA 5ELFA 4XTCS 4EPTA 4AZSA 3L93A 2A1TS 2RHHA 3KEQA 1PTOH 2I99A 3MK31 5HUQA 2HMAA 3A3YA 3O03A 1NRWA 3UNXA 5CD1A 2PUGA 2O0JA 2YRFA 1CY8A 4UXHA 3H2GA 1QYXA 2HWUA 1HUQA 2WG0A 2DNCA 4UFOA 5LMNW 3RNOA 2B9EA 5D6OA 4X66B 2PZMA 1M2NA 3T5BA 2RHTA 5AK0A 5GMOA 621PA 4C0KA 1QK3A 3PQDA 1U8TA 2PXAA 1NXPA 2EFDB 4UNSA 3WIOA 2HSEA 4H7JA 1G51A 1D0SA 3IHWA 1C1XA 4HADA 4Y1EA 4NCJA 3WDNA 5IP9H 3OJ0A 4LHYA 4LWPA 3I34X 1L7MA 4FZ5A 5JD3A 4HVAA 1AV6A 1FDTA 3HB7A 1Q6ZA 4ZT5A 3KHTA 4A3EB 3GOHA 2PH7A 1ZIPA 1K4MA 4X0EA 4NW2A 4MZDA 4PX3A 3V1MA 2EXDA 4WDQA 3U39A 1UJ5A 3WBKA 2IXEA 2PL1A 3CW8X 3UPTA 4GGOA 3ZUPA 3CEPB 2P6RA 1OD6A 4CNBA 1B2LA 3GD5A 3WJ1A 4U3JB 5BYBA 1RWXA 4XDZA 4AUNA 3KL2A 1DT3A 3STWA 1TMOA 1R12A 1RHMA 1DQNA 1Y48E 2W2PA 1FQKA 3MQFA 5G4KA 1REQB 4LF7B 8ABPA 3DR3A 1WUHS 5SYAA 2QLNA 1QAMA 4PMWA 1TQDA 5HTKA 3MN1A 1FXUA 2F64A 2Z56A 2D54A 3F97A 1SOVA 1T15A 2EW1A 4WFQA 4JOSA 2AL7A 3PT5A 1Y7IA 2FDRA 2OGZA 1J0CA 3K1AA 1XU7A 2HLNA 3I04A 4P83A 1Z4LA 3NORA 2GAJA 5DWDA 2XCIA 4DMUB 1EAYA 3KQKA 3VX4A 1W5SA 3RF6A 4O4IA 4XVUA 3CH5A 2RJOA 5FUMA 1EFUA 2WB4A 1ML0D 1I3MA 2HDMA 4U7FA 1RZRA 3W6NA 5IG2A 2AR0A 1J8IA 3N2YA 4ME3A 1R5OA 2BMFA 4IG9A 4PYLA 3LQRA 5KYUB 4B3SQ 5E4TA 5AI8A 3AM4A 3DUFA 1U2GA 1SG9A 2PQ6A 3BWBA 3T1HQ 2W2KB 5ALIA 1D6EC 4BJHB 4RCYA 5EJ5A 4D45A 4U7PB 4CHGA 1KRHA 5EZQA 4DWWA 2VTEA 4BO8A 5JNRA 3QMVA 1F12A 5K01A 3QBEA 2VQFQ 4TV8A 4E2YA 4H7BA 5KI6A 1RJEA 3FYUC 4MVJP 4OL9A 3PC8C 5CYOA 2FEOA 3KJXA 1JQLB 4LQ4A 1PVVA 1DFIA 1V4VA 1KKLA 1D3AA 3U2QA 3WYAA 4MUJA 5IOCA 4Y0AA 3AF1A 4OREX 1PFNA 4G1EB 1JLRA 1C1XB 3H0GG 4PW0A 5M34A 1CU1A 5C9ZA 2AOXA 3M7IA 3BDOA 1KY2A 4KRFA 1W2BA 3QFCA 2GPSA 5C3UA 1QP8A 1HPLA 4INPA 3LLMA 3VC1A 3PQ3A 2DJFC 1WUJS 1Z2NX 5IT9c 4DR2L 1O2DA 3ZBQA 4ME6A 1MB4A 2GNOA 1K4KA 4ENQA 3A37A 5C2JB 1WOYA 3WQBA 1PEKE 4RHRA 3GJ4A 3RQIA 1OXBB 5IVHA 3NJ4A 3FIUA 3NWBA 1NYTA 2VBFA 2X3UA 2VRCA 5IJXA 2FZKA 2O2IA 5CR3A 1YZ3A 4GS5A 1XNRQ 4HYQA 4TWJA 1B3BA 3ONDA 4R3NA 2G40A 5E8RA 2PEYA 3TOZA 4F3TA 2WDPA 4DR3L 5G4KB 3D3EA 4D9IA 1UQUA 4HRVA 4QU9A 1X54A 3UW1A 3GVHA 5E9WA 1MO2A 4PGAA 4BFLA 5HUHA 3G5TA 4H7KA 5A4KA 1EBFA 3H0GH 4JI2L 4D8VA 1Y3AA 3B53X 5L3RA 2F4VQ 4UUBA 3WMFA 1SN8A 4H6PA 4TL7A 4PAQA 4MRMA 4AYBE 3K1AB 1VIMA 3BB1A 3DHVA 3EWSA 3LX4A 1DONA 4S1WA 5H82A 3Q8DA 1HE8B 3NNDA 4FT2A 5FUBA 3U0VA 4FMPA 3X3NA 1TF7A 1CA6A 3PO3G 1Y3CE 3FY4A 4FXKC 2C54A 1MFPA 3KSRA 2JHGA 2PYIA 3LP6A 3ESXA 4O4IB 1V6AA 3GTQH 2O50A 1FNUA 2HGZA 4KO2S 4Q9IA 4H7DA 5C8VA 5HJ5A 3HOYB 1PT8A 3CF4A 1SURA 1OO9B 2P0EA 1XZIA 4IGKA 4QUFA 2Q2IA 3LO5A 1XMOQ 1R88A 3DUFB 4JWKA 1EJ2A 4RY2A 5C80A 1C7RA 2I71A 4NAVA 1PYOA 1N5LA 2EYFA 2D1TA 5FJIA 1T3LA 2J0QA 3ZGNA 2JGNA 3BS1A 1B0UA 1SWVA 3CLSC 2JVIA 3NYQA 4TV8B 3ZVKA 2EBWA 1FW8A 3BHJA 4GKKL 3M33A 3ERQA 3O93A 3D64A 3LXXA 1IBMB 2C58A 2IL8A 5JECA 4PSAA 3LNTA 3AJAA 1Q3KA 1MJHA 1J1ZA 2YYYA 1ESRA 1DC3A 1U4OA 1HT0A 3ESYA 1NL3A 4NCAA 3I0ZA 2Q41A 1P5HA 4NDXA 3JQBC 3OICA 3GJTA 1XQ6A 2ET6A 2D1RA 2XRMA 5EKIA 4BZXA 5F33A 3PO3H 2A7QA 4OHPA 3W34A 5EEGA 3ZZ0A 4JJ7A 3CJRA 3NBHA 4GVPA 2OHJA 3QVUA 3Q7EA 2ZBEA 4RLFA 2ENUA 2QN1A 4C03A 3P5BA 5CVTA 1XNQB 1OA0A 1JP7A 5KEIA 4RPHA 3DEAA 1Z4KA 1C4KA 4D0LB 4PZPA 1P1FA 1BGXT 3CX7A 3QNWA 4EI7A 3GLTA 2GBPA 2DQ4A 2YNMA 3MWKA 1RLOA 1U02A 5KVSA 1T8UA 1XGKA 4PXAA 2PGOA 1YJ8A 4F2WA 4BWGB 2XQKA 3SKVA 1ZPDA 4LOKA 1W0JA 3IAS1 5ICGA 2JBHA 4BTLA 1QVAA 4YRJA 2PS9A 5EXXA