1Q1HA

An extended winged helix domain in general transcription factor e/iie alpha
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
85
Chain Sequence
b'MVNAEDLFINLAKSLLGDDVIDVLRILLDKGTEMTDEEIANQLNIKVNDVRKKLNLLEEQGFVSYRKTRSGWFIYYWKPNIDQIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription Factor E
publication title An Extended Winged Helix Domain in General Transcription Factor E/IIE alpha
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transcription
total genus 17
structure length 85
sequence length 88
ec nomenclature
pdb deposition date 2003-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1q1hA00
2H27A 4I02A 4HOBA 4G6DA 1FPQA 3WE2A 5EEHA 2QQBA 2NS0A 1FOKA 2ZNYA 2ZCWA 4PCQA 1USTA 2QVOA 2PLYA 2GA1A 1O57A 1YG2A 3WTTC 3K69A 1EH8A 1DDNA 1K79A 3VEPA 1UFMA 3VOEA 3IL2A 3ECHA 1YW7A 2W57A 3QU6A 4WWCA 5CVJA 1I1GA 1U78A 3J81K 3DV8A 1MJBA 5ICCA 1S3JA 2K4JA 2IT0A 4MQVA 4ZYDA 2DTRA 2GA2A 3R0AA 2EFOA 2P8TA 1U3EM 4EM1A 3WTZA 2K02A 2OZ6A 2STTA 5AIQA 1OYYA 4EGYA 1KU2A 3QU3A 1F1ZA 1GXPA 2XASA 3FXRA 4B8XA 2HYGD 2ZBKA 2MA3A 5ICGA 1P92A 2J5OA 2LSOA 2OQRA 4HF1A 5TJJA 3DPLC 3JSOA 4B09A 1ON2A 2A3SA 5D6EA 1SD5A 3NQOA 1G3WA 4L9VA 3ECOA 3CDHA 5LRRA 4ON0A 1O3RA 1JHHA 4U0WA 1KYZA 1P4WA 4HF2A 3RKYA 5LLQA 4IXAA 1IXSB 4G94A 4IHSA 5D4SA 4Y15A 3BZ6A 1EH6A 2JRTA 2A6HF 2G7UA 2EA4A 5L3CA 2ISYA 2EV0A 2BGCA 2DO7A 3BPXA 1P4XA 3QP5A 2A07F 5ERIA 2DQLA 2M87A 2PMHA 3CLOA 3RTRA 1ODDA 2RNJA 4N9IA 1ZAOA 2IA1A 2P7CB 1GHCA 1D8JA 1TW3A 3TGNA 2CG4A 3JTGA 5LGUA 4G7ZF 5LHHA 1O3TA 5H6QA 1WWXA 2D45A 3ROUA 2M8EA 3D5LA 3HTSB 1P2FA 2RKHA 1YYVA 5L3GA 2GQQA 2Z3YA 4ENKA 4RAZA 3ULQB 2AXLA 1H9TA 1FT9A 5D4RA 3F23A 3SFZA 3O6BB 2EWNA 2FU4A 2EFNA 5HLIA 1W7PD 2JPBA 1P4AA 3GFLA 2A5YB 1BIBA 4EJTA 1R1UA 1TNTA 4FX0A 3CO7C 2PBIA 3GX4X 2IW5A 3RPUA 1ZGJA 1V4RA 2EJRA 3F8FA 2M30A 2R7FA 4L9NA 2OAZA 2XGXA 4I0BA 5ILSA 3ZMDA 2FE3A 1AOYA 3GZ5A 3IWZA 1B1BA 3C18A 4RB0A 2CWEA 4YFKF 5E1ZB 4KDPA 3ZMUA 1H9GA 2Y75A 2XUBA 2ESHA 2D1HA 1EH7A 3MZHA 3J81Z 1YFHA 4HX7A 3GUDA 3QPHA 2K27A 2W24A 4A0ZA 4G7OF 2DK8A 2VXZA 5E8GA 2STWA 4KMFA 3FXUA 1UB9A 1LEBA 2ACJA 1LDJA 1KU3A 5DV5A 3VFZA 3TKYA 1O3QA 4CZZA 3ZMZA 2F2EA 4GXOA 2ZJ2A 3P7NA 3CJNA 1C0WA 4DQ2A 2QUFA 3EDPA 1J7KA 2RDPA 1MZBA 3H3UA 3KEQA 5H20A 4P9UA 1S7OA 1HKTA 2UZKA 2UWMA 5D8KB 3HOTA 2JPCA 1ZN2A 2DT5A 2FNPA 1XSVA 4KMUX 2Z9OA 4WXCA 4FHTA 3LQQA 4P55A 2Z99A 1MKMA 3GYHX 1U2WA 4HX8A 4EVIA 5KK1A 3WTXC 2V79A 5ICEA 1USSA 4JBAA 1IN4A 2RVCA 4XLPF 2MC3A 2NNNA 1FYLA 3ML6A 3F6VA 1MJAA 1W5SA 2E1NA 5D5UB 3EYIA 1U5TB 3V8KA 2HKOA 1QPMA 4RAYA 4MEYF 1BM9A 1WI9A 2M1BA 5L3EA 1XGOA 5TRDA 4R1HA 1IN8A 3U9GA 5K5OA 5HS8A 4HF0A 3IRQA 3V7SA 2HGCA 3I4PA 4RB3C 1FWZA 2R3SA 3K1PA 2BYVE 2WV0A 3GWZA 3NEUA 2CYYA 4RB1A 2J5PA 5CVVA 2F5CA 4A0XA 2IP2A 1U5TA 4N9HA 1U6GA 5E18F 3B02A 4L9TA 5CVRA 2HQNA 1ZGAA 3G73A 2VBXA 4PZJA 4RGSA 4A6EA 1YW9A 2WTEA 2GXGA 3U1DA 4EJWA 5FO5A 2LF8A 5L3FA 3BDDA 5HVQC 4M9ZA 2O3FA 2JT1A 2E7WA 3CO6C 3K0LA 4ETSA 2CGPA 5ICFA 3F8NA 1KYWA 2GZWA 1T0FA 3TO6A 5LHIA 3I58A 1LVAA 2V1XA 2UXXA 4YFNF 4XRFA 4AIKA 3QP6A 2H6BA 2VT3A 3GO5A 4CXFA 2IA0A 2MLKA 2EFPA 2L01A 2FF4A 4BHBA 5HDKA 2CW0F 2YPRA 2ZO4A 3KFWX 1HBXG 4MQ9F 4LB5A 2G9WA 4Z2YA 1E17A 1HKSA 1OMIA 5BS6A 1VTNC 5H6RA 4WF2A 2XAFA 2Q8KA 2HYFA 5A2QZ 1MGTA 4S05A 4KUMA 2DAOA 4L9JA 1R5HA 2PG4A 4UVAA 5ILUA 1YO5C 1PDNC 3BPVA 1S7AA 2H94A 2XAQA 4WK8F 2VE9A 3V4GA 3LA7A 3PQJA 3K2ZA 2IJLA 4G9YA 3HOSA 2E7XA 3M8FA 1BC7C 2EV6A 4OMYA 1CF7B 1KA8A 5JFRA 3Q5FA 3R0JA 2FMLA 3MZYA 1TQPA 1OYWA 2FXAA 4BXUA 4AIHA 5HOOA 3P9CA 2Y48A 3KP2A 3PQKA 5HLGA 2W85A 1MDMB 1OPCA 3F6OA 3B73A 2MD5A 1NHAA 1XSDA 4N0BA 3WGHA 3LA2A 2FBIA 3ZPLA 3I59B 1G4DA 3KP5A 3E3VA 1SFXA 5E1WA 3S2WA 3Q9SA 1TQIA 2AS5F 3KP6A 1XDSA 1CF7A 1XN7A 3R4KA 4L18B 1L3LA 5F6FA 2V9VA 3BOQA 1JE8A 1W4MA 4NB5A 2FA5A 4S04A 2NYXA 3EYYA 3GEZA 2W84A 2ZXJA 3IWFA 1MDMA 1LDKB 1PP8F 4ZYEA 1BIAA 2OQGA 5FLXK 3Q9VA 3JTHA 1XSXA 4RS8A 3EETA 4L5IA 4A12A 3DXJF 4RGRA 3I59A 4CDGA 3RYPA 3F22A 2M5WA 3BROA 3HRTA 3H3ZA 4LLNA 2HTSA 4MNUA 4Y13A 3R60A 3C7JA 2B0LA 4F7ZA 2D1VA 1RZ4A 2G7HA 2P6SA 1O7LA 4EGZA 1QNTA 1FP2A 3I71A 2VC1A 1MJ9A 3KZYA 1HKQA 4KN7X 4UXNA 2NAZA 3ERED 4G7HF 3REOA 5L3BA 1GVJA 2Q2EA 3GFJA 3HTUA 2XKPA 1G3YA 4E70A 2RN7A 1YTYA 1FSEA 5HLHA 2CFXA 1LB2A 3TDUC 3TQNA 4ESFA 3D0SA 2RC4A 3J7AO 3F8BA 5BQTA 2M45A 1KQ0A 1ZG1A 1ZRCA 1T2KA 3FXQA 3W6KB 3PFIA 1JGSA 1XDUA 2VBWA 3FMQA 3TOBA 2VN2A 1G3SA 3E5QA 2YX4A 1BJAA 1RUOA 3WODF 1R23A 3VODA 3LWFA 1G3TA 2PFBA 2DPUA 2HFHA 5D5XB 2KIFA 1BBYA 4I09A 5JHUA 2O61A 3SXYA 1J5YA 5FFZA 4G6QA 2XKOA 3SZPA 1UHMA 5BPDA 2VOPA 3KEOA 2FSWA 5DYMA 4P96A 4O3MA 1D5VA 3RKWA 1QGPA 1ON1A 3L9FA 2XRNA 3M9AA 2BE5F 4KIBA 1IXCA 3O2PE 5D5VB 1FP1D 1LQ1A 5F64A 1FLIA 4OIOF 4AIJA 3HRUA 1ZLKA 3EQLF 2F5FA 3E5XA 1F9NA 4M6YA 2H6CA 5LRSA 4OMZA 1J0RA 1G6NA 3V7CA 2XHKA 2DI3A 4QLCU 2MH9A 4BH9A 1P6RA 4WCGA 1IN5A 5E1XA 1TW2A 1XCBA 2VE8A 5D8LB 3GZ6A 3ZMTA 2K4BA 1KU7A 1Q1HA 4HA8A 5FLXZ 3R6SA 2KJBA 3F72A 4KYWA 3KP4A 3DQVC 3JAMK 1BI3A 2F5DA 4U0VA 4HX4A 2X4HA 2PN6A 2EK5A 4LG0B 1TBXA 3BJ6A 4YIIA 4WXDA 3QRFF 4HDUA 1ZG5A 1CGPA 5EEGA 2VBZA 1QBJA 3BJAA 2X0LA 2O8XA 4EMSA 2BEOA 3GW2A 4M73A 2KIUA 3V8JA 4Q48A 2L4MA 1Z7UA 3WTSC 2P5LC 2A61A 2QBYB 4A0YA 6PAXA 2XAJA 4UV8A 4LG0A 5JI6A 4LJZF 2EFWA 2XAHA 5LHGA 3K1MA 4PGHA 3ZMSA 1TTYA 2DLLA 1IF1A 2OU2A 3IKVA 1W7PB 3I53A 4ZYGA 2COMA 4M74A 4CO8A 4IF4A 4HAMA 2XAGA 2V1UA 4M9XA 2F5EA 4G8XA 1O7FA 1DUXC 2K86A 2QBYA 4IVNA 5CVIA 3WTWC 2QM3A 5J6XA 3E5UA 3O3KA 2ZNZA 1RNLA 3E6MA 1TQMA 3ZN0A 3RI4A 2P4WA 2YU3A 2VOOA 3C3WA 1W7PA 4LGWA 3KP7A 3E6CC 1I5ZA 5K1YA 5HS9A 1XMAA 2YSRA 4LD5A 3GFIA 5DD4A 1WRJA 4CHUA 5F1RA 2FOKA 1IRFA 1J9IA 2ESNA 1WQ2A 3DEUA 3ISPA 3WTVC 3LAPA 3H92A 3FHZA 1T6SA 1XGMA 3HUGA 3LSTA 4M6XA 1ZYRF 2HR3A 3BJOA 2Z5UA 4P5OA 3T5XA 2EV5A 3DPTA 3MEXA 3IKTA 5CYVA 1BC8C 3HHHA 3KETA 3QOPA 3KCCA 3FMRA 4XSZF 1IRGA 5DCMB 1ZHFA 3I5UA 1YS7A 3E97A 4KFCA 3MQ0A 4Q47A 2CSOA 3GF2A 2DU9A 2C6YA 1F4KA 5L3DA 1K6OA 5FFXA 1BN5A 3JAMZ 1MD0A 1GXQA 2DW4A 4LMYA 4L0YB 4UVCA 3I0TA 4U0YA 4YIFA 2O03A 2V6CA 3L00A 3OOPA 5DCMA 4RB2C 2PQ8A 4ZYHA 5FD5A 1K78B 1Z9CA 4ESBA 2QQ9A 4HV6A 2LDUA 4GO1A 1TLHB 4FX4A 2QZ8A 2GWRA 4UVBA 5D5WB 3IRRA 2DPDA 4KT5C 1XB4A 1IUYA 4K2EA 4EJVA 1YQAA 2A68F 2ZKZA 3LQRA 2LNBA 4LLGF 3WTYC 4ZH4F 3K1NA 3R61A 2CQKA 4OOIA 1QQIA 5LGTA 3L7WA 1T98A 1SD7A 1BI1A 3WGGA 1FNNA 2EA2A 3GXOA 2GIVA 4PDKA 1K78A 1XGNA 2ZFWA 5K5QA 3HHGA 2XVCA 1SD6A 3ZP5A 1EV7A 2L3DA 3V8LA 1LNWA 2QLZA 1IZ1A 1ZRFA 3BWGA 3IC7A 1XGSA 2KIMA 5KVRA 4EM0B 3GLXA 3SQNA 2JZYA 5IT9K 1ZREA 4IPAA 3K9TA 2FEZA 3COAC 3V7RA 2FBHA 1XD7A 3HRMA 4U88A 5IT3A 1Z91A 3HYIA 2YR2A 2LKPA 4AD9A 4GYIA 3FX3A 4MHGA 1ZARA 1ZLJA 2OZUA 1LEAA 4HZFA 4BHCA 1JHFA 1R1VA 3ABTA 1YW8A 2TDXA 5AIPA 2JSCA 3FM3A 1FBQA 2R7DA 2IVMA 1BOAA 3I64A 3RIRA 2QENA 1HW2A 1FSHA 4Q5SF 4UNOA 3DFGA 3E6BA 5HDGA 4TV7A 4A6DA 1TNSA 1YS6A 3MCZA 1YLFA 4I2OA 4L0ZB 1UHWA 3MFKA 1F5TA 4M9SA 3T8TA 2FQ3A 4Y17A 2P5VA 3N97A 1Z1DA 3LA3A 1FBUA 1I1SA 1WKMA 2KJCA 2WWYA 1D8KA 2E1CA 2ETHA 3RJPA 3W6JB 3L2CA 4NHJA 4H0EA 1LJ9A 3EUHA 1SFEA 4IRGA 4GGGA 4KICA 4KNYA 1XMKA 1KGSA 3HRSA 3DKWA 2XROA 2L02A 2XV4S 3KZZA 4XLNF 5E17F 2HS5A 1ONVA 4BAYA 1W5TA 1T39A 2IRFG 3BP8A 3HIFA 2VBYA 5E8IA 1ZRDA 4HQEA 2KKOA 1J2XA 3KLOA 2GAUA 3F21A 2Z33A 1R5GA 2O0YA 3RYRA 4NQWA 4YG2F 4ENJA 1SMTA 3J80K 2HQRA 5CLSA 4A5MA 1HW5A 1S6LA 3CUQB 1XCVA 3T8RA 2GXBA 3LAJA 2PJPA 2P7VB 2MLGA 4OIPF 4R79A 1Z6TA 4R8HA 1A04A 1B9MA 3GVAA 1J59A 2FNAA 4WXHA 4MTEA 4HLXA 2YX7A 1REPC 4M72A 2BV6A 3CUQC 5IT9Z 3CUOA 3CUQA 4ENNA 1FYMA 2HDCA 2FMYA 3LFKA 2Y0MA 1B6AA 3KE2A 1H0MA 4HDVA 1FBSA 2MBFA 3SZTA 4HW0A 3IHUA 1R36A 1STZA 4ENMA 3DF8A 4I7HA 2FBKA 3FMSA 4KIFA 1LDDA 4RGUA 4LK1F 1I27A 1DPRA 4IRIA 1R58A 3AAFA 2D2WA 3M8EA 1R22A 2O6GE 2QYOA 3RDIA 5K5RA 4CGZA 2DFIA 1X3UA 1SAXA 4BQAA 1YIOA 3E6DA 4GCVA 4M71A 1SFUA 1DP7P 1OR7A 2A6EF 4OU0A 4EV0A 4IRHA 4IJAA 1FYKA 5CJ9A 1ZG3A 3MAJA 3N4MA 3FM5A 2VC0A 4LB6B 5A2QK 4ZZDA 3ABUA 3C1DA 4LLLA 3HSFA 3QPTA 1HW1A 2LF7A 4HBLA 5DEQA 5DUIA 5E20A 1E2XA 3TO9A 3ZN1A 1L0OC 4I0AA 2UXNA 2IA2A 2HTJA 2OBPA 4O5VA 2HZTA 1B4AA 1K7AA 5J8CA 4OIQF 4JK1X 3OV8A 5JR3A 1FX7A 2PEXA 5DUKA 5ILVA 4MTDA 3FWEA 1BI2A 3RKXA 3FF5A 3I54A 1S8NA 2VODA 3KLNA 3M7GA 1U8RA 2JTVA 2CO5A 1OKRA 2DQRA 2RQPA 2EFQA 1T38A 4U7BA 4A2UA 1QO0D 1WSUA 4LK0F 4JQFA 3VB2A 4RGXA 2A69F 1OYIA 1KQ9A 5CVUA 4D0PA 4HLYA 5JVTA 1IXRC 5DCFA 1J75A 3HSEA 5LGNA 5LEKA 4FT8A 1V3FA 5HS7A 4EQQA 2FRHA 1D3YA 4MEXF 2NRAC 1PUEE 1IAWA 1SMYF 2IPQX 5J8FA 2NNYA 4AVPA 4BYYA 2HKXA 5BMZA 4YFXF 2HOEA 4I01A 2ADUA 4XBFA 4WX9A 5D6FA 4UUVA 4GYGA 1QZZA 3J80Z 2RGVA 4KN4X 1KQ8A 4AWXB 1HQCA 2Q0OA 3MWMA 4LFUA 3FZVA 3QAHA 4HV5A 1HSJA 5AONA 2VONA 3NRVA 4HYEA 3F3XA 3WU1B 4O6JA 1AWCA 5FGMA 3T0YA 2KRFA 4PGGA 1U5TC 2OA4A 2P6TA 3WE3A 4P9FA 4IHTA 3U2RA 4ASNA 1ULYA 3F8MA 2BBYA 1IN6A 2ELHA 1IW7F 1Z6RA 5BOXA 1S29A 3ELKA 4Q4ZF 1FC3A 1RIOH 4ESJA 4CYDA 4BNCA 2ISZA 2QWWA 3ZQ7A 2DK5A 3ZMVA 1FZPB 1PP7U 3P9IA 1I6XA 4UV9A 4EJUA 4I98B 1R1TA 2QQAA 5FD6A 1IN7A 2DBBA 3JSPA 2MH2A 4UHTA 3L09A 1UCRA 2XIGA 3T1BA 4BHPA 4A5NA 4CICA 1O3SA 2PMUA 2WC2A 5ED4A 2OD5A 4HQMA 1Z05A 3HSRA 4OIRF 1FY7A 4EJOA 5LBQA 5HDNA 4QWQA 4OINF 3JW4A 1R7JA 3WGIA 2L4AA 4DNCA 1JXSA 1B59A 2P5KA 1RUNA 3TO7A 4KA4A 4L5JA 1KU9A 3KP3A 2HEOA 2V1DA 2ZMEB 2PI0A 1SD4A 1RI7A 5BPIA 3M1EA 1ZH5A 2EB7A 1B9NA 3BY6A 5DDGA 5DD8A 2RV8A 2L54A 3F8CA 3WTUC 2H09A 3TDZC 3CTAA 4XSXF 4ZZLA 3DP7A 4EM2A 2VT2A 1Y0UA 5LEJA 3GFMA 1HXDA 3G3ZA 3SHFA 4MGRA 3TOAA 3RPQA 2W25A 3WG9A 3P9KA 1HSTA 1BI0A 4KIGA 3WU0A 2K7LA 4U7DA 1R00A 2ZMEA 5FB2A 2HWVA 1QZYA 1DPUA
chains in the Genus database with same CATH superfamily
2V9PA 3H1CA 3LSIA 2H27A 4I02A 4HOBA 2X48A 4G6DA 1ENHA 1FPQA 3WE2A 2NVXJ 5EEHA 2R0QC 2QQBA 2NS0A 1FOKA 2ZNYA 1WHUA 5FRNA 1SC7A 2ZCWA 2MFZA 4PCQA 1USTA 3KYCB 1EF4A 2QVOA 2PLYA 4XLCA 1UG2A 2GA1A 4E7KA 2LR8A 1O57A 1YG2A 3WTTC 2R7UA 3K69A 2VJ4A 1LE8B 1EH8A 1DDNA 4UY8I 1K79A 3VEPA 2QKLB 1UFMA 3VOEA 3DTKA 3IL2A 3ECHA 1YW7A 2W57A 3QU6A 1P7IA 2BOLA 2X9DA 2XDVA 5GAEJ 4XKCA 4WWCA 5CVJA 1VQ6I 1I1GA 4DW6A 3IV5A 1U78A 2ELJA 4UB6C 3QYEA 3J81K 1Y39A 3DV8A 1MJBA 1V5GA 4UB8C 5ICCA 2W7NA 3BR6A 1S3JA 3K4KA 2K4JA 2IT0A 2P81A 4MQVA 4ZYDA 1YX5A 2XSJC 2LMDA 3AFHA 2DTRA 2GA2A 1I39A 3R0AA 1HCRA 2EFOA 1SEUA 2DA2A 2ICWG 2P8TA 4CCMA 1U3EM 3WU2C 5E3LA 1Q1VA 4EM1A 2H8RA 2L9SA 3WTZA 2K02A 4PK4A 2OZ6A 1WJAA 2STTA 2HU9A 5AIQA 1OYYA 1YOVB 2HI3A 4EGYA 1KU2A 3IH2A 3QU3A 2K3PA 1LE8A 2X1CA 1F1ZA 4I99C 1GXPA 2XASA 2AQFA 1U8BA 3FXRA 4B8XA 1MBJA 2HYGD 2ZBKA 2X85A 2MA3A 5ICGA 2R92J 4Z6YA 3HEFA 5F0FA 3RKXA 1Z0XA 1P92A 4DYRA 4FISA 2J5OA 2LSOA 2OQRA 4HF1A 4ITVA 1EJ9A 5TJJA 1OCPA 2XPUA 3DPLC 3CCRI 3JSOA 4B09A 1ON2A 2A3SA 5D6EA 5FKOA 1SD5A 3NQOA 4HG2A 1G3WA 3ZQIA 4PFPA 5HLTA 2VJ5A 3HKZA 4L9VA 3OYIA 3CCJI 3ECOA 3MKZA 3CDHA 1KONA 3KZIC 1LPQA 1JT6A 5LRRA 4DIQA 4ON0A 1Y8RB 1O3RA 2IS4A 1JHHA 4ZTJA 4U0WA 4BJTA 1KYZA 1P4WA 3ZRGA 2HVSA 1WVRA 2HPMA 4HF2A 2VXDA 3ABMH 4RAFA 3RKYA 5LLQA 2ZJQF 2L9RA 2DMQA 3AG2H 3K6GA 4IXAA 3ERMA 4AM3A 4MFDA 5GAHJ 1IXSB 4G94A 4AYBN 2M3AA 2HXIA 4IHSA 3LL7A 2XGCA 5D4SA 2JQ7A 4Y15A 3BZ6A 1FIAA 4D9JA 4DZPA 2DA6A 1EH6A 2JRTA 2A6HF 2G7UA 2EA4A 4M6VA 5L3CA 2WAFA 3HPGA 1POGA 2ISYA 2JSPA 2EV0A 3LSHA 4BY1J 2BGCA 3PJRA 3SYTA 2DO7A 3BPXA 1P4XA 3QP5A 2EZKA 2L0KA 3M07A 5HODA 4IHYA 3N05A 1ZTRA 3FISA 5EGOB 2A07F 2KDZA 5ERIA 2DQLA 2M87A 2PMHA 2MSYA 5JLXA 3CLOA 3RTRA 2KPMA 3A03A 3K4CA 1ODDA 2AO9A 2RNJA 2VPLA 3BR1A 4N9IA 1VQOI 2WY8Q 1VQPI 1ZAOA 2IA1A 2E1MB 3CCUI 2P7CB 1GHCA 4RAGA 1D8JA 2A5WA 1TW3A 3M1CA 3TGNA 2CG4A 2CQNA 3S17J 3JTGA 2BY3A 5LGUA 4G7ZF 1AU7A 5LHHA 1O3TA 5H6QA 1IUFA 1ZKGA 3LFUA 1WWXA 2D45A 3ROUA 1QPIA 2M8EA 3D5LA 3DEEA 3HTSB 2NVUB 4I76A 1P2FA 2OF7A 2K9SA 2FQ4A 2RKHA 1YYVA 5L3GA 3G4SI 5M3FJ 2GQQA 5B5EC 2Z3YA 4LOCA 1UMQA 2DDAA 4ENKA 2IS1A 4RAZA 2Y31A 3ULQB 1T56A 3HZJA 2AXLA 2B7EA 1FT9A 2LREA 5D4RA 1H9TA 1ERDA 3F23A 2MD0A 3SFZA 5EGOA 4KT6A 3HJEA 1N77A 3O6BB 1YJ9I 1JUMA 5CQGA 2EWNA 1YJNI 3ZQHA 2FU4A 2EFNA 1Y6IA 5HLIA 1W7PD 2JPBA 4LIVA 1TC3C 1P4AA 3GFLA 2A5YB 4C2MJ 1BIBA 4EJTA 4IHXA 1R1UA 1TNTA 3OYGA 4FX0A 3LSJA 2JUCA 2AHQA 3CO7C 4D7NA 3AG3H 2PBIA 3GX4X 2IW5A 4BBRJ 3B6CA 4BBSJ 2ECCA 2XGDA 3RPUA 1ZGJA 2DJNA 1V4RA 2E19A 1RRJA 2EJRA 2HQ5A 3AL0B 3F8FA 5J4VA 2B63J 2M30A 4HNTA 2R7FA 5M5XJ 3VYUB 4BDYA 2M2EA 4L9NA 2OAZA 2I10A 3LOCA 2XGXA 4NC6A 4I0BA 5EG0B 1R9TJ 5ILSA 3ZMDA 2FE3A 2WBMA 1W0UA 2R7ZJ 1AOYA 3GZ5A 3IWZA 1B1BA 3C18A 4RB0A 2CWEA 4DZJA 4YFKF 5E1ZB 1X4PA 4KDPA 3DBRB 1TWCJ 3ZMUA 1H9GA 2F4IA 2Y75A 2XUBA 5LD2C 2LY1A 2ESHA 3DKYA 2D1HA 1FIPA 3UNGC 1EH7A 3MZHA 3J81Z 1T33A 2KRHA 5IP7J 1YFHA 2CV1A 3I3LA 4HX7A 3GUDA 4E7ZA 1FJLA 3QPHA 4J01A 2K27A 2NOGA 2W24A 4A0ZA 4G7OF 3BZKA 4GDFA 2DK8A 3H35A 2VXZA 5E8GA 2STWA 4KMFA 3VPRA 4B1RA 1DGRM 3FXUA 3FK7A 3MMYB 1UHSA 1UB9A 4C2TA 2X1EA 1OCTC 2EZHA 1ETVA 3E1SA 1LEBA 1A5JA 2ACJA 1LDJA 1KU3A 2N8GA 3CQZJ 5DV5A 5EG0A 2HOTA 3VFZA 3TKYA 3W2VA 4IX7A 1O3QA 5B1AH 4CZZA 5EZHA 5F0CA 3ZMZA 3ZXSA 1VQLI 2F2EA 4GXOA 2ZJ2A 2L5QA 1S9HA 2IAIA 4IEJA 2ZB9A 3P7NA 3CJNA 1C0WA 2LP0A 4DQ2A 2QUFA 4BACA 1VQ8I 5B1BH 3EDPA 4C30A 4IO9F 2QF7A 1J7KA 2RDPA 1MMDA 4Y4RA 2DCEA 4C3HJ 1MZBA 1DU6A 3H3UA 3KEQA 2PX9A 5H20A 2K40A 1H8AC 1SVMA 4P9UA 3K70D 3S14J 1S7OA 1YJWI 1HKTA 2UZKA 2H1KA 5D8KB 2K85A 5CQEA 2UWMA 3HOTA 3M3YJ 1E0EA 2M0CA 2JPCA 4I6ZA 3CDIA 1PYVA 2XSDC 1ZN2A 2DT5A 3OIOA 4A3EJ 2FNPA 1XSVA 4EATA 1G8XA 4KMUX 2Z9OA 3O8GA 4WXCA 3BT9A 4FHTA 2GLOA 2Z2SB 3LQQA 2GXAA 5J47A 4P55A 2Z99A 1MKMA 1WGXA 1U2WA 4HX8A 4EVIA 3GYHX 2ZSIB 2VKEA 1SVLA 5IYBJ 1X4OA 1S5LC 3CJQB 5KK1A 3WTXC 1UJ8A 2V79A 3BTIA 4M3GA 4E4HA 5ICEA 1USSA 4JBAA 1IN4A 2RVCA 1X2MA 4XLPF 3C2BA 2MC3A 2NNNA 2EILH 4ZDOA 1FYLA 3ML6A 2OUMA 3F6VA 3TW6A 2XPWA 4RA2A 1MJAA 1W5SA 2E1NA 5D5UB 3SEQA 3EYIA 1U5TB 3V8KA 4F3QA 2HKOA 1QPMA 2WB1A 3QPLA 4RAYA 5E3MA 4MEYF 1JKQC 1BM9A 1WI9A 4JX6A 4D5FA 2M1BA 5L3EA 4H4KC 1XGOA 2KRCA 2LY2A 2MG4A 4R1HA 5FJ8J 5TRDA 2K9MA 2WADA 1IN8A 4DBQA 2EPFA 3A4CA 5GP9A 3U9GA 5K5OA 5HS8A 4XN0A 3CCMI 4HF0A 4B3AA 1RETA 2E2JJ 3IRQA 1K83J 2WV1A 3V7SA 3JR9A 2HGCA 1TZLA 2QQ8A 2IGKA 3I4PA 1FWZA 2LC2A 4HSRA 5F04A 4RB3C 4XRSA 2DDBA 2V1NA 2NS8A 2KZVA 2R3SA 3K1PA 2VIXA 5DM7F 2BYVE 1NK3P 2XB0X 2WV0A 3GWZA 3NEUA 4PJ0C 1UAAA 2W1OA 2CYYA 1V54H 4RB1A 2DMUA 5EJCA 2J5PA 2X6WA 3H5AA 5CVVA 2F5CA 4A0XA 2IP2A 1ETOA 2JK3A 4XM3A 1JKOC 2L7ZA 1MSFC 4B43A 1U5TA 4N9HA 1U6GA 5E18F 3B02A 4L9TA 5CVRA 2LH9A 2HQNA 3BR0A 1ZGAA 3UR3C 3G73A 2VBXA 4PZJA 4DYCA 4RGSA 4A6EA 1YW9A 2WTEA 1PVEA 2GXGA 5EDNA 2OJED 4PJMA 3OYKA 3U1DA 1OQYA 1WJ5A 3Q0VA 2GM4A 4EJWA 3ABLH 5FO5A 4MIMA 1X2NA 3KIOA 2R7RA 2LF8A 3NAUA 5L3FA 4F93B 3BDDA 5HVQC 4M9ZA 2O3FA 1XTAA 2IGOA 2JT1A 2E7WA 3CO6C 3K0LA 3NWSA 5KHDA 4ETSA 4XN3A 1K4TA 2CGPA 2Y9YA 5ICFA 3F8NA 4CA0A 2PMZA 1EKEA 5KAFC 1KYWA 2GZWA 1WCMJ 1T0FC 3OSFA 1T0FA 1ORKA 3TO6A 5LHIA 3I58A 1LVAA 2V1XA 2UXXA 3DU5A 2CQXA 4YFNF 4XRFA 4BJ5C 4AIKA 4B48A 4L5EA 3QP6A 2H6BA 3ABKH 2R5ZB 2VT3A 1QA6A 3CF2A 2XB5A 4FETA 4RMNA 3GO5A 3FIWA 3S93A 1IDZA 1OCOH 2RNGA 2OPTA 5FLVA 4CXFA 2IA0A 2MLKA 2EFPA 2XF5A 2L01A 2FF4A 4YRVA 4BHBA 2QSFX 5K7HA 5HDKA 5TGTA 2CW0F 2YPRA 2ZO4A 3KFWX 3BQYA 1HBXG 4MQ9F 4LB5A 2G9WA 4Z2YA 1E17A 1HKSA 1OMIA 5BS6A 3HB9A 1H89C 1VTNC 5H6RA 4WF2A 1MMNA 2XAFA 2Q8KA 5CPRB 3G1OA 4XLAA 5TISC 3ZCOA 1WJEA 2HYFA 2M4GA 4CCJA 5A2QZ 2DT7B 4A3BJ 4A3GJ 4CH7A 1MGTA 2GBYA 3LSGA 4KUMA 4S05A 3OS2A 2DAOA 4L9JA 1K6YA 1R5HA 2PG4A 4UVAA 4Y3OA 4D7MA 4AU7A 4CZCA 5ILUA 3J7ZI 1YO5C 1PDNC 1UG0A 3BPVA 1S7AA 3LSMA 2H94A 2XAQA 4WK8F 2R5ZA 2JWTA 2VE9A 3K70C 4NC8A 2F48A 3D1NI 3V4GA 3LA7A 2M4KA 3PQJA 2R7OA 3DWLE 3K2ZA 3OR1C 2IJLA 4G9YA 3HOSA 2E7XA 2X6XA 3M8FA 4IL6C 2XGEA 1BC7C 1ACIA 2VB6A 4DGWB 5IYCJ 2EV6A 2HVQA 1T8IA 4RLFA 4OMYA 1M1EB 2NVYJ 3A02A 3L2RA 3BG7A 1CF7B 1KA8A 2CU7A 1RR7A 5JFRA 3OOUA 1IGNA 2KMUA 3HOXJ 3Q5FA 3R0JA 4HNVA 2ZXHA 2FMLA 3MZYA 1H88C 1TQPA 3J7AY 1VQNI 1OYWA 2FXAA 4BXUA 4AIHA 3QWLA 5HOOA 3OYJA 3P9CA 2DT6A 2UV1A 3B6AA 4LG3A 2DXIA 2IS2A 2Y48A 3KP2A 3PQKA 5HLGA 3MVPA 2W85A 1K61A 2RREA 1LFUP 1MDMB 1OPCA 3F6OA 3PSFA 1HDPA 2Z1DA 3B73A 3G71I 3H9QA 1QHGA 3RZDJ 2MD5A 2M8GX 1NHAA 1XSDA 2LVSA 3HOVJ 2LTPA 3KX2A 3CMEI 3DTIA 2RAEA 4N0BA 3GTJJ 3CLQA 2PJRB 3HM5A 1NG6A 3WGHA 4HPQA 2VKDA 2QGUA 2TCTA 3LA2A 2FBIA 3ZPLA 3I59B 1G4DA 3KP5A 1Z3XA 1SFXA 3E3VA 5E1WA 1V55H 3Q9SA 3S2WA 3J7YJ 1TQIA 5JLWA 2AS5F 1BOBA 1APLC 3BG5A 3KP6A 1XDSA 3S3MA 1CF7A 1XN7A 3R4KA 2ZC2A 4L18B 1L3LA 5F6FA 3TMOA 2V9VA 2CS3A 5IPAA 3JRBA 4XMYA 3BOQA 1JE8A 1JTXA 3S2DJ 3EPZA 1OCCH 1XX5A 1ZR4A 1QRYA 1W4MA 4JOMA 4NB5A 3ZGKA 2FA5A 4S04A 4CYCB 3G1LA 2NYXA 3EYYA 3GEZA 2W84A 2ZXJA 3IWFA 1MW7A 1YIJI 1MDMA 1LDKB 2R7WA 1ZR2A 1PP8F 4ZYEA 3CMYA 1IRXA 1BIAA 3RZOJ 1R71A 2OQGA 5FLXK 3Q9VA 3JTHA 1XSXA 4RS8A 2PJRA 2BW3A 3EETA 4L5IA 4BJ6C 1X1CA 4A12A 2DOFA 3TP3A 4NNJA 5GADJ 3PNTA 3DXJF 4YELA 4RGRA 3I59A 4CDGA 3RYPA 5J3LA 3F22A 3OY9A 3ZQCA 2XC7A 2M5WA 2Y2ZA 3BROA 5EEAA 4AUXA 3TP0A 4XRMA 1O4XA 2Q2EB 4E7HA 1TWHJ 4KJZA 4J00A 3HRTA 2I8DA 2DTZA 1HC8A 3JRDA 3H3ZA 2ME0A 2JVGA 4LLNA 2HTSA 3BTCA 4MNUA 4Y13A 3R60A 2OV7A 3C7JA 1G2HA 3CJTB 2B0LA 2Z16A 1UELB 3DBLB 4F7ZA 2KFDA 4CYCA 4BQOA 2D1VA 5IYDJ 1HA8A 1RZ4A 2CV0A 2G7HA 1WH5A 1BJZA 2Y69H 2P6SA 5IP9J 3BG6A 1O7LA 4EGZA 1QNTA 4QTRA 4XLEA 1FP2A 3I71A 1YI2I 2A6TA 2LBFB 3FXOA 4BE1A 2VC1A 1MJ9A 3ZQGA 3KZYA 2MC4A 1HKQA 3ZOBA 2UUZA 1Z3YA 4KN7X 1BW6A 4UXNA 2NAZA 3ERED 3PL8A 4G7HF 3REOA 5L3BA 5EZGA 1GVJA 2Q2EA 3GFJA 3HTUA 2XKPA 1G3YA 2DMNA 4E70A 3VSKA 2RN7A 2LD5A 4C3JJ 1YTYA 2DA3A 2M0MA 4GFBA 1FSEA 2ZJPF 5HLHA 2E34A 2CFXA 1LB2A 3TDUC 4IOAF 3TQNA 4CCNA 2KT0A 4ESFA 3D0SA 2RC4A 3IAM2 1IRZA 1B72B 3L2QA 3J7AO 3F8BA 5BQTA 1EA3A 2M45A 2NOJB 4E7JA 1GDTA 3M8JA 1KQ0A 1LVKA 1IJWC 2LBFA 3OL4A 1ZG1A 1ZRCA 3S32A 1T2KA 4CSWA 3FXQA 3W6KB 3PFIA 2VQCA 3WG7H 2JA7J 1JGSA 1XDUA 2VBWA 3FMQA 3TOBA 3OYFA 2VN2A 1G3SA 1VQMI 3E5QA 2YX4A 1BJAA 1RUOA 4G12A 3WODF 1R23A 2OCCH 2JJ7A 3VODA 3LWFA 1G3TA 2PFBA 3FHNA 5K7FA 3I4NJ 1A31A 3VSLA 2DPUA 3MKWB 2HFHA 2VL8A 3S8PA 3F9KA 5D5XB 3MKYB 2VKVA 2KIFA 1BBYA 4I09A 2QSGX 1DP3A 5JHUA 1X1AA 3G2BA 1SAUA 1YRNB 3SZGA 2BXZA 1B72A 2O61A 1TWFJ 3SXYA 1W5CC 1NK2P 2H8WA 3GTPJ 1J5YA 5FFZA 3CDLA 4G6QA 1MH4A 3H36A 3CP2A 2XKOA 1JUPA 1UHMA 3SZPA 1LFPA 5BPDA 3L1PA 3KEOA 2VOPA 2FSWA 2W82A 3CESA 4XNFA 5DYMA 1X1BA 2F6CA 3PSIA 4P96A 4XKWA 2V4JC 4O3MA 1W0TA 1D5VA 4RM3A 3RKWA 1QGPA 1ON1A 3H3VK 1HLVA 3L9FA 1GVDA 1ETXA 2XRNA 3M9AA 4B3XA 1CQTA 5C4JJ 4BXXJ 5BNGA 2BE5F 4KIBA 5FKKA 1IXCA 3O2PE 5D5VB 1FP1D 2Q1ZB 3LMMA 2R7SA 4E7SA 1LQ1A 1ETWA 5F64A 3TW7A 3M4OJ 2CQQA 2WAQA 4OIOF 1FLIA 1Y56A 4AIJA 2LYCA 3HRUA 1ZLKA 2LFBA 3S3OA 2ID6A 3EQLF 2F5FA 3E5XA 1YRNA 1F9NA 4M6YA 2H6CA 4OWRB 2E2IJ 4A3DJ 5LRSA 4OMZA 1J0RA 2BHYA 3FKIJ 2LK2A 1G6NA 3V7CA 2XHKA 5EF6A 1BA5A 3RSNA 2DI3A 4QLCU 2ME6A 4XORA 2FJ1A 2MH9A 4BH9A 3TL4X 1P6RA 4BKXA 4WCGA 1IN5A 3BQZA 4CCOA 5E1XA 4UUSB 5C4XJ 4CUGA 1J09A 1TW2A 1XCBA 1XMXA 2VE8A 1TT0A 2DA7A 2Y0SA 1F36A 5D8LB 3GZ6A 3ZMTA 3JCUC 2K4BA 1KU7A 2CUJA 1Q1HA 4HA8A 5FLXZ 3R6SA 1ZELA 3HKZN 2DN0A 2KJBA 3F72A 3PNVA 2V26A 9ANTA 3W6VA 2DJIA 4KYWA 2E35A 3KP4A 3DQVC 3ONQA 3JAMK 1BI3A 2F5DA 3QYFA 4U0VA 2ID3A 4HX4A 1B8IB 2X4HA 5C3EJ 2PN6A 2EK5A 2CV2A 4MO7A 2K9NA 4A3FJ 4LG0B 3X2QH 1TBXA 2VKHA 3BJ6A 2LKSA 1OR7C 2F5VA 1GLNA 3P5JA 4YIIA 2HQAA 4QPOA 4WXDA 1WJDA 2MYSA 3JRAA 3QRFF 1Z7LA 3KYDB 3H9JA 2BHZA 1MMAA 4X1EA 4HDUA 5KCMA 2VQHA 1TT5B 1ZG5A 1CGPA 5EEGA 1QZEA 2VBZA 4UUSA 1QBJA 2R7TA 4XL9A 3BJAA 2X0LA 2COBA 2O8XA 4EMSA 2BEOA 2VQGA 4XLHA 3I56I 5B3SH 3GW2A 3K7AJ 3K4BA 4M73A 1IV8A 1A35A 2KIUA 4B47A 3V8JA 3SDGA 2TRTA 4Q48A 3W3CA 2L4MA 1X19A 1Z7UA 4QIWN 1QHHD 1TWAJ 3PIPF 1B8IA 3HGYA 4C3IJ 3WTSC 4FE4A 2P5LC 2A61A 5FLMJ 3CZ6A 2QBYB 4A0YA 6PAXA 2XAJA 4UV8A 5DS9A 4LG0A 5JI6A 3RKQA 4LJZF 2EFWA 3FBNB 2XF7A 2XAHA 4A3KJ 1VQ5I 1WI3A 5LHGA 3K1MA 4PGHA 1K4SA 2R7XA 3ZMSA 1IO2A 1TTYA 2K9QA 2M34A 5IOZA 2QSHX 5FKMA 1FMWA 2DLLA 3HXLA 1IF1A 2OU2A 1XS9A 2DA1A 3OYCA 5F1JA 3IKVA 1W7PB 2X51A 4A69C 3I53A 4ZYGA 2COMA 3Q3SA 4HRIA 2ZXWH 4M74A 4CO8A 1W36D 1NG7A 4IF4A 4HAMA 1JT0A 2DYSH 2XAGA 2V1UA 5C44J 2NXNB 1D0ZA 4M9XA 4FASD 3HDDA 2F5EA 4IQ4A 1VF9A 4G8XA 1U9NA 4W97A 3OYNA 1O7FA 1DUXC 2K86A 2VI6A 3DPUA 2QBYA 4IVNA 5CVIA 1X1PA 2QM3A 3WTWC 2KDOA 5J6XA 3E5UA 3O3KA 2ZNZA 1RNLA 3E6MA 4IHWA 1TQMA 3ZN0A 2LY9A 4HEA2 5JHFA 1MNDA 3HUGB 3RI4A 2W4SA 2P4WA 2YU3A 3JRGA 2VOOA 3C3WA 3I4MJ 4JX4A 2K9LA 3G1MA 3PM1A 2JUGA 2DFHA 1W7PA 4LGWA 3CCQI 3KP7A 4DBRA 4IOCF 4JP0A 3TBIA 3NWTA 3AG4H 3E6CC 1I5ZA 5K1YA 1D5YA 5HS9A 2WA0A 1D0XA 2CQ7A 3DCFA 5JVGF 2ZJRF 1XMAA 2YSRA 1FTZA 4LD5A 2LRDA 3GFIA 1WFXA 5DD4A 4BUPA 2IXSA 1WRJA 4CHUA 5F1RA 2IBDA 4XOPA 2FOKA 2YS9A 1IRFA 1RESA 3WHCA 1WPKA 2ESNA 3LNQA 2QA4I 1J9IA 1WQ2A 3DEUA 3ISPA 4XK4A 3JRCA 1MNEA 3WTVC 2LLKA 3QPSA 3LAPA 3H92A 3FHZA 2I5UA 1T6SA 3RQIA 1XGMA 4CCLA 3HUGA 3LSTA 3S15J 3D5SC 2LKXA 4M6XA 1ZYRF 2HR3A 3BJOA 4DJAA 1NTCA 3A0BC 2Z5UA 4P5OA 3SDBA 3S1MJ 3T5XA 2EV5A 3DPTA 3MEXA 4XONA 3IKTA 2E5ZA 5CYVA 2BZTA 4UUTA 4BXFA 1BC8C 3L2VA 1SFOJ 3HHHA 1I50J 3O8HA 3KETA 3OR2C 1ZK8A 3OS0A 3QOPA 4FCYA 4F55A 3KCCA 3FMRA 2Y9ZA 5B66C 1Y1WJ 1MBFA 4XSZF 1IRGA 5DCMB 1Z67A 1AHDP 2D5VA 4EEFG 5E79C 1ZHFA 3I5UA 4E7LA 2EIKH 1Y8QB 1YS7A 1OFCX 3E97A 4KFCA 1PUFB 3MQ0A 4Q47A 2EINH 2CSOA 1ITYA 3GF2A 2BXYA 2DU9A 4FE7A 2C6YA 2XPVA 1RR8C 5F27A 1F4KA 4XICA 5L3DA 1K6OA 4KISA 1JUSA 5FFXA 3L2WA 1BN5A 3OYLA 3JAMZ 2JA8J 1MD0A 3ASNH 1GXQA 2DW4A 4LMYA 4L0YB 2ZSHB 3C2GA 3F0CA 5FROA 2LOOA 4IQJA 3CD6I 4UVCA 1FTTA 3PUFA 1WZ2A 1MSEC 3BG9A 2HOSA 3I0TA 3H5RA 4U0YA 5FRMA 4YIFA 3CCEI 1OJLA 2YUSA 2O03A 4DOZA 2NVQJ 2V6CA 2BY1A 2GOXB 4XIDA 3L00A 2CUFA 4ZYAA 3OOPA 5DCMA 4RB2C 2PQ8A 4ZYHA 5FD5A 1K78B 1Z9CA 4ESBA 2QQ9A 4AYBA 1PUFA 4HV6A 2LDUA 4GO1A 1TLHB 2DA5A 4FX4A 2QZ8A 2GWRA 4UVBA 2KL4A 5D5WB 3LSRA 3HL2A 3S1NJ 1R4NB 1Y1VJ 1RKTA 1W1WE 3IRRA 2DPDA 1T08B 1X58A 1FOWA 2BY0A 4KT5C 2HVRA 5DTDA 4LIUA 1XB4A 1IUYA 4K2EA 4EJVA 3U1KA 1YQAA 1D1AA 2A68F 2ZKZA 3LQRA 4U87A 3IP4B 3DEWA 2W48A 2WB1N 2LNBA 3SJMA 1ZQ3P 4LLGF 3MZ8A 1ETYA 3CCYA 3WTYC 4ZH4F 1TP4A 2E1OA 3DTEA 4OAYA 3K1NA 3KYLA 3R61A 2CQKA 4OOIA 1QQIA 1OLTA 2VJJA 2XAUA 1DQUA 5LGTA 3FXJA 3L7WA 1MBHA 1T98A 1SD7A 1BI1A 1G59A 3CC4I 4NUBA 3WGGA 1FNNA 3CC7I 3DKXA 2EA2A 3GXOA 2GIVA 4PDKA 3DU6A 1K78A 2DODA 3CCSI 2WAEA 1XGNA 2K3FA 2BW3B 5K7ZA 2ZFWA 1D1BA 4HNUA 5K5QA 2R7VA 3HHGA 2XVCA 2R93J 1BR2A 1SD6A 5M3MJ 1Z21A 4A3IJ 1SANA 1IDYA 2ZMEC 3GLLA 1EV7A 2L3DA 3V8LA 3H5NA 1LNWA 3ZP5A 2X1DA 2QLZA 1IZ1A 3NARA 3E7LA 1ZRFA 3BWGA 3IC7A 3TEDA 1XGSA 2KIMA 5KVRA 4EM0B 3EUAA 2EZLA 2JZYA 3GLXA 3SQNA 5IT9K 1XC5A 1ZREA 1P7JA 2CW8A 4IPAA 4LITA 3K9TA 3PUBA 2FEZA 4V2FA 3COAC 1MMGA 3V7RA 2DA4A 5IOYA 1HDDC 2FBHA 1U9OA 3GTMJ 1XD7A 3RPUD 3HRMA 2H1LA 2FUG2 4BU2A 4U88A 3PIOF 4IZZA 5IT3A 1Z91A 1MMSA 3FXLA 3HYIA 2YR2A 3H0DA 2LKPA 4AD9A 4JX5A 4GYIA 3E0JB 2EIJH 5GAGJ 3MD2A 3K4JA 1JTYA 3FX3A 2CRGA 4MHGA 1ZARA 1ZLJA 2XRLA 4BGDA 4XQFA 3UKGA 3OSGA 2MW8A 2OZUA 3Q0WA 5IP6A 4F91B 3JRIA 1JJ6C 3GTGJ 2PMZN 3PO2J 1YX3A 3HBLA 1LEAA 3OMYA 2E5NA 4C9YA 4HZFA 4BHCA 1JHFA 1R1VA 3ABTA 2VLAA 1YW8A 3BR5A 3SEZA 2TDXA 1N75A 5AIPA 3W2WA 2JSCA 3FM3A 3BR2A 1FBQA 2R7DA 2IVMA 1BOAA 3I64A 1BW5A 3RIRA 2QENA 1HW2A 1FSHA 4Q5SF 5KNLA 4UNOA 3HPHA 1JI8A 3DFGA 3E6BA 2CW7A 5HDGA 2V7FA 4TV7A 4M3BA 4A6DA 5LFAA 1TNSA 1KZHA 4A3LJ 2DOEA 2E36A 1YS6A 3MCZA 3VDXA 1RC9A 1YLFA 4I2OA 3A01B 4BDZA 4L0ZB 1UHWA 2L2OA 3MFKA 1F5TA 1P9QC 1T95A 4M9SA 3T8TA 2FQ3A 3BCAA 4Y17A 3H0GJ 1GT0C 4M3EA 4PJNA 2P5VA 3N97A 1Z1DA 2VASA 3LA3A 1FBUA 2ZXIA 2GIZA 1X3WB 4Y33A 4BY7J 1I1SA 1WKMA 2KJCA 3ZQQA 1S7EA 4AIDA 2BY2A 2M7AA 2WWYA 1MBKA 5GTIC 1MNMC 1D8KA 2E1CA 4NQWB 2IGMA 4A3JJ 2CFOA 2ETHA 3RJPA 3W6JB 4X0GA 3L2CA 4NHJA 1ETQA 3H9GA 4V19K 3PNYA 4NBQA 4H0EA 3CC2I 3A01A 3EUHC 1LJ9A 3EUHA 3OS1A 4AC0A 2EQRA 1Y0NA 1SFEA 2JMWA 4IRGA 2HYJA 4GGGA 3ZQFA 2JRMA 4KICA 4G6TB 4KNYA 1XMKA 1KGSA 3HRSA 4XR6A 3DKWA 2XROA 1TWGJ 3QYBA 2L02A 2XV4S 4N4OB 2O7OA 2V6EA 1HOMA 1MH3A 3KZZA 1VQ7I 4XLNF 5E17F 2HS5A 1ONVA 3I9V2 3JRFA 5HNFA 4BAYA 1W5TA 1T39A 4J19A 2IRFG 3BP8A 3HIFA 2VBYA 4ABZA 2VUMJ 5E8IA 1ZRDA 1YE9A 4HQEA 2KKOA 2KZGA 3IH4A 3VYRB 1J2XA 3GTLJ 3KLOA 2GAUA 3F21A 2Z33A 1JJ8C 3CF5F 1R5GA 3S1RJ 2JA5J 2O0YA 1GUUA 5J40A 3S2HJ 3RYRA 3Q0UA 4NQWA 5J4YA 2L7MP 4YG2F 4XLFA 4ENJA 2QEXI 1SMTA 1MIJA 3J80K 3JRHA 2JA6J 1OCZH 3GTOJ 3HOWJ 4D5CA 2HQRA 2MGQA 5CLSA 4A5MA 1HW5A 3K4LA 1S6LA 3CUQB 4RM2A 2NVTJ 1YITI 1JGGA 1XCVA 3T8RA 3V42A 2GXBA 3LAJA 2PJPA 4PSXA 1X3ZB 1SVOA 2P7VB 3K2AA 2CMPA 2MLGA 5IY5H 4OIPF 4BE0A 1WJFA 4R79A 1Z6TA 1D1CA 2L7FP 2QCOA 3HOZJ 4HSTA 3ZR8X 4R8HA 4II2A 1FMVA 3KPHA 1A04A 1B9MA 4MFEA 3GVAA 1J59A 2FNAA 2E1MC 4WXHA 4MTEA 4HLXA 2EBIA 2YX7A 1REPC 2KQRA 1DGWY 4M72A 4E6KG 2Y30A 2JA2A 4QPQA 2BV6A 3CUQC 3JREA 5IT9Z 3CUOA 3CUQA 3S1QJ 4ENNA 1FYMA 3FXMA 4BL0B 2HDCA 2OTLI 3I55I 3CMAI 3AKZA 2FMYA 3LFKA 3ZQLA 2Y0MA 2CUZA 5CKTA 1B6AA 3KE2A 1JKPC 1QVTA 2HOAA 5E3NA 2F4OB 1H0MA 4HDVA 1FBSA 4PJLA 5F0HA 2MBFA 3HC7A 3SFIA 4N4NB 3SZTA 2L9NA 2ELKA 4HW0A 3IHUA 1R36A 1STZA 4ENMA 4II3A 4BS9A 3DF8A 4I7HA 1VQKI 2FBKA 3FMSA 4KIFA 4RBOA 1HF0A 3QQAA 2LG4A 4E7IA 1LDDA 2CJJA 4RGUA 4LK1F 4BE2A 1I27A 1DPRA 4IRIA 2KP6A 1R58A 3AAFA 2D2WA 3BTLA 1R49A 3M8EA 1R22A 2O6GE 2QYOA 1RPWA 3CP8A 3RDIA 5J1RA 1JKRC 2OC6A 2AXTC 5K5RA 3FXKA 2HZDA 4CGZA 2DFIA 1X3UA 1SAXA 2JVHA 2FX0A 3DBHB 4BQAA 1YIOA 3E6DA 4GCVA 4M71A 2R7QA 1SFUA 1DP7P 3OIPA 3AL0C 5M5WJ 1OR7A 2A6EF 4ZDLA 4OU0A 5KAIC 5J1UA 4EV0A 4IRHA 3K10A 1AKHB 4IJAA 1WJCA 4MLOA 1FYKA 5CJ9A 2DFEA 1ZG3A 3EUKL 3MAJA 3N4MA 3FM5A 2VC0A 4LB6B 5A2QK 1ZGWA 4ZZDA 3ABUA 1FOXA 1MBGA 4M3DA 5FKNA 1MBEA 3C1DA 3QODA 4LLLA 1VQ4I 3HSFA 3QPTA 1HW1A 2LF7A 1F43A 2HNHA 4PJJA 4HBLA 5DEQA 5DUIA 4JYKA 5E20A 1E2XA 4A3CJ 3AG1H 2OCEA 3ESWB 4ANJA 1IC8A 3TO9A 3ZN1A 1L0OC 4I0AA 2UXNA 2IA2A 2HTJA 4W1UA 2OBPA 4O5VA 2HZTA 1VNDA 4D1QA 1B4AA 3OYDA 1K7AA 2VPRA 5J8CA 4OIQF 3HOYJ 4JK1X 3OV8A 2YU9J 5JR3A 1FX7A 3CCVI 2PEXA 5DUKA 5ILVA 4MTDA 3FWEA 1BI2A 1RKWA 3FF5A 3I54A 1OCRH 1S8NA 1X1DA 3KLNA 1OISA 3M7GA 3OL3A 2JTVA 5J1YA 1U8RA 2CO5A 2VODA 2DOAA 3RCOA 1OKRA 3G6EI 2X6OA 2DQRA 3BLYA 3OIQA 1A6IA 2RQPA 2M9HA 2EFQA 1T38A 1AKHA 3GTQJ 1I3QJ 4U7BA 4A2UA 1QO0D 1WSUA 1YHQI 3S3NA 4LK0F 4JQFA 1NH3A 3VB2A 1LUJB 2A69F 2WY7Q 1OYIA 1KQ9A 4RGXA 3OYHA 5CVUA 4D0PA 4HLYA 5JVTA 4M3FA 1IXRC 1N25A 3A0HC 1A6QA 3A1YA 4FTHA 2FOWA 1ETKA 2P0WA 5DCFA 2B9SA 1J75A 3C2HA 3HSEA 5LGNA 2KISA 4ZTFA 5LEKA 3VYSB 2AQEA 4V2GA 5EYRA 4A93J 4FT8A 1V3FA 2HPIA 2HDDA 5HS7A 4Y7NJ 3OYAA 4F92B 4EQQA 3FBIB 4IHVA 2FRHA 1D3YA 3IH3A 2DMTA 4MEXF 3GBGA 4BQNA 4NC7A 2NRAC 1VQ9I 1PUEE 1IAWA 1SMYF 2IPQX 5J8FA 2NNYA 2VQLA 4AVPA 2E71A 2JN6A 4BYYA 2HKXA 4OAZA 4YFXF 5BMZA 2HOEA 4I01A 4PFOA 4XOTA 2ADUA 2ECBA 4XBFA 4XRSG 5D6FA 4WX9A 4ZDPA 3GZNB 2KLOA 3IUOA 4PSWA 4UUVA 4GYGA 2IGNA 1QZZA 2M7BA 4RLQA 4F52A 5E3OA 3J80Z 2WAQN 2RGVA 2R5YB 4KN4X 1KQ8A 1UZCA 4AWXB 2A05A 1SFKA 1HQCA 2Q0OA 2W00A 2DFFA 3MWMA 4LFUA 3FZVA 3QAHA 4HV5A 1HSJA 5AONA 2VONA 1PJRA 3NRVA 3PFYA 4HYEA 3L2UA 3F3XA 2NS7A 3WU1B 5FKLA 4O6JA 2RQQA 1QU3A 1AWCA 2EH3A 3GMEA 5FGMA 3HG9A 3KEYA 2X6YA 3T0YA 4C2UA 1BR4A 2BVLA 2KRFA 2HDWA 1IG7A 1WJBA 4PGGA 2R4GA 1N78A 1U5TC 1S72I 4PUSA 3DLLF 1TL8A 1Z77A 2OA4A 2ZFUA 1I3AA 2P6TA 3WE3A 4B4CA 2DYRH 2FD5A 3MKLA 1E3HA 2Y0SN 4P9FA 4IHTA 3U2RA 4ASNA 3OYEA 2L7KA 1ULYA 3F8MA 5HNHA 2BBYA 1IN6A 2ELHA 1E3OC 1R5ID 1IW7F 1Z6RA 2CH0A 5BOXA 2R5YA 1S29A 3CJRB 3ELKA 4BEHB 2QKMB 4Q4ZF 3GCMA 1FC3A 1RIOH 4ESJA 4YIRX 2DMPA 4CYDA 4BNCA 3D5RC 1D0YA 2BVMA 4AVZA 2ISZA 1QVUA 2QWWA 3ZQ7A 3CCLI 3OWTA 4KITB 2EZIA 1V5EA 3PO3J 2DK5A 3BTJA 4XKVA 3ZMVA 5GPAA 1FZPB 1XPXA 2MABA 1PP7U 2V9KA 3P9IA 1V5FA 1R6RA 1I6XA 4UV9A 4EJUA 4ZC3A 2OTJI 2L9VA 4I98B 1R1TA 2QQAA 5FD6A 1IN7A 2GOMA 3LSPA 2DBBA 3JSPA 2MH2A 4UHTA 3L09A 2KIQA 1A36A 3A2KA 4YEJA 1UCRA 2XIGA 3RQ4A 3VYTB 1R4MB 3T1BA 4NDLA 4S0HB 4BHPA 4A5NA 4CICA 3OYMA 2PMUA 1O3SA 3HOUJ 2WC2A 4QSHA 5ED4A 2OD5A 4HQMA 1Z05A 1VFCA 1DU0A 3HSRA 2XF6A 3MN2A 4OIRF 3OYBA 1FEXA 3BG3A 3DLAA 4GRIA 3BCBA 1FY7A 4BEHA 2F4MB 1AA7A 4EJOA 5LBQA 2O8KA 5HDNA 2E2HJ 3K4MA 1I6HJ 4XKBA 3FDYA 4QWQA 3ASOH 3IAS2 3BC8A 2EIMH 4OINF 3W2AA 3BZCA 1BL0A 3JW4A 2CUEA 4B44A 1XG1A 3FK6A 1R7JA 3WGIA 5M5YJ 1GV5A 2L4AA 5F08A 3HGGA 2VJIA 4DNCA 1JXSA 1B59A 4DYQA 2O5RA 2P5KA 1RUNA 3TO7A 4KA4A 4L5JA 4BQQA 1KU9A 3QOEA 1VZ0A 3KP3A 4CCKA 2G0EA 2HEOA 2V1DA 2ZMEB 1FOYA 1U0JA 3FKJA 1GV2A 2PI0A 1SD4A 4P1WA 5GPCA 2O9LA 1RI7A 5BPIA 1WH7A 3M1EA 1ZH5A 2EB7A 4Y52J 2K5CA 1B9NA 3BY6A 3VWBA 5DDGA 5DD8A 5DM6F 2RV8A 2L54A 3GTKJ 3LSKA 3K4NA 4X6AJ 3F8CA 3WTUC 1LFBA 1E3PA 2H09A 1LKXA 1VI0A 3TDZC 2IS6A 3CTAA 4XSXF 4ZZLA 3WHBA 3DP7A 5GTHC 4A3MJ 5H2FC 4FQGA 3S16J 3CMMA 4IKFA 4EM2A 2VT2A 1Y0UA 5LEJA 1BR1A 3GFMA 1HXDA 1W36C 3G3ZA 3SHFA 4MGRA 3TOAA 3RPQA 2W25A 4ZJZA 1IV6A 3WG9A 3P9KA 2KHMA 1HSTA 1BI0A 2E60A 4KIGA 3WU0A 2K7LA 4U7DA 2HXOA 3BR3A 1R00A 2ZMEA 5FB2A 4RDUA 2HWVA 1QZYA 3U21A 1DPUA 2IEKA
chains in the Genus database with same CATH topology
2H27A 4I02A 4HOBA 4G6DA 1FPQA 3WE2A 5EEHA 2QQBA 2NS0A 1FOKA 2ZNYA 2ZCWA 4PCQA 1USTA 2QVOA 2PLYA 2GA1A 1O57A 1YG2A 3WTTC 3K69A 1EH8A 1DDNA 1K79A 3VEPA 1UFMA 3VOEA 3IL2A 3ECHA 1YW7A 2W57A 3QU6A 4WWCA 5CVJA 1I1GA 1U78A 3J81K 3DV8A 1MJBA 5ICCA 1S3JA 2K4JA 2IT0A 4MQVA 4ZYDA 2DTRA 2GA2A 3R0AA 2EFOA 2P8TA 1U3EM 4EM1A 3WTZA 2K02A 2OZ6A 2STTA 5AIQA 1OYYA 4EGYA 1KU2A 3QU3A 1F1ZA 1GXPA 2XASA 3FXRA 4B8XA 2HYGD 2ZBKA 2MA3A 5ICGA 1P92A 2J5OA 2LSOA 2OQRA 4HF1A 5TJJA 3DPLC 3JSOA 4B09A 1ON2A 2A3SA 5D6EA 1SD5A 3NQOA 1G3WA 4L9VA 3ECOA 3CDHA 5LRRA 4ON0A 1O3RA 1JHHA 4U0WA 1KYZA 1P4WA 4HF2A 3RKYA 5LLQA 4IXAA 1IXSB 4G94A 4IHSA 5D4SA 4Y15A 3BZ6A 1EH6A 2JRTA 2A6HF 2G7UA 2EA4A 5L3CA 2ISYA 2EV0A 2BGCA 2DO7A 3BPXA 1P4XA 3QP5A 2A07F 5ERIA 2DQLA 2M87A 2PMHA 3CLOA 3RTRA 1ODDA 2RNJA 4N9IA 1ZAOA 2IA1A 2P7CB 1GHCA 1D8JA 1TW3A 3TGNA 2CG4A 3JTGA 5LGUA 4G7ZF 5LHHA 1O3TA 5H6QA 1WWXA 2D45A 3ROUA 2M8EA 3D5LA 3HTSB 1P2FA 2RKHA 1YYVA 5L3GA 2GQQA 2Z3YA 4ENKA 4RAZA 3ULQB 2AXLA 1H9TA 1FT9A 5D4RA 3F23A 3SFZA 3O6BB 2EWNA 2FU4A 2EFNA 5HLIA 1W7PD 2JPBA 1P4AA 3GFLA 2A5YB 1BIBA 4EJTA 1R1UA 1TNTA 4FX0A 3CO7C 2PBIA 3GX4X 2IW5A 3RPUA 1ZGJA 1V4RA 2EJRA 3F8FA 2M30A 2R7FA 4L9NA 2OAZA 2XGXA 4I0BA 5ILSA 3ZMDA 2FE3A 1AOYA 3GZ5A 3IWZA 1B1BA 3C18A 4RB0A 2CWEA 4YFKF 5E1ZB 4KDPA 3ZMUA 1H9GA 2Y75A 2XUBA 2ESHA 2D1HA 1EH7A 3MZHA 3J81Z 1YFHA 4HX7A 3GUDA 3QPHA 2K27A 2W24A 4A0ZA 4G7OF 2DK8A 2VXZA 5E8GA 2STWA 4KMFA 3FXUA 1UB9A 1LEBA 2ACJA 1LDJA 1KU3A 5DV5A 3VFZA 3TKYA 1O3QA 4CZZA 3ZMZA 2F2EA 4GXOA 2ZJ2A 3P7NA 3CJNA 1C0WA 4DQ2A 2QUFA 3EDPA 1J7KA 2RDPA 1MZBA 3H3UA 3KEQA 5H20A 4P9UA 1S7OA 1HKTA 2UZKA 2UWMA 5D8KB 3HOTA 2JPCA 1ZN2A 2DT5A 2FNPA 1XSVA 4KMUX 2Z9OA 4WXCA 4FHTA 3LQQA 4P55A 2Z99A 1MKMA 3GYHX 1U2WA 4HX8A 4EVIA 5KK1A 3WTXC 2V79A 5ICEA 1USSA 4JBAA 1IN4A 2RVCA 4XLPF 2MC3A 2NNNA 1FYLA 3ML6A 3F6VA 1MJAA 1W5SA 2E1NA 5D5UB 3EYIA 1U5TB 3V8KA 2HKOA 1QPMA 4RAYA 4MEYF 1BM9A 1WI9A 2M1BA 5L3EA 1XGOA 5TRDA 4R1HA 1IN8A 3U9GA 5K5OA 5HS8A 4HF0A 3IRQA 3V7SA 2HGCA 3I4PA 4RB3C 1FWZA 2R3SA 3K1PA 2BYVE 2WV0A 3GWZA 3NEUA 2CYYA 4RB1A 2J5PA 5CVVA 2F5CA 4A0XA 2IP2A 1U5TA 4N9HA 1U6GA 5E18F 3B02A 4L9TA 5CVRA 2HQNA 1ZGAA 3G73A 2VBXA 4PZJA 4RGSA 4A6EA 1YW9A 2WTEA 2GXGA 3U1DA 4EJWA 5FO5A 2LF8A 5L3FA 3BDDA 5HVQC 4M9ZA 2O3FA 2JT1A 2E7WA 3CO6C 3K0LA 4ETSA 2CGPA 5ICFA 3F8NA 1KYWA 2GZWA 1T0FA 3TO6A 5LHIA 3I58A 1LVAA 2V1XA 2UXXA 4YFNF 4XRFA 4AIKA 3QP6A 2H6BA 2VT3A 3GO5A 4CXFA 2IA0A 2MLKA 2EFPA 2L01A 2FF4A 4BHBA 5HDKA 2CW0F 2YPRA 2ZO4A 3KFWX 1HBXG 4MQ9F 4LB5A 2G9WA 4Z2YA 1E17A 1HKSA 1OMIA 5BS6A 1VTNC 5H6RA 4WF2A 2XAFA 2Q8KA 2HYFA 5A2QZ 1MGTA 4S05A 4KUMA 2DAOA 4L9JA 1R5HA 2PG4A 4UVAA 5ILUA 1YO5C 1PDNC 3BPVA 1S7AA 2H94A 2XAQA 4WK8F 2VE9A 3V4GA 3LA7A 3PQJA 3K2ZA 2IJLA 4G9YA 3HOSA 2E7XA 3M8FA 1BC7C 2EV6A 4OMYA 1CF7B 1KA8A 5JFRA 3Q5FA 3R0JA 2FMLA 3MZYA 1TQPA 1OYWA 2FXAA 4BXUA 4AIHA 5HOOA 3P9CA 2Y48A 3KP2A 3PQKA 5HLGA 2W85A 1MDMB 1OPCA 3F6OA 3B73A 2MD5A 1NHAA 1XSDA 4N0BA 3WGHA 3LA2A 2FBIA 3ZPLA 3I59B 1G4DA 3KP5A 3E3VA 1SFXA 5E1WA 3S2WA 3Q9SA 1TQIA 2AS5F 3KP6A 1XDSA 1CF7A 1XN7A 3R4KA 4L18B 1L3LA 5F6FA 2V9VA 3BOQA 1JE8A 1W4MA 4NB5A 2FA5A 4S04A 2NYXA 3EYYA 3GEZA 2W84A 2ZXJA 3IWFA 1MDMA 1LDKB 1PP8F 4ZYEA 1BIAA 2OQGA 5FLXK 3Q9VA 3JTHA 1XSXA 4RS8A 3EETA 4L5IA 4A12A 3DXJF 4RGRA 3I59A 4CDGA 3RYPA 3F22A 2M5WA 3BROA 3HRTA 3H3ZA 4LLNA 2HTSA 4MNUA 4Y13A 3R60A 3C7JA 2B0LA 4F7ZA 2D1VA 1RZ4A 2G7HA 2P6SA 1O7LA 4EGZA 1QNTA 1FP2A 3I71A 2VC1A 1MJ9A 3KZYA 1HKQA 4KN7X 4UXNA 2NAZA 3ERED 4G7HF 3REOA 5L3BA 1GVJA 2Q2EA 3GFJA 3HTUA 2XKPA 1G3YA 4E70A 2RN7A 1YTYA 1FSEA 5HLHA 2CFXA 1LB2A 3TDUC 3TQNA 4ESFA 3D0SA 2RC4A 3J7AO 3F8BA 5BQTA 2M45A 1KQ0A 1ZG1A 1ZRCA 1T2KA 3FXQA 3W6KB 3PFIA 1JGSA 1XDUA 2VBWA 3FMQA 3TOBA 2VN2A 1G3SA 3E5QA 2YX4A 1BJAA 1RUOA 3WODF 1R23A 3VODA 3LWFA 1G3TA 2PFBA 2DPUA 2HFHA 5D5XB 2KIFA 1BBYA 4I09A 5JHUA 2O61A 3SXYA 1J5YA 5FFZA 4G6QA 2XKOA 3SZPA 1UHMA 5BPDA 2VOPA 3KEOA 2FSWA 5DYMA 4P96A 4O3MA 1D5VA 3RKWA 1QGPA 1ON1A 3L9FA 2XRNA 3M9AA 2BE5F 4KIBA 1IXCA 3O2PE 5D5VB 1FP1D 1LQ1A 5F64A 1FLIA 4OIOF 4AIJA 3HRUA 1ZLKA 3EQLF 2F5FA 3E5XA 1F9NA 4M6YA 2H6CA 5LRSA 4OMZA 1J0RA 1G6NA 3V7CA 2XHKA 2DI3A 4QLCU 2MH9A 4BH9A 1P6RA 4WCGA 1IN5A 5E1XA 1TW2A 1XCBA 2VE8A 5D8LB 3GZ6A 3ZMTA 2K4BA 1KU7A 1Q1HA 4HA8A 5FLXZ 3R6SA 2KJBA 3F72A 4KYWA 3KP4A 3DQVC 3JAMK 1BI3A 2F5DA 4U0VA 4HX4A 2X4HA 2PN6A 2EK5A 4LG0B 1TBXA 3BJ6A 4YIIA 4WXDA 3QRFF 4HDUA 1ZG5A 1CGPA 5EEGA 2VBZA 1QBJA 3BJAA 2X0LA 2O8XA 4EMSA 2BEOA 3GW2A 4M73A 2KIUA 3V8JA 4Q48A 2L4MA 1Z7UA 3WTSC 2P5LC 2A61A 2QBYB 4A0YA 6PAXA 2XAJA 4UV8A 4LG0A 5JI6A 4LJZF 2EFWA 2XAHA 5LHGA 3K1MA 4PGHA 3ZMSA 1TTYA 2DLLA 1IF1A 2OU2A 3IKVA 1W7PB 3I53A 4ZYGA 2COMA 4M74A 4CO8A 4IF4A 4HAMA 2XAGA 2V1UA 4M9XA 2F5EA 4G8XA 1O7FA 1DUXC 2K86A 2QBYA 4IVNA 5CVIA 3WTWC 2QM3A 5J6XA 3E5UA 3O3KA 2ZNZA 1RNLA 3E6MA 1TQMA 3ZN0A 3RI4A 2P4WA 2YU3A 2VOOA 3C3WA 1W7PA 4LGWA 3KP7A 3E6CC 1I5ZA 5K1YA 5HS9A 1XMAA 2YSRA 4LD5A 3GFIA 5DD4A 1WRJA 4CHUA 5F1RA 2FOKA 1IRFA 1J9IA 2ESNA 1WQ2A 3DEUA 3ISPA 3WTVC 3LAPA 3H92A 3FHZA 1T6SA 1XGMA 3HUGA 3LSTA 4M6XA 1ZYRF 2HR3A 3BJOA 2Z5UA 4P5OA 3T5XA 2EV5A 3DPTA 3MEXA 3IKTA 5CYVA 1BC8C 3HHHA 3KETA 3QOPA 3KCCA 3FMRA 4XSZF 1IRGA 5DCMB 1ZHFA 3I5UA 1YS7A 3E97A 4KFCA 3MQ0A 4Q47A 2CSOA 3GF2A 2DU9A 2C6YA 1F4KA 5L3DA 1K6OA 5FFXA 1BN5A 3JAMZ 1MD0A 1GXQA 2DW4A 4LMYA 4L0YB 4UVCA 3I0TA 4U0YA 4YIFA 2O03A 2V6CA 3L00A 3OOPA 5DCMA 4RB2C 2PQ8A 4ZYHA 5FD5A 1K78B 1Z9CA 4ESBA 2QQ9A 4HV6A 2LDUA 4GO1A 1TLHB 4FX4A 2QZ8A 2GWRA 4UVBA 5D5WB 3IRRA 2DPDA 4KT5C 1XB4A 1IUYA 4K2EA 4EJVA 1YQAA 2A68F 2ZKZA 3LQRA 2LNBA 4LLGF 3WTYC 4ZH4F 3K1NA 3R61A 2CQKA 4OOIA 1QQIA 5LGTA 3L7WA 1T98A 1SD7A 1BI1A 3WGGA 1FNNA 2EA2A 3GXOA 2GIVA 4PDKA 1K78A 1XGNA 2ZFWA 5K5QA 3HHGA 2XVCA 1SD6A 3ZP5A 1EV7A 2L3DA 3V8LA 1LNWA 2QLZA 1IZ1A 1ZRFA 3BWGA 3IC7A 1XGSA 2KIMA 5KVRA 4EM0B 3GLXA 3SQNA 2JZYA 5IT9K 1ZREA 4IPAA 3K9TA 2FEZA 3COAC 3V7RA 2FBHA 1XD7A 3HRMA 4U88A 5IT3A 1Z91A 3HYIA 2YR2A 2LKPA 4AD9A 4GYIA 3FX3A 4MHGA 1ZARA 1ZLJA 2OZUA 1LEAA 4HZFA 4BHCA 1JHFA 1R1VA 3ABTA 1YW8A 2TDXA 5AIPA 2JSCA 3FM3A 1FBQA 2R7DA 2IVMA 1BOAA 3I64A 3RIRA 2QENA 1HW2A 1FSHA 4Q5SF 4UNOA 3DFGA 3E6BA 5HDGA 4TV7A 4A6DA 1TNSA 1YS6A 3MCZA 1YLFA 4I2OA 4L0ZB 1UHWA 3MFKA 1F5TA 4M9SA 3T8TA 2FQ3A 4Y17A 2P5VA 3N97A 1Z1DA 3LA3A 1FBUA 1I1SA 1WKMA 2KJCA 2WWYA 1D8KA 2E1CA 2ETHA 3RJPA 3W6JB 3L2CA 4NHJA 4H0EA 1LJ9A 3EUHA 1SFEA 4IRGA 4GGGA 4KICA 4KNYA 1XMKA 1KGSA 3HRSA 3DKWA 2XROA 2L02A 2XV4S 3KZZA 4XLNF 5E17F 2HS5A 1ONVA 4BAYA 1W5TA 1T39A 2IRFG 3BP8A 3HIFA 2VBYA 5E8IA 1ZRDA 4HQEA 2KKOA 1J2XA 3KLOA 2GAUA 3F21A 2Z33A 1R5GA 2O0YA 3RYRA 4NQWA 4YG2F 4ENJA 1SMTA 3J80K 2HQRA 5CLSA 4A5MA 1HW5A 1S6LA 3CUQB 1XCVA 3T8RA 2GXBA 3LAJA 2PJPA 2P7VB 2MLGA 4OIPF 4R79A 1Z6TA 4R8HA 1A04A 1B9MA 3GVAA 1J59A 2FNAA 4WXHA 4MTEA 4HLXA 2YX7A 1REPC 4M72A 2BV6A 3CUQC 5IT9Z 3CUOA 3CUQA 4ENNA 1FYMA 2HDCA 2FMYA 3LFKA 2Y0MA 1B6AA 3KE2A 1H0MA 4HDVA 1FBSA 2MBFA 3SZTA 4HW0A 3IHUA 1R36A 1STZA 4ENMA 3DF8A 4I7HA 2FBKA 3FMSA 4KIFA 1LDDA 4RGUA 4LK1F 1I27A 1DPRA 4IRIA 1R58A 3AAFA 2D2WA 3M8EA 1R22A 2O6GE 2QYOA 3RDIA 5K5RA 4CGZA 2DFIA 1X3UA 1SAXA 4BQAA 1YIOA 3E6DA 4GCVA 4M71A 1SFUA 1DP7P 1OR7A 2A6EF 4OU0A 4EV0A 4IRHA 4IJAA 1FYKA 5CJ9A 1ZG3A 3MAJA 3N4MA 3FM5A 2VC0A 4LB6B 5A2QK 4ZZDA 3ABUA 3C1DA 4LLLA 3HSFA 3QPTA 1HW1A 2LF7A 4HBLA 5DEQA 5DUIA 5E20A 1E2XA 3TO9A 3ZN1A 1L0OC 4I0AA 2UXNA 2IA2A 2HTJA 2OBPA 4O5VA 2HZTA 1B4AA 1K7AA 5J8CA 4OIQF 4JK1X 3OV8A 5JR3A 1FX7A 2PEXA 5DUKA 5ILVA 4MTDA 3FWEA 1BI2A 3RKXA 3FF5A 3I54A 1S8NA 2VODA 3KLNA 3M7GA 1U8RA 2JTVA 2CO5A 1OKRA 2DQRA 2RQPA 2EFQA 1T38A 4U7BA 4A2UA 1QO0D 1WSUA 4LK0F 4JQFA 3VB2A 4RGXA 2A69F 1OYIA 1KQ9A 5CVUA 4D0PA 4HLYA 5JVTA 1IXRC 5DCFA 1J75A 3HSEA 5LGNA 5LEKA 4FT8A 1V3FA 5HS7A 4EQQA 2FRHA 1D3YA 4MEXF 2NRAC 1PUEE 1IAWA 1SMYF 2IPQX 5J8FA 2NNYA 4AVPA 4BYYA 2HKXA 5BMZA 4YFXF 2HOEA 4I01A 2ADUA 4XBFA 4WX9A 5D6FA 4UUVA 4GYGA 1QZZA 3J80Z 2RGVA 4KN4X 1KQ8A 4AWXB 1HQCA 2Q0OA 3MWMA 4LFUA 3FZVA 3QAHA 4HV5A 1HSJA 5AONA 2VONA 3NRVA 4HYEA 3F3XA 3WU1B 4O6JA 1AWCA 5FGMA 3T0YA 2KRFA 4PGGA 1U5TC 2OA4A 2P6TA 3WE3A 4P9FA 4IHTA 3U2RA 4ASNA 1ULYA 3F8MA 2BBYA 1IN6A 2ELHA 1IW7F 1Z6RA 5BOXA 1S29A 3ELKA 4Q4ZF 1FC3A 1RIOH 4ESJA 4CYDA 4BNCA 2ISZA 2QWWA 3ZQ7A 2DK5A 3ZMVA 1FZPB 1PP7U 3P9IA 1I6XA 4UV9A 4EJUA 4I98B 1R1TA 2QQAA 5FD6A 1IN7A 2DBBA 3JSPA 2MH2A 4UHTA 3L09A 1UCRA 2XIGA 3T1BA 4BHPA 4A5NA 4CICA 1O3SA 2PMUA 2WC2A 5ED4A 2OD5A 4HQMA 1Z05A 3HSRA 4OIRF 1FY7A 4EJOA 5LBQA 5HDNA 4QWQA 4OINF 3JW4A 1R7JA 3WGIA 2L4AA 4DNCA 1JXSA 1B59A 2P5KA 1RUNA 3TO7A 4KA4A 4L5JA 1KU9A 3KP3A 2HEOA 2V1DA 2ZMEB 2PI0A 1SD4A 1RI7A 5BPIA 3M1EA 1ZH5A 2EB7A 1B9NA 3BY6A 5DDGA 5DD8A 2RV8A 2L54A 3F8CA 3WTUC 2H09A 3TDZC 3CTAA 4XSXF 4ZZLA 3DP7A 4EM2A 2VT2A 1Y0UA 5LEJA 3GFMA 1HXDA 3G3ZA 3SHFA 4MGRA 3TOAA 3RPQA 2W25A 3WG9A 3P9KA 1HSTA 1BI0A 4KIGA 3WU0A 2K7LA 4U7DA 1R00A 2ZMEA 5FB2A 2HWVA 1QZYA 1DPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H27 A;  4I02 A;  4HOB A;  4G6D A;  1FPQ A;  3WE2 A;  5EEH A;  2QQB A;  2NS0 A;  1FOK A;  2ZNY A;  2ZCW A;  4PCQ A;  1UST A;  2QVO A;  2PLY A;  2GA1 A;  1O57 A;  1YG2 A;  3WTT C;  3K69 A;  1EH8 A;  1DDN A;  1K79 A;  3VEP A;  1UFM A;  3VOE A;  3IL2 A;  3ECH A;  1YW7 A;  2W57 A;  3QU6 A;  4WWC A;  5CVJ A;  1I1G A;  1U78 A;  3J81 K;  3DV8 A;  1MJB A;  5ICC A;  1S3J A;  2K4J A;  2IT0 A;  4MQV A;  4ZYD A;  2DTR A;  2GA2 A;  3R0A A;  2EFO A;  2P8T A;  1U3E M;  4EM1 A;  3WTZ A;  2K02 A;  2OZ6 A;  2STT A;  5AIQ A;  1OYY A;  4EGY A;  1KU2 A;  3QU3 A;  1F1Z A;  1GXP A;  2XAS A;  3FXR A;  4B8X A;  2HYG D;  2ZBK A;  2MA3 A;  5ICG A;  1P92 A;  2J5O A;  2LSO A;  2OQR A;  4HF1 A;  5TJJ A;  3DPL C;  3JSO A;  4B09 A;  1ON2 A;  2A3S A;  5D6E A;  1SD5 A;  3NQO A;  1G3W A;  4L9V A;  3ECO A;  3CDH A;  5LRR A;  4ON0 A;  1O3R A;  1JHH A;  4U0W A;  1KYZ A;  1P4W A;  4HF2 A;  3RKY A;  5LLQ A;  4IXA A;  1IXS B;  4G94 A;  4IHS A;  5D4S A;  4Y15 A;  3BZ6 A;  1EH6 A;  2JRT A;  2A6H F;  2G7U A;  2EA4 A;  5L3C A;  2ISY A;  2EV0 A;  2BGC A;  2DO7 A;  3BPX A;  1P4X A;  3QP5 A;  2A07 F;  5ERI A;  2DQL A;  2M87 A;  2PMH A;  3CLO A;  3RTR A;  1ODD A;  2RNJ A;  4N9I A;  1ZAO A;  2IA1 A;  2P7C B;  1GHC A;  1D8J A;  1TW3 A;  3TGN A;  2CG4 A;  3JTG A;  5LGU A;  4G7Z F;  5LHH A;  1O3T A;  5H6Q A;  1WWX A;  2D45 A;  3ROU A;  2M8E A;  3D5L A;  3HTS B;  1P2F A;  2RKH A;  1YYV A;  5L3G A;  2GQQ A;  2Z3Y A;  4ENK A;  4RAZ A;  3ULQ B;  2AXL A;  1H9T A;  1FT9 A;  5D4R A;  3F23 A;  3SFZ A;  3O6B B;  2EWN A;  2FU4 A;  2EFN A;  5HLI A;  1W7P D;  2JPB A;  1P4A A;  3GFL A;  2A5Y B;  1BIB A;  4EJT A;  1R1U A;  1TNT A;  4FX0 A;  3CO7 C;  2PBI A;  3GX4 X;  2IW5 A;  3RPU A;  1ZGJ A;  1V4R A;  2EJR A;  3F8F A;  2M30 A;  2R7F A;  4L9N A;  2OAZ A;  2XGX A;  4I0B A;  5ILS A;  3ZMD A;  2FE3 A;  1AOY A;  3GZ5 A;  3IWZ A;  1B1B A;  3C18 A;  4RB0 A;  2CWE A;  4YFK F;  5E1Z B;  4KDP A;  3ZMU A;  1H9G A;  2Y75 A;  2XUB A;  2ESH A;  2D1H A;  1EH7 A;  3MZH A;  3J81 Z;  1YFH A;  4HX7 A;  3GUD A;  3QPH A;  2K27 A;  2W24 A;  4A0Z A;  4G7O F;  2DK8 A;  2VXZ A;  5E8G A;  2STW A;  4KMF A;  3FXU A;  1UB9 A;  1LEB A;  2ACJ A;  1LDJ A;  1KU3 A;  5DV5 A;  3VFZ A;  3TKY A;  1O3Q A;  4CZZ A;  3ZMZ A;  2F2E A;  4GXO A;  2ZJ2 A;  3P7N A;  3CJN A;  1C0W A;  4DQ2 A;  2QUF A;  3EDP A;  1J7K A;  2RDP A;  1MZB A;  3H3U A;  3KEQ A;  5H20 A;  4P9U A;  1S7O A;  1HKT A;  2UZK A;  2UWM A;  5D8K B;  3HOT A;  2JPC A;  1ZN2 A;  2DT5 A;  2FNP A;  1XSV A;  4KMU X;  2Z9O A;  4WXC A;  4FHT A;  3LQQ A;  4P55 A;  2Z99 A;  1MKM A;  3GYH X;  1U2W A;  4HX8 A;  4EVI A;  5KK1 A;  3WTX C;  2V79 A;  5ICE A;  1USS A;  4JBA A;  1IN4 A;  2RVC A;  4XLP F;  2MC3 A;  2NNN A;  1FYL A;  3ML6 A;  3F6V A;  1MJA A;  1W5S A;  2E1N A;  5D5U B;  3EYI A;  1U5T B;  3V8K A;  2HKO A;  1QPM A;  4RAY A;  4MEY F;  1BM9 A;  1WI9 A;  2M1B A;  5L3E A;  1XGO A;  5TRD A;  4R1H A;  1IN8 A;  3U9G A;  5K5O A;  5HS8 A;  4HF0 A;  3IRQ A;  3V7S A;  2HGC A;  3I4P A;  4RB3 C;  1FWZ A;  2R3S A;  3K1P A;  2BYV E;  2WV0 A;  3GWZ A;  3NEU A;  2CYY A;  4RB1 A;  2J5P A;  5CVV A;  2F5C A;  4A0X A;  2IP2 A;  1U5T A;  4N9H A;  1U6G A;  5E18 F;  3B02 A;  4L9T A;  5CVR A;  2HQN A;  1ZGA A;  3G73 A;  2VBX A;  4PZJ A;  4RGS A;  4A6E A;  1YW9 A;  2WTE A;  2GXG A;  3U1D A;  4EJW A;  5FO5 A;  2LF8 A;  5L3F A;  3BDD A;  5HVQ C;  4M9Z A;  2O3F A;  2JT1 A;  2E7W A;  3CO6 C;  3K0L A;  4ETS A;  2CGP A;  5ICF A;  3F8N A;  1KYW A;  2GZW A;  1T0F A;  3TO6 A;  5LHI A;  3I58 A;  1LVA A;  2V1X A;  2UXX A;  4YFN F;  4XRF A;  4AIK A;  3QP6 A;  2H6B A;  2VT3 A;  3GO5 A;  4CXF A;  2IA0 A;  2MLK A;  2EFP A;  2L01 A;  2FF4 A;  4BHB A;  5HDK A;  2CW0 F;  2YPR A;  2ZO4 A;  3KFW X;  1HBX G;  4MQ9 F;  4LB5 A;  2G9W A;  4Z2Y A;  1E17 A;  1HKS A;  1OMI A;  5BS6 A;  1VTN C;  5H6R A;  4WF2 A;  2XAF A;  2Q8K A;  2HYF A;  5A2Q Z;  1MGT A;  4S05 A;  4KUM A;  2DAO A;  4L9J A;  1R5H A;  2PG4 A;  4UVA A;  5ILU A;  1YO5 C;  1PDN C;  3BPV A;  1S7A A;  2H94 A;  2XAQ A;  4WK8 F;  2VE9 A;  3V4G A;  3LA7 A;  3PQJ A;  3K2Z A;  2IJL A;  4G9Y A;  3HOS A;  2E7X A;  3M8F A;  1BC7 C;  2EV6 A;  4OMY A;  1CF7 B;  1KA8 A;  5JFR A;  3Q5F A;  3R0J A;  2FML A;  3MZY A;  1TQP A;  1OYW A;  2FXA A;  4BXU A;  4AIH A;  5HOO A;  3P9C A;  2Y48 A;  3KP2 A;  3PQK A;  5HLG A;  2W85 A;  1MDM B;  1OPC A;  3F6O A;  3B73 A;  2MD5 A;  1NHA A;  1XSD A;  4N0B A;  3WGH A;  3LA2 A;  2FBI A;  3ZPL A;  3I59 B;  1G4D A;  3KP5 A;  3E3V A;  1SFX A;  5E1W A;  3S2W A;  3Q9S A;  1TQI A;  2AS5 F;  3KP6 A;  1XDS A;  1CF7 A;  1XN7 A;  3R4K A;  4L18 B;  1L3L A;  5F6F A;  2V9V A;  3BOQ A;  1JE8 A;  1W4M A;  4NB5 A;  2FA5 A;  4S04 A;  2NYX A;  3EYY A;  3GEZ A;  2W84 A;  2ZXJ A;  3IWF A;  1MDM A;  1LDK B;  1PP8 F;  4ZYE A;  1BIA A;  2OQG A;  5FLX K;  3Q9V A;  3JTH A;  1XSX A;  4RS8 A;  3EET A;  4L5I A;  4A12 A;  3DXJ F;  4RGR A;  3I59 A;  4CDG A;  3RYP A;  3F22 A;  2M5W A;  3BRO A;  3HRT A;  3H3Z A;  4LLN A;  2HTS A;  4MNU A;  4Y13 A;  3R60 A;  3C7J A;  2B0L A;  4F7Z A;  2D1V A;  1RZ4 A;  2G7H A;  2P6S A;  1O7L A;  4EGZ A;  1QNT A;  1FP2 A;  3I71 A;  2VC1 A;  1MJ9 A;  3KZY A;  1HKQ A;  4KN7 X;  4UXN A;  2NAZ A;  3ERE D;  4G7H F;  3REO A;  5L3B A;  1GVJ A;  2Q2E A;  3GFJ A;  3HTU A;  2XKP A;  1G3Y A;  4E70 A;  2RN7 A;  1YTY A;  1FSE A;  5HLH A;  2CFX A;  1LB2 A;  3TDU C;  3TQN A;  4ESF A;  3D0S A;  2RC4 A;  3J7A O;  3F8B A;  5BQT A;  2M45 A;  1KQ0 A;  1ZG1 A;  1ZRC A;  1T2K A;  3FXQ A;  3W6K B;  3PFI A;  1JGS A;  1XDU A;  2VBW A;  3FMQ A;  3TOB A;  2VN2 A;  1G3S A;  3E5Q A;  2YX4 A;  1BJA A;  1RUO A;  3WOD F;  1R23 A;  3VOD A;  3LWF A;  1G3T A;  2PFB A;  2DPU A;  2HFH A;  5D5X B;  2KIF A;  1BBY A;  4I09 A;  5JHU A;  2O61 A;  3SXY A;  1J5Y A;  5FFZ A;  4G6Q A;  2XKO A;  3SZP A;  1UHM A;  5BPD A;  2VOP A;  3KEO A;  2FSW A;  5DYM A;  4P96 A;  4O3M A;  1D5V A;  3RKW A;  1QGP A;  1ON1 A;  3L9F A;  2XRN A;  3M9A A;  2BE5 F;  4KIB A;  1IXC A;  3O2P E;  5D5V B;  1FP1 D;  1LQ1 A;  5F64 A;  1FLI A;  4OIO F;  4AIJ A;  3HRU A;  1ZLK A;  3EQL F;  2F5F A;  3E5X A;  1F9N A;  4M6Y A;  2H6C A;  5LRS A;  4OMZ A;  1J0R A;  1G6N A;  3V7C A;  2XHK A;  2DI3 A;  4QLC U;  2MH9 A;  4BH9 A;  1P6R A;  4WCG A;  1IN5 A;  5E1X A;  1TW2 A;  1XCB A;  2VE8 A;  5D8L B;  3GZ6 A;  3ZMT A;  2K4B A;  1KU7 A;  1Q1H A;  4HA8 A;  5FLX Z;  3R6S A;  2KJB A;  3F72 A;  4KYW A;  3KP4 A;  3DQV C;  3JAM K;  1BI3 A;  2F5D A;  4U0V A;  4HX4 A;  2X4H A;  2PN6 A;  2EK5 A;  4LG0 B;  1TBX A;  3BJ6 A;  4YII A;  4WXD A;  3QRF F;  4HDU A;  1ZG5 A;  1CGP A;  5EEG A;  2VBZ A;  1QBJ A;  3BJA A;  2X0L A;  2O8X A;  4EMS A;  2BEO A;  3GW2 A;  4M73 A;  2KIU A;  3V8J A;  4Q48 A;  2L4M A;  1Z7U A;  3WTS C;  2P5L C;  2A61 A;  2QBY B;  4A0Y A;  6PAX A;  2XAJ A;  4UV8 A;  4LG0 A;  5JI6 A;  4LJZ F;  2EFW A;  2XAH A;  5LHG A;  3K1M A;  4PGH A;  3ZMS A;  1TTY A;  2DLL A;  1IF1 A;  2OU2 A;  3IKV A;  1W7P B;  3I53 A;  4ZYG A;  2COM A;  4M74 A;  4CO8 A;  4IF4 A;  4HAM A;  2XAG A;  2V1U A;  4M9X A;  2F5E A;  4G8X A;  1O7F A;  1DUX C;  2K86 A;  2QBY A;  4IVN A;  5CVI A;  3WTW C;  2QM3 A;  5J6X A;  3E5U A;  3O3K A;  2ZNZ A;  1RNL A;  3E6M A;  1TQM A;  3ZN0 A;  3RI4 A;  2P4W A;  2YU3 A;  2VOO A;  3C3W A;  1W7P A;  4LGW A;  3KP7 A;  3E6C C;  1I5Z A;  5K1Y A;  5HS9 A;  1XMA A;  2YSR A;  4LD5 A;  3GFI A;  5DD4 A;  1WRJ A;  4CHU A;  5F1R A;  2FOK A;  1IRF A;  1J9I A;  2ESN A;  1WQ2 A;  3DEU A;  3ISP A;  3WTV C;  3LAP A;  3H92 A;  3FHZ A;  1T6S A;  1XGM A;  3HUG A;  3LST A;  4M6X A;  1ZYR F;  2HR3 A;  3BJO A;  2Z5U A;  4P5O A;  3T5X A;  2EV5 A;  3DPT A;  3MEX A;  3IKT A;  5CYV A;  1BC8 C;  3HHH A;  3KET A;  3QOP A;  3KCC A;  3FMR A;  4XSZ F;  1IRG A;  5DCM B;  1ZHF A;  3I5U A;  1YS7 A;  3E97 A;  4KFC A;  3MQ0 A;  4Q47 A;  2CSO A;  3GF2 A;  2DU9 A;  2C6Y A;  1F4K A;  5L3D A;  1K6O A;  5FFX A;  1BN5 A;  3JAM Z;  1MD0 A;  1GXQ A;  2DW4 A;  4LMY A;  4L0Y B;  4UVC A;  3I0T A;  4U0Y A;  4YIF A;  2O03 A;  2V6C A;  3L00 A;  3OOP A;  5DCM A;  4RB2 C;  2PQ8 A;  4ZYH A;  5FD5 A;  1K78 B;  1Z9C A;  4ESB A;  2QQ9 A;  4HV6 A;  2LDU A;  4GO1 A;  1TLH B;  4FX4 A;  2QZ8 A;  2GWR A;  4UVB A;  5D5W B;  3IRR A;  2DPD A;  4KT5 C;  1XB4 A;  1IUY A;  4K2E A;  4EJV A;  1YQA A;  2A68 F;  2ZKZ A;  3LQR A;  2LNB A;  4LLG F;  3WTY C;  4ZH4 F;  3K1N A;  3R61 A;  2CQK A;  4OOI A;  1QQI A;  5LGT A;  3L7W A;  1T98 A;  1SD7 A;  1BI1 A;  3WGG A;  1FNN A;  2EA2 A;  3GXO A;  2GIV A;  4PDK A;  1K78 A;  1XGN A;  2ZFW A;  5K5Q A;  3HHG A;  2XVC A;  1SD6 A;  3ZP5 A;  1EV7 A;  2L3D A;  3V8L A;  1LNW A;  2QLZ A;  1IZ1 A;  1ZRF A;  3BWG A;  3IC7 A;  1XGS A;  2KIM A;  5KVR A;  4EM0 B;  3GLX A;  3SQN A;  2JZY A;  5IT9 K;  1ZRE A;  4IPA A;  3K9T A;  2FEZ A;  3COA C;  3V7R A;  2FBH A;  1XD7 A;  3HRM A;  4U88 A;  5IT3 A;  1Z91 A;  3HYI A;  2YR2 A;  2LKP A;  4AD9 A;  4GYI A;  3FX3 A;  4MHG A;  1ZAR A;  1ZLJ A;  2OZU A;  1LEA A;  4HZF A;  4BHC A;  1JHF A;  1R1V A;  3ABT A;  1YW8 A;  2TDX A;  5AIP A;  2JSC A;  3FM3 A;  1FBQ A;  2R7D A;  2IVM A;  1BOA A;  3I64 A;  3RIR A;  2QEN A;  1HW2 A;  1FSH A;  4Q5S F;  4UNO A;  3DFG A;  3E6B A;  5HDG A;  4TV7 A;  4A6D A;  1TNS A;  1YS6 A;  3MCZ A;  1YLF A;  4I2O A;  4L0Z B;  1UHW A;  3MFK A;  1F5T A;  4M9S A;  3T8T A;  2FQ3 A;  4Y17 A;  2P5V A;  3N97 A;  1Z1D A;  3LA3 A;  1FBU A;  1I1S A;  1WKM A;  2KJC A;  2WWY A;  1D8K A;  2E1C A;  2ETH A;  3RJP A;  3W6J B;  3L2C A;  4NHJ A;  4H0E A;  1LJ9 A;  3EUH A;  1SFE A;  4IRG A;  4GGG A;  4KIC A;  4KNY A;  1XMK A;  1KGS A;  3HRS A;  3DKW A;  2XRO A;  2L02 A;  2XV4 S;  3KZZ A;  4XLN F;  5E17 F;  2HS5 A;  1ONV A;  4BAY A;  1W5T A;  1T39 A;  2IRF G;  3BP8 A;  3HIF A;  2VBY A;  5E8I A;  1ZRD A;  4HQE A;  2KKO A;  1J2X A;  3KLO A;  2GAU A;  3F21 A;  2Z33 A;  1R5G A;  2O0Y A;  3RYR A;  4NQW A;  4YG2 F;  4ENJ A;  1SMT A;  3J80 K;  2HQR A;  5CLS A;  4A5M A;  1HW5 A;  1S6L A;  3CUQ B;  1XCV A;  3T8R A;  2GXB A;  3LAJ A;  2PJP A;  2P7V B;  2MLG A;  4OIP F;  4R79 A;  1Z6T A;  4R8H A;  1A04 A;  1B9M A;  3GVA A;  1J59 A;  2FNA A;  4WXH A;  4MTE A;  4HLX A;  2YX7 A;  1REP C;  4M72 A;  2BV6 A;  3CUQ C;  5IT9 Z;  3CUO A;  3CUQ A;  4ENN A;  1FYM A;  2HDC A;  2FMY A;  3LFK A;  2Y0M A;  1B6A A;  3KE2 A;  1H0M A;  4HDV A;  1FBS A;  2MBF A;  3SZT A;  4HW0 A;  3IHU A;  1R36 A;  1STZ A;  4ENM A;  3DF8 A;  4I7H A;  2FBK A;  3FMS A;  4KIF A;  1LDD A;  4RGU A;  4LK1 F;  1I27 A;  1DPR A;  4IRI A;  1R58 A;  3AAF A;  2D2W A;  3M8E A;  1R22 A;  2O6G E;  2QYO A;  3RDI A;  5K5R A;  4CGZ A;  2DFI A;  1X3U A;  1SAX A;  4BQA A;  1YIO A;  3E6D A;  4GCV A;  4M71 A;  1SFU A;  1DP7 P;  1OR7 A;  2A6E F;  4OU0 A;  4EV0 A;  4IRH A;  4IJA A;  1FYK A;  5CJ9 A;  1ZG3 A;  3MAJ A;  3N4M A;  3FM5 A;  2VC0 A;  4LB6 B;  5A2Q K;  4ZZD A;  3ABU A;  3C1D A;  4LLL A;  3HSF A;  3QPT A;  1HW1 A;  2LF7 A;  4HBL A;  5DEQ A;  5DUI A;  5E20 A;  1E2X A;  3TO9 A;  3ZN1 A;  1L0O C;  4I0A A;  2UXN A;  2IA2 A;  2HTJ A;  2OBP A;  4O5V A;  2HZT A;  1B4A A;  1K7A A;  5J8C A;  4OIQ F;  4JK1 X;  3OV8 A;  5JR3 A;  1FX7 A;  2PEX A;  5DUK A;  5ILV A;  4MTD A;  3FWE A;  1BI2 A;  3RKX A;  3FF5 A;  3I54 A;  1S8N A;  2VOD A;  3KLN A;  3M7G A;  1U8R A;  2JTV A;  2CO5 A;  1OKR A;  2DQR A;  2RQP A;  2EFQ A;  1T38 A;  4U7B A;  4A2U A;  1QO0 D;  1WSU A;  4LK0 F;  4JQF A;  3VB2 A;  4RGX A;  2A69 F;  1OYI A;  1KQ9 A;  5CVU A;  4D0P A;  4HLY A;  5JVT A;  1IXR C;  5DCF A;  1J75 A;  3HSE A;  5LGN A;  5LEK A;  4FT8 A;  1V3F A;  5HS7 A;  4EQQ A;  2FRH A;  1D3Y A;  4MEX F;  2NRA C;  1PUE E;  1IAW A;  1SMY F;  2IPQ X;  5J8F A;  2NNY A;  4AVP A;  4BYY A;  2HKX A;  5BMZ A;  4YFX F;  2HOE A;  4I01 A;  2ADU A;  4XBF A;  4WX9 A;  5D6F A;  4UUV A;  4GYG A;  1QZZ A;  3J80 Z;  2RGV A;  4KN4 X;  1KQ8 A;  4AWX B;  1HQC A;  2Q0O A;  3MWM A;  4LFU A;  3FZV A;  3QAH A;  4HV5 A;  1HSJ A;  5AON A;  2VON A;  3NRV A;  4HYE A;  3F3X A;  3WU1 B;  4O6J A;  1AWC A;  5FGM A;  3T0Y A;  2KRF A;  4PGG A;  1U5T C;  2OA4 A;  2P6T A;  3WE3 A;  4P9F A;  4IHT A;  3U2R A;  4ASN A;  1ULY A;  3F8M A;  2BBY A;  1IN6 A;  2ELH A;  1IW7 F;  1Z6R A;  5BOX A;  1S29 A;  3ELK A;  4Q4Z F;  1FC3 A;  1RIO H;  4ESJ A;  4CYD A;  4BNC A;  2ISZ A;  2QWW A;  3ZQ7 A;  2DK5 A;  3ZMV A;  1FZP B;  1PP7 U;  3P9I A;  1I6X A;  4UV9 A;  4EJU A;  4I98 B;  1R1T A;  2QQA A;  5FD6 A;  1IN7 A;  2DBB A;  3JSP A;  2MH2 A;  4UHT A;  3L09 A;  1UCR A;  2XIG A;  3T1B A;  4BHP A;  4A5N A;  4CIC A;  1O3S A;  2PMU A;  2WC2 A;  5ED4 A;  2OD5 A;  4HQM A;  1Z05 A;  3HSR A;  4OIR F;  1FY7 A;  4EJO A;  5LBQ A;  5HDN A;  4QWQ A;  4OIN F;  3JW4 A;  1R7J A;  3WGI A;  2L4A A;  4DNC A;  1JXS A;  1B59 A;  2P5K A;  1RUN A;  3TO7 A;  4KA4 A;  4L5J A;  1KU9 A;  3KP3 A;  2HEO A;  2V1D A;  2ZME B;  2PI0 A;  1SD4 A;  1RI7 A;  5BPI A;  3M1E A;  1ZH5 A;  2EB7 A;  1B9N A;  3BY6 A;  5DDG A;  5DD8 A;  2RV8 A;  2L54 A;  3F8C A;  3WTU C;  2H09 A;  3TDZ C;  3CTA A;  4XSX F;  4ZZL A;  3DP7 A;  4EM2 A;  2VT2 A;  1Y0U A;  5LEJ A;  3GFM A;  1HXD A;  3G3Z A;  3SHF A;  4MGR A;  3TOA A;  3RPQ A;  2W25 A;  3WG9 A;  3P9K A;  1HST A;  1BI0 A;  4KIG A;  3WU0 A;  2K7L A;  4U7D A;  1R00 A;  2ZME A;  5FB2 A;  2HWV A;  1QZY A;  1DPU A; 
#chains in the Genus database with same CATH topology
 2V9P A;  3H1C A;  3LSI A;  2H27 A;  4I02 A;  4HOB A;  2X48 A;  4G6D A;  1ENH A;  1FPQ A;  3WE2 A;  2NVX J;  5EEH A;  2R0Q C;  2QQB A;  2NS0 A;  1FOK A;  2ZNY A;  1WHU A;  5FRN A;  1SC7 A;  2ZCW A;  2MFZ A;  4PCQ A;  1UST A;  3KYC B;  1EF4 A;  2QVO A;  2PLY A;  4XLC A;  1UG2 A;  2GA1 A;  4E7K A;  2LR8 A;  1O57 A;  1YG2 A;  3WTT C;  2R7U A;  3K69 A;  2VJ4 A;  1LE8 B;  1EH8 A;  1DDN A;  4UY8 I;  1K79 A;  3VEP A;  2QKL B;  1UFM A;  3VOE A;  3DTK A;  3IL2 A;  3ECH A;  1YW7 A;  2W57 A;  3QU6 A;  1P7I A;  2BOL A;  2X9D A;  2XDV A;  5GAE J;  4XKC A;  4WWC A;  5CVJ A;  1VQ6 I;  1I1G A;  4DW6 A;  3IV5 A;  1U78 A;  2ELJ A;  4UB6 C;  3QYE A;  3J81 K;  1Y39 A;  3DV8 A;  1MJB A;  1V5G A;  4UB8 C;  5ICC A;  2W7N A;  3BR6 A;  1S3J A;  3K4K A;  2K4J A;  2IT0 A;  2P81 A;  4MQV A;  4ZYD A;  1YX5 A;  2XSJ C;  2LMD A;  3AFH A;  2DTR A;  2GA2 A;  1I39 A;  3R0A A;  1HCR A;  2EFO A;  1SEU A;  2DA2 A;  2ICW G;  2P8T A;  4CCM A;  1U3E M;  3WU2 C;  5E3L A;  1Q1V A;  4EM1 A;  2H8R A;  2L9S A;  3WTZ A;  2K02 A;  4PK4 A;  2OZ6 A;  1WJA A;  2STT A;  2HU9 A;  5AIQ A;  1OYY A;  1YOV B;  2HI3 A;  4EGY A;  1KU2 A;  3IH2 A;  3QU3 A;  2K3P A;  1LE8 A;  2X1C A;  1F1Z A;  4I99 C;  1GXP A;  2XAS A;  2AQF A;  1U8B A;  3FXR A;  4B8X A;  1MBJ A;  2HYG D;  2ZBK A;  2X85 A;  2MA3 A;  5ICG A;  2R92 J;  4Z6Y A;  3HEF A;  5F0F A;  3RKX A;  1Z0X A;  1P92 A;  4DYR A;  4FIS A;  2J5O A;  2LSO A;  2OQR A;  4HF1 A;  4ITV A;  1EJ9 A;  5TJJ A;  1OCP A;  2XPU A;  3DPL C;  3CCR I;  3JSO A;  4B09 A;  1ON2 A;  2A3S A;  5D6E A;  5FKO A;  1SD5 A;  3NQO A;  4HG2 A;  1G3W A;  3ZQI A;  4PFP A;  5HLT A;  2VJ5 A;  3HKZ A;  4L9V A;  3OYI A;  3CCJ I;  3ECO A;  3MKZ A;  3CDH A;  1KON A;  3KZI C;  1LPQ A;  1JT6 A;  5LRR A;  4DIQ A;  4ON0 A;  1Y8R B;  1O3R A;  2IS4 A;  1JHH A;  4ZTJ A;  4U0W A;  4BJT A;  1KYZ A;  1P4W A;  3ZRG A;  2HVS A;  1WVR A;  2HPM A;  4HF2 A;  2VXD A;  3ABM H;  4RAF A;  3RKY A;  5LLQ A;  2ZJQ F;  2L9R A;  2DMQ A;  3AG2 H;  3K6G A;  4IXA A;  3ERM A;  4AM3 A;  4MFD A;  5GAH J;  1IXS B;  4G94 A;  4AYB N;  2M3A A;  2HXI A;  4IHS A;  3LL7 A;  2XGC A;  5D4S A;  2JQ7 A;  4Y15 A;  3BZ6 A;  1FIA A;  4D9J A;  4DZP A;  2DA6 A;  1EH6 A;  2JRT A;  2A6H F;  2G7U A;  2EA4 A;  4M6V A;  5L3C A;  2WAF A;  3HPG A;  1POG A;  2ISY A;  2JSP A;  2EV0 A;  3LSH A;  4BY1 J;  2BGC A;  3PJR A;  3SYT A;  2DO7 A;  3BPX A;  1P4X A;  3QP5 A;  2EZK A;  2L0K A;  3M07 A;  5HOD A;  4IHY A;  3N05 A;  1ZTR A;  3FIS A;  5EGO B;  2A07 F;  2KDZ A;  5ERI A;  2DQL A;  2M87 A;  2PMH A;  2MSY A;  5JLX A;  3CLO A;  3RTR A;  2KPM A;  3A03 A;  3K4C A;  1ODD A;  2AO9 A;  2RNJ A;  2VPL A;  3BR1 A;  4N9I A;  1VQO I;  2WY8 Q;  1VQP I;  1ZAO A;  2IA1 A;  2E1M B;  3CCU I;  2P7C B;  1GHC A;  4RAG A;  1D8J A;  2A5W A;  1TW3 A;  3M1C A;  3TGN A;  2CG4 A;  2CQN A;  3S17 J;  3JTG A;  2BY3 A;  5LGU A;  4G7Z F;  1AU7 A;  5LHH A;  1O3T A;  5H6Q A;  1IUF A;  1ZKG A;  3LFU A;  1WWX A;  2D45 A;  3ROU A;  1QPI A;  2M8E A;  3D5L A;  3DEE A;  3HTS B;  2NVU B;  4I76 A;  1P2F A;  2OF7 A;  2K9S A;  2FQ4 A;  2RKH A;  1YYV A;  5L3G A;  3G4S I;  5M3F J;  2GQQ A;  5B5E C;  2Z3Y A;  4LOC A;  1UMQ A;  2DDA A;  4ENK A;  2IS1 A;  4RAZ A;  2Y31 A;  3ULQ B;  1T56 A;  3HZJ A;  2AXL A;  2B7E A;  1FT9 A;  2LRE A;  5D4R A;  1H9T A;  1ERD A;  3F23 A;  2MD0 A;  3SFZ A;  5EGO A;  4KT6 A;  3HJE A;  1N77 A;  3O6B B;  1YJ9 I;  1JUM A;  5CQG A;  2EWN A;  1YJN I;  3ZQH A;  2FU4 A;  2EFN A;  1Y6I A;  5HLI A;  1W7P D;  2JPB A;  4LIV A;  1TC3 C;  1P4A A;  3GFL A;  2A5Y B;  4C2M J;  1BIB A;  4EJT A;  4IHX A;  1R1U A;  1TNT A;  3OYG A;  4FX0 A;  3LSJ A;  2JUC A;  2AHQ A;  3CO7 C;  4D7N A;  3AG3 H;  2PBI A;  3GX4 X;  2IW5 A;  4BBR J;  3B6C A;  4BBS J;  2ECC A;  2XGD A;  3RPU A;  1ZGJ A;  2DJN A;  1V4R A;  2E19 A;  1RRJ A;  2EJR A;  2HQ5 A;  3AL0 B;  3F8F A;  5J4V A;  2B63 J;  2M30 A;  4HNT A;  2R7F A;  5M5X J;  3VYU B;  4BDY A;  2M2E A;  4L9N A;  2OAZ A;  2I10 A;  3LOC A;  2XGX A;  4NC6 A;  4I0B A;  5EG0 B;  1R9T J;  5ILS A;  3ZMD A;  2FE3 A;  2WBM A;  1W0U A;  2R7Z J;  1AOY A;  3GZ5 A;  3IWZ A;  1B1B A;  3C18 A;  4RB0 A;  2CWE A;  4DZJ A;  4YFK F;  5E1Z B;  1X4P A;  4KDP A;  3DBR B;  1TWC J;  3ZMU A;  1H9G A;  2F4I A;  2Y75 A;  2XUB A;  5LD2 C;  2LY1 A;  2ESH A;  3DKY A;  2D1H A;  1FIP A;  3UNG C;  1EH7 A;  3MZH A;  3J81 Z;  1T33 A;  2KRH A;  5IP7 J;  1YFH A;  2CV1 A;  3I3L A;  4HX7 A;  3GUD A;  4E7Z A;  1FJL A;  3QPH A;  4J01 A;  2K27 A;  2NOG A;  2W24 A;  4A0Z A;  4G7O F;  3BZK A;  4GDF A;  2DK8 A;  3H35 A;  2VXZ A;  5E8G A;  2STW A;  4KMF A;  3VPR A;  4B1R A;  1DGR M;  3FXU A;  3FK7 A;  3MMY B;  1UHS A;  1UB9 A;  4C2T A;  2X1E A;  1OCT C;  2EZH A;  1ETV A;  3E1S A;  1LEB A;  1A5J A;  2ACJ A;  1LDJ A;  1KU3 A;  2N8G A;  3CQZ J;  5DV5 A;  5EG0 A;  2HOT A;  3VFZ A;  3TKY A;  3W2V A;  4IX7 A;  1O3Q A;  5B1A H;  4CZZ A;  5EZH A;  5F0C A;  3ZMZ A;  3ZXS A;  1VQL I;  2F2E A;  4GXO A;  2ZJ2 A;  2L5Q A;  1S9H A;  2IAI A;  4IEJ A;  2ZB9 A;  3P7N A;  3CJN A;  1C0W A;  2LP0 A;  4DQ2 A;  2QUF A;  4BAC A;  1VQ8 I;  5B1B H;  3EDP A;  4C30 A;  4IO9 F;  2QF7 A;  1J7K A;  2RDP A;  1MMD A;  4Y4R A;  2DCE A;  4C3H J;  1MZB A;  1DU6 A;  3H3U A;  3KEQ A;  2PX9 A;  5H20 A;  2K40 A;  1H8A C;  1SVM A;  4P9U A;  3K70 D;  3S14 J;  1S7O A;  1YJW I;  1HKT A;  2UZK A;  2H1K A;  5D8K B;  2K85 A;  5CQE A;  2UWM A;  3HOT A;  3M3Y J;  1E0E A;  2M0C A;  2JPC A;  4I6Z A;  3CDI A;  1PYV A;  2XSD C;  1ZN2 A;  2DT5 A;  3OIO A;  4A3E J;  2FNP A;  1XSV A;  4EAT A;  1G8X A;  4KMU X;  2Z9O A;  3O8G A;  4WXC A;  3BT9 A;  4FHT A;  2GLO A;  2Z2S B;  3LQQ A;  2GXA A;  5J47 A;  4P55 A;  2Z99 A;  1MKM A;  1WGX A;  1U2W A;  4HX8 A;  4EVI A;  3GYH X;  2ZSI B;  2VKE A;  1SVL A;  5IYB J;  1X4O A;  1S5L C;  3CJQ B;  5KK1 A;  3WTX C;  1UJ8 A;  2V79 A;  3BTI A;  4M3G A;  4E4H A;  5ICE A;  1USS A;  4JBA A;  1IN4 A;  2RVC A;  1X2M A;  4XLP F;  3C2B A;  2MC3 A;  2NNN A;  2EIL H;  4ZDO A;  1FYL A;  3ML6 A;  2OUM A;  3F6V A;  3TW6 A;  2XPW A;  4RA2 A;  1MJA A;  1W5S A;  2E1N A;  5D5U B;  3SEQ A;  3EYI A;  1U5T B;  3V8K A;  4F3Q A;  2HKO A;  1QPM A;  2WB1 A;  3QPL A;  4RAY A;  5E3M A;  4MEY F;  1JKQ C;  1BM9 A;  1WI9 A;  4JX6 A;  4D5F A;  2M1B A;  5L3E A;  4H4K C;  1XGO A;  2KRC A;  2LY2 A;  2MG4 A;  4R1H A;  5FJ8 J;  5TRD A;  2K9M A;  2WAD A;  1IN8 A;  4DBQ A;  2EPF A;  3A4C A;  5GP9 A;  3U9G A;  5K5O A;  5HS8 A;  4XN0 A;  3CCM I;  4HF0 A;  4B3A A;  1RET A;  2E2J J;  3IRQ A;  1K83 J;  2WV1 A;  3V7S A;  3JR9 A;  2HGC A;  1TZL A;  2QQ8 A;  2IGK A;  3I4P A;  1FWZ A;  2LC2 A;  4HSR A;  5F04 A;  4RB3 C;  4XRS A;  2DDB A;  2V1N A;  2NS8 A;  2KZV A;  2R3S A;  3K1P A;  2VIX A;  5DM7 F;  2BYV E;  1NK3 P;  2XB0 X;  2WV0 A;  3GWZ A;  3NEU A;  4PJ0 C;  1UAA A;  2W1O A;  2CYY A;  1V54 H;  4RB1 A;  2DMU A;  5EJC A;  2J5P A;  2X6W A;  3H5A A;  5CVV A;  2F5C A;  4A0X A;  2IP2 A;  1ETO A;  2JK3 A;  4XM3 A;  1JKO C;  2L7Z A;  1MSF C;  4B43 A;  1U5T A;  4N9H A;  1U6G A;  5E18 F;  3B02 A;  4L9T A;  5CVR A;  2LH9 A;  2HQN A;  3BR0 A;  1ZGA A;  3UR3 C;  3G73 A;  2VBX A;  4PZJ A;  4DYC A;  4RGS A;  4A6E A;  1YW9 A;  2WTE A;  1PVE A;  2GXG A;  5EDN A;  2OJE D;  4PJM A;  3OYK A;  3U1D A;  1OQY A;  1WJ5 A;  3Q0V A;  2GM4 A;  4EJW A;  3ABL H;  5FO5 A;  4MIM A;  1X2N A;  3KIO A;  2R7R A;  2LF8 A;  3NAU A;  5L3F A;  4F93 B;  3BDD A;  5HVQ C;  4M9Z A;  2O3F A;  1XTA A;  2IGO A;  2JT1 A;  2E7W A;  3CO6 C;  3K0L A;  3NWS A;  5KHD A;  4ETS A;  4XN3 A;  1K4T A;  2CGP A;  2Y9Y A;  5ICF A;  3F8N A;  4CA0 A;  2PMZ A;  1EKE A;  5KAF C;  1KYW A;  2GZW A;  1WCM J;  1T0F C;  3OSF A;  1T0F A;  1ORK A;  3TO6 A;  5LHI A;  3I58 A;  1LVA A;  2V1X A;  2UXX A;  3DU5 A;  2CQX A;  4YFN F;  4XRF A;  4BJ5 C;  4AIK A;  4B48 A;  4L5E A;  3QP6 A;  2H6B A;  3ABK H;  2R5Z B;  2VT3 A;  1QA6 A;  3CF2 A;  2XB5 A;  4FET A;  4RMN A;  3GO5 A;  3FIW A;  3S93 A;  1IDZ A;  1OCO H;  2RNG A;  2OPT A;  5FLV A;  4CXF A;  2IA0 A;  2MLK A;  2EFP A;  2XF5 A;  2L01 A;  2FF4 A;  4YRV A;  4BHB A;  2QSF X;  5K7H A;  5HDK A;  5TGT A;  2CW0 F;  2YPR A;  2ZO4 A;  3KFW X;  3BQY A;  1HBX G;  4MQ9 F;  4LB5 A;  2G9W A;  4Z2Y A;  1E17 A;  1HKS A;  1OMI A;  5BS6 A;  3HB9 A;  1H89 C;  1VTN C;  5H6R A;  4WF2 A;  1MMN A;  2XAF A;  2Q8K A;  5CPR B;  3G1O A;  4XLA A;  5TIS C;  3ZCO A;  1WJE A;  2HYF A;  2M4G A;  4CCJ A;  5A2Q Z;  2DT7 B;  4A3B J;  4A3G J;  4CH7 A;  1MGT A;  2GBY A;  3LSG A;  4KUM A;  4S05 A;  3OS2 A;  2DAO A;  4L9J A;  1K6Y A;  1R5H A;  2PG4 A;  4UVA A;  4Y3O A;  4D7M A;  4AU7 A;  4CZC A;  5ILU A;  3J7Z I;  1YO5 C;  1PDN C;  1UG0 A;  3BPV A;  1S7A A;  3LSM A;  2H94 A;  2XAQ A;  4WK8 F;  2R5Z A;  2JWT A;  2VE9 A;  3K70 C;  4NC8 A;  2F48 A;  3D1N I;  3V4G A;  3LA7 A;  2M4K A;  3PQJ A;  2R7O A;  3DWL E;  3K2Z A;  3OR1 C;  2IJL A;  4G9Y A;  3HOS A;  2E7X A;  2X6X A;  3M8F A;  4IL6 C;  2XGE A;  1BC7 C;  1ACI A;  2VB6 A;  4DGW B;  5IYC J;  2EV6 A;  2HVQ A;  1T8I A;  4RLF A;  4OMY A;  1M1E B;  2NVY J;  3A02 A;  3L2R A;  3BG7 A;  1CF7 B;  1KA8 A;  2CU7 A;  1RR7 A;  5JFR A;  3OOU A;  1IGN A;  2KMU A;  3HOX J;  3Q5F A;  3R0J A;  4HNV A;  2ZXH A;  2FML A;  3MZY A;  1H88 C;  1TQP A;  3J7A Y;  1VQN I;  1OYW A;  2FXA A;  4BXU A;  4AIH A;  3QWL A;  5HOO A;  3OYJ A;  3P9C A;  2DT6 A;  2UV1 A;  3B6A A;  4LG3 A;  2DXI A;  2IS2 A;  2Y48 A;  3KP2 A;  3PQK A;  5HLG A;  3MVP A;  2W85 A;  1K61 A;  2RRE A;  1LFU P;  1MDM B;  1OPC A;  3F6O A;  3PSF A;  1HDP A;  2Z1D A;  3B73 A;  3G71 I;  3H9Q A;  1QHG A;  3RZD J;  2MD5 A;  2M8G X;  1NHA A;  1XSD A;  2LVS A;  3HOV J;  2LTP A;  3KX2 A;  3CME I;  3DTI A;  2RAE A;  4N0B A;  3GTJ J;  3CLQ A;  2PJR B;  3HM5 A;  1NG6 A;  3WGH A;  4HPQ A;  2VKD A;  2QGU A;  2TCT A;  3LA2 A;  2FBI A;  3ZPL A;  3I59 B;  1G4D A;  3KP5 A;  1Z3X A;  1SFX A;  3E3V A;  5E1W A;  1V55 H;  3Q9S A;  3S2W A;  3J7Y J;  1TQI A;  5JLW A;  2AS5 F;  1BOB A;  1APL C;  3BG5 A;  3KP6 A;  1XDS A;  3S3M A;  1CF7 A;  1XN7 A;  3R4K A;  2ZC2 A;  4L18 B;  1L3L A;  5F6F A;  3TMO A;  2V9V A;  2CS3 A;  5IPA A;  3JRB A;  4XMY A;  3BOQ A;  1JE8 A;  1JTX A;  3S2D J;  3EPZ A;  1OCC H;  1XX5 A;  1ZR4 A;  1QRY A;  1W4M A;  4JOM A;  4NB5 A;  3ZGK A;  2FA5 A;  4S04 A;  4CYC B;  3G1L A;  2NYX A;  3EYY A;  3GEZ A;  2W84 A;  2ZXJ A;  3IWF A;  1MW7 A;  1YIJ I;  1MDM A;  1LDK B;  2R7W A;  1ZR2 A;  1PP8 F;  4ZYE A;  3CMY A;  1IRX A;  1BIA A;  3RZO J;  1R71 A;  2OQG A;  5FLX K;  3Q9V A;  3JTH A;  1XSX A;  4RS8 A;  2PJR A;  2BW3 A;  3EET A;  4L5I A;  4BJ6 C;  1X1C A;  4A12 A;  2DOF A;  3TP3 A;  4NNJ A;  5GAD J;  3PNT A;  3DXJ F;  4YEL A;  4RGR A;  3I59 A;  4CDG A;  3RYP A;  5J3L A;  3F22 A;  3OY9 A;  3ZQC A;  2XC7 A;  2M5W A;  2Y2Z A;  3BRO A;  5EEA A;  4AUX A;  3TP0 A;  4XRM A;  1O4X A;  2Q2E B;  4E7H A;  1TWH J;  4KJZ A;  4J00 A;  3HRT A;  2I8D A;  2DTZ A;  1HC8 A;  3JRD A;  3H3Z A;  2ME0 A;  2JVG A;  4LLN A;  2HTS A;  3BTC A;  4MNU A;  4Y13 A;  3R60 A;  2OV7 A;  3C7J A;  1G2H A;  3CJT B;  2B0L A;  2Z16 A;  1UEL B;  3DBL B;  4F7Z A;  2KFD A;  4CYC A;  4BQO A;  2D1V A;  5IYD J;  1HA8 A;  1RZ4 A;  2CV0 A;  2G7H A;  1WH5 A;  1BJZ A;  2Y69 H;  2P6S A;  5IP9 J;  3BG6 A;  1O7L A;  4EGZ A;  1QNT A;  4QTR A;  4XLE A;  1FP2 A;  3I71 A;  1YI2 I;  2A6T A;  2LBF B;  3FXO A;  4BE1 A;  2VC1 A;  1MJ9 A;  3ZQG A;  3KZY A;  2MC4 A;  1HKQ A;  3ZOB A;  2UUZ A;  1Z3Y A;  4KN7 X;  1BW6 A;  4UXN A;  2NAZ A;  3ERE D;  3PL8 A;  4G7H F;  3REO A;  5L3B A;  5EZG A;  1GVJ A;  2Q2E A;  3GFJ A;  3HTU A;  2XKP A;  1G3Y A;  2DMN A;  4E70 A;  3VSK A;  2RN7 A;  2LD5 A;  4C3J J;  1YTY A;  2DA3 A;  2M0M A;  4GFB A;  1FSE A;  2ZJP F;  5HLH A;  2E34 A;  2CFX A;  1LB2 A;  3TDU C;  4IOA F;  3TQN A;  4CCN A;  2KT0 A;  4ESF A;  3D0S A;  2RC4 A;  3IAM 2;  1IRZ A;  1B72 B;  3L2Q A;  3J7A O;  3F8B A;  5BQT A;  1EA3 A;  2M45 A;  2NOJ B;  4E7J A;  1GDT A;  3M8J A;  1KQ0 A;  1LVK A;  1IJW C;  2LBF A;  3OL4 A;  1ZG1 A;  1ZRC A;  3S32 A;  1T2K A;  4CSW A;  3FXQ A;  3W6K B;  3PFI A;  2VQC A;  3WG7 H;  2JA7 J;  1JGS A;  1XDU A;  2VBW A;  3FMQ A;  3TOB A;  3OYF A;  2VN2 A;  1G3S A;  1VQM I;  3E5Q A;  2YX4 A;  1BJA A;  1RUO A;  4G12 A;  3WOD F;  1R23 A;  2OCC H;  2JJ7 A;  3VOD A;  3LWF A;  1G3T A;  2PFB A;  3FHN A;  5K7F A;  3I4N J;  1A31 A;  3VSL A;  2DPU A;  3MKW B;  2HFH A;  2VL8 A;  3S8P A;  3F9K A;  5D5X B;  3MKY B;  2VKV A;  2KIF A;  1BBY A;  4I09 A;  2QSG X;  1DP3 A;  5JHU A;  1X1A A;  3G2B A;  1SAU A;  1YRN B;  3SZG A;  2BXZ A;  1B72 A;  2O61 A;  1TWF J;  3SXY A;  1W5C C;  1NK2 P;  2H8W A;  3GTP J;  1J5Y A;  5FFZ A;  3CDL A;  4G6Q A;  1MH4 A;  3H36 A;  3CP2 A;  2XKO A;  1JUP A;  1UHM A;  3SZP A;  1LFP A;  5BPD A;  3L1P A;  3KEO A;  2VOP A;  2FSW A;  2W82 A;  3CES A;  4XNF A;  5DYM A;  1X1B A;  2F6C A;  3PSI A;  4P96 A;  4XKW A;  2V4J C;  4O3M A;  1W0T A;  1D5V A;  4RM3 A;  3RKW A;  1QGP A;  1ON1 A;  3H3V K;  1HLV A;  3L9F A;  1GVD A;  1ETX A;  2XRN A;  3M9A A;  4B3X A;  1CQT A;  5C4J J;  4BXX J;  5BNG A;  2BE5 F;  4KIB A;  5FKK A;  1IXC A;  3O2P E;  5D5V B;  1FP1 D;  2Q1Z B;  3LMM A;  2R7S A;  4E7S A;  1LQ1 A;  1ETW A;  5F64 A;  3TW7 A;  3M4O J;  2CQQ A;  2WAQ A;  4OIO F;  1FLI A;  1Y56 A;  4AIJ A;  2LYC A;  3HRU A;  1ZLK A;  2LFB A;  3S3O A;  2ID6 A;  3EQL F;  2F5F A;  3E5X A;  1YRN A;  1F9N A;  4M6Y A;  2H6C A;  4OWR B;  2E2I J;  4A3D J;  5LRS A;  4OMZ A;  1J0R A;  2BHY A;  3FKI J;  2LK2 A;  1G6N A;  3V7C A;  2XHK A;  5EF6 A;  1BA5 A;  3RSN A;  2DI3 A;  4QLC U;  2ME6 A;  4XOR A;  2FJ1 A;  2MH9 A;  4BH9 A;  3TL4 X;  1P6R A;  4BKX A;  4WCG A;  1IN5 A;  3BQZ A;  4CCO A;  5E1X A;  4UUS B;  5C4X J;  4CUG A;  1J09 A;  1TW2 A;  1XCB A;  1XMX A;  2VE8 A;  1TT0 A;  2DA7 A;  2Y0S A;  1F36 A;  5D8L B;  3GZ6 A;  3ZMT A;  3JCU C;  2K4B A;  1KU7 A;  2CUJ A;  1Q1H A;  4HA8 A;  5FLX Z;  3R6S A;  1ZEL A;  3HKZ N;  2DN0 A;  2KJB A;  3F72 A;  3PNV A;  2V26 A;  9ANT A;  3W6V A;  2DJI A;  4KYW A;  2E35 A;  3KP4 A;  3DQV C;  3ONQ A;  3JAM K;  1BI3 A;  2F5D A;  3QYF A;  4U0V A;  2ID3 A;  4HX4 A;  1B8I B;  2X4H A;  5C3E J;  2PN6 A;  2EK5 A;  2CV2 A;  4MO7 A;  2K9N A;  4A3F J;  4LG0 B;  3X2Q H;  1TBX A;  2VKH A;  3BJ6 A;  2LKS A;  1OR7 C;  2F5V A;  1GLN A;  3P5J A;  4YII A;  2HQA A;  4QPO A;  4WXD A;  1WJD A;  2MYS A;  3JRA A;  3QRF F;  1Z7L A;  3KYD B;  3H9J A;  2BHZ A;  1MMA A;  4X1E A;  4HDU A;  5KCM A;  2VQH A;  1TT5 B;  1ZG5 A;  1CGP A;  5EEG A;  1QZE A;  2VBZ A;  4UUS A;  1QBJ A;  2R7T A;  4XL9 A;  3BJA A;  2X0L A;  2COB A;  2O8X A;  4EMS A;  2BEO A;  2VQG A;  4XLH A;  3I56 I;  5B3S H;  3GW2 A;  3K7A J;  3K4B A;  4M73 A;  1IV8 A;  1A35 A;  2KIU A;  4B47 A;  3V8J A;  3SDG A;  2TRT A;  4Q48 A;  3W3C A;  2L4M A;  1X19 A;  1Z7U A;  4QIW N;  1QHH D;  1TWA J;  3PIP F;  1B8I A;  3HGY A;  4C3I J;  3WTS C;  4FE4 A;  2P5L C;  2A61 A;  5FLM J;  3CZ6 A;  2QBY B;  4A0Y A;  6PAX A;  2XAJ A;  4UV8 A;  5DS9 A;  4LG0 A;  5JI6 A;  3RKQ A;  4LJZ F;  2EFW A;  3FBN B;  2XF7 A;  2XAH A;  4A3K J;  1VQ5 I;  1WI3 A;  5LHG A;  3K1M A;  4PGH A;  1K4S A;  2R7X A;  3ZMS A;  1IO2 A;  1TTY A;  2K9Q A;  2M34 A;  5IOZ A;  2QSH X;  5FKM A;  1FMW A;  2DLL A;  3HXL A;  1IF1 A;  2OU2 A;  1XS9 A;  2DA1 A;  3OYC A;  5F1J A;  3IKV A;  1W7P B;  2X51 A;  4A69 C;  3I53 A;  4ZYG A;  2COM A;  3Q3S A;  4HRI A;  2ZXW H;  4M74 A;  4CO8 A;  1W36 D;  1NG7 A;  4IF4 A;  4HAM A;  1JT0 A;  2DYS H;  2XAG A;  2V1U A;  5C44 J;  2NXN B;  1D0Z A;  4M9X A;  4FAS D;  3HDD A;  2F5E A;  4IQ4 A;  1VF9 A;  4G8X A;  1U9N A;  4W97 A;  3OYN A;  1O7F A;  1DUX C;  2K86 A;  2VI6 A;  3DPU A;  2QBY A;  4IVN A;  5CVI A;  1X1P A;  2QM3 A;  3WTW C;  2KDO A;  5J6X A;  3E5U A;  3O3K A;  2ZNZ A;  1RNL A;  3E6M A;  4IHW A;  1TQM A;  3ZN0 A;  2LY9 A;  4HEA 2;  5JHF A;  1MND A;  3HUG B;  3RI4 A;  2W4S A;  2P4W A;  2YU3 A;  3JRG A;  2VOO A;  3C3W A;  3I4M J;  4JX4 A;  2K9L A;  3G1M A;  3PM1 A;  2JUG A;  2DFH A;  1W7P A;  4LGW A;  3CCQ I;  3KP7 A;  4DBR A;  4IOC F;  4JP0 A;  3TBI A;  3NWT A;  3AG4 H;  3E6C C;  1I5Z A;  5K1Y A;  1D5Y A;  5HS9 A;  2WA0 A;  1D0X A;  2CQ7 A;  3DCF A;  5JVG F;  2ZJR F;  1XMA A;  2YSR A;  1FTZ A;  4LD5 A;  2LRD A;  3GFI A;  1WFX A;  5DD4 A;  4BUP A;  2IXS A;  1WRJ A;  4CHU A;  5F1R A;  2IBD A;  4XOP A;  2FOK A;  2YS9 A;  1IRF A;  1RES A;  3WHC A;  1WPK A;  2ESN A;  3LNQ A;  2QA4 I;  1J9I A;  1WQ2 A;  3DEU A;  3ISP A;  4XK4 A;  3JRC A;  1MNE A;  3WTV C;  2LLK A;  3QPS A;  3LAP A;  3H92 A;  3FHZ A;  2I5U A;  1T6S A;  3RQI A;  1XGM A;  4CCL A;  3HUG A;  3LST A;  3S15 J;  3D5S C;  2LKX A;  4M6X A;  1ZYR F;  2HR3 A;  3BJO A;  4DJA A;  1NTC A;  3A0B C;  2Z5U A;  4P5O A;  3SDB A;  3S1M J;  3T5X A;  2EV5 A;  3DPT A;  3MEX A;  4XON A;  3IKT A;  2E5Z A;  5CYV A;  2BZT A;  4UUT A;  4BXF A;  1BC8 C;  3L2V A;  1SFO J;  3HHH A;  1I50 J;  3O8H A;  3KET A;  3OR2 C;  1ZK8 A;  3OS0 A;  3QOP A;  4FCY A;  4F55 A;  3KCC A;  3FMR A;  2Y9Z A;  5B66 C;  1Y1W J;  1MBF A;  4XSZ F;  1IRG A;  5DCM B;  1Z67 A;  1AHD P;  2D5V A;  4EEF G;  5E79 C;  1ZHF A;  3I5U A;  4E7L A;  2EIK H;  1Y8Q B;  1YS7 A;  1OFC X;  3E97 A;  4KFC A;  1PUF B;  3MQ0 A;  4Q47 A;  2EIN H;  2CSO A;  1ITY A;  3GF2 A;  2BXY A;  2DU9 A;  4FE7 A;  2C6Y A;  2XPV A;  1RR8 C;  5F27 A;  1F4K A;  4XIC A;  5L3D A;  1K6O A;  4KIS A;  1JUS A;  5FFX A;  3L2W A;  1BN5 A;  3OYL A;  3JAM Z;  2JA8 J;  1MD0 A;  3ASN H;  1GXQ A;  2DW4 A;  4LMY A;  4L0Y B;  2ZSH B;  3C2G A;  3F0C A;  5FRO A;  2LOO A;  4IQJ A;  3CD6 I;  4UVC A;  1FTT A;  3PUF A;  1WZ2 A;  1MSE C;  3BG9 A;  2HOS A;  3I0T A;  3H5R A;  4U0Y A;  5FRM A;  4YIF A;  3CCE I;  1OJL A;  2YUS A;  2O03 A;  4DOZ A;  2NVQ J;  2V6C A;  2BY1 A;  2GOX B;  4XID A;  3L00 A;  2CUF A;  4ZYA A;  3OOP A;  5DCM A;  4RB2 C;  2PQ8 A;  4ZYH A;  5FD5 A;  1K78 B;  1Z9C A;  4ESB A;  2QQ9 A;  4AYB A;  1PUF A;  4HV6 A;  2LDU A;  4GO1 A;  1TLH B;  2DA5 A;  4FX4 A;  2QZ8 A;  2GWR A;  4UVB A;  2KL4 A;  5D5W B;  3LSR A;  3HL2 A;  3S1N J;  1R4N B;  1Y1V J;  1RKT A;  1W1W E;  3IRR A;  2DPD A;  1T08 B;  1X58 A;  1FOW A;  2BY0 A;  4KT5 C;  2HVR A;  5DTD A;  4LIU A;  1XB4 A;  1IUY A;  4K2E A;  4EJV A;  3U1K A;  1YQA A;  1D1A A;  2A68 F;  2ZKZ A;  3LQR A;  4U87 A;  3IP4 B;  3DEW A;  2W48 A;  2WB1 N;  2LNB A;  3SJM A;  1ZQ3 P;  4LLG F;  3MZ8 A;  1ETY A;  3CCY A;  3WTY C;  4ZH4 F;  1TP4 A;  2E1O A;  3DTE A;  4OAY A;  3K1N A;  3KYL A;  3R61 A;  2CQK A;  4OOI A;  1QQI A;  1OLT A;  2VJJ A;  2XAU A;  1DQU A;  5LGT A;  3FXJ A;  3L7W A;  1MBH A;  1T98 A;  1SD7 A;  1BI1 A;  1G59 A;  3CC4 I;  4NUB A;  3WGG A;  1FNN A;  3CC7 I;  3DKX A;  2EA2 A;  3GXO A;  2GIV A;  4PDK A;  3DU6 A;  1K78 A;  2DOD A;  3CCS I;  2WAE A;  1XGN A;  2K3F A;  2BW3 B;  5K7Z A;  2ZFW A;  1D1B A;  4HNU A;  5K5Q A;  2R7V A;  3HHG A;  2XVC A;  2R93 J;  1BR2 A;  1SD6 A;  5M3M J;  1Z21 A;  4A3I J;  1SAN A;  1IDY A;  2ZME C;  3GLL A;  1EV7 A;  2L3D A;  3V8L A;  3H5N A;  1LNW A;  3ZP5 A;  2X1D A;  2QLZ A;  1IZ1 A;  3NAR A;  3E7L A;  1ZRF A;  3BWG A;  3IC7 A;  3TED A;  1XGS A;  2KIM A;  5KVR A;  4EM0 B;  3EUA A;  2EZL A;  2JZY A;  3GLX A;  3SQN A;  5IT9 K;  1XC5 A;  1ZRE A;  1P7J A;  2CW8 A;  4IPA A;  4LIT A;  3K9T A;  3PUB A;  2FEZ A;  4V2F A;  3COA C;  1MMG A;  3V7R A;  2DA4 A;  5IOY A;  1HDD C;  2FBH A;  1U9O A;  3GTM J;  1XD7 A;  3RPU D;  3HRM A;  2H1L A;  2FUG 2;  4BU2 A;  4U88 A;  3PIO F;  4IZZ A;  5IT3 A;  1Z91 A;  1MMS A;  3FXL A;  3HYI A;  2YR2 A;  3H0D A;  2LKP A;  4AD9 A;  4JX5 A;  4GYI A;  3E0J B;  2EIJ H;  5GAG J;  3MD2 A;  3K4J A;  1JTY A;  3FX3 A;  2CRG A;  4MHG A;  1ZAR A;  1ZLJ A;  2XRL A;  4BGD A;  4XQF A;  3UKG A;  3OSG A;  2MW8 A;  2OZU A;  3Q0W A;  5IP6 A;  4F91 B;  3JRI A;  1JJ6 C;  3GTG J;  2PMZ N;  3PO2 J;  1YX3 A;  3HBL A;  1LEA A;  3OMY A;  2E5N A;  4C9Y A;  4HZF A;  4BHC A;  1JHF A;  1R1V A;  3ABT A;  2VLA A;  1YW8 A;  3BR5 A;  3SEZ A;  2TDX A;  1N75 A;  5AIP A;  3W2W A;  2JSC A;  3FM3 A;  3BR2 A;  1FBQ A;  2R7D A;  2IVM A;  1BOA A;  3I64 A;  1BW5 A;  3RIR A;  2QEN A;  1HW2 A;  1FSH A;  4Q5S F;  5KNL A;  4UNO A;  3HPH A;  1JI8 A;  3DFG A;  3E6B A;  2CW7 A;  5HDG A;  2V7F A;  4TV7 A;  4M3B A;  4A6D A;  5LFA A;  1TNS A;  1KZH A;  4A3L J;  2DOE A;  2E36 A;  1YS6 A;  3MCZ A;  3VDX A;  1RC9 A;  1YLF A;  4I2O A;  3A01 B;  4BDZ A;  4L0Z B;  1UHW A;  2L2O A;  3MFK A;  1F5T A;  1P9Q C;  1T95 A;  4M9S A;  3T8T A;  2FQ3 A;  3BCA A;  4Y17 A;  3H0G J;  1GT0 C;  4M3E A;  4PJN A;  2P5V A;  3N97 A;  1Z1D A;  2VAS A;  3LA3 A;  1FBU A;  2ZXI A;  2GIZ A;  1X3W B;  4Y33 A;  4BY7 J;  1I1S A;  1WKM A;  2KJC A;  3ZQQ A;  1S7E A;  4AID A;  2BY2 A;  2M7A A;  2WWY A;  1MBK A;  5GTI C;  1MNM C;  1D8K A;  2E1C A;  4NQW B;  2IGM A;  4A3J J;  2CFO A;  2ETH A;  3RJP A;  3W6J B;  4X0G A;  3L2C A;  4NHJ A;  1ETQ A;  3H9G A;  4V19 K;  3PNY A;  4NBQ A;  4H0E A;  3CC2 I;  3A01 A;  3EUH C;  1LJ9 A;  3EUH A;  3OS1 A;  4AC0 A;  2EQR A;  1Y0N A;  1SFE A;  2JMW A;  4IRG A;  2HYJ A;  4GGG A;  3ZQF A;  2JRM A;  4KIC A;  4G6T B;  4KNY A;  1XMK A;  1KGS A;  3HRS A;  4XR6 A;  3DKW A;  2XRO A;  1TWG J;  3QYB A;  2L02 A;  2XV4 S;  4N4O B;  2O7O A;  2V6E A;  1HOM A;  1MH3 A;  3KZZ A;  1VQ7 I;  4XLN F;  5E17 F;  2HS5 A;  1ONV A;  3I9V 2;  3JRF A;  5HNF A;  4BAY A;  1W5T A;  1T39 A;  4J19 A;  2IRF G;  3BP8 A;  3HIF A;  2VBY A;  4ABZ A;  2VUM J;  5E8I A;  1ZRD A;  1YE9 A;  4HQE A;  2KKO A;  2KZG A;  3IH4 A;  3VYR B;  1J2X A;  3GTL J;  3KLO A;  2GAU A;  3F21 A;  2Z33 A;  1JJ8 C;  3CF5 F;  1R5G A;  3S1R J;  2JA5 J;  2O0Y A;  1GUU A;  5J40 A;  3S2H J;  3RYR A;  3Q0U A;  4NQW A;  5J4Y A;  2L7M P;  4YG2 F;  4XLF A;  4ENJ A;  2QEX I;  1SMT A;  1MIJ A;  3J80 K;  3JRH A;  2JA6 J;  1OCZ H;  3GTO J;  3HOW J;  4D5C A;  2HQR A;  2MGQ A;  5CLS A;  4A5M A;  1HW5 A;  3K4L A;  1S6L A;  3CUQ B;  4RM2 A;  2NVT J;  1YIT I;  1JGG A;  1XCV A;  3T8R A;  3V42 A;  2GXB A;  3LAJ A;  2PJP A;  4PSX A;  1X3Z B;  1SVO A;  2P7V B;  3K2A A;  2CMP A;  2MLG A;  5IY5 H;  4OIP F;  4BE0 A;  1WJF A;  4R79 A;  1Z6T A;  1D1C A;  2L7F P;  2QCO A;  3HOZ J;  4HST A;  3ZR8 X;  4R8H A;  4II2 A;  1FMV A;  3KPH A;  1A04 A;  1B9M A;  4MFE A;  3GVA A;  1J59 A;  2FNA A;  2E1M C;  4WXH A;  4MTE A;  4HLX A;  2EBI A;  2YX7 A;  1REP C;  2KQR A;  1DGW Y;  4M72 A;  4E6K G;  2Y30 A;  2JA2 A;  4QPQ A;  2BV6 A;  3CUQ C;  3JRE A;  5IT9 Z;  3CUO A;  3CUQ A;  3S1Q J;  4ENN A;  1FYM A;  3FXM A;  4BL0 B;  2HDC A;  2OTL I;  3I55 I;  3CMA I;  3AKZ A;  2FMY A;  3LFK A;  3ZQL A;  2Y0M A;  2CUZ A;  5CKT A;  1B6A A;  3KE2 A;  1JKP C;  1QVT A;  2HOA A;  5E3N A;  2F4O B;  1H0M A;  4HDV A;  1FBS A;  4PJL A;  5F0H A;  2MBF A;  3HC7 A;  3SFI A;  4N4N B;  3SZT A;  2L9N A;  2ELK A;  4HW0 A;  3IHU A;  1R36 A;  1STZ A;  4ENM A;  4II3 A;  4BS9 A;  3DF8 A;  4I7H A;  1VQK I;  2FBK A;  3FMS A;  4KIF A;  4RBO A;  1HF0 A;  3QQA A;  2LG4 A;  4E7I A;  1LDD A;  2CJJ A;  4RGU A;  4LK1 F;  4BE2 A;  1I27 A;  1DPR A;  4IRI A;  2KP6 A;  1R58 A;  3AAF A;  2D2W A;  3BTL A;  1R49 A;  3M8E A;  1R22 A;  2O6G E;  2QYO A;  1RPW A;  3CP8 A;  3RDI A;  5J1R A;  1JKR C;  2OC6 A;  2AXT C;  5K5R A;  3FXK A;  2HZD A;  4CGZ A;  2DFI A;  1X3U A;  1SAX A;  2JVH A;  2FX0 A;  3DBH B;  4BQA A;  1YIO A;  3E6D A;  4GCV A;  4M71 A;  2R7Q A;  1SFU A;  1DP7 P;  3OIP A;  3AL0 C;  5M5W J;  1OR7 A;  2A6E F;  4ZDL A;  4OU0 A;  5KAI C;  5J1U A;  4EV0 A;  4IRH A;  3K10 A;  1AKH B;  4IJA A;  1WJC A;  4MLO A;  1FYK A;  5CJ9 A;  2DFE A;  1ZG3 A;  3EUK L;  3MAJ A;  3N4M A;  3FM5 A;  2VC0 A;  4LB6 B;  5A2Q K;  1ZGW A;  4ZZD A;  3ABU A;  1FOX A;  1MBG A;  4M3D A;  5FKN A;  1MBE A;  3C1D A;  3QOD A;  4LLL A;  1VQ4 I;  3HSF A;  3QPT A;  1HW1 A;  2LF7 A;  1F43 A;  2HNH A;  4PJJ A;  4HBL A;  5DEQ A;  5DUI A;  4JYK A;  5E20 A;  1E2X A;  4A3C J;  3AG1 H;  2OCE A;  3ESW B;  4ANJ A;  1IC8 A;  3TO9 A;  3ZN1 A;  1L0O C;  4I0A A;  2UXN A;  2IA2 A;  2HTJ A;  4W1U A;  2OBP A;  4O5V A;  2HZT A;  1VND A;  4D1Q A;  1B4A A;  3OYD A;  1K7A A;  2VPR A;  5J8C A;  4OIQ F;  3HOY J;  4JK1 X;  3OV8 A;  2YU9 J;  5JR3 A;  1FX7 A;  3CCV I;  2PEX A;  5DUK A;  5ILV A;  4MTD A;  3FWE A;  1BI2 A;  1RKW A;  3FF5 A;  3I54 A;  1OCR H;  1S8N A;  1X1D A;  3KLN A;  1OIS A;  3M7G A;  3OL3 A;  2JTV A;  5J1Y A;  1U8R A;  2CO5 A;  2VOD A;  2DOA A;  3RCO A;  1OKR A;  3G6E I;  2X6O A;  2DQR A;  3BLY A;  3OIQ A;  1A6I A;  2RQP A;  2M9H A;  2EFQ A;  1T38 A;  1AKH A;  3GTQ J;  1I3Q J;  4U7B A;  4A2U A;  1QO0 D;  1WSU A;  1YHQ I;  3S3N A;  4LK0 F;  4JQF A;  1NH3 A;  3VB2 A;  1LUJ B;  2A69 F;  2WY7 Q;  1OYI A;  1KQ9 A;  4RGX A;  3OYH A;  5CVU A;  4D0P A;  4HLY A;  5JVT A;  4M3F A;  1IXR C;  1N25 A;  3A0H C;  1A6Q A;  3A1Y A;  4FTH A;  2FOW A;  1ETK A;  2P0W A;  5DCF A;  2B9S A;  1J75 A;  3C2H A;  3HSE A;  5LGN A;  2KIS A;  4ZTF A;  5LEK A;  3VYS B;  2AQE A;  4V2G A;  5EYR A;  4A93 J;  4FT8 A;  1V3F A;  2HPI A;  2HDD A;  5HS7 A;  4Y7N J;  3OYA A;  4F92 B;  4EQQ A;  3FBI B;  4IHV A;  2FRH A;  1D3Y A;  3IH3 A;  2DMT A;  4MEX F;  3GBG A;  4BQN A;  4NC7 A;  2NRA C;  1VQ9 I;  1PUE E;  1IAW A;  1SMY F;  2IPQ X;  5J8F A;  2NNY A;  2VQL A;  4AVP A;  2E71 A;  2JN6 A;  4BYY A;  2HKX A;  4OAZ A;  4YFX F;  5BMZ A;  2HOE A;  4I01 A;  4PFO A;  4XOT A;  2ADU A;  2ECB A;  4XBF A;  4XRS G;  5D6F A;  4WX9 A;  4ZDP A;  3GZN B;  2KLO A;  3IUO A;  4PSW A;  4UUV A;  4GYG A;  2IGN A;  1QZZ A;  2M7B A;  4RLQ A;  4F52 A;  5E3O A;  3J80 Z;  2WAQ N;  2RGV A;  2R5Y B;  4KN4 X;  1KQ8 A;  1UZC A;  4AWX B;  2A05 A;  1SFK A;  1HQC A;  2Q0O A;  2W00 A;  2DFF A;  3MWM A;  4LFU A;  3FZV A;  3QAH A;  4HV5 A;  1HSJ A;  5AON A;  2VON A;  1PJR A;  3NRV A;  3PFY A;  4HYE A;  3L2U A;  3F3X A;  2NS7 A;  3WU1 B;  5FKL A;  4O6J A;  2RQQ A;  1QU3 A;  1AWC A;  2EH3 A;  3GME A;  5FGM A;  3HG9 A;  3KEY A;  2X6Y A;  3T0Y A;  4C2U A;  1BR4 A;  2BVL A;  2KRF A;  2HDW A;  1IG7 A;  1WJB A;  4PGG A;  2R4G A;  1N78 A;  1U5T C;  1S72 I;  4PUS A;  3DLL F;  1TL8 A;  1Z77 A;  2OA4 A;  2ZFU A;  1I3A A;  2P6T A;  3WE3 A;  4B4C A;  2DYR H;  2FD5 A;  3MKL A;  1E3H A;  2Y0S N;  4P9F A;  4IHT A;  3U2R A;  4ASN A;  3OYE A;  2L7K A;  1ULY A;  3F8M A;  5HNH A;  2BBY A;  1IN6 A;  2ELH A;  1E3O C;  1R5I D;  1IW7 F;  1Z6R A;  2CH0 A;  5BOX A;  2R5Y A;  1S29 A;  3CJR B;  3ELK A;  4BEH B;  2QKM B;  4Q4Z F;  3GCM A;  1FC3 A;  1RIO H;  4ESJ A;  4YIR X;  2DMP A;  4CYD A;  4BNC A;  3D5R C;  1D0Y A;  2BVM A;  4AVZ A;  2ISZ A;  1QVU A;  2QWW A;  3ZQ7 A;  3CCL I;  3OWT A;  4KIT B;  2EZI A;  1V5E A;  3PO3 J;  2DK5 A;  3BTJ A;  4XKV A;  3ZMV A;  5GPA A;  1FZP B;  1XPX A;  2MAB A;  1PP7 U;  2V9K A;  3P9I A;  1V5F A;  1R6R A;  1I6X A;  4UV9 A;  4EJU A;  4ZC3 A;  2OTJ I;  2L9V A;  4I98 B;  1R1T A;  2QQA A;  5FD6 A;  1IN7 A;  2GOM A;  3LSP A;  2DBB A;  3JSP A;  2MH2 A;  4UHT A;  3L09 A;  2KIQ A;  1A36 A;  3A2K A;  4YEJ A;  1UCR A;  2XIG A;  3RQ4 A;  3VYT B;  1R4M B;  3T1B A;  4NDL A;  4S0H B;  4BHP A;  4A5N A;  4CIC A;  3OYM A;  2PMU A;  1O3S A;  3HOU J;  2WC2 A;  4QSH A;  5ED4 A;  2OD5 A;  4HQM A;  1Z05 A;  1VFC A;  1DU0 A;  3HSR A;  2XF6 A;  3MN2 A;  4OIR F;  3OYB A;  1FEX A;  3BG3 A;  3DLA A;  4GRI A;  3BCB A;  1FY7 A;  4BEH A;  2F4M B;  1AA7 A;  4EJO A;  5LBQ A;  2O8K A;  5HDN A;  2E2H J;  3K4M A;  1I6H J;  4XKB A;  3FDY A;  4QWQ A;  3ASO H;  3IAS 2;  3BC8 A;  2EIM H;  4OIN F;  3W2A A;  3BZC A;  1BL0 A;  3JW4 A;  2CUE A;  4B44 A;  1XG1 A;  3FK6 A;  1R7J A;  3WGI A;  5M5Y J;  1GV5 A;  2L4A A;  5F08 A;  3HGG A;  2VJI A;  4DNC A;  1JXS A;  1B59 A;  4DYQ A;  2O5R A;  2P5K A;  1RUN A;  3TO7 A;  4KA4 A;  4L5J A;  4BQQ A;  1KU9 A;  3QOE A;  1VZ0 A;  3KP3 A;  4CCK A;  2G0E A;  2HEO A;  2V1D A;  2ZME B;  1FOY A;  1U0J A;  3FKJ A;  1GV2 A;  2PI0 A;  1SD4 A;  4P1W A;  5GPC A;  2O9L A;  1RI7 A;  5BPI A;  1WH7 A;  3M1E A;  1ZH5 A;  2EB7 A;  4Y52 J;  2K5C A;  1B9N A;  3BY6 A;  3VWB A;  5DDG A;  5DD8 A;  5DM6 F;  2RV8 A;  2L54 A;  3GTK J;  3LSK A;  3K4N A;  4X6A J;  3F8C A;  3WTU C;  1LFB A;  1E3P A;  2H09 A;  1LKX A;  1VI0 A;  3TDZ C;  2IS6 A;  3CTA A;  4XSX F;  4ZZL A;  3WHB A;  3DP7 A;  5GTH C;  4A3M J;  5H2F C;  4FQG A;  3S16 J;  3CMM A;  4IKF A;  4EM2 A;  2VT2 A;  1Y0U A;  5LEJ A;  1BR1 A;  3GFM A;  1HXD A;  1W36 C;  3G3Z A;  3SHF A;  4MGR A;  3TOA A;  3RPQ A;  2W25 A;  4ZJZ A;  1IV6 A;  3WG9 A;  3P9K A;  2KHM A;  1HST A;  1BI0 A;  2E60 A;  4KIG A;  3WU0 A;  2K7L A;  4U7D A;  2HXO A;  3BR3 A;  1R00 A;  2ZME A;  5FB2 A;  4RDU A;  2HWV A;  1QZY A;  3U21 A;  1DPU A;  2IEK A; 
#chains in the Genus database with same CATH homology
 2H27 A;  4I02 A;  4HOB A;  4G6D A;  1FPQ A;  3WE2 A;  5EEH A;  2QQB A;  2NS0 A;  1FOK A;  2ZNY A;  2ZCW A;  4PCQ A;  1UST A;  2QVO A;  2PLY A;  2GA1 A;  1O57 A;  1YG2 A;  3WTT C;  3K69 A;  1EH8 A;  1DDN A;  1K79 A;  3VEP A;  1UFM A;  3VOE A;  3IL2 A;  3ECH A;  1YW7 A;  2W57 A;  3QU6 A;  4WWC A;  5CVJ A;  1I1G A;  1U78 A;  3J81 K;  3DV8 A;  1MJB A;  5ICC A;  1S3J A;  2K4J A;  2IT0 A;  4MQV A;  4ZYD A;  2DTR A;  2GA2 A;  3R0A A;  2EFO A;  2P8T A;  1U3E M;  4EM1 A;  3WTZ A;  2K02 A;  2OZ6 A;  2STT A;  5AIQ A;  1OYY A;  4EGY A;  1KU2 A;  3QU3 A;  1F1Z A;  1GXP A;  2XAS A;  3FXR A;  4B8X A;  2HYG D;  2ZBK A;  2MA3 A;  5ICG A;  1P92 A;  2J5O A;  2LSO A;  2OQR A;  4HF1 A;  5TJJ A;  3DPL C;  3JSO A;  4B09 A;  1ON2 A;  2A3S A;  5D6E A;  1SD5 A;  3NQO A;  1G3W A;  4L9V A;  3ECO A;  3CDH A;  5LRR A;  4ON0 A;  1O3R A;  1JHH A;  4U0W A;  1KYZ A;  1P4W A;  4HF2 A;  3RKY A;  5LLQ A;  4IXA A;  1IXS B;  4G94 A;  4IHS A;  5D4S A;  4Y15 A;  3BZ6 A;  1EH6 A;  2JRT A;  2A6H F;  2G7U A;  2EA4 A;  5L3C A;  2ISY A;  2EV0 A;  2BGC A;  2DO7 A;  3BPX A;  1P4X A;  3QP5 A;  2A07 F;  5ERI A;  2DQL A;  2M87 A;  2PMH A;  3CLO A;  3RTR A;  1ODD A;  2RNJ A;  4N9I A;  1ZAO A;  2IA1 A;  2P7C B;  1GHC A;  1D8J A;  1TW3 A;  3TGN A;  2CG4 A;  3JTG A;  5LGU A;  4G7Z F;  5LHH A;  1O3T A;  5H6Q A;  1WWX A;  2D45 A;  3ROU A;  2M8E A;  3D5L A;  3HTS B;  1P2F A;  2RKH A;  1YYV A;  5L3G A;  2GQQ A;  2Z3Y A;  4ENK A;  4RAZ A;  3ULQ B;  2AXL A;  1H9T A;  1FT9 A;  5D4R A;  3F23 A;  3SFZ A;  3O6B B;  2EWN A;  2FU4 A;  2EFN A;  5HLI A;  1W7P D;  2JPB A;  1P4A A;  3GFL A;  2A5Y B;  1BIB A;  4EJT A;  1R1U A;  1TNT A;  4FX0 A;  3CO7 C;  2PBI A;  3GX4 X;  2IW5 A;  3RPU A;  1ZGJ A;  1V4R A;  2EJR A;  3F8F A;  2M30 A;  2R7F A;  4L9N A;  2OAZ A;  2XGX A;  4I0B A;  5ILS A;  3ZMD A;  2FE3 A;  1AOY A;  3GZ5 A;  3IWZ A;  1B1B A;  3C18 A;  4RB0 A;  2CWE A;  4YFK F;  5E1Z B;  4KDP A;  3ZMU A;  1H9G A;  2Y75 A;  2XUB A;  2ESH A;  2D1H A;  1EH7 A;  3MZH A;  3J81 Z;  1YFH A;  4HX7 A;  3GUD A;  3QPH A;  2K27 A;  2W24 A;  4A0Z A;  4G7O F;  2DK8 A;  2VXZ A;  5E8G A;  2STW A;  4KMF A;  3FXU A;  1UB9 A;  1LEB A;  2ACJ A;  1LDJ A;  1KU3 A;  5DV5 A;  3VFZ A;  3TKY A;  1O3Q A;  4CZZ A;  3ZMZ A;  2F2E A;  4GXO A;  2ZJ2 A;  3P7N A;  3CJN A;  1C0W A;  4DQ2 A;  2QUF A;  3EDP A;  1J7K A;  2RDP A;  1MZB A;  3H3U A;  3KEQ A;  5H20 A;  4P9U A;  1S7O A;  1HKT A;  2UZK A;  2UWM A;  5D8K B;  3HOT A;  2JPC A;  1ZN2 A;  2DT5 A;  2FNP A;  1XSV A;  4KMU X;  2Z9O A;  4WXC A;  4FHT A;  3LQQ A;  4P55 A;  2Z99 A;  1MKM A;  3GYH X;  1U2W A;  4HX8 A;  4EVI A;  5KK1 A;  3WTX C;  2V79 A;  5ICE A;  1USS A;  4JBA A;  1IN4 A;  2RVC A;  4XLP F;  2MC3 A;  2NNN A;  1FYL A;  3ML6 A;  3F6V A;  1MJA A;  1W5S A;  2E1N A;  5D5U B;  3EYI A;  1U5T B;  3V8K A;  2HKO A;  1QPM A;  4RAY A;  4MEY F;  1BM9 A;  1WI9 A;  2M1B A;  5L3E A;  1XGO A;  5TRD A;  4R1H A;  1IN8 A;  3U9G A;  5K5O A;  5HS8 A;  4HF0 A;  3IRQ A;  3V7S A;  2HGC A;  3I4P A;  4RB3 C;  1FWZ A;  2R3S A;  3K1P A;  2BYV E;  2WV0 A;  3GWZ A;  3NEU A;  2CYY A;  4RB1 A;  2J5P A;  5CVV A;  2F5C A;  4A0X A;  2IP2 A;  1U5T A;  4N9H A;  1U6G A;  5E18 F;  3B02 A;  4L9T A;  5CVR A;  2HQN A;  1ZGA A;  3G73 A;  2VBX A;  4PZJ A;  4RGS A;  4A6E A;  1YW9 A;  2WTE A;  2GXG A;  3U1D A;  4EJW A;  5FO5 A;  2LF8 A;  5L3F A;  3BDD A;  5HVQ C;  4M9Z A;  2O3F A;  2JT1 A;  2E7W A;  3CO6 C;  3K0L A;  4ETS A;  2CGP A;  5ICF A;  3F8N A;  1KYW A;  2GZW A;  1T0F A;  3TO6 A;  5LHI A;  3I58 A;  1LVA A;  2V1X A;  2UXX A;  4YFN F;  4XRF A;  4AIK A;  3QP6 A;  2H6B A;  2VT3 A;  3GO5 A;  4CXF A;  2IA0 A;  2MLK A;  2EFP A;  2L01 A;  2FF4 A;  4BHB A;  5HDK A;  2CW0 F;  2YPR A;  2ZO4 A;  3KFW X;  1HBX G;  4MQ9 F;  4LB5 A;  2G9W A;  4Z2Y A;  1E17 A;  1HKS A;  1OMI A;  5BS6 A;  1VTN C;  5H6R A;  4WF2 A;  2XAF A;  2Q8K A;  2HYF A;  5A2Q Z;  1MGT A;  4S05 A;  4KUM A;  2DAO A;  4L9J A;  1R5H A;  2PG4 A;  4UVA A;  5ILU A;  1YO5 C;  1PDN C;  3BPV A;  1S7A A;  2H94 A;  2XAQ A;  4WK8 F;  2VE9 A;  3V4G A;  3LA7 A;  3PQJ A;  3K2Z A;  2IJL A;  4G9Y A;  3HOS A;  2E7X A;  3M8F A;  1BC7 C;  2EV6 A;  4OMY A;  1CF7 B;  1KA8 A;  5JFR A;  3Q5F A;  3R0J A;  2FML A;  3MZY A;  1TQP A;  1OYW A;  2FXA A;  4BXU A;  4AIH A;  5HOO A;  3P9C A;  2Y48 A;  3KP2 A;  3PQK A;  5HLG A;  2W85 A;  1MDM B;  1OPC A;  3F6O A;  3B73 A;  2MD5 A;  1NHA A;  1XSD A;  4N0B A;  3WGH A;  3LA2 A;  2FBI A;  3ZPL A;  3I59 B;  1G4D A;  3KP5 A;  3E3V A;  1SFX A;  5E1W A;  3S2W A;  3Q9S A;  1TQI A;  2AS5 F;  3KP6 A;  1XDS A;  1CF7 A;  1XN7 A;  3R4K A;  4L18 B;  1L3L A;  5F6F A;  2V9V A;  3BOQ A;  1JE8 A;  1W4M A;  4NB5 A;  2FA5 A;  4S04 A;  2NYX A;  3EYY A;  3GEZ A;  2W84 A;  2ZXJ A;  3IWF A;  1MDM A;  1LDK B;  1PP8 F;  4ZYE A;  1BIA A;  2OQG A;  5FLX K;  3Q9V A;  3JTH A;  1XSX A;  4RS8 A;  3EET A;  4L5I A;  4A12 A;  3DXJ F;  4RGR A;  3I59 A;  4CDG A;  3RYP A;  3F22 A;  2M5W A;  3BRO A;  3HRT A;  3H3Z A;  4LLN A;  2HTS A;  4MNU A;  4Y13 A;  3R60 A;  3C7J A;  2B0L A;  4F7Z A;  2D1V A;  1RZ4 A;  2G7H A;  2P6S A;  1O7L A;  4EGZ A;  1QNT A;  1FP2 A;  3I71 A;  2VC1 A;  1MJ9 A;  3KZY A;  1HKQ A;  4KN7 X;  4UXN A;  2NAZ A;  3ERE D;  4G7H F;  3REO A;  5L3B A;  1GVJ A;  2Q2E A;  3GFJ A;  3HTU A;  2XKP A;  1G3Y A;  4E70 A;  2RN7 A;  1YTY A;  1FSE A;  5HLH A;  2CFX A;  1LB2 A;  3TDU C;  3TQN A;  4ESF A;  3D0S A;  2RC4 A;  3J7A O;  3F8B A;  5BQT A;  2M45 A;  1KQ0 A;  1ZG1 A;  1ZRC A;  1T2K A;  3FXQ A;  3W6K B;  3PFI A;  1JGS A;  1XDU A;  2VBW A;  3FMQ A;  3TOB A;  2VN2 A;  1G3S A;  3E5Q A;  2YX4 A;  1BJA A;  1RUO A;  3WOD F;  1R23 A;  3VOD A;  3LWF A;  1G3T A;  2PFB A;  2DPU A;  2HFH A;  5D5X B;  2KIF A;  1BBY A;  4I09 A;  5JHU A;  2O61 A;  3SXY A;  1J5Y A;  5FFZ A;  4G6Q A;  2XKO A;  3SZP A;  1UHM A;  5BPD A;  2VOP A;  3KEO A;  2FSW A;  5DYM A;  4P96 A;  4O3M A;  1D5V A;  3RKW A;  1QGP A;  1ON1 A;  3L9F A;  2XRN A;  3M9A A;  2BE5 F;  4KIB A;  1IXC A;  3O2P E;  5D5V B;  1FP1 D;  1LQ1 A;  5F64 A;  1FLI A;  4OIO F;  4AIJ A;  3HRU A;  1ZLK A;  3EQL F;  2F5F A;  3E5X A;  1F9N A;  4M6Y A;  2H6C A;  5LRS A;  4OMZ A;  1J0R A;  1G6N A;  3V7C A;  2XHK A;  2DI3 A;  4QLC U;  2MH9 A;  4BH9 A;  1P6R A;  4WCG A;  1IN5 A;  5E1X A;  1TW2 A;  1XCB A;  2VE8 A;  5D8L B;  3GZ6 A;  3ZMT A;  2K4B A;  1KU7 A;  1Q1H A;  4HA8 A;  5FLX Z;  3R6S A;  2KJB A;  3F72 A;  4KYW A;  3KP4 A;  3DQV C;  3JAM K;  1BI3 A;  2F5D A;  4U0V A;  4HX4 A;  2X4H A;  2PN6 A;  2EK5 A;  4LG0 B;  1TBX A;  3BJ6 A;  4YII A;  4WXD A;  3QRF F;  4HDU A;  1ZG5 A;  1CGP A;  5EEG A;  2VBZ A;  1QBJ A;  3BJA A;  2X0L A;  2O8X A;  4EMS A;  2BEO A;  3GW2 A;  4M73 A;  2KIU A;  3V8J A;  4Q48 A;  2L4M A;  1Z7U A;  3WTS C;  2P5L C;  2A61 A;  2QBY B;  4A0Y A;  6PAX A;  2XAJ A;  4UV8 A;  4LG0 A;  5JI6 A;  4LJZ F;  2EFW A;  2XAH A;  5LHG A;  3K1M A;  4PGH A;  3ZMS A;  1TTY A;  2DLL A;  1IF1 A;  2OU2 A;  3IKV A;  1W7P B;  3I53 A;  4ZYG A;  2COM A;  4M74 A;  4CO8 A;  4IF4 A;  4HAM A;  2XAG A;  2V1U A;  4M9X A;  2F5E A;  4G8X A;  1O7F A;  1DUX C;  2K86 A;  2QBY A;  4IVN A;  5CVI A;  3WTW C;  2QM3 A;  5J6X A;  3E5U A;  3O3K A;  2ZNZ A;  1RNL A;  3E6M A;  1TQM A;  3ZN0 A;  3RI4 A;  2P4W A;  2YU3 A;  2VOO A;  3C3W A;  1W7P A;  4LGW A;  3KP7 A;  3E6C C;  1I5Z A;  5K1Y A;  5HS9 A;  1XMA A;  2YSR A;  4LD5 A;  3GFI A;  5DD4 A;  1WRJ A;  4CHU A;  5F1R A;  2FOK A;  1IRF A;  1J9I A;  2ESN A;  1WQ2 A;  3DEU A;  3ISP A;  3WTV C;  3LAP A;  3H92 A;  3FHZ A;  1T6S A;  1XGM A;  3HUG A;  3LST A;  4M6X A;  1ZYR F;  2HR3 A;  3BJO A;  2Z5U A;  4P5O A;  3T5X A;  2EV5 A;  3DPT A;  3MEX A;  3IKT A;  5CYV A;  1BC8 C;  3HHH A;  3KET A;  3QOP A;  3KCC A;  3FMR A;  4XSZ F;  1IRG A;  5DCM B;  1ZHF A;  3I5U A;  1YS7 A;  3E97 A;  4KFC A;  3MQ0 A;  4Q47 A;  2CSO A;  3GF2 A;  2DU9 A;  2C6Y A;  1F4K A;  5L3D A;  1K6O A;  5FFX A;  1BN5 A;  3JAM Z;  1MD0 A;  1GXQ A;  2DW4 A;  4LMY A;  4L0Y B;  4UVC A;  3I0T A;  4U0Y A;  4YIF A;  2O03 A;  2V6C A;  3L00 A;  3OOP A;  5DCM A;  4RB2 C;  2PQ8 A;  4ZYH A;  5FD5 A;  1K78 B;  1Z9C A;  4ESB A;  2QQ9 A;  4HV6 A;  2LDU A;  4GO1 A;  1TLH B;  4FX4 A;  2QZ8 A;  2GWR A;  4UVB A;  5D5W B;  3IRR A;  2DPD A;  4KT5 C;  1XB4 A;  1IUY A;  4K2E A;  4EJV A;  1YQA A;  2A68 F;  2ZKZ A;  3LQR A;  2LNB A;  4LLG F;  3WTY C;  4ZH4 F;  3K1N A;  3R61 A;  2CQK A;  4OOI A;  1QQI A;  5LGT A;  3L7W A;  1T98 A;  1SD7 A;  1BI1 A;  3WGG A;  1FNN A;  2EA2 A;  3GXO A;  2GIV A;  4PDK A;  1K78 A;  1XGN A;  2ZFW A;  5K5Q A;  3HHG A;  2XVC A;  1SD6 A;  3ZP5 A;  1EV7 A;  2L3D A;  3V8L A;  1LNW A;  2QLZ A;  1IZ1 A;  1ZRF A;  3BWG A;  3IC7 A;  1XGS A;  2KIM A;  5KVR A;  4EM0 B;  3GLX A;  3SQN A;  2JZY A;  5IT9 K;  1ZRE A;  4IPA A;  3K9T A;  2FEZ A;  3COA C;  3V7R A;  2FBH A;  1XD7 A;  3HRM A;  4U88 A;  5IT3 A;  1Z91 A;  3HYI A;  2YR2 A;  2LKP A;  4AD9 A;  4GYI A;  3FX3 A;  4MHG A;  1ZAR A;  1ZLJ A;  2OZU A;  1LEA A;  4HZF A;  4BHC A;  1JHF A;  1R1V A;  3ABT A;  1YW8 A;  2TDX A;  5AIP A;  2JSC A;  3FM3 A;  1FBQ A;  2R7D A;  2IVM A;  1BOA A;  3I64 A;  3RIR A;  2QEN A;  1HW2 A;  1FSH A;  4Q5S F;  4UNO A;  3DFG A;  3E6B A;  5HDG A;  4TV7 A;  4A6D A;  1TNS A;  1YS6 A;  3MCZ A;  1YLF A;  4I2O A;  4L0Z B;  1UHW A;  3MFK A;  1F5T A;  4M9S A;  3T8T A;  2FQ3 A;  4Y17 A;  2P5V A;  3N97 A;  1Z1D A;  3LA3 A;  1FBU A;  1I1S A;  1WKM A;  2KJC A;  2WWY A;  1D8K A;  2E1C A;  2ETH A;  3RJP A;  3W6J B;  3L2C A;  4NHJ A;  4H0E A;  1LJ9 A;  3EUH A;  1SFE A;  4IRG A;  4GGG A;  4KIC A;  4KNY A;  1XMK A;  1KGS A;  3HRS A;  3DKW A;  2XRO A;  2L02 A;  2XV4 S;  3KZZ A;  4XLN F;  5E17 F;  2HS5 A;  1ONV A;  4BAY A;  1W5T A;  1T39 A;  2IRF G;  3BP8 A;  3HIF A;  2VBY A;  5E8I A;  1ZRD A;  4HQE A;  2KKO A;  1J2X A;  3KLO A;  2GAU A;  3F21 A;  2Z33 A;  1R5G A;  2O0Y A;  3RYR A;  4NQW A;  4YG2 F;  4ENJ A;  1SMT A;  3J80 K;  2HQR A;  5CLS A;  4A5M A;  1HW5 A;  1S6L A;  3CUQ B;  1XCV A;  3T8R A;  2GXB A;  3LAJ A;  2PJP A;  2P7V B;  2MLG A;  4OIP F;  4R79 A;  1Z6T A;  4R8H A;  1A04 A;  1B9M A;  3GVA A;  1J59 A;  2FNA A;  4WXH A;  4MTE A;  4HLX A;  2YX7 A;  1REP C;  4M72 A;  2BV6 A;  3CUQ C;  5IT9 Z;  3CUO A;  3CUQ A;  4ENN A;  1FYM A;  2HDC A;  2FMY A;  3LFK A;  2Y0M A;  1B6A A;  3KE2 A;  1H0M A;  4HDV A;  1FBS A;  2MBF A;  3SZT A;  4HW0 A;  3IHU A;  1R36 A;  1STZ A;  4ENM A;  3DF8 A;  4I7H A;  2FBK A;  3FMS A;  4KIF A;  1LDD A;  4RGU A;  4LK1 F;  1I27 A;  1DPR A;  4IRI A;  1R58 A;  3AAF A;  2D2W A;  3M8E A;  1R22 A;  2O6G E;  2QYO A;  3RDI A;  5K5R A;  4CGZ A;  2DFI A;  1X3U A;  1SAX A;  4BQA A;  1YIO A;  3E6D A;  4GCV A;  4M71 A;  1SFU A;  1DP7 P;  1OR7 A;  2A6E F;  4OU0 A;  4EV0 A;  4IRH A;  4IJA A;  1FYK A;  5CJ9 A;  1ZG3 A;  3MAJ A;  3N4M A;  3FM5 A;  2VC0 A;  4LB6 B;  5A2Q K;  4ZZD A;  3ABU A;  3C1D A;  4LLL A;  3HSF A;  3QPT A;  1HW1 A;  2LF7 A;  4HBL A;  5DEQ A;  5DUI A;  5E20 A;  1E2X A;  3TO9 A;  3ZN1 A;  1L0O C;  4I0A A;  2UXN A;  2IA2 A;  2HTJ A;  2OBP A;  4O5V A;  2HZT A;  1B4A A;  1K7A A;  5J8C A;  4OIQ F;  4JK1 X;  3OV8 A;  5JR3 A;  1FX7 A;  2PEX A;  5DUK A;  5ILV A;  4MTD A;  3FWE A;  1BI2 A;  3RKX A;  3FF5 A;  3I54 A;  1S8N A;  2VOD A;  3KLN A;  3M7G A;  1U8R A;  2JTV A;  2CO5 A;  1OKR A;  2DQR A;  2RQP A;  2EFQ A;  1T38 A;  4U7B A;  4A2U A;  1QO0 D;  1WSU A;  4LK0 F;  4JQF A;  3VB2 A;  4RGX A;  2A69 F;  1OYI A;  1KQ9 A;  5CVU A;  4D0P A;  4HLY A;  5JVT A;  1IXR C;  5DCF A;  1J75 A;  3HSE A;  5LGN A;  5LEK A;  4FT8 A;  1V3F A;  5HS7 A;  4EQQ A;  2FRH A;  1D3Y A;  4MEX F;  2NRA C;  1PUE E;  1IAW A;  1SMY F;  2IPQ X;  5J8F A;  2NNY A;  4AVP A;  4BYY A;  2HKX A;  5BMZ A;  4YFX F;  2HOE A;  4I01 A;  2ADU A;  4XBF A;  4WX9 A;  5D6F A;  4UUV A;  4GYG A;  1QZZ A;  3J80 Z;  2RGV A;  4KN4 X;  1KQ8 A;  4AWX B;  1HQC A;  2Q0O A;  3MWM A;  4LFU A;  3FZV A;  3QAH A;  4HV5 A;  1HSJ A;  5AON A;  2VON A;  3NRV A;  4HYE A;  3F3X A;  3WU1 B;  4O6J A;  1AWC A;  5FGM A;  3T0Y A;  2KRF A;  4PGG A;  1U5T C;  2OA4 A;  2P6T A;  3WE3 A;  4P9F A;  4IHT A;  3U2R A;  4ASN A;  1ULY A;  3F8M A;  2BBY A;  1IN6 A;  2ELH A;  1IW7 F;  1Z6R A;  5BOX A;  1S29 A;  3ELK A;  4Q4Z F;  1FC3 A;  1RIO H;  4ESJ A;  4CYD A;  4BNC A;  2ISZ A;  2QWW A;  3ZQ7 A;  2DK5 A;  3ZMV A;  1FZP B;  1PP7 U;  3P9I A;  1I6X A;  4UV9 A;  4EJU A;  4I98 B;  1R1T A;  2QQA A;  5FD6 A;  1IN7 A;  2DBB A;  3JSP A;  2MH2 A;  4UHT A;  3L09 A;  1UCR A;  2XIG A;  3T1B A;  4BHP A;  4A5N A;  4CIC A;  1O3S A;  2PMU A;  2WC2 A;  5ED4 A;  2OD5 A;  4HQM A;  1Z05 A;  3HSR A;  4OIR F;  1FY7 A;  4EJO A;  5LBQ A;  5HDN A;  4QWQ A;  4OIN F;  3JW4 A;  1R7J A;  3WGI A;  2L4A A;  4DNC A;  1JXS A;  1B59 A;  2P5K A;  1RUN A;  3TO7 A;  4KA4 A;  4L5J A;  1KU9 A;  3KP3 A;  2HEO A;  2V1D A;  2ZME B;  2PI0 A;  1SD4 A;  1RI7 A;  5BPI A;  3M1E A;  1ZH5 A;  2EB7 A;  1B9N A;  3BY6 A;  5DDG A;  5DD8 A;  2RV8 A;  2L54 A;  3F8C A;  3WTU C;  2H09 A;  3TDZ C;  3CTA A;  4XSX F;  4ZZL A;  3DP7 A;  4EM2 A;  2VT2 A;  1Y0U A;  5LEJ A;  3GFM A;  1HXD A;  3G3Z A;  3SHF A;  4MGR A;  3TOA A;  3RPQ A;  2W25 A;  3WG9 A;  3P9K A;  1HST A;  1BI0 A;  4KIG A;  3WU0 A;  2K7L A;  4U7D A;  1R00 A;  2ZME A;  5FB2 A;  2HWV A;  1QZY A;  1DPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...