1Q2CA

Crystal structure of tetrahymena gcn5 with bound coenzyme a and a 19-residue histone h4 peptide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
162
structure length
162
Chain Sequence
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for histone and phosphohistone binding by the GCN5 histone acetyltransferase
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Transferase/structural protein
molecule keywords histone acetyltransferase GCN5
total genus 46
structure length 162
sequence length 162
ec nomenclature ec 2.3.1.-:
pdb deposition date 2003-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1q2cA00
4CRZB 3TTHA 2R7HA 1S5KA 2ARHA 3D3SA 4AG9A 3TO9A 1M4DA 4AB7A 4JXRA 3S6HA 3FNCA 2OZUA 2FT0A 5J8CA 1Y7RA 3TOAA 1KZFA 1IICA 5CNPA 2KCWA 3ZZIA 1I12A 4KLVA 2ZW6A 1B6BA 2G3TA 1TIQA 3R95A 2JDDA 3EO4A 2EVNA 4PSWA 2FS5A 4E2AA 3PP9A 2Q7BA 3T90A 3V8IA 3UY5A 3I9SA 3D2MA 3W91A 3DR8A 5F48A 4PSXA 3W6SA 1S7LA 2VEZA 1R57A 4YFJA 4OAEA 3DSBA 4H6ZA 1WWZA 3PGPA 2FE7A 4JJXA 1YREA 1XIXA 3D2PA 2OZGA 4R87A 4JLYA 4R3LA 1QSRA 4KZTA 3SXNA 4CAVA 4E0AA 4R9MA 4DNCA 1QSOA 2JDCA 3DNSA 5F47A 2VZYA 2ZW4A 4H89A 3EXNA 1IB1E 1S3ZA 2REFA 1IYKA 3F5BA 3FB3A 4NEXA 4U5YA 5ISVA 1M4IA 5IX3A 1M4GA 2FCKA 3WR7A 3BJ8A 2PSWA 3C26A 4CS0B 2CNMA 3CXQA 2ATRA 3GY9A 2JLMA 5H84A 4BMHA 2PRBA 5DWMA 5E96A 2O28A 3CXSA 1VKCA 3B8GA 2WPXA 2HV2A 4OADA 3P2HA 1IYLA 3JUWA 2A4NA 3KKWA 1NMTA 1SQHA 2Z10A 5IB0A 2FXFA 4L89A 1YGHA 4Y49B 3OWCA 4KOYA 2GE3A 4KOVA 1Y9KA 2D4OA 2VQYA 4KOWA 3RYOA 4NF1A 4IUSA 5HMNA 2B5GA 4H6UA 2P6GA 3G3SA 4FD6A 3LD2A 2I79A 5KTDA 1S7NA 4LUAA 4KOUA 4FD7A 4I49A 1S60A 2ZW5A 3D8PA 1WK4A 2G0BA 3FBUA 2PR8A 5C88A 4B5PA 4NCZA 4MI4A 2HQYA 4MBUA 4J3GA 4JXQA 2OB0A 2OH1A 2Q4VA 3TE4A 2BSWA 3NE7A 1J4JA 3BLNA 1CJWA 3T9YA 1M1DA 4II9A 4LX9A 2GIVA 2Q4YA 1Y9WA 2ZPAA 5I0CA 3F0AA 4XPLA 3TOBA 5KTCA 2VI7A 3ZJ0A 3I3GA 4RI1A 1XE4A 2AJ6A 3S6KA 3S6GA 5F46A 4U9YA 2HUZA 1MJBA 4FD4A 3JVNA 2I00A 5JPHA 1L0CA 1N71A 4HNXB 4AG7A 4ZBGA 1YVKA 1LRZA 4R57A 1BOBA 1CM0A 3VWDA 1P0HA 4Y49C 5H86A 3BJ7A 1IIDA 1Q2CA 4PK3A 2R98A 3R9FA 3R9EA 1YR0A 1QSTA 5J8FA 4KVME 4CAXA 2P0WA 1I1DA 2C27A 2D4PA 2J8RA 2REEA 3LODA 2Z11A 3PZJA 4JD6A 2B3UA 5HH1A 3VWEA 3W6XA 2FIWA 3TO7A 4AVCA 4EVYA 1PUAA 2VXKA 2OZHA 2Z0ZA 4XNHC 1QSMA 4KOXA 1YX0A 4HNWB 3EFAA 1YK3A 3GKRA 1MJ9A 4F0YA 1Z4EA 2PR1A 3IWGA 4M3SA 4YRHA 1OZPA 4KVOE 4F6AA 2Q04A 3FXTA 1KUYA 1XF8A 5KTAA 4QVTA 1BO4A 1S7KA 2Y0MA 1NE9A 2P6EA 3TCVA 4KUAA 4NSQA 3CXPA 4XPKA 2Q0YA 4MJ8A 4KOTA 2X7BA 3TFYA 4U9ZA 2FL4A 3FIXA 3K9UA 1PU9A 4QUSA 5EC4A 1MK4A 1U6MA 2NMTA 2B4DA 3FYNA 2RC4A 2QIRA 2PDOA 1XEBA 2BEIA 3EY5A 3QAHA 1VHSA 3SHPA 1I21A 4UBRA 1Q2YA 2PQ8A 4R3KA 1P4NA 2BL1A 4B5OA 1YVOA 2CY2A 5DWNA 1YLEA 4X5KA 2IL4A 3F8KA 4KUBA 1KUXA 1V0CA 2H5MA 4E8OA 5F49A 4K30A 2EUIA 4HKFA 4PV6A 4L8AA 3P2FA 4QC6A 4NXYA 2PC1A 3G8WA 1QSNA 4MHDA 5FVJA 2VBQA 3GYAA 1K4JA 5JQ4A 3TT2A 2CNSA 2VZZA 2CNTA 4AVAA 2R8VA 1FY7A 4UWJA 3R96A 2WPWA 2FSRA 2ZW7A 4CRYB 4MY3A 4XNHB 2J8NA 2F5IA 4KOSA 4GS4A 1ON0A 2Q44A 4MY0A 2J8MA 2ZXVA 2B4DB 4KVXA 2BUEA 2OU2A 4B5PB 1S7FA 1Z4RA 2JEVA 4KLWA 4M85A 2FIAA 4UWIA 4KORA 3DDDA 3SXOA 3FRMA 4QB9A 2K5TA 5GCNA 4OLLA 4PK2A 4QBJA 4YGOA 2QECA 4IF5A 2DXQA 2R1IA 4FD5A 1XMTA 4HNYB 4CAWA 4JWPA 3TO6A 3H4QA 2B5GB 2QMLA 1Q2DA 3IGRA 3S6FA 1RO5A 3N7ZA 2B3VA 3R9GA 1RXTA 1Z9UA 4ONUA 2B4BA 2B58A 1GHEA 1KUVA 4UA3A 4XPDC 1NSLA 4AVBA 5EBVA 2P6FA 4RS2A 3QB8A 3EC4A 2AE6A 3R1KA 2G3AA 4XPDB 1M44A 1UFHA 3DR6A 4ORFA 1B87A 5C82A 5IV0A 2GANA 3E0KA 1MJAA 3MGDA
chains in the Genus database with same CATH superfamily
3TC8A 2AFXA 4CGOA 4CRZB 3TTHA 2R7HA 1S5KA 2ARHA 1X12A 3D3SA 2XEJA 5ELYA 4AG9A 4OP4A 5A27A 1IU8A 3TO9A 1M4DA 2BCOA 2XEFA 4AB7A 1AUGA 4JXRA 1IOIA 1ZLHA 2PIYA 3S6HA 3S9NA 3FNCA 4NGPA 1A2ZA 2OZUA 4OC2A 5I4MA 4C2YA 2AFMA 2FT0A 3B2YA 4NJQA 5J8FA 3K9TA 2YNDA 5J8CA 1Y7RA 4BBHA 3TOAA 1KZFA 1IICA 5CNPA 4NGRA 2KCWA 3IU1A 4KSFA 3ZZIA 1I12A 4A32A 3PBBA 1F2PA 4KLVA 1VHOA 2ZW6A 1B6BA 4B13A 2G3TA 2ODFA 4ZGYB 1TIQA 3BI0A 3R95A 1ZG9A 2ABZA 2JDDA 2AFSA 3LWUA 3EO4A 2EVNA 4GM5A 4PSWA 2FS5A 4CYOA 3GB0A 1ARMA 2PJ4A 4E2AA 1Q7LA 3PP9A 5D29A 2Q7BA 3T90A 3D7HA 3UY5A 3NA6A 3I9SA 4MCQA 3RO0A 3D2MA 3V8IA 2PJBA 2EO8A 4OC1A 3W91A 5BWAB 1Y0RA 2PJ7A 1IY7A 3DR8A 3PB9X 4UFWA 5F48A 3D7FA 4PSXA 2DPSA 3CT9A 3W6SA 3WC6A 1S7LA 2VEZA 1R57A 4Q7AA 4YFJA 4OAEA 4JZ0A 3DSBA 3NE8A 4H6ZA 1WWZA 3PGPA 2FE7A 2AFUA 4MFPA 4JJXA 5IB9A 1YREA 2EWBA 2JBKA 1XIXA 1Y7EA 2DEAA 3WABA 4TNUA 4ZYQA 3D2PA 2ZOGA 2OZGA 4R87A 3ISZA 4JLYA 2O4HA 1Z8TA 4R3LA 5JGFA 1QMUA 1JQGA 1PYTB 1GYTA 1ARLA 1QSRA 2ZEEA 4KZTA 5G22A 2ZEFA 3SXNA 4CAVA 4E0AA 4R9MA 4DNCA 1QSOA 2JDCA 4ZY1A 3H5ZA 5JH9A 4BINA 1Z8WA 1VHEA 2QVPA 3DNSA 3IO1A 5F47A 2V77A 2VZYA 4UCNA 3SI0A 4P6YA 1VIXA 2ZW4A 4H89A 3EXNA 5A28A 1IB1E 1S3ZA 3PB7X 2REFA 1IYKA 3F5BA 2PJCA 3FB3A 4NEXA 2Z3OA 5AGEA 4U5YA 2CTCA 3VH9A 5ISVA 1M4IA 4X3RA 1ZG7A 3PFOA 3IIBA 4GXHA 4AXVA 5IX3A 1M4GA 2IJZA 2FCKA 4P4IA 3VATA 4K3NA 3WR7A 3BJ8A 2PSWA 3C26A 4CS0B 4CAEA 2GFQA 4Z65A 2CNMA 2WSAA 3CXQA 2ATRA 3WC7A 1HDUA 2CIJA 1TKJA 3GY9A 2POKA 2JLMA 3N5FA 4MFZA 5H84A 4BMHA 2PRBA 1XOVA 5DWMA 3BHXA 3K2KA 2O28A 3D67A 5E96A 3CXSA 1VKCA 3B8GA 4MCPA 2WPXA 2HV2A 4OADA 2GLFA 2PE3A 1CBXA 4CPAA 2RFHA 3P2HA 4ZX8A 1F2OA 3B3TA 4P4DA 4KSIA 1IYLA 3B3VA 1NSAA 4P4JA 1UWYA 3JUWA 4OIDA 2A4NA 3GLJA 3KKWA 8CPAA 1NMTA 5LYIA 4BD9A 1SQHA 2Z10A 5IB0A 2FXFA 5CPAA 4L89A 1YGHA 3KL9A 4Y49B 3OWCA 4KOYA 5G21A 4C2XA 3H8EA 2GE3A 2WYRA 3A9LA 3NFZA 4KOVA 1BLLE 4MRIA 1Y9KA 3KQZA 1Z8XA 3MRUA 2PJ5A 2D4OA 2VQYA 4KOWA 3CPAA 3RYOA 4NF1A 4A37A 4IUSA 1CP6A 5HMNA 2B5GA 2F7VA 4EWTA 1JWQA 4FBEA 4H6UA 2P6GA 3G3SA 3HLPA 1YMEA 4NGMA 4FD6A 3LD2A 2I79A 3H8FA 2F8HA 1ELMP 4FWUA 5DS0A 2PJ3A 4PPZA 5LYDA 1S7NA 4LUAA 5KTDA 1AYEA 4KOUA 4FD7A 3SJEA 3FF3A 3KHZA 1LANA 3NH4A 1S60A 4I49A 1TF9A 3S9LA 2EK9A 2ZW5A 3D8PA 1WK4A 2G0BA 3H8GA 3T8WA 3FBUA 2PR8A 3B3CA 5C88A 4B5PA 1M4LA 4NCZA 4F9UA 4MI4A 4NGTA 4NGQA 4Q38A 3SJGA 3D4UA 2PRQA 3FEDA 2HQYA 1R43A 2Q7SA 2PJ9A 4P4FA 2AFWA 4MBUA 4J3GA 4JXQA 2ZEDA 4PXBA 2EBJA 1LCPA 2OB0A 2OH1A 2Q4VA 3TE4A 1Z5RA 2BSWA 4UCMA 3NE7A 1J4JA 1ZO0A 2Z3LA 3BLNA 3QAYA 1CJWA 4UFXA 3T9YA 3IC1A 1M1DA 2ANPA 3SJXA 5F09A 1AMPA 4II9A 4EFDA 2PJAA 4LX9A 2GIVA 1LOKA 3DGVA 2CXAA 2Q4YA 3B7IA 4ZI6A 1Y9WA 2ZPAA 3IU2A 4B11A 3JTKA 2JBJA 4A2ZA 5I0CA 3F0AA 4XPLA 3TOBA 2PJ6A 5KTCA 2VI7A 3ZJ0A 2CTBA 3I3GA 4RI1A 1XE4A 3KGQA 4UEZA 1XBUA 4MHYA 2AJ6A 3S6KA 3S6GA 4TWEA 5F46A 4U9YA 2HUZA 2V8GA 4MCRA 1MJBA 4FD4A 3JVNA 2I00A 4MFKA 5JPHA 1L0CA 1N71A 4HNXB 3FH4A 4AG7A 4ZBGA 3RZAA 1CPXA 1YVKA 1LRZA 1Z2LA 3QNVA 2PJ2A 4OC4A 1QQ9A 4R57A 1BOBA 1H8LA 1CM0A 1YW6A 2AFZA 2DPTA 2BO9A 3VWDA 1P0HA 3D68A 5HVHA 2JEWA 2V8HA 4Y49C 4O23A 4CGPA 4LQ6A 1BPNA 4WWVA 3BJ7A 2IMOA 1FNOA 5H86A 4RUHA 1IIDA 1Q2CA 3D66A 4PK3A 2ZEPA 3KZWA 2R98A 5EMIA 3GUXA 1RTQA 2WZNA 3R9FA 3R9EA 1FT7A 1YR0A 1QSTA 4KS9A 4KVME 3SI2A 4CAXA 4YWYA 2P0WA 2FVGA 1I1DA 2C27A 2D4PA 2J8RA 2REEA 1IGBA 4IAVA 2WUUA 3LODA 2Z11A 3PZJA 4JD6A 5AG4A 4YU9A 2B3UA 4OIWA 5HH1A 4ONWA 3VWEA 3W6XA 2FIWA 2RB7A 1IOFA 5THWA 3TO7A 4A33A 4MXUA 4AVCA 4EVYA 1PUAA 2VXKA 3JRUA 2OZHA 1EE3P 1ZG8A 5K8OA 2Z0ZA 4MFQA 1DTDA 3B3WA 4PXEA 4XNHC 1TF8A 1QSMA 4KOXA 1YX0A 4OC5A 2ZELA 4ZY2A 4HNWB 2HC9A 3EFAA 4PQAA 3S9MA 2OOTA 2YNCC 1YK3A 2PJ0A 3GKRA 1MJ9A 4A38A 4F0YA 1Z4EA 2QYVA 4C68A 2PR1A 4A30A 2C6GA 3WC5A 3IWGA 5CBMA 4M3SA 4YRHA 1OZPA 1DE4C 1YSJA 1TXRA 4A39A 4KVOE 4B12A 4F6AA 2Q04A 4H2KA 3FXTA 1KUYA 3WT4A 1XF8A 5KTAA 1X10A 2ZENA 4QVTA 1BPMA 5J1QA 1BO4A 4R7MA 4LQGA 1TKHA 4B10A 1S7KA 2Y0MA 1NE9A 4NGSA 2P6EA 5K8NA 3KI9A 3TCVA 4DYOA 1PCAA 2GU2A 4PXDA 4KUAA 4NSQA 1KWMA 3BI1A 2C6CA 3CXPA 3IJ3A 4XPKA 2Q0YA 1TKFA 4JYWA 2GLJA 3FMCA 4MJ8A 4KOTA 4IHMA 2X7BA 4W9YA 1Y0YA 3TFYA 1F57A 3RAMA 4P44A 3I1UA 2NYQA 4R8FA 4U9ZA 2PJ1A 2FL4A 2Z3MA 2GREA 3CZXA 3L2NA 5AG6A 5HXDA 3FIXA 3K9UA 1PU9A 3FECA 4M6IA 5G20A 4F9VA 4FAIA 4QUSA 4KSAA 5EC4A 1MK4A 1U6MA 4DUKA 2NMTA 2BOAA 2B4DA 3KASA 1BAVA 4OKOA 3FYNA 3MN8A 2RC4A 2QIRA 2PDOA 4P4EA 1XEBA 4B6ZA 5HVGA 1XFOA 2BEIA 3EY5A 3QAHA 5LYFA 2PVWA 1VHSA 4UFVA 2IQ6A 2Q4ZA 2O53A 3SHPA 2PCUA 1I21A 4UBRA 2YGWA 3FX6A 1Q2YA 4A94A 2PQ8A 4C2ZA 4MHPA 4P10A 3V7ZA 1P4NA 2BL1A 4R3KA 3TX8A 4B5OA 1OBRA 1YVOA 2CY2A 3NH5A 5DWNA 2Z3KA 4A31A 2Z3PA 1YLEA 4X5KA 1ZLIA 2IL4A 3F8KA 4RN7A 4KUBA 1KUXA 1V0CA 2H5MA 4E8OA 3IWEA 5LRKA 5F49A 4CYNA 2EUIA 4K30A 4NJRA 4NGNA 2QJ8A 4HKFA 4PV6A 3IWWA 4L8AA 2XEIA 2I3CA 3P2FA 4UIBA 4F8ZA 4QC6A 4NXYA 4OMEA 6CPAA 2PC1A 3G8WA 4MMOA 1QSNA 4MHDA 5FVJA 2VBQA 3GYAA 4ZX9A 1K4JA 3PB4X 1YW4A 2ZEGA 3B3SA 4C7HA 5JQ4A 1CP7A 1LAMA 3TT2A 2CNSA 3NH8A 4M6HA 5D8NA 2VZZA 2CNTA 3SI1A 2R8VA 4AVAA 1YLOA 1FY7A 4UWJA 3PEIA 5K8PA 3R96A 2ZEOA 3SJFA 4EMEA 2WPWA 2FSRA 2ZW7A 4CRYB 1ELLP 4MY3A 2J8NA 4XNHB 2PJ8A 2J9AA 2F5IA 1XMBA 4KOSA 7CPAA 4GS4A 1ON0A 4X2TA 1XRYA 2Q44A 2YNEA 4MY0A 4MFLA 5K8MA 2J8MA 4CAFA 4PXCA 2C6PA 2ZXVA 2B4DB 3RBUA 2BUEA 2YNCA 4KVXA 2OU2A 1CG2A 4M6GA 4B5PB 1S7FA 4P45A 1Z4RA 4A95A 2JEVA 4KLWA 3KHXA 1CX8A 4M85A 4UEFA 1YQEA 2CF4A 2FIAA 1LAPA 3BXMA 4UWIA 4KORA 3LMSA 2Q51A 3FEEA 2C1CA 4B14A 3DDDA 4FUUA 3HUVA 4CGMA 2G9DA 4OC3A 3FRMA 3SXOA 4CGLA 3KQXA 4QB9A 4IK2A 2NSMA 3FJUA 3KR4A 2K5TA 2EK8A 4MCSA 3PBEA 4OLLA 5GCNA 4R6TA 4PK2A 4QBJA 4YGOA 4CYPA 2QECA 4IF5A 2DXQA 2R1IA 2Q43A 3KR5A 4FD5A 4CGNA 1XMTA 4HNYB 5LYLA 4CAWA 4ZY0A 2ZEHA 4JWPA 3TO6A 3H4QA 4UEEA 5HVFA 2B5GB 2QMLA 4DJLA 1Q2DA 2VL1A 4Q36A 2DF5A 3IGRA 3IEHA 1RO5A 3PFEA 4MHZA 3S6FA 3V38A 3N7ZA 2B3VA 3CPXA 5G1ZA 2AFOA 3CDXA 4NFRA 4CYQA 5JM6A 4HPSA 3R9GA 1RXTA 3PRTA 5AG7A 3GIUA 5LRJA 4MFJA 5AG5A 1Z9UA 1VGYA 4UIAA 3RNZA 4ONUA 2XEGA 4MHNA 2OR4A 2B4BA 2Z3NA 3IFEA 2B58A 2ZOFA 1GHEA 3FVLA 1KUVA 4UA3A 3ISXA 4XPDC 1NSLA 4AVBA 2HB6A 2PVVA 2ZEMA 3B35A 4P4BA 4R76A 5EBVA 2P6FA 3DLJA 3D7DA 4RS2A 3QB8A 1HEEA 3EC4A 2AE6A 1Z8LA 3R1KA 4G1PA 1CPSA 2G3AA 2V8VA 3LACA 4XPDB 5LRGA 4UF4A 2V8DA 1M44A 1UFHA 3DR6A 4ORFA 3D7GA 4WJBA 1B87A 1HDQA 1LFWA 4X8IA 3VARA 4UCPA 3PB8X 5C82A 5IV0A 2GANA 3E0KA 4C7IA 2PIZA 1R3NA 1XJOA 3PB6X 4F0XA 1MJAA 3MGDA 4OC0A
chains in the Genus database with same CATH topology
4CGOA 4CRZB 3TTHA 2R7HA 1S5KA 2ARHA 3D3SA 4AG9A 5A27A 3TO9A 1M4DA 4AB7A 4JXRA 3S6HA 3FNCA 2OZUA 4C2YA 2FT0A 2YNDA 5J8CA 1Y7RA 4BBHA 3TOAA 1KZFA 1IICA 5CNPA 2KCWA 3IU1A 4KSFA 3ZZIA 1I12A 4A32A 4KLVA 2ZW6A 1B6BA 4B13A 2G3TA 4ZGYB 1TIQA 3R95A 2JDDA 3EO4A 2EVNA 4PSWA 2FS5A 4CYOA 4E2AA 3PP9A 2Q7BA 3T90A 3V8IA 3UY5A 3I9SA 3D2MA 3W91A 5BWAB 3DR8A 4UFWA 5F48A 4PSXA 2DPSA 3W6SA 1S7LA 2VEZA 1R57A 4YFJA 4OAEA 3DSBA 4H6ZA 1WWZA 3PGPA 2FE7A 4MFPA 4JJXA 1YREA 1XIXA 3D2PA 2OZGA 4R87A 4JLYA 4R3LA 1QSRA 4KZTA 5G22A 3SXNA 4CAVA 4E0AA 4R9MA 4DNCA 1QSOA 2JDCA 3H5ZA 3DNSA 5F47A 2VZYA 4UCNA 2ZW4A 4H89A 3EXNA 5A28A 1IB1E 1S3ZA 2REFA 1IYKA 3F5BA 3FB3A 4NEXA 2Z3OA 5AGEA 4U5YA 5ISVA 1M4IA 5IX3A 1M4GA 2FCKA 3WR7A 3BJ8A 2PSWA 3C26A 4CS0B 4CAEA 2CNMA 2WSAA 3CXQA 2ATRA 3GY9A 4MFZA 2JLMA 5H84A 4BMHA 2PRBA 5DWMA 5E96A 2O28A 3CXSA 1VKCA 3B8GA 2WPXA 2HV2A 4OADA 3P2HA 1IYLA 3JUWA 2A4NA 3KKWA 1NMTA 1SQHA 2Z10A 5IB0A 2FXFA 4L89A 1YGHA 4Y49B 3OWCA 4KOYA 5G21A 4C2XA 2GE3A 3A9LA 4KOVA 1Y9KA 2D4OA 2VQYA 4KOWA 3RYOA 4NF1A 4IUSA 5HMNA 2B5GA 4H6UA 2P6GA 3G3SA 4FD6A 3LD2A 2I79A 5KTDA 1S7NA 4LUAA 4KOUA 4FD7A 4I49A 1S60A 2ZW5A 3D8PA 1WK4A 2G0BA 3FBUA 2PR8A 5C88A 4B5PA 4NCZA 4MI4A 4Q38A 2HQYA 4MBUA 4J3GA 4JXQA 2OB0A 2OH1A 2Q4VA 3TE4A 2BSWA 4UCMA 3NE7A 1J4JA 1ZO0A 2Z3LA 3BLNA 1CJWA 4UFXA 3T9YA 1M1DA 4II9A 4LX9A 2GIVA 2CXAA 2Q4YA 1Y9WA 2ZPAA 3IU2A 4B11A 3JTKA 4A2ZA 5I0CA 3F0AA 4XPLA 3TOBA 5KTCA 2VI7A 3ZJ0A 3I3GA 4RI1A 1XE4A 2AJ6A 3S6KA 3S6GA 5F46A 4U9YA 2HUZA 1MJBA 4FD4A 3JVNA 2I00A 4MFKA 5JPHA 1L0CA 1N71A 4HNXB 4AG7A 4ZBGA 1YVKA 1LRZA 4R57A 1BOBA 1CM0A 2DPTA 3VWDA 1P0HA 4Y49C 4CGPA 5H86A 3BJ7A 1IIDA 1Q2CA 4PK3A 2R98A 3R9FA 3R9EA 1YR0A 1QSTA 4KS9A 4KVME 5J8FA 4CAXA 2P0WA 1I1DA 2C27A 2D4PA 2J8RA 2REEA 2WUUA 3LODA 2Z11A 3PZJA 4JD6A 5AG4A 2B3UA 5HH1A 3VWEA 3W6XA 4A33A 2FIWA 3TO7A 4AVCA 4EVYA 1PUAA 2VXKA 2OZHA 2Z0ZA 4MFQA 4XNHC 1QSMA 4KOXA 1YX0A 4HNWB 3EFAA 2YNCC 1YK3A 3GKRA 1MJ9A 4F0YA 1Z4EA 4C68A 2PR1A 4A30A 3IWGA 4M3SA 4YRHA 1OZPA 4KVOE 4B12A 4F6AA 2Q04A 3FXTA 1KUYA 1XF8A 5KTAA 4QVTA 1BO4A 4B10A 1S7KA 2Y0MA 1NE9A 2P6EA 3TCVA 4KUAA 4NSQA 3CXPA 4XPKA 2Q0YA 4MJ8A 4KOTA 2X7BA 3TFYA 4U9ZA 2FL4A 2Z3MA 5AG6A 3FIXA 3K9UA 1PU9A 5G20A 4QUSA 4KSAA 5EC4A 1MK4A 1U6MA 2NMTA 2B4DA 3FYNA 2RC4A 2QIRA 2PDOA 1XEBA 2BEIA 3EY5A 3QAHA 1VHSA 4UFVA 3SHPA 1I21A 4UBRA 2YGWA 1Q2YA 2PQ8A 4C2ZA 1P4NA 2BL1A 4R3KA 4B5OA 1YVOA 2CY2A 5DWNA 2Z3KA 4A31A 2Z3PA 1YLEA 4X5KA 2IL4A 3F8KA 4KUBA 1KUXA 1V0CA 2H5MA 4E8OA 3IWEA 5F49A 4CYNA 2EUIA 4K30A 4HKFA 4PV6A 4L8AA 3P2FA 4QC6A 4NXYA 2PC1A 3G8WA 1QSNA 4MHDA 5FVJA 2VBQA 3GYAA 1K4JA 4C7HA 5JQ4A 3TT2A 2CNSA 2VZZA 2CNTA 4AVAA 2R8VA 1FY7A 4UWJA 3R96A 2WPWA 2FSRA 2ZW7A 4CRYB 4MY3A 4XNHB 2J8NA 2F5IA 4KOSA 4GS4A 1ON0A 2Q44A 2YNEA 4MY0A 4MFLA 2J8MA 4CAFA 2ZXVA 2B4DB 4KVXA 2BUEA 2YNCA 2OU2A 4B5PB 1S7FA 1Z4RA 4A95A 2JEVA 4KLWA 4M85A 2FIAA 4UWIA 4KORA 4B14A 3DDDA 4CGLA 4CGMA 3SXOA 3FRMA 4QB9A 2K5TA 5GCNA 4OLLA 4PK2A 4QBJA 4YGOA 4CYPA 2QECA 4IF5A 2DXQA 2R1IA 4FD5A 4CGNA 1XMTA 4HNYB 4CAWA 4JWPA 3TO6A 3H4QA 2B5GB 2QMLA 1Q2DA 4Q36A 3IGRA 3S6FA 1RO5A 3N7ZA 2B3VA 5G1ZA 4CYQA 3R9GA 1RXTA 5AG7A 4MFJA 5AG5A 1Z9UA 4ONUA 2B4BA 2Z3NA 2B58A 1GHEA 1KUVA 4UA3A 4XPDC 1NSLA 4AVBA 5EBVA 2P6FA 4RS2A 3QB8A 3EC4A 2AE6A 3R1KA 2G3AA 4XPDB 1M44A 1UFHA 3DR6A 4ORFA 1B87A 4UCPA 5C82A 5IV0A 2GANA 3E0KA 4C7IA 4F0XA 1MJAA 3MGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CRZ B;  3TTH A;  2R7H A;  1S5K A;  2ARH A;  3D3S A;  4AG9 A;  3TO9 A;  1M4D A;  4AB7 A;  4JXR A;  3S6H A;  3FNC A;  2OZU A;  2FT0 A;  5J8C A;  1Y7R A;  3TOA A;  1KZF A;  1IIC A;  5CNP A;  2KCW A;  3ZZI A;  1I12 A;  4KLV A;  2ZW6 A;  1B6B A;  2G3T A;  1TIQ A;  3R95 A;  2JDD A;  3EO4 A;  2EVN A;  4PSW A;  2FS5 A;  4E2A A;  3PP9 A;  2Q7B A;  3T90 A;  3V8I A;  3UY5 A;  3I9S A;  3D2M A;  3W91 A;  3DR8 A;  5F48 A;  4PSX A;  3W6S A;  1S7L A;  2VEZ A;  1R57 A;  4YFJ A;  4OAE A;  3DSB A;  4H6Z A;  1WWZ A;  3PGP A;  2FE7 A;  4JJX A;  1YRE A;  1XIX A;  3D2P A;  2OZG A;  4R87 A;  4JLY A;  4R3L A;  1QSR A;  4KZT A;  3SXN A;  4CAV A;  4E0A A;  4R9M A;  4DNC A;  1QSO A;  2JDC A;  3DNS A;  5F47 A;  2VZY A;  2ZW4 A;  4H89 A;  3EXN A;  1IB1 E;  1S3Z A;  2REF A;  1IYK A;  3F5B A;  3FB3 A;  4NEX A;  4U5Y A;  5ISV A;  1M4I A;  5IX3 A;  1M4G A;  2FCK A;  3WR7 A;  3BJ8 A;  2PSW A;  3C26 A;  4CS0 B;  2CNM A;  3CXQ A;  2ATR A;  3GY9 A;  2JLM A;  5H84 A;  4BMH A;  2PRB A;  5DWM A;  5E96 A;  2O28 A;  3CXS A;  1VKC A;  3B8G A;  2WPX A;  2HV2 A;  4OAD A;  3P2H A;  1IYL A;  3JUW A;  2A4N A;  3KKW A;  1NMT A;  1SQH A;  2Z10 A;  5IB0 A;  2FXF A;  4L89 A;  1YGH A;  4Y49 B;  3OWC A;  4KOY A;  2GE3 A;  4KOV A;  1Y9K A;  2D4O A;  2VQY A;  4KOW A;  3RYO A;  4NF1 A;  4IUS A;  5HMN A;  2B5G A;  4H6U A;  2P6G A;  3G3S A;  4FD6 A;  3LD2 A;  2I79 A;  5KTD A;  1S7N A;  4LUA A;  4KOU A;  4FD7 A;  4I49 A;  1S60 A;  2ZW5 A;  3D8P A;  1WK4 A;  2G0B A;  3FBU A;  2PR8 A;  5C88 A;  4B5P A;  4NCZ A;  4MI4 A;  2HQY A;  4MBU A;  4J3G A;  4JXQ A;  2OB0 A;  2OH1 A;  2Q4V A;  3TE4 A;  2BSW A;  3NE7 A;  1J4J A;  3BLN A;  1CJW A;  3T9Y A;  1M1D A;  4II9 A;  4LX9 A;  2GIV A;  2Q4Y A;  1Y9W A;  2ZPA A;  5I0C A;  3F0A A;  4XPL A;  3TOB A;  5KTC A;  2VI7 A;  3ZJ0 A;  3I3G A;  4RI1 A;  1XE4 A;  2AJ6 A;  3S6K A;  3S6G A;  5F46 A;  4U9Y A;  2HUZ A;  1MJB A;  4FD4 A;  3JVN A;  2I00 A;  5JPH A;  1L0C A;  1N71 A;  4HNX B;  4AG7 A;  4ZBG A;  1YVK A;  1LRZ A;  4R57 A;  1BOB A;  1CM0 A;  3VWD A;  1P0H A;  4Y49 C;  5H86 A;  3BJ7 A;  1IID A;  1Q2C A;  4PK3 A;  2R98 A;  3R9F A;  3R9E A;  1YR0 A;  1QST A;  5J8F A;  4KVM E;  4CAX A;  2P0W A;  1I1D A;  2C27 A;  2D4P A;  2J8R A;  2REE A;  3LOD A;  2Z11 A;  3PZJ A;  4JD6 A;  2B3U A;  5HH1 A;  3VWE A;  3W6X A;  2FIW A;  3TO7 A;  4AVC A;  4EVY A;  1PUA A;  2VXK A;  2OZH A;  2Z0Z A;  4XNH C;  1QSM A;  4KOX A;  1YX0 A;  4HNW B;  3EFA A;  1YK3 A;  3GKR A;  1MJ9 A;  4F0Y A;  1Z4E A;  2PR1 A;  3IWG A;  4M3S A;  4YRH A;  1OZP A;  4KVO E;  4F6A A;  2Q04 A;  3FXT A;  1KUY A;  1XF8 A;  5KTA A;  4QVT A;  1BO4 A;  1S7K A;  2Y0M A;  1NE9 A;  2P6E A;  3TCV A;  4KUA A;  4NSQ A;  3CXP A;  4XPK A;  2Q0Y A;  4MJ8 A;  4KOT A;  2X7B A;  3TFY A;  4U9Z A;  2FL4 A;  3FIX A;  3K9U A;  1PU9 A;  4QUS A;  5EC4 A;  1MK4 A;  1U6M A;  2NMT A;  2B4D A;  3FYN A;  2RC4 A;  2QIR A;  2PDO A;  1XEB A;  2BEI A;  3EY5 A;  3QAH A;  1VHS A;  3SHP A;  1I21 A;  4UBR A;  1Q2Y A;  2PQ8 A;  4R3K A;  1P4N A;  2BL1 A;  4B5O A;  1YVO A;  2CY2 A;  5DWN A;  1YLE A;  4X5K A;  2IL4 A;  3F8K A;  4KUB A;  1KUX A;  1V0C A;  2H5M A;  4E8O A;  5F49 A;  4K30 A;  2EUI A;  4HKF A;  4PV6 A;  4L8A A;  3P2F A;  4QC6 A;  4NXY A;  2PC1 A;  3G8W A;  1QSN A;  4MHD A;  5FVJ A;  2VBQ A;  3GYA A;  1K4J A;  5JQ4 A;  3TT2 A;  2CNS A;  2VZZ A;  2CNT A;  4AVA A;  2R8V A;  1FY7 A;  4UWJ A;  3R96 A;  2WPW A;  2FSR A;  2ZW7 A;  4CRY B;  4MY3 A;  4XNH B;  2J8N A;  2F5I A;  4KOS A;  4GS4 A;  1ON0 A;  2Q44 A;  4MY0 A;  2J8M A;  2ZXV A;  2B4D B;  4KVX A;  2BUE A;  2OU2 A;  4B5P B;  1S7F A;  1Z4R A;  2JEV A;  4KLW A;  4M85 A;  2FIA A;  4UWI A;  4KOR A;  3DDD A;  3SXO A;  3FRM A;  4QB9 A;  2K5T A;  5GCN A;  4OLL A;  4PK2 A;  4QBJ A;  4YGO A;  2QEC A;  4IF5 A;  2DXQ A;  2R1I A;  4FD5 A;  1XMT A;  4HNY B;  4CAW A;  4JWP A;  3TO6 A;  3H4Q A;  2B5G B;  2QML A;  1Q2D A;  3IGR A;  3S6F A;  1RO5 A;  3N7Z A;  2B3V A;  3R9G A;  1RXT A;  1Z9U A;  4ONU A;  2B4B A;  2B58 A;  1GHE A;  1KUV A;  4UA3 A;  4XPD C;  1NSL A;  4AVB A;  5EBV A;  2P6F A;  4RS2 A;  3QB8 A;  3EC4 A;  2AE6 A;  3R1K A;  2G3A A;  4XPD B;  1M44 A;  1UFH A;  3DR6 A;  4ORF A;  1B87 A;  5C82 A;  5IV0 A;  2GAN A;  3E0K A;  1MJA A;  3MGD A; 
#chains in the Genus database with same CATH topology
 3TC8 A;  2AFX A;  4CGO A;  4CRZ B;  3TTH A;  2R7H A;  1S5K A;  2ARH A;  1X12 A;  3D3S A;  2XEJ A;  5ELY A;  4AG9 A;  4OP4 A;  5A27 A;  1IU8 A;  3TO9 A;  1M4D A;  2BCO A;  2XEF A;  4AB7 A;  1AUG A;  4JXR A;  1IOI A;  1ZLH A;  2PIY A;  3S6H A;  3S9N A;  3FNC A;  4NGP A;  1A2Z A;  2OZU A;  4OC2 A;  5I4M A;  4C2Y A;  2AFM A;  2FT0 A;  3B2Y A;  4NJQ A;  5J8F A;  3K9T A;  2YND A;  5J8C A;  1Y7R A;  4BBH A;  3TOA A;  1KZF A;  1IIC A;  5CNP A;  4NGR A;  2KCW A;  3IU1 A;  4KSF A;  3ZZI A;  1I12 A;  4A32 A;  3PBB A;  1F2P A;  4KLV A;  1VHO A;  2ZW6 A;  1B6B A;  4B13 A;  2G3T A;  2ODF A;  4ZGY B;  1TIQ A;  3BI0 A;  3R95 A;  1ZG9 A;  2ABZ A;  2JDD A;  2AFS A;  3LWU A;  3EO4 A;  2EVN A;  4GM5 A;  4PSW A;  2FS5 A;  4CYO A;  3GB0 A;  1ARM A;  2PJ4 A;  4E2A A;  1Q7L A;  3PP9 A;  5D29 A;  2Q7B A;  3T90 A;  3D7H A;  3UY5 A;  3NA6 A;  3I9S A;  4MCQ A;  3RO0 A;  3D2M A;  3V8I A;  2PJB A;  2EO8 A;  4OC1 A;  3W91 A;  5BWA B;  1Y0R A;  2PJ7 A;  1IY7 A;  3DR8 A;  3PB9 X;  4UFW A;  5F48 A;  3D7F A;  4PSX A;  2DPS A;  3CT9 A;  3W6S A;  3WC6 A;  1S7L A;  2VEZ A;  1R57 A;  4Q7A A;  4YFJ A;  4OAE A;  4JZ0 A;  3DSB A;  3NE8 A;  4H6Z A;  1WWZ A;  3PGP A;  2FE7 A;  2AFU A;  4MFP A;  4JJX A;  5IB9 A;  1YRE A;  2EWB A;  2JBK A;  1XIX A;  1Y7E A;  2DEA A;  3WAB A;  4TNU A;  4ZYQ A;  3D2P A;  2ZOG A;  2OZG A;  4R87 A;  3ISZ A;  4JLY A;  2O4H A;  1Z8T A;  4R3L A;  5JGF A;  1QMU A;  1JQG A;  1PYT B;  1GYT A;  1ARL A;  1QSR A;  2ZEE A;  4KZT A;  5G22 A;  2ZEF A;  3SXN A;  4CAV A;  4E0A A;  4R9M A;  4DNC A;  1QSO A;  2JDC A;  4ZY1 A;  3H5Z A;  5JH9 A;  4BIN A;  1Z8W A;  1VHE A;  2QVP A;  3DNS A;  3IO1 A;  5F47 A;  2V77 A;  2VZY A;  4UCN A;  3SI0 A;  4P6Y A;  1VIX A;  2ZW4 A;  4H89 A;  3EXN A;  5A28 A;  1IB1 E;  1S3Z A;  3PB7 X;  2REF A;  1IYK A;  3F5B A;  2PJC A;  3FB3 A;  4NEX A;  2Z3O A;  5AGE A;  4U5Y A;  2CTC A;  3VH9 A;  5ISV A;  1M4I A;  4X3R A;  1ZG7 A;  3PFO A;  3IIB A;  4GXH A;  4AXV A;  5IX3 A;  1M4G A;  2IJZ A;  2FCK A;  4P4I A;  3VAT A;  4K3N A;  3WR7 A;  3BJ8 A;  2PSW A;  3C26 A;  4CS0 B;  4CAE A;  2GFQ A;  4Z65 A;  2CNM A;  2WSA A;  3CXQ A;  2ATR A;  3WC7 A;  1HDU A;  2CIJ A;  1TKJ A;  3GY9 A;  2POK A;  2JLM A;  3N5F A;  4MFZ A;  5H84 A;  4BMH A;  2PRB A;  1XOV A;  5DWM A;  3BHX A;  3K2K A;  2O28 A;  3D67 A;  5E96 A;  3CXS A;  1VKC A;  3B8G A;  4MCP A;  2WPX A;  2HV2 A;  4OAD A;  2GLF A;  2PE3 A;  1CBX A;  4CPA A;  2RFH A;  3P2H A;  4ZX8 A;  1F2O A;  3B3T A;  4P4D A;  4KSI A;  1IYL A;  3B3V A;  1NSA A;  4P4J A;  1UWY A;  3JUW A;  4OID A;  2A4N A;  3GLJ A;  3KKW A;  8CPA A;  1NMT A;  5LYI A;  4BD9 A;  1SQH A;  2Z10 A;  5IB0 A;  2FXF A;  5CPA A;  4L89 A;  1YGH A;  3KL9 A;  4Y49 B;  3OWC A;  4KOY A;  5G21 A;  4C2X A;  3H8E A;  2GE3 A;  2WYR A;  3A9L A;  3NFZ A;  4KOV A;  1BLL E;  4MRI A;  1Y9K A;  3KQZ A;  1Z8X A;  3MRU A;  2PJ5 A;  2D4O A;  2VQY A;  4KOW A;  3CPA A;  3RYO A;  4NF1 A;  4A37 A;  4IUS A;  1CP6 A;  5HMN A;  2B5G A;  2F7V A;  4EWT A;  1JWQ A;  4FBE A;  4H6U A;  2P6G A;  3G3S A;  3HLP A;  1YME A;  4NGM A;  4FD6 A;  3LD2 A;  2I79 A;  3H8F A;  2F8H A;  1ELM P;  4FWU A;  5DS0 A;  2PJ3 A;  4PPZ A;  5LYD A;  1S7N A;  4LUA A;  5KTD A;  1AYE A;  4KOU A;  4FD7 A;  3SJE A;  3FF3 A;  3KHZ A;  1LAN A;  3NH4 A;  1S60 A;  4I49 A;  1TF9 A;  3S9L A;  2EK9 A;  2ZW5 A;  3D8P A;  1WK4 A;  2G0B A;  3H8G A;  3T8W A;  3FBU A;  2PR8 A;  3B3C A;  5C88 A;  4B5P A;  1M4L A;  4NCZ A;  4F9U A;  4MI4 A;  4NGT A;  4NGQ A;  4Q38 A;  3SJG A;  3D4U A;  2PRQ A;  3FED A;  2HQY A;  1R43 A;  2Q7S A;  2PJ9 A;  4P4F A;  2AFW A;  4MBU A;  4J3G A;  4JXQ A;  2ZED A;  4PXB A;  2EBJ A;  1LCP A;  2OB0 A;  2OH1 A;  2Q4V A;  3TE4 A;  1Z5R A;  2BSW A;  4UCM A;  3NE7 A;  1J4J A;  1ZO0 A;  2Z3L A;  3BLN A;  3QAY A;  1CJW A;  4UFX A;  3T9Y A;  3IC1 A;  1M1D A;  2ANP A;  3SJX A;  5F09 A;  1AMP A;  4II9 A;  4EFD A;  2PJA A;  4LX9 A;  2GIV A;  1LOK A;  3DGV A;  2CXA A;  2Q4Y A;  3B7I A;  4ZI6 A;  1Y9W A;  2ZPA A;  3IU2 A;  4B11 A;  3JTK A;  2JBJ A;  4A2Z A;  5I0C A;  3F0A A;  4XPL A;  3TOB A;  2PJ6 A;  5KTC A;  2VI7 A;  3ZJ0 A;  2CTB A;  3I3G A;  4RI1 A;  1XE4 A;  3KGQ A;  4UEZ A;  1XBU A;  4MHY A;  2AJ6 A;  3S6K A;  3S6G A;  4TWE A;  5F46 A;  4U9Y A;  2HUZ A;  2V8G A;  4MCR A;  1MJB A;  4FD4 A;  3JVN A;  2I00 A;  4MFK A;  5JPH A;  1L0C A;  1N71 A;  4HNX B;  3FH4 A;  4AG7 A;  4ZBG A;  3RZA A;  1CPX A;  1YVK A;  1LRZ A;  1Z2L A;  3QNV A;  2PJ2 A;  4OC4 A;  1QQ9 A;  4R57 A;  1BOB A;  1H8L A;  1CM0 A;  1YW6 A;  2AFZ A;  2DPT A;  2BO9 A;  3VWD A;  1P0H A;  3D68 A;  5HVH A;  2JEW A;  2V8H A;  4Y49 C;  4O23 A;  4CGP A;  4LQ6 A;  1BPN A;  4WWV A;  3BJ7 A;  2IMO A;  1FNO A;  5H86 A;  4RUH A;  1IID A;  1Q2C A;  3D66 A;  4PK3 A;  2ZEP A;  3KZW A;  2R98 A;  5EMI A;  3GUX A;  1RTQ A;  2WZN A;  3R9F A;  3R9E A;  1FT7 A;  1YR0 A;  1QST A;  4KS9 A;  4KVM E;  3SI2 A;  4CAX A;  4YWY A;  2P0W A;  2FVG A;  1I1D A;  2C27 A;  2D4P A;  2J8R A;  2REE A;  1IGB A;  4IAV A;  2WUU A;  3LOD A;  2Z11 A;  3PZJ A;  4JD6 A;  5AG4 A;  4YU9 A;  2B3U A;  4OIW A;  5HH1 A;  4ONW A;  3VWE A;  3W6X A;  2FIW A;  2RB7 A;  1IOF A;  5THW A;  3TO7 A;  4A33 A;  4MXU A;  4AVC A;  4EVY A;  1PUA A;  2VXK A;  3JRU A;  2OZH A;  1EE3 P;  1ZG8 A;  5K8O A;  2Z0Z A;  4MFQ A;  1DTD A;  3B3W A;  4PXE A;  4XNH C;  1TF8 A;  1QSM A;  4KOX A;  1YX0 A;  4OC5 A;  2ZEL A;  4ZY2 A;  4HNW B;  2HC9 A;  3EFA A;  4PQA A;  3S9M A;  2OOT A;  2YNC C;  1YK3 A;  2PJ0 A;  3GKR A;  1MJ9 A;  4A38 A;  4F0Y A;  1Z4E A;  2QYV A;  4C68 A;  2PR1 A;  4A30 A;  2C6G A;  3WC5 A;  3IWG A;  5CBM A;  4M3S A;  4YRH A;  1OZP A;  1DE4 C;  1YSJ A;  1TXR A;  4A39 A;  4KVO E;  4B12 A;  4F6A A;  2Q04 A;  4H2K A;  3FXT A;  1KUY A;  3WT4 A;  1XF8 A;  5KTA A;  1X10 A;  2ZEN A;  4QVT A;  1BPM A;  5J1Q A;  1BO4 A;  4R7M A;  4LQG A;  1TKH A;  4B10 A;  1S7K A;  2Y0M A;  1NE9 A;  4NGS A;  2P6E A;  5K8N A;  3KI9 A;  3TCV A;  4DYO A;  1PCA A;  2GU2 A;  4PXD A;  4KUA A;  4NSQ A;  1KWM A;  3BI1 A;  2C6C A;  3CXP A;  3IJ3 A;  4XPK A;  2Q0Y A;  1TKF A;  4JYW A;  2GLJ A;  3FMC A;  4MJ8 A;  4KOT A;  4IHM A;  2X7B A;  4W9Y A;  1Y0Y A;  3TFY A;  1F57 A;  3RAM A;  4P44 A;  3I1U A;  2NYQ A;  4R8F A;  4U9Z A;  2PJ1 A;  2FL4 A;  2Z3M A;  2GRE A;  3CZX A;  3L2N A;  5AG6 A;  5HXD A;  3FIX A;  3K9U A;  1PU9 A;  3FEC A;  4M6I A;  5G20 A;  4F9V A;  4FAI A;  4QUS A;  4KSA A;  5EC4 A;  1MK4 A;  1U6M A;  4DUK A;  2NMT A;  2BOA A;  2B4D A;  3KAS A;  1BAV A;  4OKO A;  3FYN A;  3MN8 A;  2RC4 A;  2QIR A;  2PDO A;  4P4E A;  1XEB A;  4B6Z A;  5HVG A;  1XFO A;  2BEI A;  3EY5 A;  3QAH A;  5LYF A;  2PVW A;  1VHS A;  4UFV A;  2IQ6 A;  2Q4Z A;  2O53 A;  3SHP A;  2PCU A;  1I21 A;  4UBR A;  2YGW A;  3FX6 A;  1Q2Y A;  4A94 A;  2PQ8 A;  4C2Z A;  4MHP A;  4P10 A;  3V7Z A;  1P4N A;  2BL1 A;  4R3K A;  3TX8 A;  4B5O A;  1OBR A;  1YVO A;  2CY2 A;  3NH5 A;  5DWN A;  2Z3K A;  4A31 A;  2Z3P A;  1YLE A;  4X5K A;  1ZLI A;  2IL4 A;  3F8K A;  4RN7 A;  4KUB A;  1KUX A;  1V0C A;  2H5M A;  4E8O A;  3IWE A;  5LRK A;  5F49 A;  4CYN A;  2EUI A;  4K30 A;  4NJR A;  4NGN A;  2QJ8 A;  4HKF A;  4PV6 A;  3IWW A;  4L8A A;  2XEI A;  2I3C A;  3P2F A;  4UIB A;  4F8Z A;  4QC6 A;  4NXY A;  4OME A;  6CPA A;  2PC1 A;  3G8W A;  4MMO A;  1QSN A;  4MHD A;  5FVJ A;  2VBQ A;  3GYA A;  4ZX9 A;  1K4J A;  3PB4 X;  1YW4 A;  2ZEG A;  3B3S A;  4C7H A;  5JQ4 A;  1CP7 A;  1LAM A;  3TT2 A;  2CNS A;  3NH8 A;  4M6H A;  5D8N A;  2VZZ A;  2CNT A;  3SI1 A;  2R8V A;  4AVA A;  1YLO A;  1FY7 A;  4UWJ A;  3PEI A;  5K8P A;  3R96 A;  2ZEO A;  3SJF A;  4EME A;  2WPW A;  2FSR A;  2ZW7 A;  4CRY B;  1ELL P;  4MY3 A;  2J8N A;  4XNH B;  2PJ8 A;  2J9A A;  2F5I A;  1XMB A;  4KOS A;  7CPA A;  4GS4 A;  1ON0 A;  4X2T A;  1XRY A;  2Q44 A;  2YNE A;  4MY0 A;  4MFL A;  5K8M A;  2J8M A;  4CAF A;  4PXC A;  2C6P A;  2ZXV A;  2B4D B;  3RBU A;  2BUE A;  2YNC A;  4KVX A;  2OU2 A;  1CG2 A;  4M6G A;  4B5P B;  1S7F A;  4P45 A;  1Z4R A;  4A95 A;  2JEV A;  4KLW A;  3KHX A;  1CX8 A;  4M85 A;  4UEF A;  1YQE A;  2CF4 A;  2FIA A;  1LAP A;  3BXM A;  4UWI A;  4KOR A;  3LMS A;  2Q51 A;  3FEE A;  2C1C A;  4B14 A;  3DDD A;  4FUU A;  3HUV A;  4CGM A;  2G9D A;  4OC3 A;  3FRM A;  3SXO A;  4CGL A;  3KQX A;  4QB9 A;  4IK2 A;  2NSM A;  3FJU A;  3KR4 A;  2K5T A;  2EK8 A;  4MCS A;  3PBE A;  4OLL A;  5GCN A;  4R6T A;  4PK2 A;  4QBJ A;  4YGO A;  4CYP A;  2QEC A;  4IF5 A;  2DXQ A;  2R1I A;  2Q43 A;  3KR5 A;  4FD5 A;  4CGN A;  1XMT A;  4HNY B;  5LYL A;  4CAW A;  4ZY0 A;  2ZEH A;  4JWP A;  3TO6 A;  3H4Q A;  4UEE A;  5HVF A;  2B5G B;  2QML A;  4DJL A;  1Q2D A;  2VL1 A;  4Q36 A;  2DF5 A;  3IGR A;  3IEH A;  1RO5 A;  3PFE A;  4MHZ A;  3S6F A;  3V38 A;  3N7Z A;  2B3V A;  3CPX A;  5G1Z A;  2AFO A;  3CDX A;  4NFR A;  4CYQ A;  5JM6 A;  4HPS A;  3R9G A;  1RXT A;  3PRT A;  5AG7 A;  3GIU A;  5LRJ A;  4MFJ A;  5AG5 A;  1Z9U A;  1VGY A;  4UIA A;  3RNZ A;  4ONU A;  2XEG A;  4MHN A;  2OR4 A;  2B4B A;  2Z3N A;  3IFE A;  2B58 A;  2ZOF A;  1GHE A;  3FVL A;  1KUV A;  4UA3 A;  3ISX A;  4XPD C;  1NSL A;  4AVB A;  2HB6 A;  2PVV A;  2ZEM A;  3B35 A;  4P4B A;  4R76 A;  5EBV A;  2P6F A;  3DLJ A;  3D7D A;  4RS2 A;  3QB8 A;  1HEE A;  3EC4 A;  2AE6 A;  1Z8L A;  3R1K A;  4G1P A;  1CPS A;  2G3A A;  2V8V A;  3LAC A;  4XPD B;  5LRG A;  4UF4 A;  2V8D A;  1M44 A;  1UFH A;  3DR6 A;  4ORF A;  3D7G A;  4WJB A;  1B87 A;  1HDQ A;  1LFW A;  4X8I A;  3VAR A;  4UCP A;  3PB8 X;  5C82 A;  5IV0 A;  2GAN A;  3E0K A;  4C7I A;  2PIZ A;  1R3N A;  1XJO A;  3PB6 X;  4F0X A;  1MJA A;  3MGD A;  4OC0 A; 
#chains in the Genus database with same CATH homology
 4CGO A;  4CRZ B;  3TTH A;  2R7H A;  1S5K A;  2ARH A;  3D3S A;  4AG9 A;  5A27 A;  3TO9 A;  1M4D A;  4AB7 A;  4JXR A;  3S6H A;  3FNC A;  2OZU A;  4C2Y A;  2FT0 A;  2YND A;  5J8C A;  1Y7R A;  4BBH A;  3TOA A;  1KZF A;  1IIC A;  5CNP A;  2KCW A;  3IU1 A;  4KSF A;  3ZZI A;  1I12 A;  4A32 A;  4KLV A;  2ZW6 A;  1B6B A;  4B13 A;  2G3T A;  4ZGY B;  1TIQ A;  3R95 A;  2JDD A;  3EO4 A;  2EVN A;  4PSW A;  2FS5 A;  4CYO A;  4E2A A;  3PP9 A;  2Q7B A;  3T90 A;  3V8I A;  3UY5 A;  3I9S A;  3D2M A;  3W91 A;  5BWA B;  3DR8 A;  4UFW A;  5F48 A;  4PSX A;  2DPS A;  3W6S A;  1S7L A;  2VEZ A;  1R57 A;  4YFJ A;  4OAE A;  3DSB A;  4H6Z A;  1WWZ A;  3PGP A;  2FE7 A;  4MFP A;  4JJX A;  1YRE A;  1XIX A;  3D2P A;  2OZG A;  4R87 A;  4JLY A;  4R3L A;  1QSR A;  4KZT A;  5G22 A;  3SXN A;  4CAV A;  4E0A A;  4R9M A;  4DNC A;  1QSO A;  2JDC A;  3H5Z A;  3DNS A;  5F47 A;  2VZY A;  4UCN A;  2ZW4 A;  4H89 A;  3EXN A;  5A28 A;  1IB1 E;  1S3Z A;  2REF A;  1IYK A;  3F5B A;  3FB3 A;  4NEX A;  2Z3O A;  5AGE A;  4U5Y A;  5ISV A;  1M4I A;  5IX3 A;  1M4G A;  2FCK A;  3WR7 A;  3BJ8 A;  2PSW A;  3C26 A;  4CS0 B;  4CAE A;  2CNM A;  2WSA A;  3CXQ A;  2ATR A;  3GY9 A;  4MFZ A;  2JLM A;  5H84 A;  4BMH A;  2PRB A;  5DWM A;  5E96 A;  2O28 A;  3CXS A;  1VKC A;  3B8G A;  2WPX A;  2HV2 A;  4OAD A;  3P2H A;  1IYL A;  3JUW A;  2A4N A;  3KKW A;  1NMT A;  1SQH A;  2Z10 A;  5IB0 A;  2FXF A;  4L89 A;  1YGH A;  4Y49 B;  3OWC A;  4KOY A;  5G21 A;  4C2X A;  2GE3 A;  3A9L A;  4KOV A;  1Y9K A;  2D4O A;  2VQY A;  4KOW A;  3RYO A;  4NF1 A;  4IUS A;  5HMN A;  2B5G A;  4H6U A;  2P6G A;  3G3S A;  4FD6 A;  3LD2 A;  2I79 A;  5KTD A;  1S7N A;  4LUA A;  4KOU A;  4FD7 A;  4I49 A;  1S60 A;  2ZW5 A;  3D8P A;  1WK4 A;  2G0B A;  3FBU A;  2PR8 A;  5C88 A;  4B5P A;  4NCZ A;  4MI4 A;  4Q38 A;  2HQY A;  4MBU A;  4J3G A;  4JXQ A;  2OB0 A;  2OH1 A;  2Q4V A;  3TE4 A;  2BSW A;  4UCM A;  3NE7 A;  1J4J A;  1ZO0 A;  2Z3L A;  3BLN A;  1CJW A;  4UFX A;  3T9Y A;  1M1D A;  4II9 A;  4LX9 A;  2GIV A;  2CXA A;  2Q4Y A;  1Y9W A;  2ZPA A;  3IU2 A;  4B11 A;  3JTK A;  4A2Z A;  5I0C A;  3F0A A;  4XPL A;  3TOB A;  5KTC A;  2VI7 A;  3ZJ0 A;  3I3G A;  4RI1 A;  1XE4 A;  2AJ6 A;  3S6K A;  3S6G A;  5F46 A;  4U9Y A;  2HUZ A;  1MJB A;  4FD4 A;  3JVN A;  2I00 A;  4MFK A;  5JPH A;  1L0C A;  1N71 A;  4HNX B;  4AG7 A;  4ZBG A;  1YVK A;  1LRZ A;  4R57 A;  1BOB A;  1CM0 A;  2DPT A;  3VWD A;  1P0H A;  4Y49 C;  4CGP A;  5H86 A;  3BJ7 A;  1IID A;  1Q2C A;  4PK3 A;  2R98 A;  3R9F A;  3R9E A;  1YR0 A;  1QST A;  4KS9 A;  4KVM E;  5J8F A;  4CAX A;  2P0W A;  1I1D A;  2C27 A;  2D4P A;  2J8R A;  2REE A;  2WUU A;  3LOD A;  2Z11 A;  3PZJ A;  4JD6 A;  5AG4 A;  2B3U A;  5HH1 A;  3VWE A;  3W6X A;  4A33 A;  2FIW A;  3TO7 A;  4AVC A;  4EVY A;  1PUA A;  2VXK A;  2OZH A;  2Z0Z A;  4MFQ A;  4XNH C;  1QSM A;  4KOX A;  1YX0 A;  4HNW B;  3EFA A;  2YNC C;  1YK3 A;  3GKR A;  1MJ9 A;  4F0Y A;  1Z4E A;  4C68 A;  2PR1 A;  4A30 A;  3IWG A;  4M3S A;  4YRH A;  1OZP A;  4KVO E;  4B12 A;  4F6A A;  2Q04 A;  3FXT A;  1KUY A;  1XF8 A;  5KTA A;  4QVT A;  1BO4 A;  4B10 A;  1S7K A;  2Y0M A;  1NE9 A;  2P6E A;  3TCV A;  4KUA A;  4NSQ A;  3CXP A;  4XPK A;  2Q0Y A;  4MJ8 A;  4KOT A;  2X7B A;  3TFY A;  4U9Z A;  2FL4 A;  2Z3M A;  5AG6 A;  3FIX A;  3K9U A;  1PU9 A;  5G20 A;  4QUS A;  4KSA A;  5EC4 A;  1MK4 A;  1U6M A;  2NMT A;  2B4D A;  3FYN A;  2RC4 A;  2QIR A;  2PDO A;  1XEB A;  2BEI A;  3EY5 A;  3QAH A;  1VHS A;  4UFV A;  3SHP A;  1I21 A;  4UBR A;  2YGW A;  1Q2Y A;  2PQ8 A;  4C2Z A;  1P4N A;  2BL1 A;  4R3K A;  4B5O A;  1YVO A;  2CY2 A;  5DWN A;  2Z3K A;  4A31 A;  2Z3P A;  1YLE A;  4X5K A;  2IL4 A;  3F8K A;  4KUB A;  1KUX A;  1V0C A;  2H5M A;  4E8O A;  3IWE A;  5F49 A;  4CYN A;  2EUI A;  4K30 A;  4HKF A;  4PV6 A;  4L8A A;  3P2F A;  4QC6 A;  4NXY A;  2PC1 A;  3G8W A;  1QSN A;  4MHD A;  5FVJ A;  2VBQ A;  3GYA A;  1K4J A;  4C7H A;  5JQ4 A;  3TT2 A;  2CNS A;  2VZZ A;  2CNT A;  4AVA A;  2R8V A;  1FY7 A;  4UWJ A;  3R96 A;  2WPW A;  2FSR A;  2ZW7 A;  4CRY B;  4MY3 A;  4XNH B;  2J8N A;  2F5I A;  4KOS A;  4GS4 A;  1ON0 A;  2Q44 A;  2YNE A;  4MY0 A;  4MFL A;  2J8M A;  4CAF A;  2ZXV A;  2B4D B;  4KVX A;  2BUE A;  2YNC A;  2OU2 A;  4B5P B;  1S7F A;  1Z4R A;  4A95 A;  2JEV A;  4KLW A;  4M85 A;  2FIA A;  4UWI A;  4KOR A;  4B14 A;  3DDD A;  4CGL A;  4CGM A;  3SXO A;  3FRM A;  4QB9 A;  2K5T A;  5GCN A;  4OLL A;  4PK2 A;  4QBJ A;  4YGO A;  4CYP A;  2QEC A;  4IF5 A;  2DXQ A;  2R1I A;  4FD5 A;  4CGN A;  1XMT A;  4HNY B;  4CAW A;  4JWP A;  3TO6 A;  3H4Q A;  2B5G B;  2QML A;  1Q2D A;  4Q36 A;  3IGR A;  3S6F A;  1RO5 A;  3N7Z A;  2B3V A;  5G1Z A;  4CYQ A;  3R9G A;  1RXT A;  5AG7 A;  4MFJ A;  5AG5 A;  1Z9U A;  4ONU A;  2B4B A;  2Z3N A;  2B58 A;  1GHE A;  1KUV A;  4UA3 A;  4XPD C;  1NSL A;  4AVB A;  5EBV A;  2P6F A;  4RS2 A;  3QB8 A;  3EC4 A;  2AE6 A;  3R1K A;  2G3A A;  4XPD B;  1M44 A;  1UFH A;  3DR6 A;  4ORF A;  1B87 A;  4UCP A;  5C82 A;  5IV0 A;  2GAN A;  3E0K A;  4C7I A;  4F0X A;  1MJA A;  3MGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...