1Q1EA

The atpase component of e. coli maltose transporter (malk) in the nucleotide-free form
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
367
structure length
367
Chain Sequence
VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A tweezers-like motion of the ATP-binding cassette dimer in an ABC transport cycle
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Maltose/maltodextrin transport ATP-binding protein malK
total genus 93
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2003-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1q1eA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q1eA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1q1eA01
3HOVG 3I56A 1OFTA 2ZI4A 4A3DG 3K0SA 4BASA 3KQUA 3K70B 1XNJA 3SJBA 3DDCA 1U81A 3TK1A 3K8AA 3M7NA 1AS3A 1NL3A 2PCJA 1UEBA 3LGJA 1JQJC 4A3GH 3CRQA 3V00A 1F60A 3U3OA 2WJVA 5IY0A 1W0KD 4G7ZC 4ABYA 4OKSA 1Z3IX 2RKOA 3AF1A 4LI0A 1MJEA 4R2IA 2QA4A 2DPXA 4L5TA 4B48A 5FOVA 2ZI6A 3L0PA 4BFUA 3K0EA 1W0JD 3RABA 3SHFA 4BZPA 1E7ZA 3HOYH 2D2CC 2GEDA 1R5OA 1RKBA 1FOEB 2FH5B 3ONWA 3PIRA 1HE8B 1NVVQ 1Y1WG 3JAMi 3KX2A 3OE7A 1I3QH 1ZD1A 2OE2A 2I0QA 3H84A 5KNDA 2ZRKA 1U0LA 4KODA 4G5GA 5H1YA 4KHPQ 5HCIA 2PLRA 2ASBA 1EFCA 1KI6A 1YHAA 3CUEF 5JS8A 1CSPA 1WRBA 1ZBDA 4HIMA 2WPDA 3CCQA 1NI3A 3F3YA 3KB2A 1Z6TA 5AJZA 4BZQA 2IS6A 4JI5L 2YU9H 2UXDQ 3OEHA 3UKDA 3ULJA 3S2DH 4KU4A 4ZI2A 3GTJH 3KDFA 1S1MA 1K8MA 1DO0A 4GI7A 1RL2A 1M7HA 3QXXA 4IEEA 3IBYA 5L3QB 4DAMA 1R9TH 2OO7A 2JLWA 3W6NA 2B8TA 1BOFA 1UE5A 1OE0A 1N36Q 2F4VL 3QF4B 1H65A 3VR2A 3L43A 4JSYA 3EAQA 4ASUA 5DYGA 3HDTA 2QE7D 2KCCA 4OO1H 2O5JC 2A9KA 4NCIA 4B34A 4EFNA 1W4CA 1XDBA 4P0TA 4LHZA 1Z6AA 3I4MH 1L2TA 1S8FA 1W2HA 3PO3H 3REFA 4C0AC 4YY3L 4V02A 3OF5A 1YRBA 5FOTA 2QQ0A 4A3KG 5GJVC 1Q7YC 4PTLA 4GLXA 1EFRD 1SXJA 1PLLA 4MKFA 1SXJB 4HI0E 2ZJBA 2NOAA 4DIDA 4Q4HB 2IXGA 3HYTA 1KMHA 4BA2I 4JC0A 2NGRA 1XPOA 2MMGA 1NVXQ 1OXVA 2ODNA 4QNRA 5JSZA 2JA8H 4LV5B 5HE8A 1NP6A 2UKDA 5A0FA 3TAUA 3ASZA 1ZC4A 4LUOA 5GAGC 3BAFA 3BS4A 3K0CC 5L3VA 1IBRA 3KTAA 3ZQJA 4AYWA 5L8VA 2Z6VA 3KTAB 1P72A 3H3VH 4LYHA 5B64A 1P61B 2UZIR 5FLMH 3IO5A 5JS7A 4A3FH 3NC0C 4E03A 3BZCA 1FMLA 1J8MF 2X1VA 2DN8A 3NHBA 1RVDA 1YZ6A 4DV3L 1GNQA 4LYFA 2FG5A 1G291 1JALA 3SN6A 2FEOA 1XD2B 3KJIA 1PH9A 2MO0A 1ONLA 4GKJQ 1SXJD 1IW7C 3CR8A 3E70C 1IXRA 1K9MC 3CX6A 2VHJA 2ZM6L 4JVLA 1Z63A 4BUJA 1B8AA 3VR6A 4X65L 4US1R 5AUQA 2ZAMA 4Q4LA 4DZZA 2P6UA 2VL6A 1A2KC 4PSVA 3LBNA 4RG1A 1P2UA 2A6ED 1NG9A 2ZS8A 3THYB 4QGAA 5IYCH 1YR8A 4DNTB 4DSTA 4NYJQ 5IP7G 3U5ZB 4GPTA 5F9FA 3PIOA 1JJ2A 4DLRA 4QKQA 3KQLA 3GLIE 1MIUA 4P74A 1XPRA 1E9CA 3IQWA 4KFRA 4V0MA 3PITA 1GNRA 3U7GA 1EFWA 2K32A 4DLWA 2B63H 4QL5A 2QN6A 3U6KA 1SE8A 1F6BA 1P7CA 1U9IA 4M1SA 2ZM5A 3ZJYC 2EJFC 3KLRA 1NJFA 1QBKC 4GMXA 2EFHB 5C2JB 4B3SQ 1GRRA 5BR8Q 3OIYA 1BS1A 4OHVA 2Y0SG 1XNRL 2REBA 5JRZA 2GJ9A 3U44B 2RGBA 3G0HA 5FBRB 1LB1B 4KXFB 3U3KA 3SC3A 2QG6A 1SZPA 5SZIA 1QRAA 1D2MA 1XMSA 4CDGA 1HZAA 5JEAH 1YNXA 1I94L 3TR0A 5C4GB 4QC2A 2ZS9A 1NVUQ 2ZRJA 3DM5A 4M1TA 3R20A 5DLQC 2DWOA 4IDPA 2FNAA 5E3HA 5FR1A 1OIXA 1QVAA 1BYUA 2JJQA 1XZPA 3T56B 3GFTA 3MWJA 4B33A 4Q9HA 1U94A 3CPJB 3KUCA 3C41J 1WCMH 3DXJC 4ACAA 2QAJA 1JJGA 2R62A 4JYAQ 3KKNA 4H13C 3TQCA 1N6OA 1B23P 4I81A 1AK2A 2VF8A 5TARA 3KKPA 2GZAA 5EE9A 2IC5A 2IT1A 4O0MA 2ALYB 2ODWA 3WMFA 1GKIA 4QGUA 2E2IH 4KBGA 4JI6L 5A5GA 3CNOA 4JI3L 1E2ZA 1EWIA 2B7BA 1KY3A 4JLAA 3GO5A 3TSWA 3S2HH 2PNRC 1G9XA 1UBCA 3Q7PA 2V8OA 2OZEA 1E1RD 1E32A 1VQJA 4US2R 4RD6A 1TMKA 4J15A 3ZZ0A 1CJUC 2F7SA 2J5XA 4NXNL 2B63G 4KAXA 4DJTA 3TGPA 3G5UA 3H0KA 2OHFA 3GLIA 3HWSA 1E79A 1LABA 1JR3D 1CKNA 1SXJE 2A7QA 3KJPA 3KL4A 3CXCA 3WXMA 2RHDA 2XXAB 2RGNA 1CJMA 3X1WA 4LBWA 2NZHA 4WZ6A 2E76C 2QT0A 1ETUA 3AVOA 1W7AA 3REGA 1IONA 2EQSA 2P6NA 2Z0SA 4AK9A 1OYYA 1VDZA 1CFMA 2I1QA 4PO9A 4UP7A 2QPAA 3QEJA 2PJZA 2O52A 3SYLA 1IW7D 2WWYA 1N8RC 3HKZG 2V4ZA 1EIFA 4DNIA 3NIBA 1ZINA 1W36B 1KO4A 3T1QA 5JMTA 1G5RA 1KHIA 4G3XA 4CW7A 1B9NA 4OQMA 2BE5D 4URZR 5C18A 2QEQA 3T53B 1F5NA 2IYUA 3FPPA 2F9LA 3CWZA 4LX0A 5AJYA 1M34E 1GP2A 1SVLA 4A8JB 3H15A 1K0RA 1ZNXA 1EOVA 4UNPA 2NQ2C 3EASA 1E1QA 2XX3A 1K3RA 1QHYA 1UEIA 2J9RA 1XZQA 1IN7A 2OV2A 2ZSAA 3FKSD 5DI3A 1S3OA 2OCBA 4LRWA 3J80c 2ZIAA 3QPWA 2BH8A 1LS6A 1UBFA 4LW1A 4OK3A 4QG7A 4W5HA 2NZJA 3I5XA 3J81i 2GDJA 3QKSA 4YCVA 5C4MA 4D25A 4I1OA 4DV3Q 4RVCA 3X1XA 3RRMA 3Q85A 2ZE8A 2HDNB 2FZ4A 4US0R 2FFAA 1A6XA 3BFXA 5DO9A 4TMKA 2AWNA 3ZZUA 5FLXc 4F38A 1E1OA 5FOWA 4B2PA 2EJGC 2CKZB 4LFAQ 3WBJA 4PMWA 2XTNA 5C4JH 2Z0MA 3TMKA 1SGWA 4DCNA 1E9EA 3LDAA 5FLMG 3UG6A 3CX8A 1XU4A 2GNOA 2PT5A 5HCNA 4EFLA 4HJ8A 2UXBL 4DSUA 1GUAA 4A8JA 2MNAA 1IYUA 1LM0A 1GIAA 2Q9CA 1T5EA 4B6FA 3L82B 5LPNA 4CEIA 2VRWA 2BBOA 1E0SA 1VQMA 2PMKA 4PX9A 1J90A 1UKEA 3W6OA 4EAQA 1P5ZB 3PG5A 3RLFA 3UE0A 3DM9B 2I5MX 1Z83A 3T1HQ 1L7VC 2P5SA 4LJ5A 3TW4A 3CCVA 1PH1A 3CPEA 3S15H 3I4LA 1HH2P 1UKVY 4OHYA 4DR3Q 2NN6G 4EFMA 1ODFA 5KU1A 2I1VB 2QNRA 4NYMR 2A3RA 1SKYE 1TQ6A 1II8A 5DH9A 5CDFE 1FQJA 3CRW1 4DLZA 4TZ0A 4Z8XA 1X9NA 1E69A 4GN5A 3GTPH 3EIQA 3L0OA 2EDGA 4JVSB 4RZXA 3GD7A 4LHYA 1XMOQ 5BWMA 2IYWA 4TLEA 2O8DB 4P3YA 2O5VA 1SLJA 2R6DA 2ZITA 4XWKA 3IIJA 4IOKA 1IN6A 3H2YA 5LB4A 4DV1L 1HY3A 1XD2A 5GAHC 4DR2L 3ULPA 4LHVA 2V7QD 4DV4L 3FVQA 1Z06A 1IAQA 1X6VA 4KV9A 4JLKA 5J3BA 2GHIA 3G4SA 3I1FA 1W4BA 4K46A 4QY7A 4DR7Q 1PZNA 3NHAA 2OEPA 2W2VA 3U4QA 3E5HA 4AY2A 1HTWA 4R1JA 2OXCA 3QPUA 4POAA 2E74C 3GJ4A 1S9DA 4JIMA 1AQYA 1Q1QA 4GMDA 1F2UB 4C0BA 1R4AA 3W9YA 4D6PA 2CCGA 3R8CA 2OLKA 1N33Q 2WSMA 1Y3AA 2BH2A 4CEHB 1J7KA 5HKKA 1HQYE 3ZVRA 2W0SA 4TL6A 4JI0L 2OAP1 4QHYA 1VCOA 3KJHA 3NTUA 4LY6A 1AS0A 3NBXX 4Q00A 4M9XA 4UXHA 4D26A 4Q66C 5J4HA 2NO6A 2A6HD 1SULA 3ER0A 3HU3A 4L5BA 1SROA 1YJWA 5L3RA 1V43A 3TNFA 2J7PD 2D74A 3A37A 3F0TA 5GJCA 1ESNA 1F48A 2DFTA 5C46F 4FMCB 2N46A 4JJKA 1CSQA 4KYUA 4A3CG 2A78A 1KK2A 3FE2A 2V6IA 5F2EA 2V3CC 3CQZH 2FX3A 1KK3A 3EARA 5EUQB 1VQ9A 3D4RA 2F3IA 1ZP6A 4PXAA 3UDFA 1RW4A 1N6RA 2AUKA 4OHWA 4X62L 4DUYL 4TVAB 2C5LA 3DHWC 4CF7A 2IYRA 1DCZA 4BXXG 3D31A 4LK1C 2GF9A 1B7YB 1S3SA 1M74A 3WYGA 3RN5A 4JI6Q 4KSCA 2R7DA 3L2PA 4JI3Q 1I50H 3CNNA 1XD9A 3L0IB 1KI2A 1RIPA 4G5OA 1Q8KA 2DWQA 1X3EA 2WWXA 1GD7A 1R7RA 4FWIB 1KO8A 4MDEA 2JCSA 3GLHA 2WOOA 1BO6A 2Q3HA 4EJSC 4JI4Q 4IOAA 1HEIA 4A0FA 4R4TA 2AN9A 1U0JA 4DCSA 3N6RA 1KXLA 2ZT9C 2CL6X 1R6BX 2EQBA 3I4OA 1YR9A 1HE1C 2D62A 4LPKA 5FJ8H 4R2HA 2KA7A 3FKQA 3GCGA 4LUZA 4QOSA 3SOPA 1Q21A 2GVDC 3VHXA 5JI2E 2HQLA 1TF2A 2XOKD 2O8EA 1NLZA 1NVWQ 2VQEL 2F1RA 4EQ6A 2CEAA 2EYQA 1KI8A 3O8RA 4N1AA 2BEJA 4DR1Q 1C1YA 2PEZA 1H8HD 2GXQA 3AKEA 1COWA 4E5UA 3GLIB 2DGYA 4YWMA 2J0VA 2ZRDA 4BEBA 5EXSA 5IYDG 4KKSA 1OFHA 4A1FA 3UPUA 3A6PC 4A4DA 4L15A 2V54A 4BY1H 4TLCA 3AGPA 1YJNA 4TL8A 3W1BA 2ZSFA 4B3BA 2NPIA 2WP8J 2HEIA 2LKCA 2ZSDA 2XXAA 2DNEA 1FL9A 3QSYA 1OFIA 1IYJB 1OJLA 5TVKA 1E3PA 1NRJB 1XTRA 2Q9AA 5CIWA 2Q21A 2WKQA 4PZZA 2I5HA 1D5CA 2FMXA 1TU3A 2OLJA 2IBMA 4J0QA 4N3NA 1PFSA 5HPYB 1SFOH 3GJ7A 2WZQA 4M1MA 3J81j 3PEVA 1S3GA 2QAGA 2WTUA 1XMJA 3FKIG 4DAYB 2ZJPA 2EYUA 1AS2A 2L0XA 4Z1MD 1SN8A 3GJ5A 4P72A 2F3TA 3U6BA 4BY7H 3EG5A 3Q72A 2JDIA 3RS5A 4X6AH 5LMNQ 1DEKA 4B3TQ 2R6AA 4B6EA 1GVNB 1Z5ZA 4DV0Q 4EX5A 3KQHA 4L5QA 2QMHA 4UP9A 4K81B 1CF4A 4DV2Q 3OHMA 4XVQA 3U58A 1K8GA 3MJHA 3ADBA 2PJRA 1KJYA 2XITA 2VHUA 4APVA 1SHZA 5AWFC 2PMDA 5EP1A 2C8VA 4A2QA 2ZRAA 3MWKA 4O2LA 1GL9B 3WMEA 4B73A 4B2IA 3U7HB 2KBNA 2YV5A 3RR5A 1CP2A 2G88A 1MKHA 1HTPA 2RH5A 4QJ3A 1VF7A 2FOLA 3K9GA 3W5OA 3GFOA 4DB4A 3ZH9B 4B76A 3CR7A 5CK4A 1R2QA 1XCMA 2RGDA 1E2JA 3I32A 4QFMA 3DPUA 1SVIA 3Q7QA 2JA6G 1M1KC 4KYIB 3DVLA 5EUMA 1Z2AA 1ZRHA 2CLSA 1Z6YA 3TIFA 4JLPA 2G83A 4C0QC 2DR3A 4ZPXA 1S96A 1A5TA 1A0IA 1EESA 4HLQB 1TWGH 1LYLA 4ESVA 3S17H 5ELOA 2HIVA 1QHIA 3HOXG 5HGQA 4DV4Q 2ZPTX 3L2OB 3NBFA 1UKZA 1KO7A 4GN3B 1X86B 2WSSA 4QBGB 3GP8A 1KTVA 3LFUA 1KRTA 2JA8G 3CF2A 5JSZB 1OXTA 2ZVQX 4QM6A 2ZYTX 5JCPA 2OESA 5KUTA 3F2DA 4RD2A 4QBFA 4OONA 5BYKA 1IQPA 1II0A 3T5DA 4P33A 2WHXA 3FP9A 4MGZR 4M8NE 2N42A 3WNDA 2K7VA 2RHQB 1YU9A 3M6AA 2BMJA 2XGTA 1XTSA 3SHWA 2J0QA 2QPTA 4DR3L 4L5SA 3T51B 1N25A 4DVGA 5JZVA 5C44G 2JJ1D 1DBSA 1E24A 4FMDF 2R93H 4XTCS 1O78A 4OK5A 2HF8A 2XB4A 5GQOA 4BE7B 3PF5A 5FTMA 3LXRA 1HNXQ 4DKXA 2DB3A 1H8ED 2PZFA 3PCRB 4RD1A 2RF4A 5GAEC 1R0WA 3T1YQ 4ARZB 1M90C 3QEOA 2LWIA 2P65A 3OAAD 2F55A 2UXBQ 1KK1A 1BYIA 2FFHA 3SFVA 2GVAA 4DR2Q 3U4QB 3QVVA 3PGZA 2XZLA 2OFXA 1Y1VG 2BHRA 1Q1ZA 5LMNW 5FOUA 2R9VA 4AWXA 4HAVA 4BWYA 4QM7A 4BGDA 1YKSA 4ZO4A 1NN5A 3LXXA 4A3BG 1IXSB 3DKPA 4BBSG 5SZKB 4EPWA 1IXZA 3CH5A 4ZCMA 4DV6L 2BWJA 1FR3A 3PO3G 2YZ2A 3J81k 5BN3A 4ZDJA 5FUXA 1PH6A 2BCJQ 5LBIA 4Q1DA 2UUCQ 1TQ4A 1XEXB 4CEJB 1ASYA 1M1YE 1LV7A 4YQFA 1WMSA 1S40A 2B8FA 2CNWD 2CXXA 4W7SA 1KZ7B 4M53A 3ZVLA 4X66L 4RSGA 5IHPA 2AHOB 2VL7A 4DLUA 4DB2A 2QBYA 4PSKA 3QI2A 4KFSA 5KSPA 4I1SA 5M04A 2JASA 2LXKA 5IE8A 1W49A 1LVGA 4QGFA 2Z4SA 3M85A 1VQCA 4OK6A 1QHGA 1VQAA 4PANA 3U44A 3ADCA 1PLJA 4GKKQ 3ERSX 1XFAA 4TLDA 1L4YA 2UXCQ 3IILA 4DCTA 1XNQQ 2PL3A 4ITRC 1FJGL 1KY2A 3QXJA 3RS3A 1YHBA 2FPLA 3GTQH 2JGNA 3PF4A 3UATA 2FJUA 3EXAA 3VDYA 2JJ2A 1HUQA 3VR5A 2IX1A 3KKOA 3LNNA 3L0SA 1Q90A 4X8HA 3Q8XB 4IOMA 4LFBQ 1JEEA 1P2SA 4NKRA 2IS1A 4XOIA 1QZHA 2F43B 2X19A 1GTVA 4L9SA 5LD2C 4OX9Q 2VHTA 4S2EA 2V1UA 5FL7A 1Z47A 2ATVA 4DR4Q 3TS0A 1JR6A 4TL9A 1Y8PB 2P3SA 3CKLA 3AP2A 5IF9A 1Z7TA 4Q19A 2P67A 4GZMA 4DWJA 1EG7A 4Q48A 1WJJA 2Q9BA 2W6ID 2CLDX 5H8WA 1ZAKA 2E5LQ 1QUQB 3K8YA 1VHLA 1GITA 4NONA 2ZRHA 2NO9A 1J8YF 2AK3A 3AF0A 3VFDA 1E2LA 4DV7Q 1XTIA 4JYCA 3KXIA 2OQKA 3HOUH 1ASZA 2JATA 2LSSA 2OBMA 2QTFA 3NH6A 3TQFA 3ZS8A 4R4OA 1JXOA 4XVUA 4YY3Q 3IPYA 2FSHA 3DZ8A 1ZNWA 4YCWA 2WWIA 2KJQA 3W8NA 2ZE6A 3CNLA 4ZDKA 3M4QA 3CB4A 1SHKA 1VYUA 3VTKA 2YWFA 4BPBA 1OH7A 1VF5C 3AQQA 3CCSA 5K36G 1VQKA 2YOGA 4FINA 3CIOA 4O25A 4DR5L 3FHCB 3LLUA 4PR0A 1E2KA 1IBLQ 1K8RA 5EP2A 1R5NA 1YZTA 2O8EB 4YHHQ 5TMPA 3W34A 4KVAA 3TZUA 1AE3A 4LF4Q 4AQYL 2ZYWX 4LF7Q 221PA 1KK0A 3SJZA 2AFIE 3HPQA 1TADA 3K70D 4QNMA 1GKHA 2GJAA 3EIEA 3LV8A 3IRBA 1G21E 5H68A 1WCMG 4NXML 5CJ2A 1QHHA 3ZS9A 2IYTA 4G01B 4TQ9A 4O0AA 4AYBG 1KI1A 3MLEA 3K0CA 1VQ7A 1C9OA 2K5VA 1DGSA 3E0EA 1A82A 1OXXK 4A6XA 1V9PA 5C0XJ 2DCUA 3FB4A 4LC1A 2WV9A 4CT4B 2FSFA 2IS4A 3TREA 1DTSA 2GKSA 4DRZA 1BMFA 4X65Q 2VY3A 3TS2A 2W6JA 1P75A 2XEXA 1DAFA 3K09C 1DO2A 1XEWY 4YDHB 2ZSEA 1L1OA 2EWWA 4DLVA 2NG1A 1JQLB 4G5SA 5CB8A 4HDCA 2PQAB 2QF7A 5DHAA 1TNDA 1D9XA 4EUNA 3UDXA 1I2DA 4DLXA 4ZI3A 1N3BA 5M3MG 2I4IA 3DO6A 2AMCB 2AXPA 3SYNA 1UBEA 2EVBA 2V4DA 1KNXA 4TMZA 4YC7A 3AVVA 4ME3A 4BFWA 5KHOC 4JVNA 4YCUA 4A3CH 4LWZA 3F2BA 4F4IA 2YNMA 1CR1A 1YZKA 3K53A 5E4FA 2QM8A 2JA6H 1T6NA 5AJ3Q 1T8TA 2B6HA 4IJHA 1HR0Q 3M3YH 4A3LG 4GKJL 1G6PA 1HA3A 1Q82C 2CWAA 2E8GA 3K9NA 1G8YA 3MXNB 1K8AC 1HJPA 1CI3M 2RHSB 3W1GA 1ONBA 2GCOA 4X66Q 1KDOA 1HNXL 1IL2A 2IYVA 2RHMA 5K8LA 3CONA 3IIMA 4ALPA 3HOWH 121PA 2ZRGA 2A5DA 4HUQA 4HUQB 3TRZA 4OGQC 3QVUA 5IT5A 3U4VA 4C3ZA 3EIVA 4B3CA 3GLGE 4MYUA 2B3GA 3RANA 1VQHA 1IY0A 3G48A 5C44H 3CCUA 3S1QH 3P4YA 4PZ7A 5L3SA 2PCLA 5DN6D 1DAIA 4II7A 1JAHA 1BKDR 2RGCA 4U00A 4URVR 4DKAC 2OT3B 2Z43A 2LCFA 3IIKA 3OEHD 2WSSD 4C7OA 3BK7A 3CC4A 3KKMA 1J2JA 4BRWA 1E4YA 2JLUA 1J5EQ 5AR1A 2G77B 3QE0A 2ZUDA 2C9CA 1G8FA 3BDOA 2BJVA 3OIWA 1NE3A 2WMOB 4KVGA 2IWHA 1N5KA 3MFYA 2WMNB 2XGJA 3EA0A 3IPXA 1W36C 2F1HA 1UPTA 1R5BA 1KMHB 2JA5H 3BJIC 3TVTA 1CEEA 1ZJ6A 5EQTA 3VMFA 2BJWA 1P73A 1OIWA 1G17A 2IWRA 2BDTA 3CH4B 3HR8A 2E75C 2WICA 1AZTA 3EA5A 2RCNA 2YC4C 4LCBA 1VQ5A 1S9HA 3BB1A 3SEAA 1OT3A 5EXPA 2CFMA 1E94E 1T9HA 4JI2Q 3DZDA 4Q7MB 4JS0A 4P4UA 1KIMA 1ZYRC 3OOCA 3HKSA 2A5FA 2AL7A 5TXGA 1D6JA 1VQ4A 5LMNL 5B30A 2HIXA 4TTQA 4MTNA 1I6HH 3PCOB 5AUNB 2ZJ2A 3I61A 4C0JA 1TPZA 2X2EA 5IWAQ 1TEXA 3WYFA 2F52A 2EVWX 1BKBA 4XD7A 2Q2UA 4IDQA 4PC1A 4BY7G 3PUWA 4OO1I 4AC9A 5BQ5A 721PA 4JLVA 5EXTA 4OXPA 1PUJA 2ZI5A 3AP1A 3B6YA 5IYDH 4KCGA 3B1ZA 5J4YA 2IYSA 5CDFA 4PPQA 1JPJA 2KBEA 4YHHL 2ZANA 4A92A 4DCUA 4U7DA 2Z6KC 4AKIA 4A3GG 4QJ5A 4EPVA 1G16A 2C9YA 4JVMA 1E3MA 4KITB 2ERXA 4PC2A 2ZE7A 1G19A 2J41A 3BH6A 4PHFA 2YWGA 2YOFA 3T35A 2UUCL 1HCZA 1CKOA 4BXXH 3DM3A 4JYAL 3B1YA 2R44A 2Y0SE 4ZV4A 3P20A 4A4IA 3GQBA 2JE6I 3S14H 1JR3A 2F9MA 2RGNC 3EC2A 3LD9A 5JWHA 3KYHC 1YR6A 1RYHA 5FBLB 1I2MA 2QRNA 4A0GA 4CIDA 1JBKA 1VG9B 3EZ6A 2WPDD 3JVVA 3AVTA 2FE4A 2B7CA 4AYBE 3RN2A 2QMEA 3UDGA 1E2FA 3B1WA 3LX8A 1KDPA 1YR7A 4G5RA 3F1ZA 2PLFA 1NN3A 4PZ6A 1U8ZA 3I2ZA 2IL1A 1M7GA 3EN2A 5CM8B 2VP0A 4V0OA 1HH4A 4EPYA 2ZU6A 4OHXA 4LF7L 3VR3A 4IRUB 1G3UA 1GHJA 5FOSA 4GZLA 1SVSA 3BBPA 2VYFA 4OJKA 3KOJA 5E7MA 1RRPA 5FTKA 4TMVA 2VP6A 2V1XA 3NC1C 3IDQA 1MKYA 1CTQA 4AYXA 4YMUA 3RDPA 4TT3D 2MO1A 1IOZA 3A7LA 2G0NA 3A36A 2BBTA 4YMTA 1E2VA 3W90A 1N0UA 1XJVA 4A75A 1E9RA 3EQLC 1MO4A 4OJQA 1WCV1 1V1QA 1VQGA 4LBVA 1VYTA 3UIEA 4G0NA 1KQSA 1YI2A 1OW3B 3M0EA 4B43A 4GOPC 1CTMA 3SGIA 1Z0FA 2N1BA 1NJGA 4F7WA 2OBNA 2KB0A 5E95A 3LVQE 3S16H 5IYBH 2HV8A 3GJ8A 3TUJC 1GG2A 3M4OH 2BIFA 3CM0A 4HZUB 5FL3A 2A6HC 3ZDQA 1XCPA 3B2EA 3LH5A 5IYCG 1ANKA 1CRQA 1SVOA 2HUPA 4V0LA 3PEWA 1NVVR 3RNUA 3NBZC 4TMTA 1KSGA 4RMFA 5C4XH 1HPCA 3QBVA 1TUIA 5F98A 5BW8A 3I3SR 4Q01A 4NB3A 1VPLA 3TSZA 2G1JA 2R6CA 2RGXA 4DBLC 3AVPA 4PC7A 4KN7C 1L1OB 2VEDA 2WVJA 3VR1A 3GTOH 1PA6A 1M8PA 1OKKD 3QY0A 4ACBA 2A19A 4YWKA 3OFNA 4DDUA 5IK2D 2V1CC 2E2JH 2XSZD 3PFIA 5KSZA 2ZTCA 2XNDA 4HIOA 4QIWE 1G3RA 1K5GA 1HZBA 1H9SB 3I92A 2ZUCA 1A62A 4HLUC 4B44A 2UXCL 1GFIA 1JPNA 1SVKA 1WXQA 4GBMA 3WNCA 4DUGA 3TW8B 1G4AE 4N0DA 4JG2A 3GEIA 1T5LA 3EPKA 3R9WA 3AF2A 4BBRH 4IFDI 4A82A 4LZZA 2QENA 1P2TA 2QROA 2JJ8A 4RCYA 5DI3B 3A1WA 2ZAOA 3IEVA 5EP3A 2ZRIA 1E99A 2GA8A 4HB4A 2ODEA 1MH1A 1QZXA 3A7AB 2DWPA 4URYR 4UNRA 1Y1VH 1JB1A 1YNNC 1G8PA 2C98A 3LWNA 4JT2A 4NE2A 2ZJOA 2AKAB 5J47A 2P6RA 2JJ1A 4E07A 4PO8A 4JI1Q 1OPXA 2FSIA 2QI9C 4X8MA 1VQLA 1X3FA 2J0UA 4GNXC 1NJIC 1WDTA 1X65A 5DHFA 2Q2TA 2F3RA 4LFAL 1W4AA 5ELNA 1NLFA 1KMQA 3K0AB 1F2TA 1DXMA 1NN1A 2K5NA 1IJFA 1P4SA 1NTGA 2BMDA 2EFEB 2PX0A 1KI9A 4P4TA 1GZSA 4Q9JA 4U5XA 4JI1L 5CLLA 2JLXA 3N5CA 2ZI3A 2OBLA 3UK6A 2B8WA 4B71A 3ZD7A 4C0SA 4JYBA 2C77A 2CK3A 4NHOA 1Q3TA 4CYMA 4BZXA 2EFCB 4BLSA 1L0WA 1N5LA 2GJSA 2BMFA 2NN6I 1ZD9A 4DR7L 4BFXA 4MRRA 2RB4A 1VCMA 2HT6A 4HB0A 3NG1A 4L8JA 2KCTA 2J59A 2ZRPA 4MYCA 4F4CA 1Q0UA 2FDCA 5JEAJ 1HR0L 1U99A 3MWYW 2VLIA 5FPTA 2F1IA 1YITA 1G41A 3QG1A 5BN4A 2JK8A 1DAHA 1FUUA 4NPSA 1SMYC 1SVWA 2G6BA 3L8YA 4EJSA 1WE2A 4HLUA 1VQEA 1R10A 3SI7A 2D5DA 1C9KA 3LNCA 4I99A 2JEOA 3I72A 4DSOA 3PENA 3FYHA 4IJMA 2WB1G 1XXHE 2QZ4A 3T34A 3WP1B 4NP6A 1UAAA 4A36A 4DUZL 2PMZE 3OFND 4A3LH 4F4JA 3LWUA 3K7UC 4NYJR 3GPLA 2E2HH 4BFVA 1BH2A 4V0KA 3KXLA 3BXZA 5K8TA 4TYPA 2CBZA 4B3RL 4IO9A 4HJ5A 2C9OA 1TEVA 1X1SA 5JHHB 2BE5C 3D3QA 3B1VA 2CHQA 3HP1A 3A4LA 1FP6A 2CWPA 3MRSA 3ZD6A 4A2PA 2KHJA 2FXQA 3CC7A 2N49A 2W58A 2QGQA 1B0UA 2QORA 1K6MA 5D3QA 4KLZA 2AKYA 4BLQA 1Z9FA 1JECA 4R9UC 4IOCA 2WAYA 1E4VA 1E1TA 2GEVA 4Q47A 4GNKA 2NN6H 5FPKA 1FPMA 2V7QA 1JJVA 2QAGC 2REOA 5KSYA 2VBCA 4BY1G 1KIXA 4LFCL 2VIIA 3WHLA 4RCZA 5IP9H 1XMVA 5CM9C 1JEDA 2WAQG 2DYKA 2GETA 1N6NA 3RS4A 4B3TL 1MOZA 5M3MH 1P62B 3KF8B 1I4DD 2GBLC 4QGGA 3WRXC 5DI9A 3O8CA 1XTQA 3JVUA 1T91A 2AD5A 2CLCX 2REXB 4LF8Q 2MQHA 2NZOA 1DG3A 2MSDB 3H1TA 2CL0X 1N0VC 4HIDA 1G6OA 4IDNA 3CPFA 3EBEA 4MA4A 4W5JA 4JI8Q 2QGNA 4HJAA 2IHEA 4KHPL 3OIUA 4H1VA 1N32Q 4O3MA 2GXSA 4HEJA 3T1OA 4JLOA 2FN4A 3NVAA 4JV5Q 3ZGXA 1RC8A 5GVSA 2A1AA 1WOCA 5IWAL 1LTQA 2FWRA 2MSCB 2XOKA 3NH9A 3QPVA 4BLPA 3FFBA 3J7ZC 4LF5L 1K5DA 1N32L 1QHNA 2JIZA 2D0OA 2O8CB 3GTMH 2Q2IA 1XB2A 1XEWX 5GVRA 3KQKA 1ZKOA 1P9NA 2KENA 1JI0A 1RE0A 3UMFA 4K0KL 4PQRA 2GWHA 1N6LA 2JLQA 1AA9A 5IK2A 3TRFA 2YKGA 2BA1A 3IQXA 6Q21A 4HJ7A 3AP3A 5H70A 1ESMA 1SKQA 3KQNA 3X1ZA 4EPXA 2K50A 1G7CA 1K73C 1RZ3A 2LMCB 3FMFA 4L5RC 2Y8EA 3GLHE 4M1OA 1CLUA 4ZCLA 3R7WB 1AQUA 1UM8A 1QZGA 4XD7D 3RWOA 4G7HC 2IX3A 3CX7A 4DLYA 4LNQA 3SBEA 4IW3B 5JEAG 3WBKA 4A3FG 4DDWA 2WKRA 4TSFA 3R8FA 3KJOA 1GRNA 5BYJA 3CCJA 1GAJA 1KI7A 1KZGB 1Z0AA 2C78A 2PZEA 1LW7A 1QVCA 2YWEA 1E9BA 4A3JG 5B58C 2QTVB 5F3WB 1OH8A 2CQOA 4JI7L 4OYHA 4NCNA 2AR7A 2FEMA 3ECCA 2QGZA 1P6XA 1N6KA 1G3MA 4TMWA 5FBVB 4KLNA 1T3HA 2H5EA 3FMOB 1PH8A 3C5CA 3GJXC 4FI3C 5BN5A 3IFTA 5JECA 1VCIA 1MRSA 1UE7A 3C8UA 4D80A 5SZHB 4R71A 5GJBA 1FGUA 4R4IA 3STBC 4MZ9A 2G0TA 2QUZA 3TUZC 4GNXB 4H9GA 1EYGA 3CLVA 4UXJA 2NVXH 4DEXA 3D0FA 2G1KA 4M22A 3LBIA 1WYDA 5J4KA 3VKGA 4LWCA 1HZ9A 3OE7D 4IFEA 3W8RA 4D4MA 1P16A 2WFWA 3FMCA 4PPFA 1S4QA 2LKDA 3IHLA 5KSOA 1YBYA 2VS1A 1CUKA 1NBMD 4JMPA 3CO5A 3PSIA 2QE7A 4PSAA 4XVRA 5K8IA 3I5YA 2I5LX 1T3SA 3E9HA 4XTRA 4EPTA 4HAUA 1X56A 2KBFA 2XZOA 2QL6A 4Q4AB 3TQYA 1X54A 2EFGA 4JBKA 1XMQQ 3CMEA 1RYFA 2O0JA 1KI3A 4CZ2A 4TYQA 3MG9A 4NYMQ 3VU9A 2Z6KA 5L3SB 2O8DA 2VF7A 2E1RA 3UG7A 5JJLA 2VQSA 2PPBC 1TL7C 2HCBA 1GDDA 2YOHA 4M9QA 1N6IA 3HYRA 3QKRA 2C2HA 3O47A 4QHSA 3SE0A 2A68D 5E7IA 1EQRA 2VHCA 1CXZA 1AGPA 2RGGA 1IN5A 1OYWA 2NZ8A 2Z4RA 1Y1WH 2K14A 1VYVA 4FXPA 5EE1A 4B3DA 4DT1B 1X6OA 5CYOA 1PJRA 3ZVNA 5KYKA 4JI2L 2IXFA 2YYZA 4HAWA 1G3QA 5HZKA 4EDHA 3SNHA 2H1LA 1H8EA 5FH9A 1AZSC 2VQFL 3BFVA 4ZCIA 4B3ML 2D4HA 1Z29A 5K8UA 3CF0A 2GF0A 3UMRA 3GTGH 1NMFA 4NYIQ 1MJCA 1CKEA 1W48A 4C2MH 1ZYUA 4DR6L 3QKTA 3WRYC 2V55B 1N34Q 1GSIA 2XNDD 1M6NA 4A3MG 3CAMA 4C3HH 4DK3C 1VQDA 3HOVH 4OX9L 4DV0L 1DAEA 1E0JA 4UY8C 4QJ4A 3BE4A 3IBGA 3STBD 3RSOA 4Q4JA 1PV4A 4Q4JB 3WY9A 2W2XA 4YMWA 4DK6C 3CCMA 3T1YL 3K0FA 4M4SA 1E2MA 3TE6A 4V0NA 1G51A 3B5JA 4PHTA 4UXIA 1FNNA 4NXNQ 1E2DA 1DAGA 4LYJA 2QA5A 1LF5A 4F91B 1R8QA 4DDVA 2F6RA 4LF4L 3A8TA 2GTPA 4B3RQ 3U61B 5JWOA 4ERNA 4DR1L 4MGKR 2J3EA 4XWAA 4M0LA 2B21A 2BC9A 4Z51A 1VECA 1XF9A 3EPJA 1LACA 1UE6A 1VQFA 4CEHA 3M4YA 2R6FA 3LQRA 4IVRA 2R2AA 4ASUD 1V5WA 4PQFA 2H18A 5FI0B 4A3KH 1E98A 4YMSA 1XJQA 4JSTA 1XP8A 2ZREA 3HU1A 5G53C 4CRWB 2JLVA 3R9IA 4M9SA 1S72A 1NY6A 1EWRA 1W0KA 3M9BA 3NWJA 2ZYVX 4LF5Q 3FOZA 1UBGA 5D3MB 3HOZG 3V4FA 1II9A 4C3IH 4Q1CA 1GOTA 4C0LA 3LW8A 3T15A 4Q7LA 1KC8C 1PHJA 3B60A 1ZCAA 4RZ3A 5JJIA 3B1XA 1MR3F 1UDWA 4R7ZA 4LJ6A 4TQAA 3CPWA 1W5TA 3KDSE 4AIIA 5FR2A 2JQOA 4GT1A 4LHXA 4NBSA 4NH0A 5TY0A 2IHFA 4C9BA 3FFAA 2JA1A 2KI5A 5C1BA 3HJNA 1PH7A 2VO1A 3RS0A 5EZ6B 4LJYA 4DPGA 1FP7A 2J46A 4TTPA 3T06B 2O8CA 1B70B 1YVCA 1YZNA 4OQNA 1D8TA 1CKNB 3F5FA 3SFZA 4LSGA 3LAWA 1HURA 2ODBA 4ILEA 3A1SA 4JBYA 1CJVC 4KKUA 4P71A 2ZRMA 5CYPA 1T5IA 1D8LA 4DV2L 1CKMA 2DNCA 1Y8NB 3AEVA 5AJXA 1K8OA 4PZ8A 3FMPB 1OSNA 4I7ZC 2MFIA 4PG3A 4RFSA 4DV6Q 2RAPA 3HOYG 1Z8FA 3AH8A 2ZTEA 1GJXA 4LHWA 1S2MA 1PYBA 2NO0A 4G5QA 4NCJA 4OQXA 1QUQA 5EE3A 3U9SA 2UU9Q 1DG1G 5K36H 5JLJA 3GLGA 1N9WA 1ZNYA 3DOFA 3IEUA 1TF7A 1HNWL 1X3SA 1ZUNB 3NXSA 2GAAA 3UWOA 3THWB 3F2CA 1EQQA 1I4TD 2XJ4A 2IUTA 4C0HA 2NO7A 4A3BH 2YTYA 1HQCA 4LJ9A 3CZQA 4KI0A 1Q86C 4HR7B 4S35A 2P0EA 3JC66 2HYDA 4IVPA 2GRJA 2IA5A 2ZJ8A 1KO1A 3D6TB 4DLSA 2IX0A 4C2TA 3IGFA 4E22A 4ZKEA 1ZUHA 2A69C 2FPKA 2OUKA 3BU2A 2BDOA 4IOLA 1CU1A 1H9RA 4OHZA 1KL9A 2HJGA 5BXQC 1KOFA 4URUR 521PA 2JLRA 2GXUA 2PT7A 1DAMA 1FTSA 1XRJA 4DK1A 4B3FX 2VQFQ 4BLTA 1ZC3A 5IP9G 4G1UC 4B3MQ 1KJWA 4MRNA 4ESHA 1WQ1R 4JBXA 4JL5A 4LF9Q 3AF4A 3AUXA 3E9IA 2G3YA 4IPCA 2JEBI 1CJTC 3NEYA 1N0WA 3KLWA 1LY1A 3K0XA 1QG2A 2NO1A 4HAYA 4AKGA 4A9AA 1US8A 1NG1A 1XJ0A 1YEZA 4Q7KA 4MDFA 5UKDA 1D7QA 2IXEA 3KDFB 1JJ7A 1Q20A 5GADC 2W6IA 2GZDA 4I1UA 4NCKA 2BOVA 4B2LA 1EIYB 3RWMB 1W2BA 4UKDA 2D06A 3WNBA 4UP8A 4AG6A 2A6EC 4RY2A 5LB2A 4A8JC 2ORIA 3QF4A 3AUYA 3EZ2A 3BD9A 4LJZC 3KJGA 1YJ9A 5FL7D 4HAXA 1EXMA 2C35B 1AM4D 3CPHA 5DE3A 1Z6GA 3JZAA 4BFSA 1KO5A 5E7JA 1I5FA 1Z2CA 1SXJC 2R92G 1UF9A 5JHGB 1YE8A 5JBQA 1P9RA 1WFQA 5JWRA 3W3ZB 4A93G 3TR5A 5KPJA 4D4LA 1JR3E 2BA0A 5DLQE 1YNJC 2CCJA 4TLBA 3TH5A 8OHMA 4CEIB 3AVQA 1UDXA 3ZIAD 2ZJAA 3K9LA 4Q9LA 1P9WA 1ZW6A 3S1MH 2EU8A 4UNSA 5GROA 3MWLA 4OI1A 2KE5A 4TMXA 1Q22A 1DVRA 1F2UA 2ECKA 2WJGA 1G7RA 3EC1A 1CRPA 2QRZA 4FCWA 1XEFA 2OAQ1 4OI2A 2BEKA 2VUMG 2ONKA 1WBBA 1DARA 2CMKA 3LVRE 3W5JA 1RIFA 4WOPA 4BQSA 2O5IC 3B85A 4IOJA 1R8SA 3P4XA 1XPUA 3AEZA 2PNHA 5DISB 3A8JE 5KNCA 4GZYC 3S1NH 3N70A 5AJWA 4IFBA 2IYQA 1OXSC 3U2QA 1JNYA 1XJCA 4TT3A 4CEJA 3U7FB 3CRLC 1CIPA 1E9DA 2B92A 4QGHA 2A68C 1RPZA 1BMFD 1IHUA 1FZQA 3BJUA 4GS3A 1Y14B 4RD4A 1Z28A 3B8HA 3RAPR 1E2GA 2HF9A 3I8XA 2L15A 3A4MA 1OTCA 2V6JA 5IYBG 3JZMA 1M7BA 1N5JA 4CVNA 3AM1A 2VZAA 5DYIA 3PUXA 4P73A 3HU2A 2N8NA 3H0GH 1E96A 1DD2A 2QU8A 3K7AH 5M3FH 5JJKA 1XXHB 5DGXA 4LF6Q 4AIMA 1DE0A 1WP9A 1A63A 4O2RA 4DV7L 4JI7Q 1ZU4A 3QG5A 5C4XG 4IKEA 4WW0A 5TB5A 4JLJA 1W46A 4D0GA 5J4VA 3CRKC 4BBRG 2UVQA 1X1RA 1YZGA 2ZQ5A 4A93H 2EJMA 2VH5R 4C30A 4JI4L 2ZETA 3ICQB 1LFDB 5JFGA 3Q3JB 4JLDA 3RZDH 2R8RA 2F43A 1E0KA 3IHWA 1GUTA 1PLKA 4GOKA 4TZ6A 2HLDA 3VX4A 3GJ3A 3AKDA 1Q1BA 4AURA 1O7LA 4WBSA 5P21A 1XTDA 1DPFA 5D3MA 1A2BA 2K33A 3SBDA 1YVDA 4YLGA 1FX0B 4LYAA 3RNLA 1YZUA 2DFLA 3WYAA 1HQMC 2D0PA 1VHTA 4IDHA 1Q81C 1QG4A 2KWIA 4MH0R 1TUEA 4M9ZA 4MKIA 3D8BA 4HIKA 4OQLA 2P5TB 1PH2A 2PH1A 4TLAA 5FOXA 3RRYA 3ZIAA 2W00A 1DELA 3AGQA 3GMTA 4LBZA 5ANRB 4D81A 4H44C 5C0XH 1AIPA 1NLYA 2C99A 2FGJA 1G8GA 2ZRFA 2GVZC 5JEDA 1H9MA 5KDDA 3A5ZB 2XNSA 3RS2A 2UUAQ 5CLQA 1W0JA 1KYIA 2TMKA 3OW7A 3QJYA 2ANBA 1OLOA 3PUZA 1QDEA 2RGAA 4UQOA 1NKSA 2AUJD 2Q8IB 3GLHB 4MITA 3AVXA 2R7FA 4LGMA 4NTZA 2J87A 2ZR7A 4Y0AA 4D0NA 2WAQE 3EWSA 3KZ1E 4A0HA 2XTZA 4LOAA 3H86A 3OESA 4B75A 4HDOB 4Z8YA 1OF1A 3PIPA 5AUPB 2C03A 1CR2A 2VP2A 4TSFD 5EJEA 2BBSA 2A2ZA 1AN0A 1Z0IA 3W3AA 4L4UA 3TKLA 1BDOA 3PO2G 4KHZA 4O2DA 3P26A 1NY5A 4Q7JB 4EQ6B 2N3SA 2QT1A 4BFTA 3EX7C 5M5WH 3CRVA 3H94A 3WHKA 4TQUS 5IRCD 4L9WA 4DEYA 4KKTA 4BECA 3A8KE 2ES2A 3G82C 4GOJA 3H4MA 4DLTA 1NKTA 1YZQA 1ZNZA 3FPAA 1JXMA 1VCNA 4IFDJ 3FHOA 3S24A 2J7PA 1IXRC 1VIAA 2ZJ5A 1OB2A 3VR4A 1TXYA 3J80i 4H1UA 4JI0Q 1NIPA 1X8KA 2YVUA 1PMRA 2H5XA 3U60B 1Y69U 3MCAA 4TYWA 4AKHA 3FWYA 4L16A 1J70A 1ELOA 3UANA 1CS4C 3T1VA 2CCKA 1TU4A 1P2VA 1LNZA 2FFQA 1JE5A 4KBFA 4Q02A 4WZBE 1EX6A 4IXMA 4LDJA 3CW2A 3OYYA 3DEFA 5CB6A 1YIJA 4DV5Q 1OB5A 3GLGB 2H16A 2P2LA 3UE1A 3AYHB 1HR0W 1Z0JA 2C04A 3P32A 4JZKA 3EPLA 1ZMXA 5FBWB 1VQPA 4G7OC 4QL3A 3WWVA 1D9ZA 1T4GA 1DAKA 1E2PA 4HZUA 4B47A 4GLAC 3CC2A 2VW9A 421PA 3U3JA 5E7NA 1E9SA 1DOAA 3LO5A 2JA5G 1KHTA 1US8B 1N6HA 5B2ZA 4YWLA 4JT4A 1OFUX 4QQBX 1I4LD 1XTJA 3MMPA 4PAOA 5EAYA 2HLDD 3QKSB 1VKJA 4X8LA 3ADKA 4JL6A 4R4QA 2CDNA 3MUFA 2A8VA 2JLYA 1Z22A 1KSHA 4IPDA 3KXKA 1OH5A 1H9SA 3SDZA 3WMGA 3OEEA 1KI4A 4ZDWA 1MABA 4RFVA 3KKQA 1Q44A 2R92H 1TQDA 4M21A 1MV5A 1TAGA 1U90A 4JBWA 3X1DA 4K8OA 5CJPA 2KHIA 4LUVA 2G9NA 5J4LA 3GTKH 4WVFA 2NVQH 4X62Q 4DUYQ 4HAZA 1U8AA 3AV0B 3QXCA 3P1JA 4WXRA 1X8JA 2OCYC 1WI5A 4CGZA 1U9IC 3RYTC 2FU5C 2AXNA 2ZSBA 3KUDA 3GDEA 2BVNA 5A35A 3N2IA 4V03A 1G4UR 821PA 4F93B 4IQZA 2O8FA 4Q4HA 1GHKA 4JBMA 5EP4A 4QXAA 2GCNA 4DUGD 1UJ2A 3CW2C 1R0YA 3FTQA 2ZJRA 2FF7A 4ON9A 3OEED 2F4VQ 5FPYA 1KNQA 4DSNA 2CNWA 4FCVA 3TJZA 5JCZA 1A1VA 1C0AA 4MGYR 4Q4AA 1AKYA 1TU2B 1IN4A 5FUYA 1E9FA 3THXB 3P27A 1BBWA 4MRPA 1X8LA 4GFDA 3GLFA 1FNMA 3VNVA 1ZCBA 3QKUA 1VG0B 3AFPA 4HLCA 2ZRCA 3SZRA 3VNUA 1QVFA 2H92A 3Q5DA 4GP6A 3AVUA 3AVWA 2RMKA 4A0RA 4C4PA 3CF5A 4B74A 4A76A 3K0FB 1FTNA 2CE2X 2CW0C 4KLKA 5TV2A 2R7ZG 4BFYA 5HE9A 1E2HA 2YHSA 2GK7A 4URWR 4N0EA 2X8AA 1RJ9A 1XMIA 2D2FA 1G5PA 2R6GA 1L4UA 1Q1EA 1YJ5A 1JT8A 2LXJA 1GUGA 2AWOA 3KF6B 1D2NA 1II8B 2Q0HA 2FGKA 1W5SA 3MD0A 4HATA 4IFDH 2HXSA 4JJZA 2IY5B 3FKIH 1N36L 4OWTB 3DL0A 2VP4A 3SS8A 2ANCA 2PCFB 3RRNA 1OHHD 2XSZA 4JOIC 1G7TA 4RZUA 3FHTA 1IBLL 4PC6A 1GUOA 1MRNA 4OO1G 2AD1A 3W5IA 4D0LB 2OTJA 4MGIR 5C0XI 1O3YA 4RKFA 3GLFB 5SZJA 4K0KQ 1IBKQ 2DY1A 2DFNA 2HCJB 5AJVB 3K70C 3RZOH 5KPDA 4M1KA 4R4CA 1IJEA 3K80C 4PFSA 5AUOB 1J99A 3U4ZA 4CT5A 5KTYA 2H57A 4BEJA 4KN4C 3PQCA 5CK5A 2XJ9A 3G6EA 5EXXA 1WB9A 3AVYA 4GOXA 1N6PA 1JJCB 1VQBA 2YJTD 2ZU0C 3OTOL 2ORVA 4JV5L 2BBWA 3CBQA 3GEHA 3BG3A 1G64A 2D7CA 4WAUA 1FQKA 3GJ0A 3RHFA 4FMCF 2BMEA 5B57C 2WJJA 3U3RA 4MKGA 4DV5L 2Q2HA 3BGWA 1I6VC 2IYZA 1IYVA 1IY2A 1ZIPA 2CHVA 3I73A 2JA7G 5CITA 2IHYA 2OFOA 4RZ2A 2BM1A 1H9KA 1TWHH 2CL7X 4D4JA 4DHEA 1Z0KA 5FUVA 1V8QA 1NBWA 2AHOA 3KFXA 4F92B 3G71A 1W3SA 2RGEA 2UUAL 2BKEA 1UFQA 4NU0A 1GKYA 5JEEA 2F1JA 1KAGA 4Q21A 4JOIA 4NXMQ 3NELA 3QOFA 2W83A 1EFTA 3CF6R 4LBYA 4LPSA 1T0HB 3TSOA 2JEAI 2HJVA 4D82A 4XSHA 4PQYA 4FW9A 1AGRA 1GRQA 3A1VA 1PH3A 4Y0VA 2EW1A 3EIHA 1XCGB 1CULC 2ZJQA 4HDQB 4Q9KA 2N78A 4UNNA 4POFA 3A58B 3ZJYA 1U8YA 4GRAA 2OM2A 3RLOA 3BFKA 3THOA 2GJKA 1SVMA 2WOJA 3OIVA 3LLMA 4LK2A 2QY9A 2IYYA 5F9HA 1E2WA 4RCNA 1QHSA 2J7KA 3X2SA 3J81c 2PQAA 1E6CA 1HT1E 4LC0A 4JCVE 4JBJA 1HZCA 1KAWA 4HJ9A 2GXAA 2XTIA 1KDRA 1C4OA 1VG8A 2QM7A 3MXUA 2XZPA 3BIFA 3M1IA 5TDHA 3V9PA 5HR5A 4TYNA 2H7VA 4OI4A 3THXA 4LF6L 2QAGB 1JB7A 1N5IA 1XTKA 2K52A 3MGCA 2JLSA 1OIVA 2SHKA 3RSLA 2QMUA 1I94Q 621PA 3J7A5 2GESA 1QHHB 1T8UA 3A8IE 2E5LL 1MO6A 4P31A 2VA8A 3EW9A 3B78A 4LF8L 5FBQB 4YONB 1R0XA 2WAXA 1EWHA 4MNOA 3IKJA 5G40A 3CP0A 2DUDA 4DV1Q 1W47A 2NPFA 1GL7A 3AF3A 2QMOA 2K4KA 3C5HA 3LQQA 2KSQA 2QSYA 1AH9A 5IP7H 2XTMA 4KSBA 4A2WA 4GOPA 1DS6A 4OBEA 5KOYA 3R9XA 1XD8A 3OW2A 4LFBL 3SR0A 3T61A 5KDOA 3VKHA 4C2UA 2J0UB 3LBHA 1XX6A 2OXRA 5ELXA 1X55A 4PAQA 2W6JD 4YXWA 4AH6A 3A5UA 2I3BA 4EQ5A 2R93G 3K1JA 2ZR0A 3HOZH 3GJ6A 5HZHA 2CE7A 1N33L 2HHHQ 2IF0A 4A3EG 4GNXA 3CD6A 3UMSA 1QJOA 1RRGA 1TQ2A 4PZYA 3NENA 3W6PA 4Q1BA 3TUIC 4Q03A 2GEUA 1KI6B 2QSZA 4WXPA 4PV1C 1R0ZA 4OQFA 3ADDA 2NMVA 2O0HA 2WWFA 3KB1A 5GADl 2OQ0A 2B8GA 2GBLA 3KFVA 1FMJA 2NVTH 4A3MH 2VUMH 1Q57A 3AB3A 3BH0A 2VSXA 3AB9A 5FPHA 1T0JB 3LY5A 2GILA 4M1YA 4L8GA 4MYTA 1GUNA 4DXAA 4MUAA 4WJ3M 1SQ5A 1HNZL 3PR1A 5DN6A 2AKWB 2C96A 3NEMA 4YXWD 1X3GA 1F2TB 4B32A 1HV8A 2ZS7A 4NCHA 3I7FA 2UZ3A 2D3WA 3VHLB 1PYSB 1XMQL 1IM2A 1UADA 4LFCQ 2OCEA 3H0GG 1AE2A 4I4LA 3B82A 3VKWA 4BFZA 4DR6Q 3O8BA 2W0MA 1ZM2A 3BB4A 1HNZQ 2QP3A 4IPHA 3OTOQ 1PVOA 3OZXA 1IN8A 2HT1A 2D2EA 1U0HC 2ATWA 4MKHA 5C3EH 4TL7A 1Z6HA 2CJWA 1Z07A 2ZJYA 2IW3A 2UXDL 4NMMA 1C7YA 1NMXA 4A3EH 2WIAA 1NMYA 3I8SA 4ARZA 4TKOB 4A15A 2FV8A 1KJZA 3TEHB 2ZRLA 1KD1C 1IZ6A 3PEUA 4MYHA 1UWVA 2YTVA 2WJHA 4GP7A 4TWZA 4BLRA 5G41A 3BC1A 1KSFX 1ZM9A 4D4KA 3CZPA 3KJEA 1E1QD 4EJSB 1CR0A 3HOXH 1RRCA 1ZIOA 3A1UA 4H0LC 3SYKA 4V0ME 4B3GA 2GCOB 4C0KA 3ZLJA 2EFDB 4DCVA 4ZKDA 4A3DH 3LX5A 4LV6A 3QXSA 1P60A 3EZ7A 1LS1A 1GO3E 1NF3A 3C15C 1G5TA 5J40A 5DSZA 4ZIRA 1XMOL 2OSBA 2OILA 2IUUA 2R7ZH 1YZLA 4B35A 4Z54A 1Y8OB 1NY4A 4DR5Q 1TX4B 4GN4B 3B9PA 3ZQ6A 5KO2A 4Y52H 1A7JA 1CBUA 4U02A 1SMXA 3PV0A 1NSFA 1XEXA 2PZGA 1GL6A 4C3JH 1MO3A 5JI3E 2ONJA 4AG5A 2EWVA 2JIZD 1VG1A 3ZYCA 2A5GA 4MRVA 1E79D 2D7DA 4M2LA 2CJWB 3U7EB 4FDBA 2AFHE 3N2EA 3S1AA 1LTLA 2JJ2D 4KFTA 3NBHB 4FD2A 3X1YA 2E87A 1ZD8A 3BB3A 1OH6A 3PO2H 1Q12A 1E2IA 1E2NA 2ORWA 2QPOA 4UNQA 5LD2B 3AKCA 4IJLA 1G3IA 4HB3A 1VQIA 2OFWA 4DNRB 3SU8A 1J5EL 5AJ3L 2UU9L 1E9AA 3T1TA 3RC8A 4GSYA 4AI6A 5HY6A 4PPGA 4JLMA 1KSJA 2AK2A 1NN0A 2FZLA 1HNWQ 4NL4H 4LJ8A 4AD8A 1TWFH 3E1SA 3OPOA 1MT0A 3MEFA 2WBLC 4QBHA 5DNYB 5A4JA 3ND8A 1Y63A 4ZIRB 1TF5A 1FUKA 3L8ZA 5CIQA 2GAOA 1S0UA 1KGDA 3QENA 3A0JA 4EPRA 2WKPA 4WZAE 3FGNA 4EKDA 2QBYB 1H9JA 4TTRA 2FSGA 1ZUIA 2ZROA 3PVSA 3LW7A 3CCLA 2GJ8A 2VTKA 1YRAA 1VS0A 3NBYC 3QXHA 2JA9A 2QEXA 1UE1A 4JK1C 2JDID 2VHQA 4NZYA 2OWOA 2H8KA 4BLOA 2ASEA 1QVGA 4PZLA 2UUBQ 2IYLD 4P32A 1FX0A 2O8BB 3PXGA 4HLDA 2VQEQ 1EX7A 1Z08A 5J5CA 2GVBA 3THWA 2ZRBA 1SRUA 1G8HA 1QF9A 2GN5A 2ZTDA 3C16C 4FN5A 4LV8B 3LA6A 3U3MA 1GKUB 1G6HA 2WWHA 1EUJA 1IBMQ 1BIFA 3RLNA 3HPRA 3HKZE 2XB2A 1FYCA 4B3SL 4HUTA 1W2GA 1VQOA 2EXDA 5BR8L 1VQNA 3DMDA 1Q46A 1XNRQ 2IHBA 4JLBA 3UXMA 5H1SE 2WIBA 2IYXA 3FMIA 5FTNA 3Q8DA 2MMCA 4BRUA 3FHWA 1KRSA 3CCRA 2WB1E 1IBML 1RFLA 4Q1AA 3SJCA 1LF0A 4UJ5A 1ZM4A 1GUSA 4MUBA 4OI0A 5LMUL 1TWCH 1NSTA 2J45A 4PPNA 4TN1A 1L1OC 4GKKL 1Z6XA 2JA7H 3B7GA 1QVRA 3K09A 1XNQL 1FJGQ 3SJAA 2OCAA 1BBUA 3M4PA 4RD3A 4LF9L 1D2EA 3OAAA 4XWOA 1GWNA 3PJRA 1TWAH 1ZVQA 2PBRA 4RJLA 1J6QA 2HXYA 2CK3D 4WIAA 4HB2A 5JRJA 2W2TA 2ZI7A 4E09A 4DIEA 2ZI9A 2ZM6Q 2DBYA 2V9PA 2B29A 3DMNA 3ND9A 4JLNA 4GOPB 1IBKL 4IFDG 5AK0A 1OV4A 4Y7NH 4P4SA 4D2IA 2L5TA 4BBSH 3NDPA 3MJRA 1WF3A 4RD0A 5G3YA 3GFPA 5GJWC 3T12A 3QNUA 1AKEA 4HZIA 2Q3MA 5FUWA 3BWDD 1Q3HA 2DHRA 2YINC 1P8LA 2K75A 4GLVB 2K5HA 5FTJA 4GDFA 2WWWA 4A6PA 5FJ8G 3DOEA 4WA7A 4ZDIA 3I62A 5EE0A 5HKKD 3AKYA 1MABB 1A4RA 1U98A 2NIPA 3BERA 5IT9c 4BA1I 2ZYUX 4AKEA 1EFRA 4JKYA 2VSFA 4B3XA 1RRFA 3O8DA 3I4NG 4IVQA 1HT2E 1E1RA 3QKRB 4KJZA 5M5YH 3PUYA 2BCGY 3QQ5A 3MAAC 2QP4A 5FFMA 4LJAA 3KFUA 2X77A 3RS7A 2CVHA 3E2IA 5M3FG 1GVPA 4PHHA 2VP9A 2HHHL 1G7SA 3UDIA 3QBTA 2Q6TA 5L3QA 1W36D 2J1LA 2NVYH 2OTLA 2QP9X 2IK8A 4FMBB 2DFKB 3FDIA 2F1MA 3EZ9A 1AJEA 1L8QA 4P4SB 4I1VA 2PI2A 3TAHA 1O7IA 1NMZA 3VX3A 4QHTA 4DUZQ 2CVFA 1ZU5A 4PAMA 3CRMA 2IEYA 3K0AA 3VU9B 4URXR 2GK6A 3TVDA 4TYYA 3DLLA 1VQ8A 3QF7A 4POGA 2MSEB 2OCPA 4KO8A 3ZVMA 3HGBA 4IEIA 2JXMB 1GILA 4NYIR 4Q9IA 3BOSA 4XSGA 1NBMA 4C7OB 2KCMA 3AFQA 2FPMA 4MQBA 3CRRA 3RC3A 1U2RA 1JMCA 3CWQA 4FCTA 3GLFE 4H02A 5C3EG 4JI5Q 1GM5A 4DDTA 4X64Q 3A4NA 3WDNA 5KNBA 1KKMA 3PUVA 4DK0A 1GNPA 4QRHA 5IDVA 1CJKC 1ZM7A 2BV3A 3TLXA 4A3IG 1SKYB 3FKSA 1COWD 4JKIA 2IUSA 4A3JH 4DT1A 2GZHA 3QUSA 5DIFA 4FWTA 1LUZA 2IS2A 2K5UA 1G20E 4X64L 1B9MA 1VIYA 3F8TA 3HOWG 4XIGS 2O8FB 3V4RA 2XAUA 3KF6A 4UPAA 1SR3A 1L2FA 4PC3A 2NTYC 3GTLH 4Q1EA 2R65A 4OL0A 3BORA 3VQTA 2JLZA 4DC9A 4A3IH 3T5GA 4KMUC 2QTHA 5FPSA 3HR7A 3S1RH 3GEEA 1FW6A 1XWIA 3VAAA 1YHNA 1EFUA 3S1AB 1FVIA 3T1HL 3I4MG 3EWAA 1PH4A 2AX4A 2OG2A 3ASYA 3VA7A 3C4JA 4JL8A 4MRSA 4IDOA 1TTTA 2CHGA 1T3LA 2IF2A 3BRWD 2FA9A 3EPHA 2ID0A 1BVSA 4KFUA 1EFHA 3CCEA 2A5JA 2WWGA 3MSXA 2A69D 2Z83A 3ETLA 4NPHA 1EK0A 1IY1A 3JAMc 1XXHA 1A8VA 3DKVA 1RJ9B 2QQEA 3BZKA 4OWXB 1E2EA 1P3JA 1YHQA 5KDLA 4PHGA 1DADA 4YMVA 3THYA 4IPGA 4LJ4A 1CR4A 2E9SA 1G18A 3CMAA 2GCPA 5LMUQ 4PO1A 2YWHA 4LJ7A 4W9MC 4AQYQ 1NMGA 1O87A 2J0SA 1E2QA 1KDTA 1PH5A 1UEJA 2ATXA 2VP5A 3NE5B 2VPPA 2WJIA 2YC2C 3I4NH 1NIJA 2A30A 3RVBA 1OHHA 3NEJA 4Q18A 3L7ZC 1OKKA 2Q3FA 1WA5A 2BKUA 3Q5EA 1VQ6A 3B6EA 4DR4L 2JAQA 3HFZB 4WJ4A 2IEZA 1JAIA 2ZXUA 1NNEA 1VTKA 3LRPA 1WBDA 2VSOA 1KKLA 2FFBA 2ZVPX 1FFHA 3B13B 3U50C 1W4RA 2O0KA 1Z0DA 4M1WA 2H17A 2ZJZA 1PUIA 4RFSB 3B9QA 3IO3A 2WJYA 1H8HA 3C14C 4Q5IA 1EGAA 1MO5A 4RKEA 4XH9B 1G1MA 3ZZTA 4LUCA 5FTLA 1N2CE 4P75A 3TBKA 2X2FA 2ZTSA 5HTKA 1F3OA 4QBIA 2HYIC 3K9HA 1OXUA 1E22A 3IUYA 4IXNA 5LDDC 4FIDA 3SQXA 2ZR9A 4AYTA 3D7MA 2ZE5A 3Q9LA 2YTXA 1U5KA 2BM0A 2PX3A 4FMDB 3QIAA 4X8OA 1E0AA 4IHQA 2ZUBA 3BH7A 3I55A 3HOUG 1S1CA 4HYYA 3K81C 4GL2A 3UWKA 5M5XH 2A5YB 4HSEA 3NKVA 3WP0A 1N34L 1EWQA 1K83H 3ULLA 1QHXA 1XBTA 2ZEJA 3PEYA 3C7KA 1NBME 3NDBB 3ICEA 4Q1FA 1W1WA 1KAOA 4NDZA 4UJ3A 4XJXA 3A74A 1YQTA 1M2OB 4YDSA 4QJFA 1UKYA 2ERYA 3AQ4A 2EIFA 1HYQA 5EZ5A 2Z5FA 2O8BA 1VMAA 1W44A 3EZFA 4EIWA 3A1TA 4R98A 4Z1MA 3RRZA 4OWWB 1TKWB 5EE5B 2PEYA 5FI1B 2C95A 2ZRNA 4W5WA 3R7WA 4JI8L 3SQWA 1FL0A 2PI2E 2CCZA 2UUBL 1H95A 5G3ZA 2WM9B 2VNUD 5C0XG 1ZM3A 3H3VI
chains in the Genus database with same CATH superfamily
3I56A 3E03A 2RGWA 3NBIA 2BGTA 1U81A 3OZUA 5F1PA 5IKXA 4D96A 4WKNA 1AS3A 8GPBA 1XL0A 2ZWVA 3CRQA 4A3GH 3V00A 4U7WA 5KJCA 1RLOA 5IY0A 1GRCA 2OGZA 4ABYA 5SV2A 1DL5A 2RKOA 1C30A 3AF1A 2ZXEA 2V58A 5AXDA 1II3A 3JAMA 3S2EA 3C24A 5IGFA 2W7TA 4I55A 4ZP1A 5DK6A 1JLLA 4BZPA 1Q3KA 1VJTA 2R92B 1W0JD 2C54A 1P2GA 3GGPA 5EXEA 3VHRA 4BC0A 4EGQA 5ALVA 3MVEA 4TZKA 4EF4A 3IAM1 1Z82A 5AK4A 3JAMi 1ZD1A 3BF7A 1UJ6A 2H0QA 4CV0A 1O9BA 1YCGA 1U0LA 2ZRKA 4KODA 1KI6A 1PTOD 1H1DA 1YHAA 5DJ5A 2WPDA 3DR3A 2CLLB 4D9IA 5BNIA 5JSUA 5T67A 3KB2A 3B48A 3CEAA 1U7PA 5AJZA 4D44A 2YU9H 2UXDQ 1NJ8A 2HMYB 3AR2A 3GELA 1O8BA 1MW8X 3GTJH 3MIZA 4B40A 5KIXA 1YJXA 1DO0A 1RL2A 3RVJA 4ZREA 3OUUA 1G8MA 3JVEA 1R9TH 2FUEA 2B8TA 1BOFA 1UE5A 5JO9A 1SNPA 3I2FA 3HUFA 1Z2EA 3WGTA 3SOZA 4BVAA 4QXQA 5JC1A 3MCUA 4ASUA 2JIBA 2E2IB 4OO1H 3IUMA 4C21A 7REQB 1DKRA 1JW9B 4FGKA 4WJWA 3M3HA 1I4PA 4P0TA 3ZCTA 4AS1A 2IOQA 1D6EC 3G5AA 3LA8A 3T7DA 4CMIA 1S8FA 3N52A 4O5AA 3PO3H 2EBFX 4OA5A 4F2WA 4QG3A 3OF5A 5FOTA 4FNAA 2QQ0A 3CZAA 2AJ8A 3RVMA 4BV2A 1SIOA 1T3ZA 1TEZA 5GJVC 5LM3A 3GF4A 2XV1A 4KREA 1KA9H 2YL2A 3RSHA 4O4HF 1S3FA 4MKFA 3IVRA 2AOWA 4HI0E 1JORA 5LA6A 1U2ZA 3J80L 2IXGA 4IHKA 1L7RA 2ODNA 1NMSA 4LISA 4W6QA 2JGLA 2OCKA 3A9VA 4N9WA 5H3LA 5HF8A 2VYVD 2ALJA 3UN1A 4WLFA 3HWRA 1NP6A 4XVHA 3REOA 3X43A 3F2VA 4Z53A 4H60A 3ASZA 5K51A 1ZC4A 2ACVA 3BAFA 3BS4A 3T9FA 5L8VA 1QZUA 3QHAA 3KTAA 4AYWA 1S5DD 1BXZA 1RVV1 2C5BA 2OHXA 3K32A 1P72A 3H3VH 4XDGA 1ZXXA 4MGEA 3OLCX 2P9BA 3IO5A 3PIP3 4RV5A 5DHUA 5JS7A 4QYSA 1ULZA 3BZCA 4LYFA 1J8MF 3GJYA 4EIWA 5JO0A 1I4HA 1V11B 1U0NA 3CLRD 4K6DA 1XD2B 3RJZA 4K2KA 1V1JA 2AZ4A 3DBIA 4XFDA 2MO0A 3T3HA 3A2KA 1IW7C 3D4DA 2PZ8A 4Y9UA 1IXRA 4C4OA 3H9GA 1EVYA 4M1EA 5KEIA 1I7DA 1HKHA 4JVLA 1Z63A 4BUJA 5CFOA 4I46A 1R6AA 5AUQA 2ZAMA 2C1ZA 3QB3A 3CA8A 3HNRA 3QFCA 1YRHA 1XX8A 2A57A 4Q4LA 2QQFA 2QD1A 3DE4X 3L77A 2VL6A 1A2KC 3PR2B 1P2UA 4GO1A 4B82A 3I1JA 4NV3A 4PTZA 2ZS8A 3THYB 1GZ5A 1PGOA 4WN9B 3A11A 4DNTB 3A14A 3NDRA 4DSTA 3DTNA 3GNQA 5IP7G 1DMSA 2RI6A 2QTAA 3H1GA 3ZEAA 1BU5A 1EM8B 1LI7A 1XPRA 1AEXA 4UTOA 4KFRA 4ZVSA 1C9YA 2YV2A 1EFWA 3PIO3 2F3WA 2K32A 1MA3A 1Z4MA 1IUPA 2B8JA 2NU6A 1S8AA 4HXFB 4U7HA 3MJCA 5BSVA 5EWMB 3U6KA 1F6BA 1QFMA 2R8EA 3B5IA 1K3UB 3OZFA 4M1SA 5CLHA 4ZVTA 1VL0A 3UK0A 1QP7A 5C2JB 4B3SQ 2WU8A 1GRRA 2CDCA 4P3NA 5ESWA 4KH1A 2Y0SG 1XNRL 4OHVA 4OHJA 2GJ9A 4RHUA 2RGBA 3HKCB 2BR4A 1WY5A 4UHJA 3WAGA 3G0HA 2CY0A 4KXFB 2XBLA 2EZTA 2IPOA 4CCSA 3SC3A 3IESA 5BR1A 2XMRA 4QPPA 5SZIA 3JQ8A 5LOVA 1XMSA 2AZXA 1O6ZA 1ENZA 2GZ3A 1HZAA 1VXRA 2GPJA 1L0YB 2R1UA 5REQA 3SXUA 3TR0A 2G5GX 2ZS9A 3V8MA 1PDWA 1WETA 5K99A 3DM5A 3E0JA 5IBRA 1R16A 4M1TA 4NG5A 4TVSA 5DLQC 2DWOA 3FDXA 3BX1A 1Y1PA 3KEOA 3ZCSA 2YCBA 1IU9A 5E3HA 5FR1A 1OIXA 2K1BA 1QVAA 1GZ7A 4BGIA 4RV9A 3AOEA 3MWJA 4B33A 3TECE 4Q9HA 2Q3LA 3AY0A 4EMTA 3KUCA 1V5IA 3BRSA 1K0UA 1A5ZA 3KHUA 1WXEA 4LXYA 3RU7A 2QAJA 4ACAA 4CKYA 1PR5A 4H13C 4BNZA 4BAUA 4OB7A 4JYPA 5IT9A 1I30A 1SCAA 1T25A 1C7JA 2VF8A 2ZJ7A 3SNKA 3TW0A 5IWAB 2E6UX 2FWBA 1K3FA 1J1IA 1V1RB 1V5GA 4J1MA 1IK4A 3ASVA 3E9RA 4KPYA 1GKIA 3ZHOA 5IVKA 4AN1A 1RC0A 2E2IH 4HT3B 2TMYA 4JDUA 1QIEA 2Z5GA 1X1TA 4PU0A 5A5GA 5KB3A 2WQ6A 1E2ZA 1EWIA 2QOEA 4JLAA 1MV8A 1MI2A 1CZNA 5CCBA 3DEZA 4LYEA 3TOSA 1E1RD 1E32A 5DM1A 4RVHA 4RD6A 3V5NA 2F7SA 4DIUA 4N12A 2BFCA 5DNDA 3CVUA 1Y6ZA 2WKWA 1OX4B 4OHRA 4FE3A 2FPUA 1A7AA 2R86A 3HWSA 3OP4A 4KLCA 3KL4A 5E0OA 4D3SA 4LQLA 1EP2B 4WOCA 3UK7A 2EY2A 2RGNA 1CJMA 2ZBFA 3HBFA 1SIBE 5C7OO 2IOHA 5BSKA 1EXDA 3H9CA 3L8FA 4O02B 3AVOA 2P1ZA 1WCWA 1IONA 2EQSA 2P6NA 3JPWA 3VZPA 5JROA 4OX9B 4A10A 1O6GA 5I8PA 2Y67A 4G0ZA 1KE2A 5IDYA 1RBMA 1UJCA 2QPAA 4I4IA 3SYLA 5I9LA 1FMTA 1KIFA 3O0DA 4BX3A 5ICGA 4EKIA 4P2CB 1V8BA 1KO4A 4JXXA 1OA1A 4BVEA 3TMYA 1DG9A 1KHIA 1B9NA 2VWHA 4OQMA 5C18A 3HLTA 3KYCA 4LX0A 3ZY3A 1QQAA 3FPPA 3CWZA 1GP2A 5L4SA 2AI3A 1T1IA 4DR6B 2Z6UA 1Y34E 4KWHA 3DWFA 3G2NA 1IPEA 2J9RA 3MGBA 5ETJA 5EJIA 3W8EA 1IUKA 2DPGA 1Y9DA 4ATNA 1VPVA 1V41E 3ETGA 1PL0A 3Q11A 1C80A 3JVDA 3P0IA 2FR1A 4JQZA 4ONEA 1K28A 1GCUA 1OTHA 4W5HA 1X7ZB 3J81i 4HR7A 3QKSA 1JLRA 4ENPA 3HNPA 5C37A 1VMCA 3GTQB 3RRMA 4DIBA 1A4IA 2FZ4A 1FIUA 4US0R 3PA8A 3S2DB 1Y4UA 3CJQA 3TTTA 5K0GA 3JZDA 3C6KA 4NPAA 5FLXc 1HHVA 4KN8A 4R1LA 4ZCQA 3DV2A 4OF4A 1KYTA 1MGSA 4PN3A 4RH3A 4BS9A 4QDTA 4MWDA 4LFAQ 1HDGO 2XKBA 3RH0A 3ZDZB 5JSKA 3J7TA 1YK0A 2FTKE 4MEAA 5IULC 3D6FA 2V9CA 2PKEA 3IBSA 4ZGWA 5A9SA 3CLRC 1NYTA 1CM9A 3CX8A 1XU4A 4TV9A 3U3DA 1OAKA 4EFLA 3HA3A 4MIUA 4NCAA 4D98A 3H0CA 3IRVA 1GIAA 4S1NA 1T9GS 2VRWA 4ZOLF 7ABPA 1F9SA 4TUYB 4KDCA 1X32A 2GCGA 3W6OA 5AOCA 1J5XA 1QUFA 3PG5A 2YRFA 1VZ3A 1YDWA 4F12A 1B3QA 4LJ5A 3JASB 3CCVA 1PH1A 2Q0SA 2Q5QA 4FU0A 4N49A 3RYIB 3ZG6A 4OHYA 4DR3Q 4N39A 3UMMA 3I09A 5KU1A 1GEGA 4L50A 4EL0A 1E66A 3CRW1 3KLPX 2A35A 2GPSA 2WVHA 4L6IA 8ATCA 1V45E 4TZ0A 1JHMA 1E69A 5JSQA 4GN5A 2AE2A 4EO7A 4RZXA 4LHYA 3OO0A 4WFN3 4RQBA 2IYWA 4TLEA 4LMRA 1M8FA 3C3MA 4PNEA 1FRNA 3KZCA 3IIJA 4PBSA 3WKBA 3OSZA 4V1CI 1CDEA 1RTKA 1U7XA 4KE9A 2C5GA 1IAQA 3NORA 1X6VA 5EHQA 3EGIA 3STXA 5SY4A 2EHDA 5J3BA 2H6EA 3C3AA 4IG9A 3H42B 4UULA 4K46A 2X3UA 4YAKA 1EVIA 4DDMA 2ES4A 3E3AA 1ZIDA 3N74A 1Z37A 4KY7A 1LNQA 4JI3B 4CDCC 3RVRA 2E74C 1REQB 3GJ4A 4HO1X 4NU6A 1XE3A 4AU1A 1Q1QA 1PG2A 3A2MA 3FPSA 5ALNA 2HHAA 1XLTC 3DUFA 3IQGX 4RELA 1S2IA 4DMFA 4A7PA 1NTOA 3T94A 4I6JA 2E4YA 1JWSD 4BNIA 1IYZA 2GZ1A 1X8XA 4MCHA 4E7PA 1L3IA 4D3FA 1NUCA 1YQEA 1DV2A 4NDAA 1YDMA 2NZUG 1VCOA 2I66A 1A69A 2X9QA 1T26A 2NADA 1Y7HA 3HYSA 3KJHA 3MCZA 3NBXX 1JIIA 4Q00A 4RL6A 1EZZA 4Q66C 2BHLA 2O7SA 5K3DA 5J4HA 2NO6A 1KDBA 1SULA 2XXBA 1HDEA 4I8DA 1YJWA 1XKQA 3TNFA 3W1VA 3A37A 3ILXA 3LYAA 1DIRA 1Z8HA 4EYSA 1AKRA 4HAIA 4BTLA 3JTEA 4ALKA 2G8LA 1KK2A 1V6SA 2QZJA 1M75A 1PFNA 3GLTA 4EF5A 2YDYA 2FX3A 2OYCA 3VZDA 4CYMA 5EUQB 1VQ9A 1ZP6A 4FYHA 5I51A 1ISFA 2X0IA 1PGQA 2E48A 2DWCA 4YACA 1NBIA 1MHPA 5KNDH 4TVAB 1VJDA 2C5LA 5DXJA 4YJKA 4XKJA 1MZPA 1DCZA 3IMGA 2RH4A 3D31A 2H2DA 2XQFA 4X5OA 4MKXA 1B43A 3RVQA 1GPAA 4KSCA 1FXUA 4JI3Q 3WB9A 1I50H 2SNSA 1R64A 3QYJA 1O94A 1KI2A 2VHXA 4O4HA 4CM9D 4IUQA 5KQRA 3K4QA 3MTIA 4XQQA 4GKKB 4XM1A 1GD7A 2ZIZA 4AP6A 2BHSA 1KO8A 4MDEA 3EISA 2WOOA 4ZO9A 1Y9EA 3JWPA 4HDNB 4TZTA 4OHKA 4EJSC 3K35A 4A0FA 4F4DA 1FU4A 2NUAA 1QWSA 2PKQO 2PX8A 4DCSA 3N6RA 1P81A 2G80A 3GCWA 4ZOBA 4P3XA 4RKWA 2KA7A 2J9GA 2LZ0A 3FKQA 2BKLA 4GLOA 1Q21A 4IGIA 4IWXA 4YJ3F 4KPEC 2HUGA 1Z68A 3TCXB 2WB1B 1KI8A 2VFAA 3OOHA 4W9NC 1PK7A 2IH4A 1VHDA 2WF6A 4FM9A 1CZOA 2XWSA 2GEJA 3LQ4A 1E92A 5B1HA 1NP3A 3GEDA 2I8LA 3WS7A 4R54A 4CCYA 2ZRDA 4E6PA 3VVBA 3IUNA 2WJ3A 2UZ1A 1VHWA 4JP1A 5IYDG 1T9CA 5AYVA 5CLFA 2C4VA 4FR5A 2GM4A 1FW6A 5B1SA 2B0JA 4A4DA 4L15A 4TLCA 3FX2A 3AGPA 1N2CA 1XLVA 1T5HX 1EXNA 1KYXA 1TC2A 2ZSFA 2NPIA 2WP8J 2HEIA 2JHFA 5KAMA 4B3BA 2XXAA 3JQGA 3QSYA 3IYLW 1UMDA 3P9XA 2QUIA 1V16B 1IYJB 2M6SA 2QGFA 3Q2IA 4ZOLB 2A1UB 3W5VA 1X1AA 1NRJB 3CXUA 1N7GA 2XWJB 4PZZA 4ETNA 4I66A 1K06A 1MX9A 1D5CA 4RMJA 2ATEA 3A2LA 3UK2A 4C89A 3GJ7A 4RVGA 1E3JA 3J81j 1D2AA 2ACWA 3IPCA 3PEVA 1IZ9A 2QAGA 2Y1CA 1QFJA 4K5QA 1RLTA 3DTYA 4C06A 1UDRA 3ROZA 4BV9A 3GG2A 4LXGA 1KPHA 1P0PA 2L0XA 2Q3CA 4RS3A 1CQIB 1A4UA 4W5QA 5AVXA 3EG5A 5CFNA 2ZAYA 3DDNA 3Q72A 5EEGA 2R6AA 2Z3VA 4B3TQ 1JQ5A 3FOWA 1GVNB 1SMYD 4L5QA 1OYOA 4UP9A 4Y2GA 4DV2Q 2ZVJA 3ZXUB 2VRNA 2UYCA 4EX6A 3QTLA 4QO8A 2I3GA 5HQTA 2PJRA 2L17A 4WGGA 2XITA 4Q39A 3MJDA 5HWSA 1ZN8A 3FNGA 3D0OA 3IUSA 2F64A 4LY9A 1O54A 2VF2A 3LGAA 3AEKB 3WMEA 4B73A 1D6SA 4YEDA 2YV5A 2QI9F 1O95D 3L7YA 3QVGA 1BHSA 3BGIA 3NV7A 4ZXFA 3VPHA 4CLDA 4FSXA 4DB4A 3ZH9B 2JA6B 3WLLA 2F55A 3IQHX 1IH8A 4G85A 1OC2A 2TMGA 1LDGA 3ZN2A 5KQGA 1QGZA 5CD9A 5I2XA 2CLSA 1MH9A 1Z6YA 2IJ0A 4ZWNA 4BVGA 1ZOPA 4GYJA 1BHQ1 1T9AA 3TM5A 1RD9D 1S96A 1A0IA 1WV0A 4HLQB 1XO1A 4MQFB 4NE9A 3VO9A 2FSUA 2HIVA 4TX1A 4FT4A 3HOXG 5HGQA 3PNOA 4YR9A 4KR3A 1NI5A 2I4OA 2WSSA 5ALEA 5GV7A 1KTVA 2PMEA 4DKJA 4UCFA 3TQFA 4BY1B 1H23A 2XWBB 1NV9A 3MT0A 3GTLB 1XWEA 3PKZA 1WXIA 4J7UA 4N9QA 3TB6A 1U7DA 2GN1A 4BTEA 1IQPA 4EATA 2HREA 1H4VB 2WYWA 1KOJA 4FVMA 1QNKA 1EDBA 3AI7A 3PRHA 4LGYA 2FJ2A 2N42A 4QOIA 3O4HA 2BMJA 1DEHA 5C3UA 4X66B 1XPJA 5LYJA 1IM5A 1NC3A 5EHIA 2AYYA 3TZ6A 5IDQA 1DOKA 2W6QA 3I0NA 4RF5A 3S2HB 4IMJB 5FO1A 3VPXA 2IYNA 1CYEA 4D8UA 1XIVA 5B3JC 4F97A 2WJWA 1T8SA 1AQ6A 2UYYA 3FCYA 1IBCA 3MHPA 4X44A 5H4GA 4Y7DA 1YTUA 5DAUA 2P65A 2SKCA 3SFVA 2FFHA 3ITKA 2EHJA 5JS2A 4DR2Q 2GYVA 3E1KA 5AKEA 2BHRA 2ICEC 2QVCA 3C39A 1EA7A 1T5XD 2IPKD 4Z9CB 1C3OB 1YKSA 3K8QA 1NN5A 3LXXA 4HH1A 4ZO4A 4A3BG 3EXG2 5SZKB 4BBSG 1IXZA 3QELA 2YZ2A 3PJEA 3PO3G 3I52A 1GCIA 4UD6A 3KLOA 2B8EA 4RANA 3U3XA 3TTUA 1PH6A 2Z1CA 5LBIA 2HADA 3RBZA 1DU4A 4CEJB 1XEXB 2PGIA 4A03A 1Q2UA 1ODKA 4XIYA 5D1HA 3RUCA 4JB3A 1WMSA 3STHA 3BHMA 3UXEA 2CXXA 3ZVLA 1XZKA 4F2PA 2QW0X 4DB2A 1CETA 3EBOA 1L8OA 3MAGA 4KFSA 4RW0A 5HGTA 3ESYA 1JIQA 5HA5A 5HKLA 4C4AA 4F85A 3D7KA 2J0TD 4G4SP 4WDRA 1TCBA 1AVTA 4YCAA 5J2TF 1QHGA 2ZPAA 1Q1NA 4IWNA 4PANA 3A27A 4NMXB 1PLJA 3SIWA 2CDBA 1OCEA 2ID8A 2HLHA 5CXQA 4TLDA 1J39A 1TWFB 1UM9B 3TIVA 2Q3EA 3UJ6A 2J3IA 4Q93A 4IIBA 4L9RA 1M2JA 4RKYA 3R0QA 3OM8A 3N28A 1NOKA 4YCJA 3P19A 2JJ2A 1HUQA 3VR5A 1JHQA 2RCFA 3RJMA 3LNNA 3ETEA 3SM3A 1Q90A 1TUBA 2KECA 3KPUA 4X8HA 2VT2A 4YHHB 1P2SA 4O59O 4BE9A 1RYEA 3GLUA 1GV1A 2X19A 3SJUA 4Y7CA 2H65A 1FSZA 4GKJB 1UCFA 5FL7A 2ATVA 1E5QA 4PWYA 4WESB 2E2HB 4LC9A 4NNPA 1L1FA 3PFHA 2YJZA 2C5EA 3DMRA 4N4AA 4NZNA 4MRAA 1CFZA 1R15A 3DZHA 3SSMA 3AP2A 4EJ6A 5K6TA 2P67A 5BR7A 3EJIA 2IDJA 3EGOA 1CZWA 1N2JA 4KWTA 3K8YA 1VHLA 2B1RA 2FMMA 3WA6A 1AO0A 1SB8A 3T3NA 1TIBA 3DBRB 5ECDA 3C1EA 4DV7Q 1UUFA 3S15B 1XTIA 1N1GA 2BW0A 2FR8C 2QG4A 4LXQA 5AM0A 1ASZA 4E5YA 4D1YA 2NXCA 2JJMA 5IPFA 3ZS8A 2FZKA 1IJKA 4YY3Q 4IM7A 5K9ZA 2FSHA 1ZNWA 4YCWA 2WWIA 4XB1A 4ZJYA 3CNLA 5CMLA 4Y6OA 5HKOA 1XI2A 3NAGA 4EO9A 1EQTA 1VYUA 1L5KA 2PANA 2DP4E 3RYCB 4DJAA 4K3VA 3VSAA 3WLKX 1POXA 4MQEB 3CCSA 5DTIA 1VQKA 5K36G 3AUFA 4FINA 4CIWA 3HUTA 2Y05A 3LY9A 2ZJ1A 2FW6A 2W2NA 5EP2A 1HSZA 5ERGB 3PPYA 3WLNA 4G5HA 4RAQA 4DR3B 4YHHQ 1EP1B 2V0NA 3W34A 4DA2A 2RJ3A 3TZUA 1N2ZA