1Q1EA

The atpase component of e. coli maltose transporter (malk) in the nucleotide-free form
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
367
structure length
367
Chain Sequence
VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A tweezers-like motion of the ATP-binding cassette dimer in an ABC transport cycle
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Maltose/maltodextrin transport ATP-binding protein malK
total genus 93
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2003-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1q1eA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q1eA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1q1eA01
1X6VA 1RW4A 2HUPA 1GUGA 3CC7A 2QEQA 4NYJR 2D7DA 5CIWA 4JC0A 4XVRA 3QNUA 3TAUA 1WJJA 4DAMA 2GVDC 4TWZA 5LD2B 4CT4B 1YIJA 1G7TA 1CJUC 4Y0VA 5E7IA 2Y8EA 4KXFB 4U5XA 5IT5A 2IC5A 1KL9A 1BMFA 1IBKQ 5K36G 3NH6A 4G7HC 1IXRC 3LV8A 4GOKA 4BY1G 1VQ9A 5KNBA 2OESA 5DI3B 1YE8A 5FLXc 2OAP1 4DSUA 4DV2Q 1IXSB 2DFNA 4PV1C 4R4TA 3EPJA 1CBUA 4OWWB 3HOZG 1U9IC 1KNQA 5IP9G 2IL1A 2IYTA 1FZQA 1WF3A 3HR7A 5DI3A 5EZ6B 3IEUA 2V9PA 1ZYRC 4LJ7A 3JAMi 4RG1A 1NE3A 2VS1A 2P65A 4EIWA 4IEIA 1KYIA 4Q9LA 3I55A 2A5FA 3NWJA 4UXHA 1WBBA 3HOWG 4NU0A 2IUSA 3O8BA 5F2EA 1Z0KA 1NMGA 1F3OA 2JJ2A 5LDDC 2UUBL 3L0IB 1PH2A 2MMGA 4JSYA 1WCV1 1IJFA 1NL3A 2GEUA 1AKYA 3PVSA 3FB4A 4PO1A 3A8JE 4QL5A 4DKXA 1YHBA 1DGSA 3AM1A 3Q9LA 4Q7LA 3S1MH 5FPTA 2R93G 4E09A 1PLLA 1XXHE 2VUMH 4DV5L 1W4BA 2ZRKA 4DV4Q 3DM9B 5CDFE 3NEJA 1Y1WG 2EJMA 1A82A 4JV5L 1N25A 4OHWA 5EE5B 1XF9A 2VSOA 4DCUA 2O8FB 1EK0A 3W5OA 1HQCA 4PFSA 1KDTA 4RSGA 3VR4A 4B3FX 3I7FA 1FJGQ 3EAQA 4HAZA 1G17A 2C98A 3ZYCA 1W3SA 3WRYC 1KK0A 1S3GA 1F48A 1Z28A 1G3MA 1ZINA 2Z0SA 2P6NA 3OEEA 2IX3A 4F4IA 4QXAA 3LWNA 1XXHB 4DV5Q 4NXNL 2ZM6L 2XJ4A 3ICEA 3HPQA 1OB2A 2VL6A 1GRNA 2VP2A 2W00A 2NVTH 3B9QA 3ZS8A 2C9CA 2QMHA 1Q21A 2HEIA 2L15A 4GKKL 4TSFD 1GKHA 4PC7A 1OFHA 2YWEA 3SYLA 4DK0A 3J80c 1T5LA 2B21A 5IRCD 1Z6GA 3GJ3A 1H9JA 2Z6KC 1MJEA 2BCJQ 4IDNA 3H15A 2R6FA 1VQPA 2GZAA 2P5SA 3OZXA 2VYFA 4KCGA 4RD6A 3PO2H 5B57C 1JE5A 1E2EA 2O0KA 2ZE8A 1PYSB 1J5EQ 4ZCMA 3VR5A 4D6PA 1G4UR 3QPUA 3TW4A 3VQTA 5FLMG 2HV8A 2QY9A 2JEBI 2HLDA 4H13C 1OYYA 2B29A 1G8FA 4JVMA 1WA5A 5AUOB 1AE2A 2F4VQ 3RLOA 2CWPA 1HH4A 3A1VA 2WJGA 3Q5DA 4D0GA 3A7AB 3GJ8A 2B8FA 5GVSA 4GS3A 3GJXC 4OK5A 4GOPB 1QVAA 4L16A 2VQSA 4QFMA 3T1QA 4BEJA 4YDSA 3DO6A 1HNWL 3AQ4A 2CK3A 2C5LA 5J40A 3RN2A 1NLYA 4US0R 2JQOA 3AEZA 3U7HB 1NN3A 3NC1C 1TQ4A 3FHWA 1QUQB 2HT1A 2V4ZA 4GNXC 4NCHA 3S2DH 2UXCQ 4MRRA 4PPNA 1KDOA 4PXAA 3GFOA 3U2QA 1XMOQ 4CVNA 4DK3C 1UDXA 1GNPA 4KHZA 1WDTA 3TSOA 1F60A 1VQNA 3L0OA 4NXML 3HOXG 3GLGB 2W2TA 2WSSA 4C0QC 4Z54A 3THOA 3GTOH 3KUDA 3E70C 4PZZA 1E0JA 4X66L 1Q1EA 4AYBG 4UP9A 4JI0L 2P0EA 3AGPA 5EXPA 5B30A 3R8CA 5FJ8G 1V1QA 1WQ1R 2OXRA 3DMDA 3MMPA 4K46A 4TYQA 1Q82C 2YVUA 4KITB 1W5TA 1K73C 4IXNA 4Q1DA 4TMWA 1NG1A 4JI5Q 1P9RA 2AKYA 3OPOA 2IEZA 1S3OA 2Z6KA 2Z5FA 4BLPA 4HB0A 2ZRMA 4B35A 1A8VA 1NBMA 2HYIC 4QHTA 4A15A 3P20A 1YVCA 3LNNA 1SVLA 4AK9A 2IYLD 5G41A 4DNRB 1TF2A 3BIFA 4PHHA 3UKDA 5IWAQ 3M3YH 3HGBA 2VY3A 4GN5A 1R0YA 3QPVA 1BKBA 4HSEA 1LF0A 2JASA 2CWAA 4OQLA 4AH6A 4HZUA 3M4YA 4IEEA 2IYXA 1YZLA 1VQBA 2EWVA 2GBLA 2ZSBA 4EPWA 4TQUS 4DUYL 5HTKA 1VG1A 2O8EA 5D3MA 3TR0A 1VQIA 4PMWA 2BDTA 3TQYA 1CLUA 4OQFA 2D2EA 2ZRAA 5DISB 2BMDA 1BKDR 2BE5D 1E2HA 1XJCA 5TVKA 3OE7A 821PA 5L3VA 2V7QA 2DR3A 2YWGA 1SXJE 1CJKC 1NTGA 3DEFA 1AGRA 2O8EB 2EU8A 3CX7A 1FVIA 5EUMA 1KXLA 1U99A 4B71A 2ZJ8A 4BLTA 4AQYL 2F52A 1FNNA 4HIMA 3BWDD 2WPDD 1GWNA 3R9IA 4DDTA 1DAHA 5C1BA 4RKFA 2D5DA 2WP8J 1KKMA 2JJ1A 2DB3A 1Z9FA 2XXAA 1N5IA 3J7A5 1YRAA 2IEYA 4IJMA 4M9SA 4QGAA 4YXWA 4EPXA 4OQMA 3SFVA 1XTJA 1KY3A 2K5NA 5IYDG 3L8ZA 4QJ4A 4C0LA 2WWXA 4Y52H 1W47A 5JWOA 3H3VH 3FKIH 2DWQA 3S1QH 4BGDA 3GLHA 2ODEA 4A3DG 2V6JA 5DSZA 1MV5A 3FGNA 1BO6A 1VQFA 2Q2HA 4B2LA 2H5XA 4I1VA 4IFDH 2EQBA 2XTZA 3IILA 4KFSA 1QDEA 3SE0A 1IN5A 5FJ8H 5HCIA 3T1OA 3A37A 3AF0A 3BH6A 1CR4A 1G19A 5JEDA 5FR1A 1CFMA 3P32A 1JAIA 4ESHA 2E74C 4LHXA 3SHWA 2AFIE 2FWRA 4DR2L 2ZE7A 2VUMG 2I3BA 1IBKL 1MR3F 3MXNB 2ZTDA 4BBRG 3LVQE 3T1YL 1DBSA 5C3EH 1OF1A 1VYVA 2J41A 2ZE6A 3E5HA 2ZJQA 1Z6XA 3CM0A 2JJ2D 2D0OA 3KXIA 4NONA 2PQAB 1XD8A 3CF2A 4PC3A 1JXMA 4ZKEA 4G5GA 4FCWA 1JEEA 2HF8A 5TMPA 1K9MC 3OE7D 4A3JG 5E7NA 2GF9A 1GNRA 1KSHA 2GJKA 1OXUA 2VRWA 2CL6X 5GVRA 1B8AA 5E3HA 3TZUA 4G01B 3RC3A 4E22A 1PH7A 5JRZA 1X8LA 1ZM2A 2O0HA 1E1TA 4PX9A 5K8LA 2I5MX 1IY1A 2NZJA 1IW7D 2WSSD 1JXOA 1H8HA 3PITA 2ZTEA 4TKOB 1ZD9A 1DTSA 1P16A 4DDVA 2IYQA 1K6MA 4FCTA 4HR7B 1Y14B 3HU1A 4A93H 4QJ5A 1ZNZA 1GSIA 4BY1H 1E6CA 2ZI9A 1YR8A 1FGUA 1KO1A 4A0GA 2KB0A 1ASZA 5BR8L 1I4LD 1K3RA 1E2JA 2G0NA 5EUQB 3SNHA 3CH5A 5LMUQ 2YTYA 1AQYA 3HOVG 5F98A 4EQ6B 4F38A 1OB5A 2QA5A 2BCGY 4M0LA 2E2HH 1VCNA 2FEOA 2QU8A 4A2PA 1GFIA 2OZEA 3PUYA 3WP1B 4A8JB 5J47A 1XEXA 3M9BA 1GM5A 1II8B 2F43B 1KI1A 5FTLA 2ODWA 3GJ5A 4BASA 1BBUA 4JI8Q 5GJBA 4GDFA 1E9FA 1EX6A 3T5GA 4K8OA 2RF4A 4MKGA 1QJOA 1N6OA 2FV8A 5TY0A 4DB2A 1D8LA 1N36L 1TPZA 1T91A 4Q4HB 2ZJRA 1HR0Q 3T56B 1E2LA 3K0SA 5KSYA 3OFND 1Z06A 4M4SA 4DHEA 2J46A 4DV3L 3CCLA 1GKUB 3K9GA 5AWFC 1QVCA 4C30A 1FX0A 4KMUC 3W1GA 4M1SA 2BM1A 2C9OA 3TW8B 5FPSA 4D80A 5B64A 4IOKA 5GAEC 1N36Q 2IY5B 2ZVQX 2YTXA 3SN6A 2DGYA 5AUNB 1NVVQ 4A3FH 1C7YA 1LB1B 3U3JA 1Z83A 4LV8B 4GLVB 3SHFA 4OO1G 3U50C 3OTOQ 3MEFA 1D5CA 2J9RA 1TAGA 4LHZA 3ZS9A 2WJHA 2ZU0C 1RZ3A 4JI3Q 1Z0IA 4MTNA 4JI5L 1VKJA 3UANA 5HKKD 4FN5A 4UJ3A 4JI7Q 3D3QA 3RSOA 4D0NA 5IHPA 1ZKOA 1M7BA 4IJLA 4G0NA 4QIWE 3DLLA 1P62B 2IYVA 2XITA 1PYBA 3THXB 1OH8A 1OE0A 2FF7A 2GJ8A 1K5GA 4H02A 4JLPA 3WMFA 4AWXA 4FDBA 5DIFA 4IDPA 3PEUA 3N2EA 3WYAA 1GL9B 1Z0DA 3LLMA 4LWCA 1E2MA 1VQ4A 1J70A 3RS7A 2RHSB 1E32A 1X56A 1WYDA 4JV5Q 4KVGA 2GK7A 2XGTA 4PAOA 1T8UA 1FOEB 4DV7Q 1JECA 2IYYA 3KFXA 1K5DA 4IQZA 1DE0A 1QHIA 1GNQA 1YR6A 2NO0A 5DI9A 4A0HA 3GLIE 1XMJA 1MO4A 4JI1L 1Q86C 3KKMA 1HT2E 1YZTA 4LF4Q 1S40A 2PX3A 2RGBA 1E99A 2KBEA 1GHKA 2V55B 1KMHB 3RYTC 4BY7G 2JIZA 3M0EA 2QORA 3B7GA 4NH0A 4QG7A 3KJPA 4IDQA 1Z7TA 2I5HA 2VEDA 4JLNA 3SOPA 1JB1A 1P4SA 1MIUA 3L8YA 5KHOC 4LJ5A 1E94E 1ZRHA 1UKZA 2QT1A 5CLQA 5ELNA 2B92A 5L8VA 1EFRD 3U60B 4H0LC 3FMCA 3NHBA 4NMMA 3QVVA 5C4GB 4DUGA 1OXTA 1OXXK 4BZXA 2ZS8A 4PZYA 2KI5A 3OF5A 1IBLQ 4DR5L 1Z08A 3TJZA 3WP0A 3GLGE 3LLUA 1CR2A 3KJEA 1VECA 1SXJB 4PHTA 1NY4A 4A3LG 2XNDA 3GP8A 3MJHA 1YVDA 4WW0A 4F4CA 4F91B 5EXSA 1UKVY 2KSQA 2H7VA 1G8PA 2IK8A 3BS4A 3NEMA 2N78A 3D0FA 4OX9Q 1U9IA 5AJ3L 1TWHH 4LF7Q 4A3GH 1VQHA 2C96A 3CCEA 4LUVA 3IDQA 3GFPA 3RC8A 2CL7X 3VR6A 3AP2A 4FD2A 4GZMA 4HATA 4S2EA 3VHLB 2QA4A 1CR1A 2MQHA 1I5FA 1CJMA 3L2PA 1KO7A 2J0UB 2ZE5A 2EVBA 1A5TA 4A3EG 1ESMA 5E4FA 5HE8A 2DFLA 3O8RA 3KQKA 3HOUG 3GTKH 1KI3A 1DARA 1S1CA 1UE6A 1W4RA 4CEJA 3DM3A 3K0AB 1IYUA 2ONJA 2R7FA 4JBJA 3RVBA 2ORWA 1HZBA 3ASYA 3FMIA 1EXMA 1PH3A 2OHFA 2Z43A 1Z6YA 1KI6A 2EIFA 2CLDX 3C5HA 3PFIA 4W5HA 2E2IH 1XTDA 5G3ZA 2GTPA 3ZQJA 5C18A 3QF4A 2CDNA 2VF8A 1GO3E 2QPOA 1A1VA 3SJAA 4HLQB 1OHHA 2WAYA 1HPCA 3FKSD 3GTMH 4JI7L 4NTZA 5DYIA 1NIPA 2JA1A 1RYFA 1Z2AA 2LXKA 3MGCA 4JLVA 1IN8A 1X54A 3CUEF 1LUZA 1FFHA 1SVOA 5LBIA 3MRSA 1DG3A 4DNIA 1QG4A 3K53A 1E2QA 4QNMA 1B9NA 2YKGA 1XFAA 1P61B 2E87A 5GAGC 2QG6A 3S14H 3FMFA 4PQRA 4Q03A 1VF5C 1E9SA 1E98A 3EA0A 4DR7L 1KAOA 3EIEA 3KKPA 4LGMA 1D7QA 2CBZA 4BQSA 1PH9A 2GN5A 3CX6A 2FE4A 2GJAA 4MQBA 1Y3AA 3VNVA 2HQLA 2K50A 5FI1B 2PT7A 4AG6A 3PR1A 4OHVA 4U7DA 1DOAA 1TU4A 3TAHA 4YCWA 4QM7A 1JAHA 3I4NH 4GNXA 2ZRIA 5J4YA 3U7FB 3HR8A 4CEIB 1XNRL 3ZGXA 1T5EA 3R7WA 3HWSA 1N0VC 1TKWB 5GROA 5AK0A 3CW2C 2RGXA 1G5TA 2IXGA 4B6FA 1S9DA 1D9ZA 3FP9A 4JI2Q 4BBSH 2C03A 3HDTA 3KX2A 2FEMA 5K8TA 1VQEA 3PO3H 3B85A 3OIUA 1MT0A 1N5KA 4X8OA 2BMJA 3IQXA 5BN3A 4IOJA 2F1HA 2WWHA 4HLUA 1HNZL 1EFRA 3BERA 3C8UA 4ARZA 4HJ9A 2NO7A 1G64A 1QF9A 3A4LA 1I4DD 1G21E 2P5TB 1VYTA 2GAAA 4RD3A 1AQUA 1AZTA 1KOFA 4KI0A 5JEAH 2XX3A 1VQKA 1JQJC 3KXLA 2ZJOA 3MWJA 4EPVA 1BH2A 3TE6A 1GUOA 5KSZA 4TQAA 1YITA 3SEAA 5AJ3Q 1N6IA 5FUVA 4A75A 3CWQA 3GDEA 3RS0A 2OLKA 5DHAA 1U94A 2WWYA 4MKIA 1K8GA 3L0PA 2R65A 2R92H 2WICA 2UUCQ 1KDRA 3LRPA 3I4NG 2AWOA 3VR1A 2JEAI 3BZCA 2ODBA 2PEZA 2ZSAA 1C9OA 1JJGA 4GT1A 1GG2A 1AK2A 1HY3A 5FTKA 4YDHB 4E07A 3BU2A 4V03A 1IZ6A 4PAQA 1CSQA 5HY6A 4B32A 4KVAA 4FMDB 1E9EA 1QUQA 1PLJA 4US1R 2I0QA 1JJVA 1GITA 3B1YA 1F6BA 4A3KG 3C41J 2WAQE 3MJRA 4TQ9A 1ZP6A 4BRUA 1T9HA 1RIPA 2ZEJA 4RCNA 3S24A 3AP3A 2NMVA 3CRQA 2RB4A 3DMNA 2FMXA 4JLKA 4LYJA 3FHCB 4BA2I 4DV7L 1ZM7A 1ZW6A 1S3SA 3HKZE 1W46A 1XTKA 2NQ2C 2V8OA 2X2EA 2ZTSA 3LBHA 4ASUD 3ZQ6A 1EQRA 1EFCA 1MOZA 2VIIA 4Q21A 3AF4A 3CCRA 2Z4RA 1S9HA 3THWB 4M1OA 1X86B 2IUTA 5FBVB 1M1KC 3QEJA 4I7ZC 3SJCA 3TLXA 2WOJA 4Q7KA 1R2QA 1ASYA 3A0JA 3VX4A 1G291 1S1MA 4DNTB 3VDYA 4LF6L 3JAMc 2CVFA 5M5WH 2HCBA 2Q6TA 3CF0A 3K0CA 4IOMA 4V0LA 5D3QA 1NSTA 1FJGL 3LW7A 2P6RA 1HYQA 3K7UC 1OLOA 2F3TA 2R6DA 4NYMR 3ZZUA 1E2NA 5KSOA 1WFQA 1E3PA 3BORA 2R7DA 2CCJA 3KB2A 5JJLA 2JIZD 3MSXA 4NCNA 2CCKA 1R5OA 2A68D 3A4MA 1RRGA 2DNCA 3HOUH 1X3SA 2FSGA 1LV7A 1KD1C 2NOAA 3KF8B 4HZUB 1O87A 3D4RA 4JYCA 4RMFA 2D7CA 1XTIA 2X1VA 3CNOA 3FHTA 4A3JH 3FVQA 3ERSX 4BFSA 3T1HL 3JVVA 3AVUA 4JI1Q 2GEDA 4DCTA 1OIVA 1DELA 4PZLA 4Z8YA 5GJCA 2N46A 2XZLA 3C7KA 2QN6A 3OIYA 3AVVA 2AK2A 4JIMA 2A5GA 4TMKA 3PEYA 3MLEA 4DR3L 2B3GA 1V5WA 2ZSFA 5JFGA 2OAQ1 1IW7C 3AF3A 3X1YA 1K8OA 5C3EG 1X8KA 1J5EL 4POFA 1FNMA 5FR2A 4G5OA 3MWYW 5G3YA 1XZPA 3I2ZA 1OSNA 2ZAOA 1J6QA 1G3RA 4XWOA 2KCCA 1NI3A 1Q1BA 2Z0MA 2JAQA 1PMRA 2NG1A 2WWIA 3A1SA 1EGAA 4PZ7A 4JJZA 5F9HA 4BFWA 1EFTA 3AGQA 1E2FA 4IOLA 5FOXA 4Z1MD 1E2IA 1KIXA 2J3EA 2BMEA 3QKRA 4L4UA 4B47A 2ASBA 1S4QA 3O8DA 1H8ED 4XVUA 4C7OB 1UFQA 3I4LA 1VQGA 4Q01A 1EOVA 4Q66C 2VL7A 1GHJA 1VS0A 5FOTA 1FMJA 2EW1A 1R5BA 4M9QA 1S96A 3M85A 1NJIC 1P2TA 2GRJA 4FCVA 4A4IA 4GP6A 3RRYA 4B74A 2MO1A 1R8SA 4QJ3A 1VHTA 1XZQA 4KJZA 3TSZA 4A3FG 3WNBA 2QF7A 1Q81C 1E9AA 4QGFA 2XB2A 1QG2A 5KDLA 2PMKA 1GUNA 1KI9A 2D74A 4Q4JB 3UE0A 1G7SA 1X3EA 5JZVA 4DV2L 2BBSA 3LD9A 3S1AA 3KTAB 4JLOA 3TK1A 3U7EB 3KFUA 2CE7A 4X6AH 2YC2C 3L7ZC 1UEBA 1MRSA 4B3MQ 3AVPA 2CLSA 1X55A 1R10A 3GJ0A 4OJQA 1L7VC 1T5IA 1XMIA 4HLCA 4HZIA 4RVCA 4UNNA 4IPCA 1NJGA 5FPYA 4AYBE 4EJSA 4W7SA 4X65Q 3EC1A 2G1KA 4MH0R 2QENA 3K80C 4TMVA 3KLRA 3QBTA 3SJBA 3VU9A 4IVPA 5H1SE 3OTOL 2C9YA 2JLQA 2KHIA 5JJIA 2KWIA 4QBGB 2P2LA 5IK2D 3K70D 1J90A 3I1FA 5M3FG 2AD1A 2ZXUA 2NVYH 2GCOA 3VU9B 1DCZA 3W5JA 3ZVNA 8OHMA 1UWVA 2RH5A 1WE2A 1VQLA 2BC9A 5CK4A 1MKYA 3LW8A 2XTNA 1UKYA 2C77A 5JWRA 3Q7QA 4YWKA 4E5UA 1KI7A 2VBCA 2GZHA 1Y8PB 4B3SL 3CCSA 2GCOB 1N6LA 1G20E 3SBEA 3CXCA 1DO2A 2WHXA 2QI9C 1A7JA 4JYAQ 4JZKA 4KBFA 3UMRA 2G83A 2HHHL 4LFAQ 1E1QD 3GJ7A 4KFTA 4YMWA 3SYNA 1K83H 2CMKA 3CAMA 1XBTA 3BXZA 3AH8A 4R98A 1J8YF 1ZU4A 3EC2A 3T15A 5FPKA 2BEJA 4RFSB 3T51B 4YHHQ 3UXMA 3W6PA 3A1WA 3N5CA 2J7KA 2W2VA 4FIDA 4DV0Q 3IQWA 1T6NA 5IYBH 1CR0A 5IF9A 3K70B 2GWHA 3JZAA 1XNRQ 2CW0C 1U0HC 1WB9A 5EJEA 3CC4A 1O7LA 2F1IA 1JPJA 1YZKA 2WWWA 5HZHA 1L0WA 4P72A 3BFVA 4GMDA 1EQQA 4LJ6A 3U6BA 1JALA 3F5FA 3KKNA 4JCVE 4DR1Q 4MGKR 2D62A 1KRSA 1GL7A 4Q47A 4DSNA 3DKPA 1XU4A 1C0AA 1IJEA 1RIFA 1LM0A 3M4OH 3CC2A 2ZI6A 3K9NA 2UU9Q 1HQYE 3GEIA 5EP3A 4YXWD 4GKJL 1R8QA 4O3MA 3AKYA 4Q18A 1YNNC 3A8KE 2JK8A 3CX8A 1JR6A 3QKRB 4DRZA 3SR0A 1XRJA 4YC7A 1UE7A 1YNXA 2PEYA 4GOJA 4B2IA 4C7OA 3OW7A 3WNCA 1NY5A 2DY1A 1IHUA 1NLZA 4TT3D 4UNQA 4Z8XA 3SS8A 3L43A 3WY9A 4LHYA 4DLYA 3GTGH 3QG5A 4LUOA 3AUXA 5J5CA 5EE9A 1AH9A 2CCZA 2G6BA 2GZDA 4C0BA 1XNJA 3BOSA 1JMCA 1EG7A 2AR7A 3GPLA 4Q9KA 1CI3M 1H9MA 4U00A 3U4QB 4XH9B 2C78A 5KNDA 1NBWA 3FFBA 3TQFA 4C0AC 4QHSA 4RD1A 3W34A 3P27A 2OCPA 2F1MA 4EX5A 1Z2CA 5IYDH 2OWOA 1RJ9B 4TVAB 4C2TA 5KYKA 2K32A 3OHMA 5EE0A 2DBYA 3DL0A 2W0MA 3P26A 4QM6A 2FGKA 1A2BA 2GAOA 5L3QB 4JLJA 4A92A 3SQWA 1NMYA 2QMUA 2BH8A 2QROA 2REXB 2PPBC 1VTKA 3OW2A 5FL7D 4A93G 2JJQA 1JB7A 4Y0AA 4Z1MA 1A0IA 3BH7A 2ZUCA 4LJ9A 1A6XA 2G9NA 2CK3D 4ESVA 5FUXA 2CKZB 1TWFH 2JLVA 2AKWB 1XCMA 2ORVA 4QOSA 1QRAA 3SJZA 5CJPA 2JLWA 2QTHA 4DWJA 3I4OA 1QZHA 1N8RC 5EP2A 5LB2A 2Q9BA 5FI0B 4V0NA 1MO5A 3LX8A 3H0GH 4F7WA 1OKKA 2A69D 4IJHA 1W0JD 1CS4C 2DHRA 3D31A 1KO8A 2WKRA 4FMCB 4JLDA 1ZC3A 2IXFA 5UKDA 1KZ7B 2A69C 3UDGA 1RYHA 1KZGB 2GBLC 3EZ2A 5G53C 5JCZA 4IVRA 2DWPA 4MKHA 2QM8A 2VHUA 1VYUA 4BY7H 3OESA 4C3HH 4HJ8A 1BYUA 1MRNA 2IYWA 4AKEA 2RKOA 2ANCA 4R4OA 4R4IA 1EWRA 5FBQB 1P2UA 3GO5A 5J4LA 2Q8IB 5C4XG 2RGEA 3E1SA 2BJWA 2RGNC 4NB3A 1N32Q 1KHTA 2IF2A 2IHYA 1FP6A 1HR0L 2G0TA 5HCNA 2CNWA 1H9RA 1T0HB 4RZUA 3CB4A 3KDFA 2ZRCA 4OGQC 4LJYA 4Z51A 1OIXA 2PH1A 3EQLC 3OIVA 1KSFX 2VQFQ 1G18A 3SDZA 4L5BA 1AS2A 4JLMA 4LJ8A 3G5UA 4W5JA 3NBHB 4DK6C 2F6RA 2ZETA 3TSWA 5JRJA 2GDJA 2LKDA 1BBWA 4DV1L 1VQMA 1WOCA 1NVXQ 4YQFA 3M4PA 4LUZA 4L5SA 1OW3B 1YRBA 2J45A 1FX0B 3LQQA 2OBMA 4KU4A 5K36H 1UE1A 4TSFA 5K8UA 4Q1AA 1T3LA 4PC6A 4O0AA 3J81i 5M5XH 4Y7NH 2GA8A 2JCSA 4HDOB 3U58A 2BOVA 3CPWA 2PBRA 2WJYA 2K75A 4JI2L 4D81A 1ZJ6A 2CFMA 4Q02A 2ZJYA 4HYYA 2HT6A 2EFDB 3QXCA 1EUJA 5EXXA 3W8RA 3FFAA 4B3TL 1DXMA 3W1BA 1TL7C 2QUZA 2JLZA 3ADCA 1NG9A 4MUAA 4LFCL 4JI3L 5SZJA 5DE3A 4A3IH 3HFZB 3PCOB 1YJNA 1BOFA 3H3VI 4MRPA 3CCJA 2WPDA 1KI6B 2ZM5A 1HZAA 1F2TB 2O5JC 3H1TA 1TADA 3BB3A 621PA 1NKSA 1D9XA 1KDPA 5DLQE 4URZR 3CRKC 1EIYB 1N33Q 1UBGA 1KJZA 1X8JA 3QENA 4KLNA 1BMFD 3ECCA 3QXSA 5G40A 1XMSA 4TTPA 2PCJA 3EZ7A 4JYBA 1MH1A 4IPGA 2OFXA 1XB2A 3ULJA 2KA7A 1BYIA 1FPMA 4BFZA 1GRQA 4A3CH 4I1OA 4YCVA 4RCZA 1GUAA 3X1XA 2KCTA 4OWTB 4X64Q 2UXCL 1Z0JA 3B1XA 4FWIB 4AYXA 4DLVA 1IXRA 3UPUA 1XMOL 1YJ5A 2JATA 1KI8A 1E3MA 2R6GA 1PVOA 2WIAA 2EQSA 3ICQB 2R2AA 2K33A 4A3BH 3UE1A 4GL2A 5EQTA 2K14A 4DLUA 1R7RA 1TTTA 4BBSG 3A7LA 521PA 3X1ZA 4BFYA 3VKGA 4D2IA 2V1XA 1XPOA 1D2MA 2FPMA 3LY5A 5HZKA 5L3SA 4D25A 4YHHL 2SHKA 2Z83A 4F4JA 5IE8A 4X66Q 5KDOA 5KPJA 4I1SA 1R5NA 2GESA 3MXUA 1KJYA 1GD7A 1E1RA 1VPLA 1ODFA 4ERNA 4JI4Q 4J0QA 4K0KQ 2CCGA 2QQEA 2Z4SA 3CCQA 2G1JA 3BB4A 1DAKA 4OO1I 5JEAG 4AURA 2ZREA 4BFTA 3KDSE 3PUXA 5LPNA 1N2CE 3AVQA 4P0TA 5FUWA 4BFVA 4UNRA 2DNEA 2A5YB 3QG1A 3K0EA 2B63H 4QY7A 3CD6A 4B3SQ 1G8GA 4P4TA 4XSHA 3TS0A 3VA7A 2AK3A 5AUPB 4DR5Q 2TMKA 3BFXA 4N3NA 3RAPR 2O8CA 2F9LA 2EYUA 2OUKA 4NYMQ 2IS6A 3LVRE 2EWWA 1IONA 1LFDB 4GMXA 1R0WA 4TMTA 3VR3A 2V3CC 1E2KA 1LF5A 3B5JA 1SXJA 4P31A 1PJRA 3NVAA 3EIQA 3KDFB 1NRJB 4LI0A 4LHVA 4KN4C 4L5TA 4JI6Q 3MCAA 2RHQB 1VIAA 3B60A 1GTVA 3I3SR 1SQ5A 1TWCH 3HOYH 4A3IG 4ZKDA 1HZ9A 2BWJA 2FFQA 4HEJA 1E1RD 3GEEA 4X8LA 2BH2A 5LMNW 2OO7A 3OYYA 4DV3Q 4AIIA 1QHGA 4DLXA 4EKDA 3NBZC 4Q4JA 5A35A 4DEXA 5DN6A 3NELA 4US2R 2W2XA 4HJAA 4UJ5A 3H0KA 1E9CA 1I4TD 3T12A 1UBFA 2P6UA 3PJRA 4TLCA 5HR5A 4MGYR 3WYFA 1G6HA 3W6OA 2Y0SE 4NCJA 4DBLC 4Q7JB 3UK6A 1JEDA 5C0XI 2J0QA 1IXZA 1TWGH 4W5WA 2AHOB 3VHXA 4B34A 4LYFA 2FFBA 4M21A 3EG5A 2YOGA 1DEKA 2EJFC 2FH5B 1PZNA 3THYB 1Z8FA 1AJEA 4LF7L 1N6NA 5DHFA 1CRPA 4APVA 1KK3A 1US8A 1LW7A 1ZIOA 1E0AA 2JLSA 2A3RA 1VCOA 3LH5A 2JA6H 2GCNA 2JLRA 1MO3A 1YNJC 1AIPA 3FKIG 3L82B 2JLUA 3AVXA 4BBRH 4HB3A 5DN6D 1Y1VG 5H1YA 1LACA 2F4VL 1VF7A 3MWKA 1IQPA 3VTKA 2F3IA 4FMCF 4NP6A 5JHGB 5IT9c 4KLZA 4A2QA 2P67A 1OV4A 2QAGB 3KUCA 2F9MA 1G5PA 1QHHA 2QP4A 3TKLA 3TVTA 3LXRA 4IFDI 1E79D 1XP8A 1TUIA 2WWGA 4TLEA 3A1UA 4NCIA 1ZYUA 4GPTA 1Z22A 1Z47A 2CHQA 4TMZA 4MITA 2AWNA 4V0MA 4BLSA 2VQEL 1R6BX 2GJSA 2BBOA 4DK1A 2HHHQ 4WOPA 2ZRNA 4E03A 3TUJC 4YCUA 2UXBQ 2JA8G 2W6IA 3DVLA 4XJXA 4D4MA 4HUTA 1OPXA 2RGCA 2JLXA 3K0XA 2LXJA 3TREA 4KFUA 3KJHA 4XSGA 4XVQA 3CMAA 1COWD 5JCPA 4IFBA 4JOIC 2VSXA 4TL9A 4ZDKA 4WZ6A 2WMOB 3IHWA 5M3MH 1T3HA 5BW8A 5H8WA 5A5GA 2J59A 3E2IA 4FXPA 4NBSA 3U61B 1JNYA 4LK1C 4JKYA 4PQFA 3AKDA 4ZIRB 1PHJA 1I2DA 1FMLA 4B3RQ 3NDBB 3G71A 2O8CB 4C3ZA 1S72A 1Z6TA 3QXHA 2KCMA 5JS7A 3PUVA 2I1VB 2R8RA 5FTMA 4JT4A 5B2ZA 1I94Q 3KYHC 4B3TQ 1ZNWA 1OT3A 1O3YA 4ZIRA 4YY3L 2NIPA 4LFCQ 3K7AH 2ZRBA 3HYTA 5J4HA 1Q3HA 1QZXA 4UPAA 1W2GA 2F7SA 3N2IA 2IWHA 1V9PA 1HV8A 2QSYA 2FNAA 4N0DA 2OBLA 1M2OB 3B6EA 1N6RA 1ZM4A 1X9NA 3BAFA 3I8SA 1VIYA 3CP0A 1SE8A 5AJVB 2VLIA 4B33A 4DEYA 4AIMA 2VH5R 3RRNA 2FA9A 2K4KA 3R8FA 2RAPA 3KJIA 4HUQA 2CLCX 3DOFA 1HE1C 5EZ5A 1HTPA 3WMGA 2WJJA 2XNSA 2PZFA 3IBYA 4R4QA 1I3QH 4Q1CA 4QKQA 2C95A 5CLLA 3FTQA 3F2CA 1W2BA 1VMAA 4LBZA 2N42A 1TUEA 1NN1A 2WZQA 3HU2A 1GILA 3FPPA 1NBME 1OFIA 3FMPB 1IOZA 4GN3B 1OFTA 2FJUA 1L1OB 4TYYA 2QMOA 3CRRA 3P4YA 1NF3A 4OI1A 3KQHA 1IN6A 1DAIA 1NJFA 3THYA 1LYLA 5DYGA 3KL4A 4D4LA 1NNEA 3GLFB 2NTYC 3BC1A 1TX4B 2AD5A 5JSZA 3NBYC 1GL6A 3VKHA 3S16H 2ES2A 4P3YA 4R7ZA 3GJ4A 4XD7A 3IO5A 1VQDA 2ASEA 3T35A 1G3IA 3CZQA 3VX3A 2AXNA 3CWZA 2LMCB 3K0CC 3KJGA 3VNUA 2QRNA 1O7IA 1OH7A 3U7GA 3BGWA 1CUKA 3D8BA 2V6IA 5L3QA 4O2LA 3GLFE 2IHEA 1JJCB 2JA5G 2QAGA 4PSAA 1OXSC 3ASZA 1U90A 1V43A 4Q4AB 1CSPA 2A30A 1FYCA 3CRMA 4LPSA 3AFQA 3AEVA 4BZQA 2JEOA 2O8FA 2IXEA 1F2UB 2QNRA 3MUFA 5FBWB 3U3RA 2O8BA 5KNCA 4P75A 1FP7A 2QAJA 2B8GA 5E7MA 3WBKA 4IDOA 4PPFA 1M34E 3P4XA 1G3QA 4II7A 4I99A 3OAAD 4FWTA 2EVWX 2WBLC 4Q00A 2MNAA 4JYAL 2IA5A 5IWAL 2B63G 4TYNA 2O8BB 4GKKQ 5EP4A 1SVMA 1N5LA 4EJSC 3K9LA 2PCFB 1X1RA 2E8GA 1JBKA 1ZAKA 3AFPA 3A1TA 3NBXX 5AUQA 2OLJA 2XJ9A 5TXGA 2EFGA 1SVSA 3WHLA 1H8EA 2EFHB 1UBEA 2GETA 3TNFA 4ZDJA 2QBYA 4TT3A 2V1CC 5M5YH 4BXXG 3I92A 2MFIA 1U2RA 5JEEA 5KU1A 1ZD1A 2R92G 2DWOA 2PLFA 3CIOA 4KO8A 1YHNA 2JDIA 2VNUD 3NIBA 4ARZB 5BWMA 2QBYB 1TNDA 1D2NA 2IW3A 1U8ZA 2J1LA 4Q9HA 3WNDA 2WIBA 3A8IE 3QXJA 4KFRA 4M1TA 5AR1A 2DPXA 3T1TA 1NVWQ 3C5CA 2IUUA 3F3YA 1SN8A 2O8DA 2MMCA 4R2HA 1NN5A 2VP9A 4NE2A 3SZRA 5CB6A 1TQDA 2FDCA 4YMVA 2IBMA 3J80i 3F2BA 1QVGA 2RGDA 4IXMA 3UMSA 3HOZH 1KJWA 1ZU5A 3ZIAD 4GOPA 3LFUA 4B3BA 4UP7A 3Q72A 1T0JB 2R6CA 4S35A 1YHAA 3CMEA 2H5EA 2WMNB 1AZSC 2JLYA 1Z0FA 5FTNA 3FPAA 2E76C 3DZ8A 3B8HA 3PGZA 1M74A 3WWVA 4NCKA 1Q1QA 4YWLA 2Q2IA 4A3LH 1KAGA 1N6HA 2OFWA 2WAXA 4NPSA 4JBXA 1ZNYA 2ID0A 1I6HH 1JR3A 4EJSB 4JBYA 1XMQQ 4ON9A 4FI3C 1R0ZA 2HF9A 2REOA 3GLFA 4ILEA 5P21A 5IP9H 1HUQA 2GNOA 4JVNA 2BM0A 1GOTA 2A7QA 4AY2A 3ZVMA 1PH4A 1P6XA 2HXYA 4LCBA 4EDHA 3ADBA 4BLRA 5FL3A 3K0FA 1W36D 2GXAA 4GOPC 2G77B 4MA4A 4D26A 2BHRA 2YOFA 3MD0A 2IYRA 1XX6A 2A68C 2W6JD 4Q9JA 2HJGA 1Z6HA 5KDDA 2Q2TA 2LWIA 1M8PA 4X62L 3B1ZA 2UUBQ 3CRLC 4ME3A 3KZ1E 3QEOA 3I4MG 1CF4A 1IBRA 3NBFA 3R9XA 1W48A 2JJ1D 4MDEA 3LWUA 3ND9A 1M6NA 4JT2A 4MRNA 1P2VA 1NVUQ 1S2MA 4OI4A 3NEYA 2H8KA 5JS8A 4NDZA 4MYTA 3G48A 2D4HA 4POGA 2QGQA 1N5JA 2FPLA 1CULC 2O0JA 4YMTA 2AUJD 3Q7PA 1D2EA 2FPKA 2KBNA 2A6ED 3OOCA 1GJXA 4C3IH 1OIWA 3RS4A 2QT0A 3CH4B 1H9SA 1F5NA 4JG2A 2PZGA 2VHQA 4A6XA 4A82A 5B58C 4M1MA 5IK2A 3J7ZC 1OH5A 2NVXH 4NPHA 4LF9Q 2RGGA 2GEVA 4M9XA 4ACAA 1FTSA 3GTJH 2WB1E 2IX1A 2WOOA 4I1UA 1N3BA 4Q1FA 4G7OC 3EIHA 4JVLA 3SU8A 3ZJYA 3RN5A 1KQSA 1G16A 4RFSA 1KI4A 4L5QA 2CL0X 4LF5L 2ATWA 1JI0A 2GXQA 5D3MB 4D4JA 3Q5EA 3IIJA 4OKSA 3SI7A 3NHAA 2Q3HA 4B3DA 1L2FA 1W49A 1NSFA 3CF6R 4MGZR 2IS1A 1JR3D 3W9YA 4IPDA 3EX7C 1JJ2A 3ZH9B 2A6HD 4JI8L 2HLDD 3AKEA 4PTLA 4RZ3A 4DV0L 1NKTA 5IDVA 3N6RA 5C4XH 3RHFA 3Q85A 5KO2A 1XPRA 3M1IA 5ELXA 3RR5A 2D06A 1RKBA 4PHFA 4LOAA 4U02A 4OL0A 3A4NA 1ELOA 4HDCA 2QQ0A 2X8AA 2QTFA 3FE2A 1W0KD 1MABA 3EN2A 1OXVA 1AKEA 4CT5A 1W36C 3BFKA 5KOYA 1S0UA 1U98A 3PENA 3GLIA 2Q9AA 5IYCH 3RLNA 1RRCA 4DIDA 4BXXH 3K9HA 1WCMH 2BMFA 4JLAA 3E0EA 3CR7A 4IVQA 3H0GG 1IBLL 2CVHA 2AFHE 2OG2A 2ONKA 2VHCA 4UKDA 5E95A 3WMEA 1W36B 1MO6A 1RJ9A 5HE9A 3O8CA 4OHXA 5EXTA 4DLTA 1AE3A 3EZ9A 2VZAA 1Y69U 1Z0AA 2ZVPX 3K8YA 4BFUA 4OONA 4DVGA 3OEED 1XNQL 3OAAA 3I56A 3PO3G 5CYOA 1Q57A 1Y1VH 2KE5A 4GI7A 4LBYA 3ULPA 3RLFA 1W44A 2J87A 4LF6Q 1QHNA 2RHDA 1LNZA 4C2MH 4LY6A 4DR4L 2OCBA 4RZ2A 3RS3A 4C4PA 1XJQA 1U0JA 3S1AB 3U4QA 3B6YA 2NVQH 2BDOA 2ZU6A 3G82C 2V54A 4OJKA 4X65L 1L4YA 2AL7A 1ZCBA 3LX5A 4CDGA 5JBQA 3BG3A 4FMDF 4OQNA 3GTQH 3GLGA 1C9KA 3K1JA 3KQUA 3CF5A 1G7CA 2OCEA 4V0KA 1AM4D 1IY2A 3B2EA 2I5LX 2IWRA 4TTQA 2IYSA 1G8HA 2UXDQ 2PJZA 1E7ZA 2ZI4A 2ZYUX 3PG5A 4DCNA 4ZI2A 2X19A 4MNOA 3RS2A 4DB4A 3PUZA 4KODA 2Q0HA 4KN7C 3UG7A 1VQJA 2ZI7A 3ZLJA 3ZJYC 3MAAC 1NY6A 2PI2E 3ETLA 4WA7A 3PCRB 1YZGA 1OTCA 1G4AE 2PZEA 3GFTA 3IIMA 5FH9A 3H94A 2ODNA 1U8YA 3FDIA 3EPLA 5F3WB 1B70B 2D2CC 5LMNL 1T8TA 2RMKA 3N70A 5BQ5A 4ASUA 3T53B 3CPJB 3S17H 4AKHA 3W5IA 1KKLA 3H2YA 5JEAJ 2Q2UA 1VG0B 4GRAA 4C0KA 2A5JA 5EP1A 2RCNA 4EQ6A 1FL0A 3NG1A 3CR8A 4RFVA 2R44A 3I73A 3CLVA 1YJ9A 3TRZA 2VQEQ 1SROA 2BIFA 5A4JA 2B8TA 2H57A 2YNMA 1SVIA 1ZCAA 2BE5C 2B8WA 4O0MA 2K52A 4EQ5A 3LBIA 4XD7D 2UUAQ 4ITRC 1EIFA 1D6JA 4R1JA 2ZPTX 3EWAA 5CITA 5BYKA 5J3BA 2KBFA 3A8TA 3B82A 4WIAA 1KIMA 1JPNA 1IBML 2IS2A 1E1QA 3QF7A 4A6PA 4A8JA 3X2SA 1W4CA 3R20A 1DAGA 4WZAE 5DGXA 1II8A 3CPEA 5JWHA 1G6PA 1XCPA 3SQXA 2ZRFA 1TWAH 4CYMA 2K7VA 1VQ5A 1W2HA 5IP7H 2ALYB 1COWA 5C4MA 2DUDA 4Q4LA 1G51A 3I32A 4FW9A 4X8MA 1KRTA 1N6KA 2JDID 1NVVR 2LCFA 2VTKA 2XSZD 5AJZA 3K81C 1P73A 2ZRLA 3CPFA 3HOYG 1G1MA 3DPUA 4HLDA 1E9RA 1AGPA 1VG9B 3QKUA 1EESA 2K5UA 2QAGC 4QGHA 4LW1A 4DR6L 2FX3A 4G5RA 4LK2A 2GILA 2W0SA 4M2LA 2GCPA 1FTNA 5BN4A 5JMTA 3C15C 1SKQA 3O47A 3TUIC 2Q21A 3EARA 4D4KA 1Q90A 2VW9A 2JA9A 3J81j 2GJ9A 2PI2A 1SULA 3RWOA 2JA8H 3IGFA 4TTRA 4HIDA 2UUCL 2H17A 3BJIC 4Q1EA 3NC0C 3QUSA 2FSFA 1TQ6A 1B7YB 3EWSA 1ZUNB 5AJWA 4H44C 3S1RH 5LD2C 1RRPA 2ZYTX 3U3MA 1ZUHA 3KF6B 2ZS7A 4LYHA 2PQAA 1YR7A 3KB1A 2NPFA 4WJ4A 4AG5A 4H9GA 1UEIA 2OILA 4OQXA 3UDFA 2JA5H 1JR3E 3CW2A 4GZLA 4JS0A 4MRVA 1KI2A 4YLGA 1UF9A 3NDPA 1QHSA 3LA6A 1VDZA 5CM9C 1J8MF 4KHPL 4WZBE 4CW7A 2P3SA 3Q8DA 5KTYA 2I1QA 2QGZA 1WBDA 1IN4A 2OQKA 5HPYB 3K09C 4DSTA 1E0KA 4UQOA 3RZOH 2ZJ2A 3T1HQ 2E2JH 4EPTA 2BBTA 2IS4A 3GQBA 3VMFA 4DCVA 4DR1L 3IUYA 3QXXA 1SHKA 3CZPA 1PA6A 4Q7MB 5C0XG 2V1UA 2WAQG 4JMPA 4W9MC 4RZXA 4HJ7A 1XEWX 3KJOA 2N1BA 3GLHE 4ZDWA 4LFAL 2CE2X 4KYUA 1KMHA 4WBSA 1OYWA 5SZIA 5TB5A 4KLKA 1JT8A 4LFBQ 1RPZA 3STBC 4PPQA 2ATVA 1SGWA 4PO8A 3VFDA 4XOIA 3KXKA 2BKUA 3QE0A 3ZVRA 2VQFL 1SXJD 4URXR 3ZVLA 4DV4L 1I6VC 1S8FA 1XEXB 1OHHD 3AVYA 3LXXA 1QVRA 3NENA 5FTJA 2JXMB 4BLOA 2OTLA 3CCMA 4GOXA 2O52A 3A5UA 2ZAMA 4LSGA 2ZT9C 4DLWA 2ZYWX 3AV0B 1CKEA 2XAUA 1XMVA 2KENA 1XPUA 4Q4HA 3WYGA 4EUNA 1KY2A 1XNQQ 3EA5A 4HUQB 2ZM6Q 4NXNQ 1FUUA 2XNDD 3D6TB 3ZDQA 4ZCIA 2WTUA 1E9DA 3FWYA 5SZKB 3UG6A 2JJ8A 1A62A 4GFDA 1G41A 1T3SA 4JL5A 3AB9A 4AD8A 2NN6G 4M1YA 4Q19A 3GJ6A 2YU9H 1L4UA 2AX4A 1KSJA 3U4ZA 3I61A 4RD2A 2ZQ5A 3WHKA 1US8B 1YU9A 2REBA 1VG8A 4D0LB 3U4VA 3EASA 3QI2A 4I81A 4LX0A 5LB4A 3X1DA 4DLRA 3EPHA 2EFCB 1SKYB 3NTUA 4I4LA 4CRWB 3RANA 5GADC 3SFZA 2ZI5A 2MSCB 2AHOA 4NYJQ 1Q12A 2FN4A 4LWZA 1PH8A 2ZRJA 3B9PA 4LDJA 4AKIA 1KAWA 2HYDA 3IEVA 5DO9A 1YZ6A 5HGQA 2X77A 3PUWA 2FU5C 1XTSA 2ORIA 2XGJA 4LV6A 1N34L 5FLMH 4MUBA 4DDUA 3AF2A 1X3GA 4OXPA 1J2JA 1PUIA 1GUSA 2EYQA 1ZD8A 1KK2A 3CO5A 4P33A 3B78A 4PSVA 2A2ZA 2D3WA 2QE7A 2E75C 1AS0A 2JA7G 3HJNA 2WWFA 1IN7A 4OWXB 4QQBX 3HYRA 1E79A 3FOZA 4IDHA 3AQQA 1R9TH 1E2PA 1C4OA 2FSHA 4PR0A 3V9PA 4A0RA 4TZ6A 3U3OA 3AF1A 2OXCA 4DUZL 1P3JA 1CKNB 1FUKA 2ZR7A 2ZSDA 1GKIA 3QOFA 1SVWA 2NN6I 2HDNB 5IYBG 4C0JA 4CGZA 3U44A 4QHYA 3ULLA 1G6OA 1IYJB 1HURA 4TLDA 5C44H 1YEZA 1KGDA 4LBVA 3QIAA 1UE5A 3LDAA 2E5LL 3CNLA 3T34A 3EIVA 1E96A 3T1VA 4DUYQ 5JHHB 1VQ8A 3U44B 1L1OC 4JI0Q 3IPXA 1I94L 2YHSA 2H16A 4IOCA 3CBQA 2N3SA 2CNWD 5C4JH 4X62Q 2B6HA 1E2GA 1HTWA 2OBNA 2VF7A 4L8GA 4B3CA 1M7HA 1ZBDA 4F93B 3PIOA 3KKOA 3VR2A 5CIQA 4AQYQ 1H9KA 1P7CA 3GMTA 3W8NA 1Y1WH 4QRHA 4DXAA 2ZJ5A 4B73A 2A5DA 3OEHA 2C2HA 2XB4A 4LC0A 4R9UC 4MYHA 1CJVC 4V0OA 4CZ2A 1HZCA 3SC3A 4O2RA 1CKOA 2DN8A 1TMKA 5GJWC 4V0ME 1Y63A 4BRWA 2O8DB 2UUAL 3T5DA 1HEIA 1ZUIA 2ZUDA 3IFTA 1KSGA 4MKFA 4R4CA 2IYUA 2J7PA 3HOVH 3K09A 5IYCG 2N8NA 4BWYA 3TMKA 4IRUB 1E4VA 1Z29A 3GTLH 2UVQA 4M1WA 2YOHA 4LJZC 4B2PA 5CDFA 3I8XA 2BBWA 3KOJA 1YZQA 1L1OA 2ZSEA 1OJLA 3H86A 1IAQA 3A6PC 1CIPA 2NZHA 4PQYA 4WXRA 4MGIR 3DKVA 4TL7A 1ZIPA 5ANRB 2H18A 3OFNA 3CPHA 3KQLA 5A0FA 4DR2Q 3FHOA 5JSZB 2IHBA 1V8QA 4Q48A 3QPWA 2HXSA 1MKHA 1UKEA 1B23P 3DHWC 2PNHA 2VO1A 1R4AA 3TGPA 2XTIA 3QF4B 1XEFA 4OHZA 4P74A 4YMSA 3SYKA 1E9BA 3PIRA 3FKSA 4BA1I 1H8HD 1WMSA 4KSBA 1Y8NB 4EPRA 3I5XA 3IKJA 1HQMC 1N33L 1PFSA 1X1SA 4B3ML 4NYIQ 4DLZA 3J81c 2FFAA 3W3ZB 1XJ0A 3ZZ0A 1QHYA 1FQJA 1E22A 3NKVA 3K8AA 4LF4L 4A3DH 4ALPA 2RGNA 4A3MG 4C0HA 3A58B 1DADA 1ZMXA 1VQCA 2ZJBA 4IFDJ 2L5TA 3S2HH 4PPGA 2JA6G 2QL6A 2ZJPA 1IL2A 2GXSA 2AMCB 2OQ0A 1L8QA 4UNSA 4DIEA 1O78A 3THWA 4DR4Q 5BXQC 5M3MG 4OYHA 4X8HA 2YWHA 1KO5A 2E5LQ 3CRVA 2CJWA 3LQRA 1U5KA 4LFBL 1Z3IX 3KFVA 4LJ4A 4CEHA 3ADDA 4TZ0A 2XSZA 3E9IA 1TEXA 4Q4AA 2FXQA 2WJVA 4LNQA 1AS3A 4KYIB 4DR3Q 4B75A 4CIDA 3AVTA 4TYWA 1H9SB 1SR3A 1MJCA 4LRWA 4A1FA 1UAAA 3FMOB 2Y0SG 3W6NA 2CEAA 3DXJC 1W1WA 3QQ5A 1KHIA 1P8LA 4IKEA 1X65A 2QSZA 3CNNA 3CQZH 4TL6A 5CM8B 4LF9L 3FKQA 1XTRA 3E9HA 2FFHA 3BH0A 4RD0A 421PA 1II9A 3BD9A 4HAWA 1K0RA 4P4SA 2EDGA 3U9SA 3PF4A 3MFYA 1DO0A 4KKTA 1L2TA 2ZRGA 5EE3A 4DCSA 3V00A 2AN9A 2IYZA 1D8TA 1EWQA 5F9FA 3OIWA 1FW6A 3PEVA 4BPBA 4NKRA 2PT5A 1NMFA 4YONB 4A3MH 2J5XA 2PX0A 1NBMD 4GZYC 4J15A 2ERXA 2B7CA 5FUYA 2GVAA 5TV2A 4H1VA 5LMUL 2UU9L 1KK1A 3AVOA 1VQ7A 3TQCA 5IP7G 1GZSA 2I4IA 4KKUA 2GK6A 3QVUA 4EAQA 1E0SA 3GLIB 1IY0A 4EFLA 3JC66 2YV5A 2OTJA 2WB1G 1M1YE 3U3KA 2ZR9A 4FMBB 4B3XA 4RKEA 4GP7A 4PC1A 4JSTA 1Q3TA 2ZJZA 3M6AA 1IBMQ 2PLRA 1RE0A 4JVSB 1U8AA 4UXJA 1RRFA 2A9KA 1PLKA 2OV2A 3V4RA 3D7MA 4GSYA 1IM2A 4TLAA 2QZ4A 3RNLA 4HIOA 4QJFA 1BVSA 5L3RA 4DUZQ 4G7ZC 3I72A 5GJVC 3UMFA 3WBJA 3HOWH 2VHTA 1SRUA 1ZM9A 2YZ2A 3GEHA 4IW3B 3PV0A 2RHMA 1DD2A 3QKTA 4PZ8A 3T1YQ 3KTAA 2PMDA 5TARA 3TVDA 2A19A 1KTVA 2ZS9A 1JJ7A 5CB8A 2A6HC 5E7JA 1TU3A 1M90C 2PCLA 4HAYA 2A8VA 1W0KA 2VHJA 4HAVA 2H92A 2FZLA 1Q0UA 3L0SA 4LJAA 4GNKA 3C4JA 3K0FB 1XD2A 1WRBA 1X6OA 1HCZA 2HIVA 4BUJA 4LYAA 4R71A 721PA 2F55A 2QP3A 1ANKA 1WXQA 1NP6A 1Q8KA 4XWAA 5AJXA 5FL7A 3UDIA 2BEKA 1OKKD 3EBEA 5FBRB 2GVBA 3M7NA 1SFOH 5H68A 3W90A 4DV6L 1XD2B 2R62A 1CRQA 2CJWB 2C99A 4X64L 1F2UA 1TXYA 1RC8A 3BRWD 3BK7A 3M4QA 4M8NE 4WAUA 4TN1A 2C8VA 3ZIAA 4BECA 4C2UA 2RGAA 4G5SA 1WI5A 1Q1ZA 4Q9IA 4ZDIA 4GN4B 4ABYA 3VAAA 4XIGS 5AJYA 3RSLA 1SMXA 3BZKA 221PA 2CXXA 1OH6A 1W0JA 1Z63A 4WJ3M 1SHZA 2OCAA 2R7ZH 2QRZA 4KHPQ 1J99A 1P72A 1GAJA 2ZIAA 2IT1A 3IRBA 3IIKA 5TDHA 1IYVA 4G3XA 4GBMA 4JBKA 5C44G 2MSEB 4D82A 1HE8B 3PEWA 1EYGA 2A6EC 4DT1B 2HJVA 1UPTA 2QM7A 1E69A 1PV4A 1NMZA 3TRFA 2HIXA 4MYUA 4LBWA 2R93H 5JI3E 4P4UA 1DAMA 3UDXA 1ZM3A 4IHQA 4OK6A 4LV5B 3AUYA 1MABB 4QNRA 1X3FA 2V4DA 2DYKA 4XTRA 3DDCA 2L0XA 2G88A 4LF5Q 1G7RA 2W6JA 2VP0A 4HAUA 3RWMB 1TU2B 2XXAB 1E24A 2ZANA 1YQTA 4OHYA 3I62A 5ELOA 1DAEA 1N0WA 4KSCA 1SXJC 1Q20A 4A36A 1N6PA 3MWLA 2EJGC 3ZZTA 3AVWA 4IOAA 3GCGA 1ZNXA 3EW9A 4LF8Q 4RCYA 2YWFA 3I5YA 2VPPA 4DZZA 2AXPA 1W5SA 4L9SA 3ER0A 2JA7H 4ZCLA 2J7PD 2MO0A 2OE2A 2O5IC 2WFWA 2GVZC 3F8TA 3BDOA 5C2JB 1YHQA 2QPAA 4HI0E 3GTPH 4AYTA 2NO1A 2Q9CA 1PH6A 2ZRPA 4Q1BA 3S1NH 4MZ9A 2VP4A 3THXA 4C9BA 1Z5ZA 4LF8L 4GLXA 1Q46A 5K8IA 4KKSA 1DAFA 2C35B 4DLSA 2PMZE 2WM9B 3LO5A 1VQ6A 2B7BA 1DS6A 2N49A 4JBMA 1BDOA 2YJTD 5J4KA 5KPDA 1XEWY 4HB2A 4URVR 4PO9A 2K5HA 4KV9A 4ZPXA 3K70C 2NO9A 5L3SB 5M04A 1Q7YC 2XZOA 3ADKA 2IF0A 2Z6VA 1B0UA 3LNCA 5H70A 4A3GG 1BIFA 2W83A 4POAA 5FPHA 5JI2E 1VCMA 1YR9A 2W58A 4MRSA 3J81k 4P73A 4JLBA 1NMXA 1R0XA 2NO6A 4LPKA 4OBEA 2ANBA 3CKLA 1W7AA 4K0KL 1Q44A 4XTCS 3V4FA 2D0PA 1E1OA 2OFOA 2DFKB 2AKAB 2EFEB 4MYCA 2KHJA 3TH5A 5EAYA 4BLQA 3A5ZB 4B3RL 2C04A 4RY2A 2ECKA 3EXAA 1PUJA 3WDNA 4A76A 1NLFA 1PH5A 4QC2A 1ZC4A 2BVNA 5DLQC 1VHLA 4HJ5A 2QP9X 1GP2A 1RFLA 2V7QD 3MG9A 4YY3Q 1UADA 3H4MA 2QE7D 4NL4H 3EZ6A 4JL6A 2ZTCA 3G0HA 4IO9A 2OT3B 4FINA 1KNXA 3TR5A 3RNUA 2QEXA 3IPYA 5GADl 4QGGA 2CQOA 2CHVA 3AKCA 2QGNA 3PXGA 4AYWA 1TQ2A 1II0A 3ONWA 5BR8Q 3L2OB 4DT1A 5FFMA 4A3EH 2VP5A 3QJYA 5CJ2A 4B44A 3TUZC 4JI6L 2BV3A 3CONA 4KBGA 2QPTA 4M53A 3U6KA 4PG3A 1N32L 1G8YA 3KQNA 4M22A 4B76A 3LBNA 1P5ZB 4B43A 2FZ4A 3T61A 1UJ2A 4NHOA 3UATA 4YMUA 5FOWA 3HOXH 2QTVB 4A9AA 2OSBA 1CU1A 2CHGA 2J0UA 1YI2A 1LS1A 2KJQA 3QY0A 4AKGA 4URWR 1H95A 1EWHA 2F1RA 3GLHB 2XZPA 3JZMA 2FSIA 3BBPA 3NXSA 1GDDA 4H1UA 3UWKA 4WVFA 2YC4C 4IFEA 4F92B 4M1KA 1K8AC 1P75A 1G9XA 2HCJB 1LABA 4A0FA 2NZ8A 1GRRA 1N9WA 2UKDA 3AYHB 3IBGA 3A36A 1NN0A 3I4MH 1DG1G 4BEBA 3RZDH 4BE7B 1AA9A 1G5RA 4QGUA 2ATXA 2WJIA 3HPRA 4O25A 4DKAC 5JJKA 3KF6A 5KSPA 2DCUA 2J0VA 1VQOA 3BJUA 1ESNA 4B48A 1GVNB 1GVPA 2PL3A 4HIKA 1QZGA 3CCVA 2XEXA 1QHHB 4L8JA 3AP1A 1N34Q 4L9WA 3TBKA 3ZD7A 121PA 2R7ZG 3VKWA 1HJPA 3KLWA 1LS6A 1UBCA 4NXMQ 1UDWA 1YKSA 5FOSA 5GAHC 1EFUA 1HT1E 1C1YA 1U0LA 1EFWA 3S15H 4DDWA 1HH2P 3OEHD 4AC9A 3LGJA 2F1JA 4URUR 3TEHB 2PNRC 4C3JH 1HNXL 1A63A 1GKYA 1P2SA 1SKYE 2E1RA 1M7GA 1AN0A 1EX7A 3PQCA 3WXMA 1VQAA 5JLJA 4OI0A 1E2ZA 2R9VA 1Y8OB 3PF5A 1CEEA 1DVRA 3G4SA 1ETUA 2A78A 3NH9A 1HA3A 3F0TA 4DSOA 5BN5A 3HKSA 4DV6Q 1XJVA 3W3AA 2R6AA 2XTMA 2ZR0A 3DZDA 2OCYC 5EE1A 4BZPA 2YINC 3PO2G 1NIJA 1TF5A 4JJKA 5IY0A 5M3FH 1HNXQ 4QBIA 2GF0A 3AB3A 4LC1A 4HLUC 2YTVA 1N0UA 4V02A 3TS2A 1G3UA 4G1UC 1WCMG 1PH1A 1LVGA 1UM8A 1H65A 4PANA 1SMYC 4PC2A 4DPGA 4QBHA 4QL3A 1CP2A 1LY1A 1A2KC 1I2MA 2XOKD 4LUCA 4DUGD 5J4VA 3BE4A 3QSYA 4DAYB 2BKEA 2WVJA 4M9ZA 4TLBA 3G6EA 3RDPA 1P9NA 3TIFA 2G3YA 2F43A 2DFTA 1EFHA 1CXZA 2Q3MA 1P9WA 1BS1A 3ND8A 4RJLA 1ZVQA 1KO4A 2GXUA 1E2WA 3SGIA 4N1AA 1TEVA 3SBDA 4AI6A 1KC8C 1XTQA 4GLAC 5FOUA 3LAWA 2IHFA 3IO3A 4LZZA 4QBFA 4NYIR 3GD7A 2D2FA 3DOEA 4B6EA 4DC9A 3CCUA 2GKSA 3STBD 1XDBA 4CF7A 2E9SA 3Q3JB 1GUTA 3B1WA 3C14C 4JBWA 4A3CG 4P71A 1UEJA 2ZRDA 2BA0A 1QHXA 2MSDB 2UZ3A 4WXPA 4EFNA 3ZD6A 4CEJB 2VP6A 1RVDA 4A8JC 2NN6H 4DR6Q 3QBVA 4O2DA 4MDFA 1FR3A 2VA8A 1XMQL 4XWKA 3IHLA 5GQOA 4OX9L 1A4RA 2ZROA 1F2TA 3P1JA 4EFMA 4R2IA 1LTLA 4N0EA 4TL8A 1P60A 1I50H 3F2DA 4L5RC 3JVUA 3K0AA 1JQLB 3T06B 4G5QA 1XD9A 2QMEA 3PIPA 3EZFA 6Q21A 2VSFA 4A4DA 4B3GA 1SLJA 4UNPA 4DJTA 2W6ID 2ZITA 3QKSB 4HDQB 3RS5A 3REGA 5C46F 2A1AA 4DR7Q 3RABA 2IX0A 4KAXA 1XWIA 3UWOA 2ZRHA 3C16C 1RL2A 3F1ZA 4PZ6A 1SVKA 2X2FA 3B1VA 3CRW1 5KUTA 1K8MA 1K8RA 2FOLA 2NPIA 2WV9A 5DNYB 4UXIA 3H84A 3QKSA 5FBLB 1U81A 1HNWQ 1Q22A 2UXBL 2YYZA 3R9WA 1QBKC 1YJWA 1XCGB 2UZIR 2WSMA 4OK3A 4UP8A 1OFUX 4OI2A 1QVFA 2JGNA 1DPFA 4ZI3A 1E2DA 5BYJA 5DH9A 2LSSA 2BJVA 2XOKA 4PHGA 2PJRA 4CEHB 4UY8C 2FGJA 5C0XH 4JI4L 3HU3A 2UXDL 3WRXC 5HKKA 3U5ZB 1J7KA 1Z6AA 4C0SA 2NZOA 4HB4A 1EWIA 1CKNA 1Z07A 2O5VA 2Q3FA 3KKQA 2ZJAA 3R7WB 4L15A 4Q5IA 1SZPA 3FYHA 1VCIA 4JOIA 2WKQA 4ACBA 5CK5A 3HKZG 3REFA 4A2WA 1ONLA 5C0XJ 1HNZQ 1T4GA 1TF7A 2LKCA 3PSIA 1YZNA 2ZI3A 4DV1Q 4HAXA 4JKIA 4RD4A 4TMXA 4OO1H 2NGRA 5LMNQ 1HR0W 4URYR 4A3BG 1XXHA 5JECA 4P32A 2WKPA 2JE6I 4GNXB 1CTMA 2J0SA 1E4YA 2FG5A 1LTQA 4P4SB 2ZUBA 4EPYA 4CEIA 1FL9A 1W4AA 3HP1A 2AUKA 4IPHA 2F3RA 3UIEA 5CYPA 1KMQA 4BFXA 4GKJQ 2OM2A 4JL8A 1YBYA 1B9MA 3A74A 4YWMA 3X1WA 1WP9A 4IFDG 4LHWA 2BA1A 2GHIA 4ZV4A 4NZYA 2OEPA 1CTQA 1CKMA 1E2VA 2ZYVX 2ERYA 2EXDA 3BB1A 3Q8XB 4JK1C 3NE5B 4PAMA 3EPKA 1GIAA 1YZUA 2H1LA 4K81B 1ONBA 5SZHB 4A3KH 1FQKA 4TYPA 3RRZA 1CJTC 3B13B 5FOVA 3DM5A 4PSKA 2K5VA 4ZO4A 3RRMA
chains in the Genus database with same CATH superfamily
2K6AA 2O2XA 2PGLA 3C3JA 4MR8A 1X6VA 3DOUA 1SCUB 3RIYA 1RW4A 2MYTA 3SX0A 5C32A 2HUPA 1GUGA 3JQAD 3NONA 4YP6A 1RXEA 1SRRA 1U0FA 2P4HX 3IYLW 1WXFA 4NYJR 5G1PA 2DH6A 3CF4G 4YRGA 1E8MA 1BHSA 4A03A 5LD2B 4F5YA 4CT4B 1YIJA 3GLQA 2BH9A 5IT5A 4KXFB 3GJSA 1VI2A 3AESB 5HXAA 4F3KA 3A04A 3LI2A 2EV9A 3NH6A 3OWHA 3RVOA 2O5CA 3R3JA 3J7AV 1IXRC 4GOKA 2ZAGA 3SX2A 5KNBA 3SY8A 3ZDFA 3PGMA 5DI3B 3S8EA 2C5SA 3GV3A 2ZJ1A 3OKCA 4HRYA 4DSUA 1RCVD 4MN3A 1LKZA 4R4TA 1L8XA 3NNDA 1Z4MA 2JAWA 2GT1A 1CBUA 1U9IC 3L0SA 4EG3A 3FWPA 1O6CA 4B6GA 2FEWB 5K51A 4G4SO 4D9CA 3PXCX 1PRTD 1CF2O 1V7CA 1YULA 5AKKA 4PFQA 5DI3A 5EZ6B 5A4IS 3IEUA 2V9PA 4ZVKA 3S8MA 2VHYA 4ALIA 1MB2A 2P79A 1UJ6A 3PYLA 4NEHB 4CMBA 5IGEA 4R68A 2Q29A 2VUSA 1U7DA 1KYIA 1P0PA 4PYQA 3KELA 4B17A 1WBBA 2SNIE 5B7GA 1WSBA 2OZVA 1XYIA 1MV8A 2PYDA 2VPZA 1T8RA 4PIVA 1I4PA 4XARA 4MVWA 5KYWB 3L0IB 2CMFA 4EKIA 3JYPA 1WCV1 1FEZA 5A0TA 3PVSA 2Z4IA 1L3IA 2GN6A 2NYAA 3FRHA 4F8EA 3TECE 1YHBA 2H8GA 4Q7LA 5JALA 3E9NA 4E09A 4RA8A 5C3EB 2PZMA 2ECOA 4DV4Q 1WTVA 1GPAA 3WIOA 1Y1WG 4OHWA 1N25A 5CB4A 3C3CA 3ENWA 1QRUA 5J39A 1P0FA 3D6FA 1KDTA 2LCIA 2WWFA 4X3OA 4YHHB 4BHTA 3EAQA 2XMQA 3EUEA 2PGNA 3IAM6 4EFKA 4ZCSA 1ZICA 1FXSA 2PX2A 3HI6A 1S3GA 2IX3A 1U0SY 1U7XA 2FEXA 5A04A 2P40A 4J0JA 2Q3JA 1J24A 1EX1A 4AL4A 4QXAA 4BDTA 3B53X 3QUBA 4NCAA 2G1UA 1JQ3A 3P9RA 3GY0A 1Q0QA 4L3OA 5CB4F 3FA2A 1OB2A 1FJXA 1ND5A 2W00A 3B9QA 2NVTH 3ZS8A 4B4VA 1Y1RA 2QMHA 4TUYB 1KZ9A 4G9BA 5M7EA 3ADOA 2L15A 5BT8A 4EOGA 1V96A 1DLJA 3PMFA 4GKKL 3UQYS 4DMUB 4K05A 4IILA 1BE6A 4CXMA 5DM70 1RI4A 2YWEA 1OXKB 3SYLA 3J80c 1D0IA 3ZTYA 1MAUA 1R6XA 2Z6KC 1SWWA 4IPTA 4JC5A 1FK8A 1XVLA 3OZXA 3FTDA 1VQPA 5JVDF 4CM6A 1BD3A 3A7EA 2IPXA 5B57C 1YZ3A 2ZE8A 5FXMA 3IEIA 1CUHA 1SXHA 3CLUC 1W30A 3EQ2A 4HJRA 1G4UR 4PS1A 1SYGA 5LIRA 3OJWA 1C0PA 2E5LB 1G8SA 4CCAA 5I7HA 1AK9A 2HLDA 2VYNA 4KK7A 1OYYA 5DXFA 4C4OA 3MQFA 4L50A 3S4YA 1WA5A 1XLVA 1AE2A 1Z7EA 3ETGA 3Q5DA 3A7AB 2YFHA 3V05A 1DQZA 2I1WA 3GJ8A 4HFNA 4GS3A 3KLOA 3E82A 3PQ5A 4OK5A 2JVJA 2VQSA 3LC1O 5GOZA 3WA6A 4R8KA 4YDSA 2FN8A 4OGWA 2C5LA 4JOCA 3RN2A 2I65A 4IHAA 4ZEOA 5J40A 4DM4A 4ZO7A 1YDMA 2FZWA 4I7AA 2EGUA 2ZSKA 3NDRA 4M7RA 3RBVA 1QUQB 4ZU1X 2HT1A 3STXA 4D9KA 3H09A 3S2DH 2IDZA 1MA0A 2EIXA 1P5JA 4DK3C 3SSMA 1AZPA 2BHSA 1ICFB 4KHZA 3TSOA 3EZGA 1JB3A 3DA8A 1C5KA 5IW8A 3L0OA 4N49A 3WLFA 1TZBA 2O6LA 3JYLA 1ORRA 2WSSA 5I4DA 1SHUX 4RTRA 2IUFA 3GTOH 1MJNA 2JANA 1Z13A 3KUDA 1TT5A 1TS5A 1E0JA 5HUJA 4NV1A 2UVPA 2O8VA 1CVIA 1Z4PX 3AGPA 1T0BA 4NU6A 4DMFA 5B30A 3R8CA 2NVTB 1V1QA 1WQ1R 4ZHQF 1U0OC 2CFIA 2RI0A 3KWFA 3TMAA 1FUEA 4FYPA 5FX2A 1W5TA 1WDKA 3UO8B 5A2QE 2WW8A 4IXNA 2J5RA 1N1GA 4ITVA 3E5NA 3WGZA 1NG1A 4JI5Q 1P9RA 3V8PA 2XGOA 2H4ZA 1KEEA 3R75A 2IL8A 3RV3A 3SYMA 4XCVA 3EXEB 1L3BA 4RGBA 1IK4A 3A1FA 3GDFA 4AK9A 4CDNA 4WGGA 4R40A 5JAOA 2IYLD 5JFTA 1AKNA 1B8VA 1LQUA 3LPAA 3SBOA 4PHHA 4R8MA 3UKDA 2FWIA 3QOLA 3J80L 3HGBA 3M3YH 1R0YA 1Y7IA 1Y82A 2PX8A 3VVLA 1LF0A 1UM9A 2JB9A 5LMCA 4DCOA 2IYXA 2EWVA 1VQBA 4EPWA 5AM2A 3H5NA 2L18A 2E2HB 5C5LA 1VG1A 4D99A 4G4KA 2FINB 1A8SA 3TR0A 1ZXLA 3BIOA 3WOEA 1OASA 1R12A 1PRTF 1UXOA 2BDTA 4N4AA 3WRVA 3X44A 2C7QA 4BY9E 3L8MA 2BMDA 1DWUA 1SUFA 2BE5D 1XJCA 3VYUB 1RCTE 3OE7A 4Q12A 2HIAA 3SHTA 2QLMA 4U1RA 1TUBA 1NTGA 3DEFA 4CV3A 5CXUA 2VK4A 1DC4A 1EIHA 1VLMA 2F52A 3NTHA 1FNNA 1YRYE 2KQUA 1GWNA 2WPDD 4DDTA 4L4YA 4YIKA 1BROA 4CFYA 3GZNA 1Z9FA 4WNYA 2EHDA 4HDSA 1YRAA 2IEYA 3H9BA 4KPUA 4Z4EA 5E2IA 1VB5A 2OCDA 4NE7A 2ZUFA 3ERCA 1Y1WB 3OHSX 3GLRA 1KY3A 2B1JA 4XQ0A 3EJIA 3FKIH 4PG8A 4N7JA 3ZX5A 1I7LA 1W1IA 3OMLA 2K2WA 1JGTA 1BO6A 3FGNA 3JWPA 5E4WC 4KSYA 4KEAA 1XKLA 4LGVA 3ITKA 1QV9A 2HJSA 3HKEB 2XYQA 4K3UA 1X0XA 5JO0A 1BXZA 5HCIA 3T1OA 3A37A 4OPMA 3WL5A 3WB0A 1G19A 4RHSA 4D97A 3P32A 1JAIA 3VISA 4ZOQI 2E74C 2Y1KA 1YFKA 4N41A 2RI1A 2ACKA 2H06A 1EZZA 3D81A 1Y3DE 3R1IA 4GYJA 5L95A 3FYCA 4J4HA 3MXNB 5B3KA 1BXKA 4BBRG 1HG0A 1VYVA 3JVEA 4A6DA 4IJ6A 3DV2A 3LHSA 2WT4A 5IH7A 2JJ2D 3OQ6A 4IXDA 4BNIA 5KKNB 1A8IA 5IAGA 3E5SA 1SUBA 2XMSA 4FDTA 3AHEA 3QYJA 3GZTB 3NHPA 2VKQA 2FPSA 4JQOA 2X7HA 4G84A 4KWHA 5IJAA 3OE7D 1L5ZA 4YRQA 2YW9A 4NMHA 1X92A 3IEXA 1TLTA 3QVTA 5E3HA 4ZHSA 4OMUA 4X66B 1AEXA 4J90A 4WCFB 1X8LA 3E61A 3KQYA 2BHNA 4BKMA 5F7XA 4RPGA 1J22A 5E9QA 3VJLA 1BMDA 1MTOA 2IXTA 2UZ1A 4FLMA 4JP8A 5CG1A 2B2WA 1IW7D 5J1ZA 2NZJA 2WSSD 3AG5A 3CFYA 3GLSA 3PITA 3D6AA 3OWFA 2ZTEA 3SBXA 4ZJZA 4TKOB 3RFCA 2JHAA 4MV1A 5LXTA 1XAIA 1PLFA 3N75A 1Y14B 3QO2A 5DEHA 2UZ1B 2ZBPA 3HU1A 4A93H 5H16A 1ZL2A 3CLTC 4MUFA 5CD9A 4QVIA 4A0SA 5LL6P 2DHQA 3PKZA 3M89A 3FWNA 5CU7A 3L4BC 4JBNA 4KR9A 5LXTB 2P7HA 3NCTA 4RDXA 4MVJF 5JSUA 5D3IB 1ASZA 3FW1A 1PU2A 2Y0PA 4C7XA 2G80A 1T2VA 1T5HX 2YTYA 1AQYA 3U16A 3JYNA 1NZJA 1SQGA 3QWBA 4IGIA 3OQIA 4JY7A 3MW8A 4EQ6B 4F38A 1O0BA 1TLLA 5E8RA 1AZLA 4A2PA 1AV6A 1WPGA 3WP1B 2QRPA 2Y0EA 2FR8C 3M9BA 1II8B 3ITEA 2CFTA 2INGX 2ACVA 5FTLA 2C7RA 3GJ5A 1BBUA 4JI8Q 1IB6A 1T36A 2G4VA 4YCDA 5FKAC 2ZBRA 4EWLA 2OK7A 4K8OA 3TD6A 2FV8A 2WD7A 5TY0A 1PJ3A 2IP1A 1RM5A 1TPZA 1Y6QA 5AVQA 1E3WA 4BJHB 2A8YA 3PQ6A 4IIJA 5H4GA 1V5GA 1E7RA 3OFND 1WDWB 1Z06A 5I4BA 3Q8KA 2J46A 4DV3L 4HDKA 3LY8A 5AI8A 3F9CA 3TBFA 1QVCA 1A98A 1XTTA 2GX6A 3N1UA 4OQPA 4RV9A 3DDNA 5HIAA 3EVEA 4RJIA 2C9OA 3CSDA 3HEAA 1GLNA 1KR5A 1NRIA 3QQPA 4QQKA 5B64A 5E3FA 1K0SA 1JE4A 3UXYA 1BRMA 5JOBA 2YTXA 2ZVQX 1PIWA 1Y9ZA 3DF9A 3E1KA 1TTPB 4GI5A 4WE3A 4EJ0A 5A5DA 5EJ6A 2E55A 5LHY1 5ISRA 3OTOQ 4C3HG 1U2QA 3AOEC 4LK3A 3V4ZA 4Y3UA 1UEXC 1QIFA 2FPIB 2C97A 4OHFA 5I9LA 4JI3Q 4RF5A 4G0MA 3ZWOA 3HBFA 1VKJA 1U11A 1A04A 1DZ1A 1LRJA 3L9AX 2HMSA 2PAFA 3V3TA 4N8EA 3CLTD 4IJLA 1DCMA 1YCFA 1NBOA 1U7PA 1P62B 2FPIA 2IYVA 2OA0A 3THXB 2HK8A 1QKIA 1XZIA 2FF7A 1ISRA 1OU4A 2GJ8A 2GS9A 5TQVA 1QIEA 5B4UA 4AWXA 1HTLD 4U673 3OF2A 5DIFA 3F46A 3OF3A 2IOQA 4IDPA 2WV7A 3N2EA 5LP6F 1IU9A 1OGIA 4OBBA 3PT9A 1GGNA 1OXMA 1W6UA 5FA8A 1Z0DA 2AG1A 1LPMA 4LWCA 3KZXA 2POQX 1J70A 4HYQA 3RS7A 2RHSB 4HX9A 4GECA 2B2UA 4V190 5CLFA 2GK7A 1D1PA 2R8XA 2PZLA 2Y3IA 1K5DA 4D3FA 3NT2A 3UJNA 1E6MA 2H48A 4FHCA 1RLMA 2G76A 1XMJA 1NGSA 4JI1L 2YIVX 3KKMA 1HE4A 3OT5A 4LKOA 3FNQA 3LUJA 1KE1A 1E99A 2V55B 3DZCA 1JLHA 1KMHB 3RYTC 2AFHA 4XJSA 3B7GA 1STYA 4QG7A 3USZA 4I3HA 3KJPA 4K26A 1TB4A 1X3QA 1Z7TA 2VEDA 1NBEA 1VHQA 4I1RA 4ZRMA 4JFAA 1P4SA 3MD9A 3FPKA 3MC1A 1EH5A 3FRJA 4JAVC 4LJ5A 4QYMA 5E6UA 2NZWA 2C59A 3A0UA 2R1TB 1ZX1A 4J7XA 1BHJA 2B92A 4UCWA 4UMFA 4GMKA 3F6PA 3LPNA 3FMCA 2XF8A 5GY7A 2HCRA 1NBAA 5C4GB 4V0QA 1XTZA 1OXXK 3CU5A 1X7GA 2HRDA 4K1XA 4E21A 4PZYA 4LRSB 4BUCA 5ALPA 1PR9A 3A2LA 1Z08A 1M2HA 3IOYA 3BMNB 2PMBA 2ZBUA 3C7DB 3R5FA 4PHTA 3KQQA 5HDBB 1OR8A 4JDUA 3OPVA 1O8CA 3RPEA 3GP8A 5J2UB 3RSFA 3DZBA 3O9MA 4F91B 4UHHA 2KSQA 2X8JA 1WCMB 1L5VA 2IK8A 1ZDMA 3NEMA 2N78A 3SHLA 4OX9Q 2PTGA 5AJ3L 3BMNA 4A3GH 2QXYA 3EZ2A 3EYAA 3I5MA 3QBDA 4GGPA 1V6CA 4S2UA 3LQ1A 4GZMA 4S2EA 3DFKA 5B55A 3RC8A 2QA4A 4CF3A 2MQHA 1ZOIA 3ENVA 1WTHA 2J0UB 1U9JA 1AD2A 4EGQA 2DFLA 2LUOA 4OHRA 4A26A 3KQKA 1KI3A 1DARA 1W4RA 4D92A 4KQMA 1HDZA 1IYUA 1FRVA 4R1SA 1QRTA 4JBJA 4X91A 2CV2A 4PQGA 5CHEA 3KQSA 1LPNA 5NULA 3TIVA 1DKMA 2OHFA 1PH3A 3FMIA 3KEMA 1T6BY 1X70A 2VT2A 3KEGA 5ALZA 3Q87B 1HYHA 5G3ZA 1F5SA 3EIWA 4HSPA 3T7DA 3ZQJA 3MA2B 1ETHA 3IHKA 3DMUA 1YU6A 1GO3E 1KZYC 4HQ0A 3FROA 3GJQA 3FKSD 4JI7L 3DO5A 3GYBA 2VRNA 5EZYB 1EE1A 4IWNA 1DWOA 1NONA 2WHYA 5AVVA 4UUMA 1Z2AA 2F00A 1CY4A 4B3TB 3CUEF 2EYHA 3N7TA 1H2XA 5HMMA 1I8TA 4LXXA 1QG4A 3LU1A 3UA4A 3U48A 1E2QA 2ZP1A 3A54A 3TRHA 3RVNA 5LLSA 2VF5X 3B7WA 1FTQA 2CLFB 3IURA 1J42A 2HMAA 2J6IA 4Z3OA 3UH1A 4C3IB 1AE1A 2XRZA 4DADA 4JB0A 3OQPA 5IZ4A 1E9SA 3L6OO 4G0WA 4DR7L 1N7GA 3KKPA 3P19A 1ZNQO 4G1FA 1S5DD 1D7QA 2CBZA 3G85A 1B6SA 2GN5A 1EGQA 2NT4A 3CX6A 1JWSD 3LT2A 4AF7A 1EM8A 4BQPA 1G98A 5A1JA 2K50A 1JWMD 5AKIA 4BO2A 3PQIA 3FDJA 4NMZA 1ZGCA 3SK4A 2KPOA 4UEOA 2NZUG 1FBTA 3NOOA 4IIYA 4OHVA 1MDFA 1TU4A 1GUYA 3OZRA 3R5KA 1KWGA 1TKBA 2J4XA 3NHRA 2V6GA 4KO2S 3ZZ1A 4BATA 2H1HA 1B2TA 4MVJI 4B4UA 3QV1A 4UDOA 3CW2C 4LDPA 4A3SA 3Q8LA 1PE0A 1K8XB 1SOAA 3L7JA 4QO8A 1DBPA 1S9DA 3OSUA 1C9YA 3OOSA 3R3XA 1KDYA 3KX2A 4EUKA 3PO3H 4QUEA 4PMBA 1YNJD 2BMJA 2C2WA 1YDFA 3IQXA 4R9NA 2WWHA 1QS0A 1HNZL 3CLRD 1R15A 3BERA 3CZMA 2OQVA 4ARZA 1WVLA 1B93A 1ZYRD 2BFNA 2NO7A 2UYHA 4E7OA 1I4DD 3ZY4A 2YY7A 1TIKA 4LECA 1N2EA 4JGBA 3C6QA 1VYTA 3ESYA 1AZQA 3H19A 2R92B 1AQUA 3K94A 2QX8A 3OMWA 4H6PA 1AZTA 3A14A 5JEAH 1Q0RA 2YIJA 1X80B 3KXLA 4BBPA 2NVBA 3MWJA 3QNMA 2JI6A 1BH2A 4ZREA 2O5RA 4TVSA 2B2XA 5HR5A 4XGKA 4DG5A 4DSAA 2BZGA 5FUVA 1V2HE 3CWQA 1HZZA 4B6RA 4DANA 4F8MA 3RS0A 3R0XA 3DXFA 2OLKA 2DE0X 5DHAA 2DT5A 3TSYA 5JXJA 1YUBA 4MKIA 1K8GA 1A69A 4M0FA 1CEYA 1QDLB 2R92H 3IMGA 4I55A 4K9LA 3I4NG 4GDMA 3VR1A 2JEAI 2B2NA 2WSIA 4KC0A 4MUEA 4F85A 3WG9A 4MUJA 3DBLB 3FCOA 2IJGX 2WC1A 3LP6A 3R5TA 5EGNA 2TS1A 4BEVA 4PM4A 3T5PA 1J97A 2C2YA 4I55B 1IZ6A 1S5ED 2G70A 3C1FA 2YMMA 3HN2A 1CRLA 3QEOA 5DNWA 4MS4A 3AZOA 5JMWA 2C84A 4UU1A 1JJVA 3OLXA 4A3KG 3R0ZA 2QB5A 4TQ9A 4E1BA 1WTOA 3FETA 2FZEA 2NMVA 3S24A 3R5XA 4J94A 3CRQA 2J3JA 2XRMA 3M70A 4CIVA 4BA2I 1ZM7A 2V8OA 3FSGD 3LBHA 2WB4A 1PNVA 2FQXA 2GH1A 2ZTSA 2OYCA 2NTEA 1ML3A 3JQ9A 4KTVE 3UTDA 3AF4A 5I47A 4O4LA 4LZOA 4X63A 4R1OA 2YNMC 3K16A 4WTOA 5DTMA 1A9SA 1M1KC 4OMFG 4I7ZC 4BC1A 2FQYA 4CKXA 1SZCA 2FW6A 4M83A 4RIIA 5BR4A 3FG9A 2CQAA 3NXWA 5EEHA 1ASYA 1EL0A 4P3NA 1G291 2Q6TA 4LF6L 5AFSA 4BKPA 4V0LA 4QB4A 5D3QA 2A1UA 1I3CA 4IQ8A 4KN8A 4WUVA 2F3TA 4R3WA 4NYMR 3LQ4A 3ZZUA 1E2NA 1OAKA 2R7DA 3QOYA 1T2AA 3EBPA 4H7FA 2A0KA 4NCNA 1RXCA 4ONEA 5ALGA 1H3EA 2CXRA 3ZDYB 1TI7A 3HOUH 2WTEA 3TN2A 1LV7A 2RONA 2R86A 3O82A 2NYZD 3LECA 5A9TA 4C3OB 3D4RA 1QE3A 3O1LA 2WM8A 1XQXA 1JCKB 3PDHA 4Q3DA 4QEZA 4F5EA 1KNAA 1V5IA 3UMGA 4JI1Q 2C9ZA 3QB3A 2XZLA 2C4WA 3C7KA 1E89A 3OIYA 2AK2A 1LXCA 2A5GA 3L6CA 4JIMA 1GADO 5H9WA 4DR3L 2ZSFA 1V5WA 3VUFA 2R8BA 2OAQ1 4QA9A 3URKA 2YY5A 4P2CB 2PPLA 4GW3A 5C3EG 3SQDA 3U3ZA 3VHQA 4NQZA 5I5EA 8ADHA 5FR2A 3Q7SA 1GZ5A 4CDDC 5G3YA 1OSNA 5BNIA 1J6QA 1JEAA 2E4AA 1U3VA 4Q9DA 4H3SA 1TIID 3UUWA 1PMRA 2VDOB 1EGAA 5CT8A 4PZ7A 4JJZA 5KYXA 3H2SA 1EFTA