1Q2CA

Crystal structure of tetrahymena gcn5 with bound coenzyme a and a 19-residue histone h4 peptide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
162
structure length
162
Chain Sequence
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords histone acetyltransferase GCN5
publication title Structural basis for histone and phosphohistone binding by the GCN5 histone acetyltransferase
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Transferase/structural protein
total genus 46
structure length 162
sequence length 162
ec nomenclature ec 2.3.1.-:
pdb deposition date 2003-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1q2cA00
3TFYA 1CJWA 3PGPA 1PUAA 2Q44A 3KKWA 4MY0A 4KOTA 2K5TA 1M4IA 5KTDA 1Y7RA 3MGDA 3TO7A 4H6UA 4YFJA 4R3LA 3TTHA 4CAXA 5J8FA 2Q0YA 3I9SA 4CAWA 1Q2CA 1BOBA 4YRHA 3F5BA 5DWNA 3EC4A 3TE4A 1P4NA 4XNHC 3W6SA 4JD6A 2ARHA 1I21A 3FIXA 5DWMA 1L0CA 2BUEA 2GIVA 4AVAA 5F46A 1XIXA 2FL4A 3I3GA 4R57A 3D3SA 1QSTA 3W91A 5IV0A 1S7LA 4KUAA 5E96A 1RXTA 3BJ8A 3H4QA 5JQ4A 4II9A 4U9YA 4NF1A 1FY7A 1YREA 4KOXA 2P0WA 1WWZA 1IIDA 4HKFA 4K30A 4R9MA 4UWIA 4KZTA 3R96A 2B3UA 4QUSA 3QAHA 3D2PA 2FXFA 1KZFA 1MJBA 4I49A 4M85A 4NXYA 5IB0A 3PP9A 1BO4A 1YVKA 4KOYA 3TOBA 1M4GA 5H84A 2FIAA 2BEIA 3JUWA 5IX3A 4B5PA 4L89A 2B3VA 4IUSA 3TOAA 2ATRA 3FBUA 1MK4A 1Z9UA 3GY9A 2PDOA 2VI7A 2ZW5A 5CNPA 2OZGA 1P0HA 3S6HA 5HMNA 1S3ZA 3F0AA 3GYAA 4AVCA 2JEVA 5JPHA 1GHEA 1NE9A 4JXRA 3OWCA 3DSBA 3D2MA 1R57A 3D8PA 3TO9A 3PZJA 3EY5A 4LX9A 1TIQA 3CXPA 3T90A 4UBRA 2PR8A 4IF5A 2JLMA 4UWJA 2OH1A 5F49A 4JWPA 4R3KA 4XPDC 4XNHB 1MJ9A 2Z11A 2VQYA 3C26A 1N71A 1KUYA 3W6XA 5HH1A 2ZW7A 3NE7A 1ON0A 1LRZA 2NMTA 2B5GB 2REFA 4KOUA 1I1DA 5EBVA 2BSWA 4MI4A 4JLYA 2Q4YA 2Y0MA 3CXSA 4KOSA 2CNMA 2ZW4A 3F8KA 3LD2A 1MJAA 1SQHA 3FXTA 4LUAA 1QSNA 1QSMA 4ZBGA 2BL1A 5ISVA 4QC6A 3QB8A 2HQYA 1Q2YA 1I12A 2A4NA 4M3SA 1CM0A 1IICA 4MBUA 4DNCA 1Y9WA 2FIWA 2VEZA 1Z4EA 5F48A 1S7FA 2I79A 4MY3A 3DR6A 3B8GA 1YR0A 4JXQA 1S60A 2R98A 2VZYA 1Y9KA 3IWGA 1IYLA 4E2AA 4OADA 2I00A 4OLLA 2CNTA 5H86A 2FCKA 4NEXA 4PSWA 4RS2A 1IB1E 5KTAA 4FD6A 1XF8A 1WK4A 2FT0A 3S6GA 2P6GA 5I0CA 5J8CA 2R7HA 4AB7A 2HUZA 2J8NA 4KVXA 2PR1A 2B4DA 2VBQA 4U5YA 1YVOA 4HNYB 4AG9A 3SXNA 1VKCA 2ZXVA 2CY2A 4J3GA 4KUBA 3SHPA 3EFAA 4Y49C 4XPDB 2CNSA 1YGHA 2OZUA 3R9FA 2D4PA 2X7BA 3DDDA 2Q04A 4B5PB 4F6AA 2IL4A 3P2FA 3LODA 1KUVA 3R1KA 4U9ZA 4EVYA 1M44A 3FRMA 4CAVA 3FB3A 2R1IA 2PQ8A 4H89A 5FVJA 1Q2DA 4KLWA 3N7ZA 1NSLA 3VWDA 4AG7A 3CXQA 3JVNA 3VWEA 2C27A 3FYNA 4KVME 3FNCA 2GE3A 2ZPAA 2JDCA 3ZJ0A 5EC4A 4L8AA 2AE6A 3DR8A 3GKRA 3E0KA 1QSRA 2EVNA 1J4JA 4PK2A 1PU9A 2DXQA 4NCZA 4KVOE 3S6FA 4H6ZA 4E8OA 4XPLA 4PK3A 2OU2A 3K9UA 4CRZB 1YX0A 1V0CA 3G8WA 2Z0ZA 4PSXA 2FSRA 5GCNA 4R87A 2P6FA 2G3AA 4E0AA 2PRBA 4UA3A 2WPWA 1YK3A 1XE4A 2D4OA 1B87A 4HNXB 1QSOA 2B58A 4CS0B 2HV2A 2VZZA 2P6EA 4QVTA 4RI1A 3BJ7A 4GS4A 3TO6A 2J8MA 4FD7A 3RYOA 1OZPA 4MJ8A 4CRYB 2QIRA 1K4JA 4XPKA 2VXKA 2PC1A 2PSWA 3S6KA 2R8VA 4YGOA 3R9GA 4JJXA 4F0YA 3BLNA 3ZZIA 4Y49B 2FE7A 2Z10A 1S7KA 4PV6A 2Q4VA 2H5MA 1UFHA 4X5KA 3R9EA 1XEBA 3EO4A 2EUIA 2JDDA 4ONUA 4KOWA 2GANA 2KCWA 3TCVA 3R95A 3V8IA 2J8RA 3G3SA 4KLVA 1VHSA 2G0BA 2FS5A 3P2HA 5C88A 1XMTA 1NMTA 3UY5A 3T9YA 2Q7BA 5F47A 2F5IA 1B6BA 1M4DA 2WPXA 4BMHA 4KOVA 4HNWB 4QBJA 5KTCA 1U6MA 3TT2A 5C82A 2B4DB 2OB0A 4FD5A 4MHDA 3SXOA 4KORA 2QECA 2O28A 2OZHA 2G3TA 3IGRA 1S7NA 4FD4A 4NSQA 3WR7A 2REEA 1YLEA 1Z4RA 2B5GA 2AJ6A 4OAEA 4AVBA 4ORFA 3EXNA 1M1DA 2B4BA 2ZW6A 2QMLA 4QB9A 1S5KA 1KUXA 2RC4A 3DNSA 4B5OA 1IYKA 1RO5A
chains in the Genus database with same CATH superfamily
3WT4A 3TFYA 1CJWA 3IC1A 3GB0A 4PQAA 3SI1A 3PGPA 1PUAA 3PB4X 2Q44A 4NJQA 2EO8A 3KKWA 3LWUA 2AFWA 4MY0A 4FBEA 4KOTA 2K5TA 1M4IA 3L2NA 1Y7RA 3LMSA 3MGDA 4NGNA 2EBJA 2Z3OA 4H6UA 3PFEA 4PXBA 3TO7A 4YFJA 3RBUA 4R3LA 3TTHA 1H8LA 1A2ZA 3KR4A 4LQGA 4CAXA 5J8FA 2Q0YA 3I9SA 1Z5RA 4LQ6A 5D8NA 4CAWA 3FX6A 5AG4A 1Q2CA 1VIXA 1BOBA 3D7HA 4CYQA 4WJBA 3F5BA 4YRHA 5DWNA 4ZX8A 3EC4A 3TE4A 2GREA 3B3CA 3QAYA 2PJ8A 1TKFA 1P4NA 2PVWA 4XNHC 3W6SA 4MCPA 1XBUA 2WYRA 1R3NA 1YMEA 2ARHA 2Q51A 3PEIA 4JD6A 1I21A 3FIXA 2PE3A 1Y0YA 5DWMA 3RZAA 4A32A 4EFDA 2AFSA 2Z3KA 5K8MA 1L0CA 4HPSA 2BUEA 2GIVA 4AVAA 5F46A 3PB8X 1XIXA 2FL4A 2AFZA 5BWAB 4P45A 2YNEA 4DUKA 3I3GA 5K8NA 1CX8A 1ARLA 4R57A 3D3SA 3PBEA 3IU1A 1QSTA 3W91A 5IV0A 1S7LA 4R76A 4K3NA 1XMBA 4KUAA 2DPTA 5E96A 1ELMP 1RXTA 2BOAA 3BJ8A 3H4QA 2GLJA 3PBBA 5JQ4A 3IJ3A 4TNUA 4RUHA 4II9A 4U9YA 4MFLA 4NF1A 1FY7A 1YREA 4KOXA 5HXDA 2P0WA 3PB7X 1HDUA 1FNOA 1WWZA 2BO9A 2ZEMA 1IIDA 4ZY2A 2VL1A 4HKFA 4KSIA 4YWYA 3IU2A 4ZY1A 2WSAA 4K30A 4MHPA 4R9MA 4UWIA 1ZG8A 3KI9A 4KZTA 2B3UA 4QUSA 3R96A 2PJ7A 3QAHA 4P4EA 3D2PA 3SJFA 2FXFA 4F9UA 1KZFA 4A2ZA 4OIWA 1MJBA 4MHNA 5HVHA 4I49A 4MCQA 4M85A 1CPXA 3KQZA 4NGTA 4NXYA 3D67A 2ODFA 1ELLP 5IB0A 3PP9A 1BO4A 1YVKA 4CGNA 4KOYA 1M4LA 2Z3PA 3DGVA 3FEEA 3TOBA 1M4GA 4B14A 5LYLA 2Q7SA 5H84A 2FIAA 4F0XA 4MHYA 1LFWA 2BEIA 3JUWA 5IX3A 4B5PA 2PCUA 2YGWA 3SJXA 3IWEA 2BCOA 4UEFA 1YSJA 4L89A 4CPAA 2B3VA 4MCSA 4IUSA 1RTQA 2G9DA 3TOAA 3CZXA 4NFRA 4F9VA 2ATRA 3ISXA 1AUGA 2FVGA 1CP6A 3FH4A 3PFOA 1F2OA 2PRQA 5CPAA 3FBUA 1MK4A 1Z9UA 3GY9A 5JGFA 2PDOA 2VI7A 2ZW5A 3KZWA 5CNPA 1Z8TA 2OZGA 1P0HA 2ZENA 4OMEA 3IFEA 3S6HA 5LRGA 2Q43A 5HMNA 4CGLA 1S3ZA 4A31A 4A94A 3F0AA 4GM5A 5G22A 3GYAA 4AVCA 2JEVA 4R6TA 3H8FA 4MFKA 4PXDA 2XEJA 3H5ZA 5JPHA 3B7IA 3FJUA 1GHEA 1JWQA 4P10A 1NE9A 4JXRA 2ANPA 3PB9X 1UWYA 2JBJA 3DSBA 3OWCA 4MFPA 3D2MA 2AFMA 3A9LA 1R57A 2QVPA 3S9MA 3D8PA 3TO9A 3PZJA 3EY5A 4LX9A 3TC8A 1TIQA 3CXPA 2IQ6A 3D7FA 4MFQA 3T90A 3HLPA 3H8GA 4UBRA 2PR8A 6CPAA 3FEDA 4IF5A 4IHMA 4CAFA 2JLMA 4UWJA 1OBRA 2PJCA 2OH1A 4C68A 2PIZA 5F49A 4JWPA 4R3KA 4XPDC 2ZEHA 2ZOFA 4XNHB 1MJ9A 4M6IA 2Z11A 4OC3A 5LYDA 2VQYA 3VARA 3C26A 1N71A 1KUYA 2OR4A 3CT9A 3W6XA 1BPMA 5LYIA 5HH1A 1IOIA 2ZW7A 2PJ2A 2C6PA 1ON0A 1LRZA 2NMTA 2B5GB 3NE7A 2REFA 3SI2A 2YNDA 1I1DA 2O4HA 4KOUA 4JYWA 2BSWA 4NGSA 5EBVA 5LYFA 3FVLA 3GUXA 1ARMA 4MI4A 3B3WA 4JLYA 2PJ9A 5AG6A 4UCMA 2Q4YA 2Y0MA 4P6YA 5AG5A 3V38A 4CGMA 4OC0A 3CXSA 4KOSA 2CNMA 2ZW4A 3F8KA 4FWUA 3FMCA 2C6CA 3LD2A 4UEEA 3DLJA 1LCPA 2PJBA 1MJAA 1SQHA 1XRYA 3FXTA 3ISZA 4JZ0A 4MHZA 1BAVA 4UFVA 2DEAA 3I1UA 1LANA 4MCRA 4LUAA 1QSNA 1QSMA 3KR5A 4C7IA 4ZGYB 5G21A 4ZBGA 2BL1A 2HC9A 5ISVA 2Z3MA 2V8HA 7CPAA 4PXEA 5LRKA 4QC6A 3QB8A 2HQYA 1Q2YA 1I12A 1YW4A 2A4NA 1CM0A 1IICA 3BXMA 4M3SA 4MBUA 5AGEA 4DNCA 1Y9WA 4Q36A 1VHOA 3GIUA 1NSAA 2FIWA 3S9NA 2VEZA 1Z4EA 3CPXA 5F48A 1S7FA 4PXCA 3PRTA 2I79A 4H2KA 3KQXA 3NH4A 4MY3A 3DR6A 1ZLHA 2AFUA 4X3RA 4CYPA 3LACA 3B8GA 1TKJA 2YNCA 8CPAA 1YR0A 3SJEA 4TWEA 1TF8A 4JXQA 1AYEA 1S60A 4KSFA 2R98A 2VZYA 1XOVA 1Y9KA 3FF3A 2WUUA 3IWGA 3B3SA 4NGQA 4CGOA 1IYLA 5I4MA 4E2AA 1YQEA 4OC1A 4OADA 4X2TA 2I00A 4OLLA 4KSAA 4P4IA 2CNTA 5H86A 4MFJA 4CAEA 1ZO0A 5D29A 2FCKA 4DYOA 4OC5A 1Z2LA 2AFOA 2CTBA 4A38A 4NEXA 4PSWA 4RS2A 5HVFA 3MN8A 2Q4ZA 4EWTA 1IB1E 2C6GA 2ZEDA 4NGPA 4UIAA 5KTAA 4FD6A 1XF8A 2PJAA 1WK4A 2FT0A 2OOTA 3S6GA 5JH9A 1TF9A 4CGPA 4M6HA 2P6GA 5I0CA 5J8CA 2R7HA 4AB7A 2NYQA 2HUZA 2J8NA 4KVXA 2PR1A 1DE4C 4IAVA 2B4DA 4BINA 2VBQA 1HEEA 4B11A 3KASA 4U5YA 2GLFA 3IEHA 1YVOA 3K9TA 2CF4A 5CBMA 4HNYB 4GXHA 4AG9A 5A27A 2PIYA 3SXNA 1VKCA 2JBKA 3BI1A 1CPSA 2CIJA 2ZXVA 4P44A 5IB9A 1Z8WA 2CY2A 4J3GA 4C2XA 4KUBA 4M6GA 3SHPA 3EFAA 4A39A 4Y49C 2YNCC 4UIBA 1GYTA 2CTCA 2F8HA 4XPDB 3RAMA 5G1ZA 4B13A 2CNSA 4UEZA 1YGHA 2OZUA 3RO0A 3R9FA 2D4PA 1CG2A 1HDQA 2X7BA 3DDDA 2Q04A 3IWWA 4B5PB 4F6AA 2IL4A 2PVVA 3H8EA 3P2FA 3LODA 1KUVA 3PB6X 2EWBA 3R1KA 1CP7A 1EE3P 1TKHA 4U9ZA 4EVYA 1M44A 3GLJA 4ZI6A 4R8FA 1IOFA 3FRMA 4CAVA 3FB3A 2O53A 2QJ8A 2R1IA 4OKOA 2PQ8A 4H89A 5FVJA 1Q2DA 4KLWA 3N7ZA 1NSLA 2XEIA 4C2YA 3VWDA 4AG7A 4P4JA 3CDXA 3D66A 3QNVA 4ZY0A 3CXQA 3B3TA 4C2ZA 3JVNA 1LAMA 3VWEA 3VH9A 2C27A 3FYNA 4FUUA 3KHZA 2PJ1A 3FNCA 4KVME 2GE3A 2ZPAA 3NFZA 2JDCA 3ZJ0A 5EC4A 5DS0A 2DPSA 4L8AA 2AE6A 3D7GA 3DR8A 3GKRA 1KWMA 3WABA 3E0KA 1QSRA 4WWVA 2EVNA 1J4JA 1Y7EA 4CYNA 4Z65A 4PK2A 5LRJA 2I3CA 5J1QA 1PU9A 2DXQA 3D7DA 1VGYA 4NCZA 4KVOE 2EK9A 3S6FA 4H6ZA 4UFWA 4E8OA 4XPLA 4F8ZA 2IMOA 2GFQA 4PK3A 2OU2A 2ZEEA 3K9UA 4MXUA 4NGMA 3IO1A 4CRZB 2Z3NA 2GU2A 2EK8A 1YX0A 1V0CA 4A33A 3G8WA 2F7VA 3B35A 2Z0ZA 4PSXA 1FT7A 2FSRA 4UF4A 5GCNA 3D4UA 4R87A 4FAIA 2P6FA 4B6ZA 2G3AA 1LOKA 4E0AA 2QYVA 2PRBA 3T8WA 1VHEA 5JM6A 1YW6A 5K8PA 3CPAA 3NH8A 3JTKA 2AFXA 4UA3A 2WPWA 1YK3A 1XE4A 2PJ0A 2D4OA 1B87A 4X8IA 4HNXB 4G1PA 1QSOA 2B58A 4UCNA 4CS0B 2RFHA 2HV2A 2VZZA 2J9AA 1Z8LA 3IIBA 2P6EA 4QVTA 4RI1A 4ZX9A 3NE8A 3BJ7A 2CXAA 3BI0A 4GS4A 3TO6A 2ZEOA 2J8MA 1PCAA 2ZOGA 3MRUA 4FD7A 3BHXA 3RYOA 5THWA 1OZPA 4MJ8A 3B2YA 2QIRA 1K4JA 4P4BA 3SJGA 3TX8A 4A30A 4CRYB 5ELYA 4MFZA 4XPKA 2VXKA 4B10A 2PC1A 1LAPA 1F57A 2PSWA 3S6KA 2R8VA 4MRIA 1IU8A 1ZG7A 4YGOA 3KHXA 1F2PA 1BLLE 3R9GA 1BPNA 4JJXA 3K2KA 4YU9A 4F0YA 3BLNA 4OC4A 3ZZIA 3WC7A 4Y49B 2PJ5A 1PYTB 2FE7A 1X12A 1S7KA 1JQGA 2Z10A 4PV6A 2Q4VA 3NA6A 1Y0RA 2H5MA 4PPZA 3V7ZA 5A28A 1UFHA 2HB6A 1IY7A 2V8DA 3D68A 4X5KA 3R9EA 2XEGA 4NJRA 4UCPA 1R43A 4OC2A 1XEBA 3EO4A 1QMUA 2EUIA 2XEFA 2JDDA 3B3VA 2NSMA 4ONUA 4KOWA 2GANA 2KCWA 3TCVA 4NGRA 2V8GA 4KS9A 3R95A 3V8IA 4C7HA 2J8RA 3G3SA 4KLVA 3KL9A 4W9YA 2RB7A 1VHSA 1XJOA 2G0BA 3KGQA 2FS5A 4OIDA 3P2HA 2Z3LA 4Q7AA 5C88A 1YLOA 1XMTA 2WZNA 1NMTA 3UY5A 3SI0A 2Q7BA 3T9YA 4AXVA 5AG7A 2F5IA 2PJ3A 5F47A 1B6BA 1Z8XA 2JEWA 4BBHA 1M4DA 2WPXA 5K8OA 4BMHA 4KOVA 4P4DA 1X10A 4HNWB 2PJ6A 4UFXA 4QBJA 3HUVA 5KTCA 3FECA 1U6MA 3TT2A 4DJLA 5C82A 1AMPA 1TXRA 3N5FA 4A37A 2B4DB 1ZLIA 2OB0A 1ZG9A 4RN7A 3WC5A 2ABZA 4FD5A 2V77A 4MHDA 3SXOA 3S9LA 4KORA 4B12A 4O23A 4MMOA 2QECA 3RNZA 2O28A 2OZHA 4ZYQA 3VATA 4IK2A 2G3TA 3IGRA 2ZEPA 2ZELA 2C1CA 1S7NA 2ZEFA 4CYOA 1CBXA 4FD4A 5F09A 4NSQA 3WR7A 2REEA 4EMEA 2POKA 1YLEA 4ONWA 1Z4RA 5KTDA 2V8VA 1DTDA 2B5GA 4Q38A 1QQ9A 2ZEGA 2AJ6A 4OAEA 1IGBA 4AVBA 2IJZA 2DF5A 2PJ4A 3EXNA 4ORFA 1M1DA 2B4BA 2ZW6A 1XFOA 3JRUA 3WC6A 4A95A 5HVGA 1Q7LA 2QMLA 4QB9A 1S5KA 5EMIA 1KUXA 5G20A 3NH5A 4BD9A 4OP4A 2RC4A 3DNSA 4B5OA 1IYKA 1RO5A 4R7MA 4P4FA
chains in the Genus database with same CATH topology
3TFYA 1CJWA 3PGPA 1PUAA 2Q44A 3KKWA 4MY0A 4KOTA 2K5TA 1M4IA 5KTDA 1Y7RA 3MGDA 3TO7A 2Z3OA 4H6UA 4YFJA 4R3LA 3TTHA 4CAXA 5J8FA 2Q0YA 3I9SA 4CAWA 5AG4A 1Q2CA 1BOBA 4CYQA 4YRHA 3F5BA 5DWNA 3EC4A 3TE4A 1P4NA 4XNHC 3W6SA 4JD6A 2ARHA 1I21A 3FIXA 4A32A 5DWMA 2Z3KA 1L0CA 2BUEA 2GIVA 4AVAA 5F46A 1XIXA 2FL4A 5BWAB 2YNEA 3I3GA 4R57A 3D3SA 3IU1A 1QSTA 3W91A 5IV0A 1S7LA 4KUAA 2DPTA 5E96A 1RXTA 3BJ8A 3H4QA 5JQ4A 4II9A 4U9YA 4MFLA 4NF1A 1FY7A 1YREA 4KOXA 2P0WA 1WWZA 1IIDA 4HKFA 3IU2A 2WSAA 4K30A 4R9MA 4UWIA 4KZTA 3R96A 2B3UA 4QUSA 3QAHA 3D2PA 2FXFA 1KZFA 4A2ZA 1MJBA 4I49A 4M85A 4NXYA 5IB0A 3PP9A 1BO4A 1YVKA 4CGNA 4KOYA 2Z3PA 3TOBA 1M4GA 4B14A 5H84A 2FIAA 4F0XA 2BEIA 3JUWA 5IX3A 4B5PA 2YGWA 3IWEA 4L89A 2B3VA 4IUSA 3TOAA 2ATRA 3FBUA 1MK4A 1Z9UA 3GY9A 2PDOA 2VI7A 2ZW5A 5CNPA 2OZGA 1P0HA 3S6HA 5HMNA 4CGLA 1S3ZA 4A31A 3F0AA 5G22A 3GYAA 4AVCA 2JEVA 4MFKA 3H5ZA 5JPHA 1GHEA 1NE9A 4JXRA 4MFPA 3OWCA 3DSBA 3D2MA 3A9LA 1R57A 3D8PA 3TO9A 3PZJA 3EY5A 4LX9A 1TIQA 3CXPA 4MFQA 3T90A 4UBRA 2PR8A 4IF5A 4CAFA 2JLMA 4UWJA 2OH1A 4C68A 5F49A 4JWPA 4R3KA 4XPDC 4XNHB 1MJ9A 2Z11A 2VQYA 3C26A 1N71A 1KUYA 3W6XA 5HH1A 2ZW7A 3NE7A 1ON0A 1LRZA 2NMTA 2B5GB 2REFA 2YNDA 1I1DA 4KOUA 5EBVA 2BSWA 4MI4A 4JLYA 5AG6A 4UCMA 2Q4YA 2Y0MA 5AG5A 4CGMA 3CXSA 4KOSA 2CNMA 2ZW4A 3F8KA 3LD2A 1MJAA 1SQHA 3FXTA 4UFVA 4C7IA 4LUAA 1QSNA 1QSMA 4ZGYB 5G21A 4ZBGA 2BL1A 5ISVA 2Z3MA 4QC6A 3QB8A 2HQYA 1Q2YA 1I12A 2A4NA 1CM0A 1IICA 4M3SA 5AGEA 4MBUA 4DNCA 1Y9WA 4Q36A 2FIWA 2VEZA 1Z4EA 5F48A 1S7FA 2I79A 4MY3A 3DR6A 4CYPA 3B8GA 2YNCA 1YR0A 4KSFA 4JXQA 1S60A 2R98A 2VZYA 1Y9KA 2WUUA 3IWGA 4CGOA 1IYLA 4E2AA 4OADA 2I00A 4OLLA 4KSAA 2CNTA 5H86A 4MFJA 4CAEA 1ZO0A 2FCKA 4NEXA 4PSWA 4RS2A 1IB1E 5KTAA 4FD6A 1XF8A 1WK4A 2FT0A 3S6GA 4CGPA 2P6GA 5I0CA 5J8CA 2R7HA 4AB7A 2HUZA 2J8NA 4KVXA 2PR1A 2B4DA 2VBQA 4B11A 4U5YA 1YVOA 4HNYB 4AG9A 5A27A 3SXNA 1VKCA 2ZXVA 2CY2A 4J3GA 4C2XA 4KUBA 3SHPA 3EFAA 4Y49C 2YNCC 4XPDB 5G1ZA 4B13A 2CNSA 1YGHA 2OZUA 3R9FA 2D4PA 2X7BA 3DDDA 2Q04A 4B5PB 4F6AA 2IL4A 3P2FA 3LODA 1KUVA 3R1KA 4U9ZA 4EVYA 1M44A 3FRMA 4CAVA 3FB3A 2R1IA 2PQ8A 4H89A 5FVJA 1Q2DA 4KLWA 3N7ZA 1NSLA 4C2YA 3VWDA 4AG7A 3CXQA 4C2ZA 3JVNA 3VWEA 2C27A 3FYNA 4KVME 3FNCA 2GE3A 2ZPAA 2JDCA 3ZJ0A 5EC4A 2DPSA 4L8AA 2AE6A 3DR8A 3GKRA 3E0KA 1QSRA 2EVNA 1J4JA 4CYNA 4PK2A 1PU9A 2DXQA 4NCZA 4KVOE 3S6FA 4H6ZA 4UFWA 4E8OA 4XPLA 4PK3A 2OU2A 3K9UA 4CRZB 2Z3NA 1YX0A 1V0CA 4A33A 3G8WA 2Z0ZA 4PSXA 2FSRA 5GCNA 4R87A 2P6FA 2G3AA 4E0AA 2PRBA 3JTKA 4UA3A 2WPWA 1YK3A 1XE4A 2D4OA 1B87A 4HNXB 1QSOA 2B58A 4UCNA 4CS0B 2HV2A 2VZZA 2P6EA 4QVTA 4RI1A 3BJ7A 2CXAA 4GS4A 3TO6A 2J8MA 4FD7A 3RYOA 1OZPA 4MJ8A 4CRYB 2QIRA 1K4JA 4A30A 4MFZA 4XPKA 2VXKA 4B10A 2PC1A 2PSWA 3S6KA 2R8VA 4YGOA 3R9GA 4JJXA 4F0YA 3BLNA 3ZZIA 4Y49B 2FE7A 2Z10A 1S7KA 4PV6A 2Q4VA 2H5MA 5A28A 1UFHA 4X5KA 3R9EA 4UCPA 1XEBA 3EO4A 2EUIA 2JDDA 4ONUA 4KOWA 2GANA 2KCWA 3TCVA 4C7HA 4KS9A 3R95A 3V8IA 2J8RA 3G3SA 4KLVA 1VHSA 2G0BA 2FS5A 3P2HA 2Z3LA 5C88A 1XMTA 1NMTA 3UY5A 3T9YA 2Q7BA 5AG7A 2F5IA 5F47A 1B6BA 4BBHA 1M4DA 2WPXA 4BMHA 4KOVA 4HNWB 4UFXA 4QBJA 5KTCA 1U6MA 3TT2A 5C82A 2B4DB 2OB0A 4FD5A 4MHDA 3SXOA 4KORA 4B12A 2QECA 2O28A 2OZHA 2G3TA 3IGRA 1S7NA 4CYOA 4FD4A 4NSQA 3WR7A 2REEA 1YLEA 1Z4RA 4Q38A 2B5GA 2AJ6A 4OAEA 4AVBA 4ORFA 3EXNA 1M1DA 2B4BA 2ZW6A 4A95A 2QMLA 4QB9A 1S5KA 1KUXA 5G20A 2RC4A 3DNSA 4B5OA 1IYKA 1RO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TFY A;  1CJW A;  3PGP A;  1PUA A;  2Q44 A;  3KKW A;  4MY0 A;  4KOT A;  2K5T A;  1M4I A;  5KTD A;  1Y7R A;  3MGD A;  3TO7 A;  4H6U A;  4YFJ A;  4R3L A;  3TTH A;  4CAX A;  5J8F A;  2Q0Y A;  3I9S A;  4CAW A;  1Q2C A;  1BOB A;  4YRH A;  3F5B A;  5DWN A;  3EC4 A;  3TE4 A;  1P4N A;  4XNH C;  3W6S A;  4JD6 A;  2ARH A;  1I21 A;  3FIX A;  5DWM A;  1L0C A;  2BUE A;  2GIV A;  4AVA A;  5F46 A;  1XIX A;  2FL4 A;  3I3G A;  4R57 A;  3D3S A;  1QST A;  3W91 A;  5IV0 A;  1S7L A;  4KUA A;  5E96 A;  1RXT A;  3BJ8 A;  3H4Q A;  5JQ4 A;  4II9 A;  4U9Y A;  4NF1 A;  1FY7 A;  1YRE A;  4KOX A;  2P0W A;  1WWZ A;  1IID A;  4HKF A;  4K30 A;  4R9M A;  4UWI A;  4KZT A;  3R96 A;  2B3U A;  4QUS A;  3QAH A;  3D2P A;  2FXF A;  1KZF A;  1MJB A;  4I49 A;  4M85 A;  4NXY A;  5IB0 A;  3PP9 A;  1BO4 A;  1YVK A;  4KOY A;  3TOB A;  1M4G A;  5H84 A;  2FIA A;  2BEI A;  3JUW A;  5IX3 A;  4B5P A;  4L89 A;  2B3V A;  4IUS A;  3TOA A;  2ATR A;  3FBU A;  1MK4 A;  1Z9U A;  3GY9 A;  2PDO A;  2VI7 A;  2ZW5 A;  5CNP A;  2OZG A;  1P0H A;  3S6H A;  5HMN A;  1S3Z A;  3F0A A;  3GYA A;  4AVC A;  2JEV A;  5JPH A;  1GHE A;  1NE9 A;  4JXR A;  3OWC A;  3DSB A;  3D2M A;  1R57 A;  3D8P A;  3TO9 A;  3PZJ A;  3EY5 A;  4LX9 A;  1TIQ A;  3CXP A;  3T90 A;  4UBR A;  2PR8 A;  4IF5 A;  2JLM A;  4UWJ A;  2OH1 A;  5F49 A;  4JWP A;  4R3K A;  4XPD C;  4XNH B;  1MJ9 A;  2Z11 A;  2VQY A;  3C26 A;  1N71 A;  1KUY A;  3W6X A;  5HH1 A;  2ZW7 A;  3NE7 A;  1ON0 A;  1LRZ A;  2NMT A;  2B5G B;  2REF A;  4KOU A;  1I1D A;  5EBV A;  2BSW A;  4MI4 A;  4JLY A;  2Q4Y A;  2Y0M A;  3CXS A;  4KOS A;  2CNM A;  2ZW4 A;  3F8K A;  3LD2 A;  1MJA A;  1SQH A;  3FXT A;  4LUA A;  1QSN A;  1QSM A;  4ZBG A;  2BL1 A;  5ISV A;  4QC6 A;  3QB8 A;  2HQY A;  1Q2Y A;  1I12 A;  2A4N A;  4M3S A;  1CM0 A;  1IIC A;  4MBU A;  4DNC A;  1Y9W A;  2FIW A;  2VEZ A;  1Z4E A;  5F48 A;  1S7F A;  2I79 A;  4MY3 A;  3DR6 A;  3B8G A;  1YR0 A;  4JXQ A;  1S60 A;  2R98 A;  2VZY A;  1Y9K A;  3IWG A;  1IYL A;  4E2A A;  4OAD A;  2I00 A;  4OLL A;  2CNT A;  5H86 A;  2FCK A;  4NEX A;  4PSW A;  4RS2 A;  1IB1 E;  5KTA A;  4FD6 A;  1XF8 A;  1WK4 A;  2FT0 A;  3S6G A;  2P6G A;  5I0C A;  5J8C A;  2R7H A;  4AB7 A;  2HUZ A;  2J8N A;  4KVX A;  2PR1 A;  2B4D A;  2VBQ A;  4U5Y A;  1YVO A;  4HNY B;  4AG9 A;  3SXN A;  1VKC A;  2ZXV A;  2CY2 A;  4J3G A;  4KUB A;  3SHP A;  3EFA A;  4Y49 C;  4XPD B;  2CNS A;  1YGH A;  2OZU A;  3R9F A;  2D4P A;  2X7B A;  3DDD A;  2Q04 A;  4B5P B;  4F6A A;  2IL4 A;  3P2F A;  3LOD A;  1KUV A;  3R1K A;  4U9Z A;  4EVY A;  1M44 A;  3FRM A;  4CAV A;  3FB3 A;  2R1I A;  2PQ8 A;  4H89 A;  5FVJ A;  1Q2D A;  4KLW A;  3N7Z A;  1NSL A;  3VWD A;  4AG7 A;  3CXQ A;  3JVN A;  3VWE A;  2C27 A;  3FYN A;  4KVM E;  3FNC A;  2GE3 A;  2ZPA A;  2JDC A;  3ZJ0 A;  5EC4 A;  4L8A A;  2AE6 A;  3DR8 A;  3GKR A;  3E0K A;  1QSR A;  2EVN A;  1J4J A;  4PK2 A;  1PU9 A;  2DXQ A;  4NCZ A;  4KVO E;  3S6F A;  4H6Z A;  4E8O A;  4XPL A;  4PK3 A;  2OU2 A;  3K9U A;  4CRZ B;  1YX0 A;  1V0C A;  3G8W A;  2Z0Z A;  4PSX A;  2FSR A;  5GCN A;  4R87 A;  2P6F A;  2G3A A;  4E0A A;  2PRB A;  4UA3 A;  2WPW A;  1YK3 A;  1XE4 A;  2D4O A;  1B87 A;  4HNX B;  1QSO A;  2B58 A;  4CS0 B;  2HV2 A;  2VZZ A;  2P6E A;  4QVT A;  4RI1 A;  3BJ7 A;  4GS4 A;  3TO6 A;  2J8M A;  4FD7 A;  3RYO A;  1OZP A;  4MJ8 A;  4CRY B;  2QIR A;  1K4J A;  4XPK A;  2VXK A;  2PC1 A;  2PSW A;  3S6K A;  2R8V A;  4YGO A;  3R9G A;  4JJX A;  4F0Y A;  3BLN A;  3ZZI A;  4Y49 B;  2FE7 A;  2Z10 A;  1S7K A;  4PV6 A;  2Q4V A;  2H5M A;  1UFH A;  4X5K A;  3R9E A;  1XEB A;  3EO4 A;  2EUI A;  2JDD A;  4ONU A;  4KOW A;  2GAN A;  2KCW A;  3TCV A;  3R95 A;  3V8I A;  2J8R A;  3G3S A;  4KLV A;  1VHS A;  2G0B A;  2FS5 A;  3P2H A;  5C88 A;  1XMT A;  1NMT A;  3UY5 A;  3T9Y A;  2Q7B A;  5F47 A;  2F5I A;  1B6B A;  1M4D A;  2WPX A;  4BMH A;  4KOV A;  4HNW B;  4QBJ A;  5KTC A;  1U6M A;  3TT2 A;  5C82 A;  2B4D B;  2OB0 A;  4FD5 A;  4MHD A;  3SXO A;  4KOR A;  2QEC A;  2O28 A;  2OZH A;  2G3T A;  3IGR A;  1S7N A;  4FD4 A;  4NSQ A;  3WR7 A;  2REE A;  1YLE A;  1Z4R A;  2B5G A;  2AJ6 A;  4OAE A;  4AVB A;  4ORF A;  3EXN A;  1M1D A;  2B4B A;  2ZW6 A;  2QML A;  4QB9 A;  1S5K A;  1KUX A;  2RC4 A;  3DNS A;  4B5O A;  1IYK A;  1RO5 A; 
#chains in the Genus database with same CATH topology
 3WT4 A;  3TFY A;  1CJW A;  3IC1 A;  3GB0 A;  4PQA A;  3SI1 A;  3PGP A;  1PUA A;  3PB4 X;  2Q44 A;  4NJQ A;  2EO8 A;  3KKW A;  3LWU A;  2AFW A;  4MY0 A;  4FBE A;  4KOT A;  2K5T A;  1M4I A;  3L2N A;  1Y7R A;  3LMS A;  3MGD A;  4NGN A;  2EBJ A;  2Z3O A;  4H6U A;  3PFE A;  4PXB A;  3TO7 A;  4YFJ A;  3RBU A;  4R3L A;  3TTH A;  1H8L A;  1A2Z A;  3KR4 A;  4LQG A;  4CAX A;  5J8F A;  2Q0Y A;  3I9S A;  1Z5R A;  4LQ6 A;  5D8N A;  4CAW A;  3FX6 A;  5AG4 A;  1Q2C A;  1VIX A;  1BOB A;  3D7H A;  4CYQ A;  4WJB A;  3F5B A;  4YRH A;  5DWN A;  4ZX8 A;  3EC4 A;  3TE4 A;  2GRE A;  3B3C A;  3QAY A;  2PJ8 A;  1TKF A;  1P4N A;  2PVW A;  4XNH C;  3W6S A;  4MCP A;  1XBU A;  2WYR A;  1R3N A;  1YME A;  2ARH A;  2Q51 A;  3PEI A;  4JD6 A;  1I21 A;  3FIX A;  2PE3 A;  1Y0Y A;  5DWM A;  3RZA A;  4A32 A;  4EFD A;  2AFS A;  2Z3K A;  5K8M A;  1L0C A;  4HPS A;  2BUE A;  2GIV A;  4AVA A;  5F46 A;  3PB8 X;  1XIX A;  2FL4 A;  2AFZ A;  5BWA B;  4P45 A;  2YNE A;  4DUK A;  3I3G A;  5K8N A;  1CX8 A;  1ARL A;  4R57 A;  3D3S A;  3PBE A;  3IU1 A;  1QST A;  3W91 A;  5IV0 A;  1S7L A;  4R76 A;  4K3N A;  1XMB A;  4KUA A;  2DPT A;  5E96 A;  1ELM P;  1RXT A;  2BOA A;  3BJ8 A;  3H4Q A;  2GLJ A;  3PBB A;  5JQ4 A;  3IJ3 A;  4TNU A;  4RUH A;  4II9 A;  4U9Y A;  4MFL A;  4NF1 A;  1FY7 A;  1YRE A;  4KOX A;  5HXD A;  2P0W A;  3PB7 X;  1HDU A;  1FNO A;  1WWZ A;  2BO9 A;  2ZEM A;  1IID A;  4ZY2 A;  2VL1 A;  4HKF A;  4KSI A;  4YWY A;  3IU2 A;  4ZY1 A;  2WSA A;  4K30 A;  4MHP A;  4R9M A;  4UWI A;  1ZG8 A;  3KI9 A;  4KZT A;  2B3U A;  4QUS A;  3R96 A;  2PJ7 A;  3QAH A;  4P4E A;  3D2P A;  3SJF A;  2FXF A;  4F9U A;  1KZF A;  4A2Z A;  4OIW A;  1MJB A;  4MHN A;  5HVH A;  4I49 A;  4MCQ A;  4M85 A;  1CPX A;  3KQZ A;  4NGT A;  4NXY A;  3D67 A;  2ODF A;  1ELL P;  5IB0 A;  3PP9 A;  1BO4 A;  1YVK A;  4CGN A;  4KOY A;  1M4L A;  2Z3P A;  3DGV A;  3FEE A;  3TOB A;  1M4G A;  4B14 A;  5LYL A;  2Q7S A;  5H84 A;  2FIA A;  4F0X A;  4MHY A;  1LFW A;  2BEI A;  3JUW A;  5IX3 A;  4B5P A;  2PCU A;  2YGW A;  3SJX A;  3IWE A;  2BCO A;  4UEF A;  1YSJ A;  4L89 A;  4CPA A;  2B3V A;  4MCS A;  4IUS A;  1RTQ A;  2G9D A;  3TOA A;  3CZX A;  4NFR A;  4F9V A;  2ATR A;  3ISX A;  1AUG A;  2FVG A;  1CP6 A;  3FH4 A;  3PFO A;  1F2O A;  2PRQ A;  5CPA A;  3FBU A;  1MK4 A;  1Z9U A;  3GY9 A;  5JGF A;  2PDO A;  2VI7 A;  2ZW5 A;  3KZW A;  5CNP A;  1Z8T A;  2OZG A;  1P0H A;  2ZEN A;  4OME A;  3IFE A;  3S6H A;  5LRG A;  2Q43 A;  5HMN A;  4CGL A;  1S3Z A;  4A31 A;  4A94 A;  3F0A A;  4GM5 A;  5G22 A;  3GYA A;  4AVC A;  2JEV A;  4R6T A;  3H8F A;  4MFK A;  4PXD A;  2XEJ A;  3H5Z A;  5JPH A;  3B7I A;  3FJU A;  1GHE A;  1JWQ A;  4P10 A;  1NE9 A;  4JXR A;  2ANP A;  3PB9 X;  1UWY A;  2JBJ A;  3DSB A;  3OWC A;  4MFP A;  3D2M A;  2AFM A;  3A9L A;  1R57 A;  2QVP A;  3S9M A;  3D8P A;  3TO9 A;  3PZJ A;  3EY5 A;  4LX9 A;  3TC8 A;  1TIQ A;  3CXP A;  2IQ6 A;  3D7F A;  4MFQ A;  3T90 A;  3HLP A;  3H8G A;  4UBR A;  2PR8 A;  6CPA A;  3FED A;  4IF5 A;  4IHM A;  4CAF A;  2JLM A;  4UWJ A;  1OBR A;  2PJC A;  2OH1 A;  4C68 A;  2PIZ A;  5F49 A;  4JWP A;  4R3K A;  4XPD C;  2ZEH A;  2ZOF A;  4XNH B;  1MJ9 A;  4M6I A;  2Z11 A;  4OC3 A;  5LYD A;  2VQY A;  3VAR A;  3C26 A;  1N71 A;  1KUY A;  2OR4 A;  3CT9 A;  3W6X A;  1BPM A;  5LYI A;  5HH1 A;  1IOI A;  2ZW7 A;  2PJ2 A;  2C6P A;  1ON0 A;  1LRZ A;  2NMT A;  2B5G B;  3NE7 A;  2REF A;  3SI2 A;  2YND A;  1I1D A;  2O4H A;  4KOU A;  4JYW A;  2BSW A;  4NGS A;  5EBV A;  5LYF A;  3FVL A;  3GUX A;  1ARM A;  4MI4 A;  3B3W A;  4JLY A;  2PJ9 A;  5AG6 A;  4UCM A;  2Q4Y A;  2Y0M A;  4P6Y A;  5AG5 A;  3V38 A;  4CGM A;  4OC0 A;  3CXS A;  4KOS A;  2CNM A;  2ZW4 A;  3F8K A;  4FWU A;  3FMC A;  2C6C A;  3LD2 A;  4UEE A;  3DLJ A;  1LCP A;  2PJB A;  1MJA A;  1SQH A;  1XRY A;  3FXT A;  3ISZ A;  4JZ0 A;  4MHZ A;  1BAV A;  4UFV A;  2DEA A;  3I1U A;  1LAN A;  4MCR A;  4LUA A;  1QSN A;  1QSM A;  3KR5 A;  4C7I A;  4ZGY B;  5G21 A;  4ZBG A;  2BL1 A;  2HC9 A;  5ISV A;  2Z3M A;  2V8H A;  7CPA A;  4PXE A;  5LRK A;  4QC6 A;  3QB8 A;  2HQY A;  1Q2Y A;  1I12 A;  1YW4 A;  2A4N A;  1CM0 A;  1IIC A;  3BXM A;  4M3S A;  4MBU A;  5AGE A;  4DNC A;  1Y9W A;  4Q36 A;  1VHO A;  3GIU A;  1NSA A;  2FIW A;  3S9N A;  2VEZ A;  1Z4E A;  3CPX A;  5F48 A;  1S7F A;  4PXC A;  3PRT A;  2I79 A;  4H2K A;  3KQX A;  3NH4 A;  4MY3 A;  3DR6 A;  1ZLH A;  2AFU A;  4X3R A;  4CYP A;  3LAC A;  3B8G A;  1TKJ A;  2YNC A;  8CPA A;  1YR0 A;  3SJE A;  4TWE A;  1TF8 A;  4JXQ A;  1AYE A;  1S60 A;  4KSF A;  2R98 A;  2VZY A;  1XOV A;  1Y9K A;  3FF3 A;  2WUU A;  3IWG A;  3B3S A;  4NGQ A;  4CGO A;  1IYL A;  5I4M A;  4E2A A;  1YQE A;  4OC1 A;  4OAD A;  4X2T A;  2I00 A;  4OLL A;  4KSA A;  4P4I A;  2CNT A;  5H86 A;  4MFJ A;  4CAE A;  1ZO0 A;  5D29 A;  2FCK A;  4DYO A;  4OC5 A;  1Z2L A;  2AFO A;  2CTB A;  4A38 A;  4NEX A;  4PSW A;  4RS2 A;  5HVF A;  3MN8 A;  2Q4Z A;  4EWT A;  1IB1 E;  2C6G A;  2ZED A;  4NGP A;  4UIA A;  5KTA A;  4FD6 A;  1XF8 A;  2PJA A;  1WK4 A;  2FT0 A;  2OOT A;  3S6G A;  5JH9 A;  1TF9 A;  4CGP A;  4M6H A;  2P6G A;  5I0C A;  5J8C A;  2R7H A;  4AB7 A;  2NYQ A;  2HUZ A;  2J8N A;  4KVX A;  2PR1 A;  1DE4 C;  4IAV A;  2B4D A;  4BIN A;  2VBQ A;  1HEE A;  4B11 A;  3KAS A;  4U5Y A;  2GLF A;  3IEH A;  1YVO A;  3K9T A;  2CF4 A;  5CBM A;  4HNY B;  4GXH A;  4AG9 A;  5A27 A;  2PIY A;  3SXN A;  1VKC A;  2JBK A;  3BI1 A;  1CPS A;  2CIJ A;  2ZXV A;  4P44 A;  5IB9 A;  1Z8W A;  2CY2 A;  4J3G A;  4C2X A;  4KUB A;  4M6G A;  3SHP A;  3EFA A;  4A39 A;  4Y49 C;  2YNC C;  4UIB A;  1GYT A;  2CTC A;  2F8H A;  4XPD B;  3RAM A;  5G1Z A;  4B13 A;  2CNS A;  4UEZ A;  1YGH A;  2OZU A;  3RO0 A;  3R9F A;  2D4P A;  1CG2 A;  1HDQ A;  2X7B A;  3DDD A;  2Q04 A;  3IWW A;  4B5P B;  4F6A A;  2IL4 A;  2PVV A;  3H8E A;  3P2F A;  3LOD A;  1KUV A;  3PB6 X;  2EWB A;  3R1K A;  1CP7 A;  1EE3 P;  1TKH A;  4U9Z A;  4EVY A;  1M44 A;  3GLJ A;  4ZI6 A;  4R8F A;  1IOF A;  3FRM A;  4CAV A;  3FB3 A;  2O53 A;  2QJ8 A;  2R1I A;  4OKO A;  2PQ8 A;  4H89 A;  5FVJ A;  1Q2D A;  4KLW A;  3N7Z A;  1NSL A;  2XEI A;  4C2Y A;  3VWD A;  4AG7 A;  4P4J A;  3CDX A;  3D66 A;  3QNV A;  4ZY0 A;  3CXQ A;  3B3T A;  4C2Z A;  3JVN A;  1LAM A;  3VWE A;  3VH9 A;  2C27 A;  3FYN A;  4FUU A;  3KHZ A;  2PJ1 A;  3FNC A;  4KVM E;  2GE3 A;  2ZPA A;  3NFZ A;  2JDC A;  3ZJ0 A;  5EC4 A;  5DS0 A;  2DPS A;  4L8A A;  2AE6 A;  3D7G A;  3DR8 A;  3GKR A;  1KWM A;  3WAB A;  3E0K A;  1QSR A;  4WWV A;  2EVN A;  1J4J A;  1Y7E A;  4CYN A;  4Z65 A;  4PK2 A;  5LRJ A;  2I3C A;  5J1Q A;  1PU9 A;  2DXQ A;  3D7D A;  1VGY A;  4NCZ A;  4KVO E;  2EK9 A;  3S6F A;  4H6Z A;  4UFW A;  4E8O A;  4XPL A;  4F8Z A;  2IMO A;  2GFQ A;  4PK3 A;  2OU2 A;  2ZEE A;  3K9U A;  4MXU A;  4NGM A;  3IO1 A;  4CRZ B;  2Z3N A;  2GU2 A;  2EK8 A;  1YX0 A;  1V0C A;  4A33 A;  3G8W A;  2F7V A;  3B35 A;  2Z0Z A;  4PSX A;  1FT7 A;  2FSR A;  4UF4 A;  5GCN A;  3D4U A;  4R87 A;  4FAI A;  2P6F A;  4B6Z A;  2G3A A;  1LOK A;  4E0A A;  2QYV A;  2PRB A;  3T8W A;  1VHE A;  5JM6 A;  1YW6 A;  5K8P A;  3CPA A;  3NH8 A;  3JTK A;  2AFX A;  4UA3 A;  2WPW A;  1YK3 A;  1XE4 A;  2PJ0 A;  2D4O A;  1B87 A;  4X8I A;  4HNX B;  4G1P A;  1QSO A;  2B58 A;  4UCN A;  4CS0 B;  2RFH A;  2HV2 A;  2VZZ A;  2J9A A;  1Z8L A;  3IIB A;  2P6E A;  4QVT A;  4RI1 A;  4ZX9 A;  3NE8 A;  3BJ7 A;  2CXA A;  3BI0 A;  4GS4 A;  3TO6 A;  2ZEO A;  2J8M A;  1PCA A;  2ZOG A;  3MRU A;  4FD7 A;  3BHX A;  3RYO A;  5THW A;  1OZP A;  4MJ8 A;  3B2Y A;  2QIR A;  1K4J A;  4P4B A;  3SJG A;  3TX8 A;  4A30 A;  4CRY B;  5ELY A;  4MFZ A;  4XPK A;  2VXK A;  4B10 A;  2PC1 A;  1LAP A;  1F57 A;  2PSW A;  3S6K A;  2R8V A;  4MRI A;  1IU8 A;  1ZG7 A;  4YGO A;  3KHX A;  1F2P A;  1BLL E;  3R9G A;  1BPN A;  4JJX A;  3K2K A;  4YU9 A;  4F0Y A;  3BLN A;  4OC4 A;  3ZZI A;  3WC7 A;  4Y49 B;  2PJ5 A;  1PYT B;  2FE7 A;  1X12 A;  1S7K A;  1JQG A;  2Z10 A;  4PV6 A;  2Q4V A;  3NA6 A;  1Y0R A;  2H5M A;  4PPZ A;  3V7Z A;  5A28 A;  1UFH A;  2HB6 A;  1IY7 A;  2V8D A;  3D68 A;  4X5K A;  3R9E A;  2XEG A;  4NJR A;  4UCP A;  1R43 A;  4OC2 A;  1XEB A;  3EO4 A;  1QMU A;  2EUI A;  2XEF A;  2JDD A;  3B3V A;  2NSM A;  4ONU A;  4KOW A;  2GAN A;  2KCW A;  3TCV A;  4NGR A;  2V8G A;  4KS9 A;  3R95 A;  3V8I A;  4C7H A;  2J8R A;  3G3S A;  4KLV A;  3KL9 A;  4W9Y A;  2RB7 A;  1VHS A;  1XJO A;  2G0B A;  3KGQ A;  2FS5 A;  4OID A;  3P2H A;  2Z3L A;  4Q7A A;  5C88 A;  1YLO A;  1XMT A;  2WZN A;  1NMT A;  3UY5 A;  3SI0 A;  2Q7B A;  3T9Y A;  4AXV A;  5AG7 A;  2F5I A;  2PJ3 A;  5F47 A;  1B6B A;  1Z8X A;  2JEW A;  4BBH A;  1M4D A;  2WPX A;  5K8O A;  4BMH A;  4KOV A;  4P4D A;  1X10 A;  4HNW B;  2PJ6 A;  4UFX A;  4QBJ A;  3HUV A;  5KTC A;  3FEC A;  1U6M A;  3TT2 A;  4DJL A;  5C82 A;  1AMP A;  1TXR A;  3N5F A;  4A37 A;  2B4D B;  1ZLI A;  2OB0 A;  1ZG9 A;  4RN7 A;  3WC5 A;  2ABZ A;  4FD5 A;  2V77 A;  4MHD A;  3SXO A;  3S9L A;  4KOR A;  4B12 A;  4O23 A;  4MMO A;  2QEC A;  3RNZ A;  2O28 A;  2OZH A;  4ZYQ A;  3VAT A;  4IK2 A;  2G3T A;  3IGR A;  2ZEP A;  2ZEL A;  2C1C A;  1S7N A;  2ZEF A;  4CYO A;  1CBX A;  4FD4 A;  5F09 A;  4NSQ A;  3WR7 A;  2REE A;  4EME A;  2POK A;  1YLE A;  4ONW A;  1Z4R A;  5KTD A;  2V8V A;  1DTD A;  2B5G A;  4Q38 A;  1QQ9 A;  2ZEG A;  2AJ6 A;  4OAE A;  1IGB A;  4AVB A;  2IJZ A;  2DF5 A;  2PJ4 A;  3EXN A;  4ORF A;  1M1D A;  2B4B A;  2ZW6 A;  1XFO A;  3JRU A;  3WC6 A;  4A95 A;  5HVG A;  1Q7L A;  2QML A;  4QB9 A;  1S5K A;  5EMI A;  1KUX A;  5G20 A;  3NH5 A;  4BD9 A;  4OP4 A;  2RC4 A;  3DNS A;  4B5O A;  1IYK A;  1RO5 A;  4R7M A;  4P4F A; 
#chains in the Genus database with same CATH homology
 3TFY A;  1CJW A;  3PGP A;  1PUA A;  2Q44 A;  3KKW A;  4MY0 A;  4KOT A;  2K5T A;  1M4I A;  5KTD A;  1Y7R A;  3MGD A;  3TO7 A;  2Z3O A;  4H6U A;  4YFJ A;  4R3L A;  3TTH A;  4CAX A;  5J8F A;  2Q0Y A;  3I9S A;  4CAW A;  5AG4 A;  1Q2C A;  1BOB A;  4CYQ A;  4YRH A;  3F5B A;  5DWN A;  3EC4 A;  3TE4 A;  1P4N A;  4XNH C;  3W6S A;  4JD6 A;  2ARH A;  1I21 A;  3FIX A;  4A32 A;  5DWM A;  2Z3K A;  1L0C A;  2BUE A;  2GIV A;  4AVA A;  5F46 A;  1XIX A;  2FL4 A;  5BWA B;  2YNE A;  3I3G A;  4R57 A;  3D3S A;  3IU1 A;  1QST A;  3W91 A;  5IV0 A;  1S7L A;  4KUA A;  2DPT A;  5E96 A;  1RXT A;  3BJ8 A;  3H4Q A;  5JQ4 A;  4II9 A;  4U9Y A;  4MFL A;  4NF1 A;  1FY7 A;  1YRE A;  4KOX A;  2P0W A;  1WWZ A;  1IID A;  4HKF A;  3IU2 A;  2WSA A;  4K30 A;  4R9M A;  4UWI A;  4KZT A;  3R96 A;  2B3U A;  4QUS A;  3QAH A;  3D2P A;  2FXF A;  1KZF A;  4A2Z A;  1MJB A;  4I49 A;  4M85 A;  4NXY A;  5IB0 A;  3PP9 A;  1BO4 A;  1YVK A;  4CGN A;  4KOY A;  2Z3P A;  3TOB A;  1M4G A;  4B14 A;  5H84 A;  2FIA A;  4F0X A;  2BEI A;  3JUW A;  5IX3 A;  4B5P A;  2YGW A;  3IWE A;  4L89 A;  2B3V A;  4IUS A;  3TOA A;  2ATR A;  3FBU A;  1MK4 A;  1Z9U A;  3GY9 A;  2PDO A;  2VI7 A;  2ZW5 A;  5CNP A;  2OZG A;  1P0H A;  3S6H A;  5HMN A;  4CGL A;  1S3Z A;  4A31 A;  3F0A A;  5G22 A;  3GYA A;  4AVC A;  2JEV A;  4MFK A;  3H5Z A;  5JPH A;  1GHE A;  1NE9 A;  4JXR A;  4MFP A;  3OWC A;  3DSB A;  3D2M A;  3A9L A;  1R57 A;  3D8P A;  3TO9 A;  3PZJ A;  3EY5 A;  4LX9 A;  1TIQ A;  3CXP A;  4MFQ A;  3T90 A;  4UBR A;  2PR8 A;  4IF5 A;  4CAF A;  2JLM A;  4UWJ A;  2OH1 A;  4C68 A;  5F49 A;  4JWP A;  4R3K A;  4XPD C;  4XNH B;  1MJ9 A;  2Z11 A;  2VQY A;  3C26 A;  1N71 A;  1KUY A;  3W6X A;  5HH1 A;  2ZW7 A;  3NE7 A;  1ON0 A;  1LRZ A;  2NMT A;  2B5G B;  2REF A;  2YND A;  1I1D A;  4KOU A;  5EBV A;  2BSW A;  4MI4 A;  4JLY A;  5AG6 A;  4UCM A;  2Q4Y A;  2Y0M A;  5AG5 A;  4CGM A;  3CXS A;  4KOS A;  2CNM A;  2ZW4 A;  3F8K A;  3LD2 A;  1MJA A;  1SQH A;  3FXT A;  4UFV A;  4C7I A;  4LUA A;  1QSN A;  1QSM A;  4ZGY B;  5G21 A;  4ZBG A;  2BL1 A;  5ISV A;  2Z3M A;  4QC6 A;  3QB8 A;  2HQY A;  1Q2Y A;  1I12 A;  2A4N A;  1CM0 A;  1IIC A;  4M3S A;  5AGE A;  4MBU A;  4DNC A;  1Y9W A;  4Q36 A;  2FIW A;  2VEZ A;  1Z4E A;  5F48 A;  1S7F A;  2I79 A;  4MY3 A;  3DR6 A;  4CYP A;  3B8G A;  2YNC A;  1YR0 A;  4KSF A;  4JXQ A;  1S60 A;  2R98 A;  2VZY A;  1Y9K A;  2WUU A;  3IWG A;  4CGO A;  1IYL A;  4E2A A;  4OAD A;  2I00 A;  4OLL A;  4KSA A;  2CNT A;  5H86 A;  4MFJ A;  4CAE A;  1ZO0 A;  2FCK A;  4NEX A;  4PSW A;  4RS2 A;  1IB1 E;  5KTA A;  4FD6 A;  1XF8 A;  1WK4 A;  2FT0 A;  3S6G A;  4CGP A;  2P6G A;  5I0C A;  5J8C A;  2R7H A;  4AB7 A;  2HUZ A;  2J8N A;  4KVX A;  2PR1 A;  2B4D A;  2VBQ A;  4B11 A;  4U5Y A;  1YVO A;  4HNY B;  4AG9 A;  5A27 A;  3SXN A;  1VKC A;  2ZXV A;  2CY2 A;  4J3G A;  4C2X A;  4KUB A;  3SHP A;  3EFA A;  4Y49 C;  2YNC C;  4XPD B;  5G1Z A;  4B13 A;  2CNS A;  1YGH A;  2OZU A;  3R9F A;  2D4P A;  2X7B A;  3DDD A;  2Q04 A;  4B5P B;  4F6A A;  2IL4 A;  3P2F A;  3LOD A;  1KUV A;  3R1K A;  4U9Z A;  4EVY A;  1M44 A;  3FRM A;  4CAV A;  3FB3 A;  2R1I A;  2PQ8 A;  4H89 A;  5FVJ A;  1Q2D A;  4KLW A;  3N7Z A;  1NSL A;  4C2Y A;  3VWD A;  4AG7 A;  3CXQ A;  4C2Z A;  3JVN A;  3VWE A;  2C27 A;  3FYN A;  4KVM E;  3FNC A;  2GE3 A;  2ZPA A;  2JDC A;  3ZJ0 A;  5EC4 A;  2DPS A;  4L8A A;  2AE6 A;  3DR8 A;  3GKR A;  3E0K A;  1QSR A;  2EVN A;  1J4J A;  4CYN A;  4PK2 A;  1PU9 A;  2DXQ A;  4NCZ A;  4KVO E;  3S6F A;  4H6Z A;  4UFW A;  4E8O A;  4XPL A;  4PK3 A;  2OU2 A;  3K9U A;  4CRZ B;  2Z3N A;  1YX0 A;  1V0C A;  4A33 A;  3G8W A;  2Z0Z A;  4PSX A;  2FSR A;  5GCN A;  4R87 A;  2P6F A;  2G3A A;  4E0A A;  2PRB A;  3JTK A;  4UA3 A;  2WPW A;  1YK3 A;  1XE4 A;  2D4O A;  1B87 A;  4HNX B;  1QSO A;  2B58 A;  4UCN A;  4CS0 B;  2HV2 A;  2VZZ A;  2P6E A;  4QVT A;  4RI1 A;  3BJ7 A;  2CXA A;  4GS4 A;  3TO6 A;  2J8M A;  4FD7 A;  3RYO A;  1OZP A;  4MJ8 A;  4CRY B;  2QIR A;  1K4J A;  4A30 A;  4MFZ A;  4XPK A;  2VXK A;  4B10 A;  2PC1 A;  2PSW A;  3S6K A;  2R8V A;  4YGO A;  3R9G A;  4JJX A;  4F0Y A;  3BLN A;  3ZZI A;  4Y49 B;  2FE7 A;  2Z10 A;  1S7K A;  4PV6 A;  2Q4V A;  2H5M A;  5A28 A;  1UFH A;  4X5K A;  3R9E A;  4UCP A;  1XEB A;  3EO4 A;  2EUI A;  2JDD A;  4ONU A;  4KOW A;  2GAN A;  2KCW A;  3TCV A;  4C7H A;  4KS9 A;  3R95 A;  3V8I A;  2J8R A;  3G3S A;  4KLV A;  1VHS A;  2G0B A;  2FS5 A;  3P2H A;  2Z3L A;  5C88 A;  1XMT A;  1NMT A;  3UY5 A;  3T9Y A;  2Q7B A;  5AG7 A;  2F5I A;  5F47 A;  1B6B A;  4BBH A;  1M4D A;  2WPX A;  4BMH A;  4KOV A;  4HNW B;  4UFX A;  4QBJ A;  5KTC A;  1U6M A;  3TT2 A;  5C82 A;  2B4D B;  2OB0 A;  4FD5 A;  4MHD A;  3SXO A;  4KOR A;  4B12 A;  2QEC A;  2O28 A;  2OZH A;  2G3T A;  3IGR A;  1S7N A;  4CYO A;  4FD4 A;  4NSQ A;  3WR7 A;  2REE A;  1YLE A;  1Z4R A;  4Q38 A;  2B5G A;  2AJ6 A;  4OAE A;  4AVB A;  4ORF A;  3EXN A;  1M1D A;  2B4B A;  2ZW6 A;  4A95 A;  2QML A;  4QB9 A;  1S5K A;  1KUX A;  5G20 A;  2RC4 A;  3DNS A;  4B5O A;  1IYK A;  1RO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...