1Q2CA

Crystal structure of tetrahymena gcn5 with bound coenzyme a and a 19-residue histone h4 peptide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
162
structure length
162
Chain Sequence
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for histone and phosphohistone binding by the GCN5 histone acetyltransferase
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Transferase/structural protein
molecule keywords histone acetyltransferase GCN5
total genus 46
structure length 162
sequence length 162
ec nomenclature ec 2.3.1.-:
pdb deposition date 2003-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1q2cA00
1P0HA 2AE6A 1S7LA 2VI7A 1TIQA 2OZHA 3EC4A 3PZJA 5FVJA 4AVCA 1KUXA 2K5TA 5JPHA 2JDCA 4UWJA 4Y49C 2Z0ZA 1PUAA 3D2MA 1GHEA 4MHDA 4KOWA 5J8CA 1MK4A 5GCNA 4MBUA 4RI1A 4RS2A 1QSRA 5E96A 2Q4YA 2R7HA 4CAVA 2QIRA 2A4NA 3JVNA 3LD2A 4CS0B 4QBJA 2ZW7A 4QUSA 1OZPA 1CJWA 4HNXB 5F48A 1NMTA 1U6MA 4U9ZA 4PSWA 2X7BA 2VZZA 3D3SA 5ISVA 2B3VA 4F6AA 2B5GB 2GANA 4E0AA 2BSWA 3P2HA 3I9SA 3SXNA 2G3AA 5EBVA 4AG7A 4OAEA 4YFJA 4DNCA 3GYAA 3DNSA 4KVXA 4I49A 2I79A 3PP9A 3B8GA 3D8PA 3R9EA 1IB1E 2FE7A 5J8FA 1I21A 3EY5A 4H89A 4B5PB 5KTAA 2ARHA 4ONUA 3V8IA 1N71A 2ZPAA 2HUZA 5C88A 2FIAA 4R57A 4KVOE 3TO9A 1KUVA 4AVAA 3EXNA 1YVKA 2P6GA 2IL4A 4QB9A 1BOBA 4ZBGA 2J8RA 2Q04A 2FSRA 3TTHA 4R3LA 1S3ZA 1M4DA 3TO7A 4MY3A 4XNHC 4XPLA 4KUBA 4ORFA 2B4DA 4KOTA 1Y9KA 3P2FA 4CAWA 4KLWA 3ZJ0A 2VZYA 2FIWA 4H6UA 3K9UA 1M4IA 3R95A 3T9YA 3FXTA 1MJAA 4CRZB 4II9A 2WPWA 4F0YA 4AB7A 1RO5A 4KOYA 4E8OA 2AJ6A 3TOAA 4MY0A 4L8AA 3CXQA 2FCKA 4UWIA 2R8VA 1IYKA 3H4QA 4LX9A 5F46A 1YX0A 4R87A 1B6BA 1NSLA 2FXFA 4FD7A 3S6GA 2CNSA 2J8NA 4HKFA 3IWGA 2G3TA 2PR8A 1CM0A 2QMLA 3DR6A 1Z4RA 2J8MA 4B5OA 3LODA 1IICA 4KOSA 3R9FA 4KZTA 3E0KA 1QSNA 2Q7BA 2P6EA 3NE7A 2B4BA 4HNWB 2B4DB 4FD4A 3W6SA 1M1DA 2JDDA 4NF1A 2CY2A 2FS5A 2PSWA 4PK2A 1YGHA 5HMNA 3MGDA 1MJ9A 1S7KA 1Z4EA 2RC4A 3TO6A 1IYLA 4UBRA 1PU9A 5I0CA 4H6ZA 4KUAA 4Y49B 5F49A 1KUYA 1RXTA 4KOVA 5KTDA 1FY7A 4M85A 1Q2YA 1R57A 4IUSA 1QSMA 2O28A 2P6FA 1B87A 4AVBA 1QSTA 4PV6A 5HH1A 2ZW4A 4CRYB 1YLEA 3W91A 4BMHA 4FD6A 2ZW5A 4EVYA 3UY5A 3SXOA 2ATRA 3JUWA 1XF8A 3S6FA 4UA3A 5JQ4A 1NE9A 5H86A 3EFAA 2H5MA 2VBQA 1LRZA 3R96A 3WR7A 4XPDC 2F5IA 1XEBA 3KKWA 3F5BA 2REFA 1S5KA 4XPDB 2EVNA 4OADA 3DDDA 2PC1A 1J4JA 3T90A 3BLNA 5DWNA 2PRBA 2B5GA 4PSXA 2DXQA 2PDOA 5C82A 1QSOA 2CNMA 4HNYB 3F8KA 4MJ8A 3EO4A 1YREA 4KLVA 4LUAA 1Y9WA 2FL4A 3S6HA 4B5PA 1KZFA 1S7FA 4PK3A 3DR8A 3BJ7A 1VHSA 5DWMA 1P4NA 2EUIA 3DSBA 2OZGA 2Z11A 4KORA 1Z9UA 2BUEA 2NMTA 4OLLA 4L89A 2GE3A 2PR1A 1I12A 2ZXVA 3FYNA 1ON0A 2KCWA 4JWPA 2REEA 1M44A 2HV2A 1SQHA 5EC4A 4R9MA 1Q2CA 2OZUA 2PQ8A 2R98A 3G8WA 4KVME 5KTCA 4M3SA 1Q2DA 2BEIA 3SHPA 3BJ8A 4K30A 2OB0A 3TOBA 4U9YA 3D2PA 1XIXA 2JEVA 4JJXA 4JXRA 4QC6A 3TE4A 4GS4A 3N7ZA 3ZZIA 1S7NA 3QB8A 1S60A 2D4PA 1WK4A 3FRMA 4J3GA 3C26A 3I3GA 3IGRA 5IV0A 1MJBA 2FT0A 4U5YA 4FD5A 2JLMA 4JD6A 3FBUA 4JXQA 1IIDA 2Z10A 3S6KA 1I1DA 2GIVA 5CNPA 3TT2A 2VXKA 2B3UA 3VWEA 5H84A 3G3SA 4NEXA 2C27A 2P0WA 3TCVA 2Q4VA 3RYOA 1UFHA 2OH1A 2B58A 3VWDA 1YK3A 2Q0YA 1L0CA 2ZW6A 3OWCA 2Y0MA 3R9GA 4CAXA 2I00A 4YRHA 4KOXA 4NCZA 3GY9A 2BL1A 3CXSA 1VKCA 4NXYA 4E2AA 2HQYA 4XPKA 2G0BA 4YGOA 1YR0A 1WWZA 1M4GA 2VEZA 3CXPA 4NSQA 1BO4A 2CNTA 4JLYA 5IB0A 4MI4A 1K4JA 3PGPA 4KOUA 4IF5A 3W6XA 3FIXA 3R1KA 1XE4A 1V0CA 4X5KA 2WPXA 5F47A 1YVOA 3FNCA 4QVTA 3GKRA 2D4OA 2QECA 4R3KA 5IX3A 3TFYA 1XMTA 3QAHA 4AG9A 3FB3A 3F0AA 2R1IA 2OU2A 1Y7RA 2Q44A 4XNHB 2VQYA
chains in the Genus database with same CATH superfamily
3B7IA 1P0HA 2AE6A 1S7LA 2VI7A 1TF8A 1TIQA 2OZHA 2PVVA 3EC4A 5D29A 3PZJA 5FVJA 4AVCA 1KUXA 2K5TA 3GLJA 5JPHA 2JDCA 4UWJA 4Y49C 2Z0ZA 1PUAA 2ZEHA 3D2MA 1GHEA 2PRQA 4MHDA 1ZLIA 4KOWA 5J8CA 2PIYA 1YQEA 1MK4A 4MXUA 5G22A 5GCNA 3PB7X 3PFOA 4MBUA 3PB6X 4RI1A 4RS2A 1QSRA 3PB8X 5E96A 3SJFA 2Q4YA 4YWYA 1AMPA 4A37A 2R7HA 4CPAA 4CAVA 2QIRA 2A4NA 2ABZA 3JVNA 3LD2A 4NGTA 4CS0B 4QBJA 3WC7A 2ZW7A 2V8DA 1UWYA 4QUSA 4R8FA 4ZI6A 3HUVA 5A27A 5F09A 4OC2A 3RZAA 2QYVA 1OZPA 1CJWA 4HNXB 4XPDC 2J9AA 1NMTA 5F48A 1U6MA 4UIAA 1ELMP 1IOFA 4U9ZA 4PSWA 2IJZA 2X7BA 3ISZA 3GUXA 5I4MA 4NGNA 2JBKA 4MFKA 5THWA 2VZZA 3D3SA 2ZEPA 5ISVA 2PJ7A 2YNDA 3LMSA 2B3VA 4F6AA 1ZG9A 4UCMA 2B5GB 3FEDA 2GANA 4E0AA 2BSWA 3P2HA 4P4DA 4JYWA 3I9SA 3SXNA 2G3AA 2EWBA 3FEEA 5EBVA 4MCRA 2RB7A 1ZLHA 4OAEA 4A2ZA 4AG7A 4BINA 4YFJA 4DNCA 3GYAA 1TF9A 3DNSA 4KVXA 2ZOGA 2I79A 3PP9A 4I49A 2YNEA 3DGVA 3B8GA 3D8PA 4R6TA 1IB1E 3R9EA 2POKA 3D67A 4OIDA 2FE7A 1CP7A 1I21A 4GXHA 5J8FA 2GLJA 3EY5A 4H89A 4NFRA 4B5PB 5KTAA 3K2KA 2ARHA 3D7DA 4ONUA 3V8IA 1N71A 3B3CA 2Z3MA 2ZPAA 4UFVA 1DE4C 2Q51A 2CIJA 2HUZA 5C88A 3MN8A 2FIAA 3BXMA 4R57A 1Z8TA 1ZO0A 3D66A 4KVOE 3TO9A 1HDUA 2JEWA 3SI1A 1KUVA 2ZEMA 4AVAA 1PCAA 3MRUA 2PJ9A 3EXNA 1YVKA 2P6GA 2IL4A 4QB9A 5JH9A 3IO1A 1BOBA 4MHNA 4UEZA 4WWVA 4ZBGA 5K8MA 2J8RA 3JTKA 1XBUA 4P4EA 2Q04A 3S9LA 2FSRA 3TTHA 1TKHA 4R3LA 1S3ZA 1M4DA 1AYEA 1ELLP 2C1CA 1Z2LA 5J1QA 3KI9A 3TO7A 4MFLA 5HVGA 4MY3A 2IMOA 4XNHC 4XPLA 4UF4A 3CPXA 4KUBA 1VHEA 2B4DA 1CPXA 1Y9KA 1CX8A 1YW4A 3P2FA 4KOTA 4CAWA 4KLWA 1DTDA 4NGRA 3IIBA 3ZJ0A 3KGQA 7CPAA 2VZYA 2FIWA 4H6UA 3FJUA 3PBBA 4X3RA 4CYPA 3K9UA 2F7VA 4MFJA 4ORFA 1IY7A 3B3TA 4F9VA 1M4IA 4P45A 3NE8A 3R95A 3T9YA 4A33A 5JGFA 3FXTA 1MJAA 4CRZB 4II9A 3NH8A 2PIZA 2VL1A 3FX6A 4TWEA 2I3CA 5G1ZA 2WPWA 4GM5A 4F0YA 3T8WA 4LQ6A 3CPAA 4C7HA 1XFOA 3SJEA 4AB7A 1RO5A 3LACA 4KOYA 5LYDA 2AJ6A 4C2ZA 4E8OA 4PPZA 1Y0YA 3TOAA 4MY0A 3SJGA 2PE3A 3IWWA 4L8AA 4CGNA 2JBJA 3CXQA 4ZYQA 2FCKA 3L2NA 4UWIA 2R8VA 2EO8A 1IYKA 4A30A 1Z8LA 3IC1A 1YSJA 3H4QA 3IU2A 4LX9A 4LQGA 5F46A 1YX0A 4R87A 4B10A 1B6BA 3KR5A 4KSIA 2FXFA 4FD7A 4FUUA 4P4BA 1NSLA 3S6GA 2CNSA 2J8NA 4HKFA 4MFQA 4X8IA 3VATA 1A2ZA 4UIBA 2EBJA 3D4UA 3IWGA 5ELYA 2YNCA 2G3TA 2PR8A 4NGSA 1CM0A 2CF4A 2QMLA 3SJXA 3DR6A 1Z4RA 3QAYA 2J8MA 3WT4A 4B5OA 4B6ZA 4BD9A 3LODA 1IICA 3PFEA 4KOSA 3R9FA 4KZTA 2HB6A 1H8LA 4PXBA 3E0KA 4P4FA 4OKOA 4P6YA 1QSNA 4F9UA 1LAMA 3VH9A 2XEIA 2Q7BA 1TKFA 4UEFA 2P6EA 4B11A 3NE7A 2B4BA 3IJ3A 4HNWB 2B4DB 2PJ3A 4M6IA 3N5FA 1BPMA 2PJ0A 4FD4A 3W6SA 2ZEOA 4KS9A 1M1DA 2JDDA 1CBXA 4NF1A 1YMEA 2CY2A 1NSAA 1ARMA 3FMCA 4CYOA 2FVGA 2PJ1A 2FS5A 1CP6A 4CAFA 3KHZA 4BBHA 5IB9A 2PSWA 4KSAA 4OIWA 4PK2A 1YGHA 3NH4A 4FAIA 4ZX8A 1TKJA 5HMNA 3MGDA 4UFWA 4IHMA 5DS0A 1MJ9A 5LYLA 1QQ9A 5K8NA 1S7KA 1Z4EA 2RC4A 4K3NA 3TO6A 1IYLA 4UBRA 1PU9A 5I0CA 4H6ZA 4KUAA 4Y49B 5F49A 2HC9A 3LWUA 1KUYA 1RXTA 3A9LA 4DUKA 4TNUA 4KOVA 4CAEA 5KTDA 1FY7A 4M85A 5AG6A 1Q2YA 1R57A 4IUSA 4P44A 1JQGA 1VHOA 3IWEA 1QSMA 5LYIA 2O28A 2P6FA 4ZGYB 1B87A 4AVBA 3IFEA 1QSTA 4PV6A 4M6HA 5G20A 5G21A 5HH1A 2WSAA 3PB9X 2ZW4A 4IAVA 4CRYB 2PJ5A 5BWAB 4A95A 1YLEA 1VGYA 1YW6A 3W91A 4BMHA 4M6GA 1CPSA 4P4JA 4FD6A 4MMOA 2ZW5A 4EVYA 3UY5A 3SXOA 2AFSA 2ATRA 1IGBA 3JUWA 1XF8A 3S6FA 4UA3A 5JQ4A 4R76A 4JZ0A 3D7FA 1NE9A 1F2OA 5H86A 4G1PA 5K8PA 3EFAA 2H5MA 2VBQA 3VARA 1XOVA 3PEIA 1LRZA 4OC4A 3R96A 3WR7A 1Z5RA 4OC3A 1HEEA 2F8HA 1XJOA 2BCOA 2O53A 3BI0A 4NGPA 4UFXA 2F5IA 1XEBA 2DEAA 4W9YA 2QJ8A 3KKWA 4UCPA 3F5BA 4Q36A 2REFA 1LFWA 3S9MA 1S5KA 4XPDB 2EVNA 4OADA 2ZENA 2OOTA 2Z3LA 3V7ZA 5HXDA 3DDDA 3BI1A 2O4HA 1J4JA 2PC1A 4PXDA 1CG2A 3T90A 5K8OA 1RTQA 4C2XA 2ODFA 3BLNA 5DWNA 5LRJA 2PRBA 1XRYA 4HPSA 2B5GA 4PSXA 3RAMA 2DXQA 2PDOA 5C82A 3IEHA 1QSOA 2PJ8A 2CNMA 3KASA 4HNYB 4MHYA 3F8KA 4EWTA 4MJ8A 1PYTB 3EO4A 2NYQA 4FWUA 4MRIA 3S9NA 1YREA 4KLVA 3WABA 4LUAA 1Y9WA 2FL4A 4R7MA 3S6HA 4CGLA 4MFZA 2DF5A 2ZOFA 4B5PA 1KZFA 2ANPA 4C7IA 3GB0A 5HVHA 3KL9A 4O23A 1S7FA 2DPSA 3FECA 4PK3A 2GU2A 3DR8A 3BJ7A 3WC6A 1VHSA 3NH5A 1BAVA 2Q7SA 3IU1A 4MCSA 2BOAA 1X12A 3I1UA 4PXEA 5DWMA 1P4NA 4KSFA 2EUIA 3CDXA 3DSBA 3KHXA 4OC0A 2PCUA 2G9DA 2ZEFA 2OZGA 2YNCC 2Z11A 4KORA 2BO9A 4CGMA 4R9MA 3RBUA 2GLFA 1Z9UA 2BUEA 2NMTA 3HLPA 4CGPA 3K9TA 4OLLA 1ZG8A 1LCPA 4L89A 2ZEEA 2GE3A 2PR1A 3KQXA 2CTCA 1I12A 2ZXVA 3KZWA 1FNOA 3FYNA 4AXVA 4OC1A 4F0XA 1ON0A 1GYTA 2Q43A 2KCWA 4JWPA 4OP4A 2REEA 3RNZA 4MFPA 1M44A 2HV2A 4UCNA 1SQHA 2ZEDA 4RN7A 5EMIA 2XEFA 5EC4A 4A38A 2PQ8A 1F2PA 1Q2CA 2OZUA 2PJ6A 2R98A 3G8WA 3PB4X 3CZXA 4KVME 2PJAA 5LYFA 5KTCA 5AGEA 4M3SA 3H8GA 1R43A 1Q2DA 2CXAA 4EMEA 3D68A 2CTBA 2BEIA 3SHPA 1LAPA 3BJ8A 1R3NA 5D8NA 1Y7EA 3FF3A 3PBEA 4K30A 4Q38A 2GFQA 1Y0RA 2RFHA 2OB0A 4H2KA 1ZG7A 3TOBA 2Z3OA 3NFZA 4U9YA 5HVFA 1F57A 1XIXA 2C6GA 3D2PA 4B12A 1BPNA 4ZY0A 5A28A 2JEVA 4JJXA 1LANA 4JXRA 5AG7A 4A32A 4QC6A 3TE4A 5CBMA 1HDQA 3BHXA 2V8HA 3WC5A 4GS4A 4MHPA 5CPAA 4CGOA 2V77A 4EFDA 3JRUA 2AFUA 3N7ZA 4NJRA 3ZZIA 3FH4A 1S7NA 3PRTA 3QB8A 1S60A 2D4PA 1WK4A 3FRMA 4YU9A 4F8ZA 4J3GA 3C26A 2OR4A 2PVWA 3H8EA 3I3GA 1OBRA 3B3WA 1AUGA 3IGRA 1MJBA 2AFWA 2FT0A 4U5YA 5IV0A 3V38A 4FD5A 3D7HA 2JLMA 4JD6A 3H8FA 3FBUA 4UEEA 1Z8WA 4JXQA 2Z3PA 4MHZA 1IIDA 2V8VA 2Z10A 3FVLA 3S6KA 1I1DA 2GIVA 5CNPA 4NGMA 1TXRA 4ZY2A 1QMUA 2XEGA 3TT2A 1IOIA 2VXKA 3GIUA 3KR4A 2B3UA 3B3SA 4OC5A 5H84A 3VWEA 3G3SA 1Z8XA 3QNVA 2AFZA 4WJBA 4NEXA 2C27A 2Z3NA 2P0WA 2PJ2A 2GREA 4FBEA 3H5ZA 1BLLE 3TCVA 3B3VA 5JM6A 1FT7A 2Q4VA 1UFHA 3RYOA 4DYOA 2V8GA 4NJQA 2OH1A 1Q7LA 2B58A 3VWDA 1YK3A 6CPAA 2Q0YA 2AFOA 4PQAA 1L0CA 2DPTA 2YGWA 2ZW6A 2Y0MA 2NSMA 3OWCA 4ZY1A 3R9GA 4CAXA 2XEJA 2I00A 2PJBA 4YRHA 1LOKA 4KOXA 4NCZA 3GY9A 2IQ6A 4DJLA 2C6CA 4P10A 2BL1A 2Z3KA 3CXSA 1VKCA 4C68A 4Z65A 4NXYA 2ZEGA 4ONWA 4E2AA 2PJ4A 2HQYA 4XPKA 2G0BA 1M4LA 1YR0A 2AFMA 5AG5A 4YGOA 3NA6A 4ZX9A 4B13A 3DLJA 3TX8A 1WWZA 5LRGA 4A39A 4MCPA 1M4GA 2EK8A 2Q4ZA 4RUHA 2VEZA 2WUUA 3CXPA 4MCQA 4NSQA 1BO4A 1EE3P 4NGQA 2CNTA 4JLYA 4Q7AA 5IB0A 3PGPA 1K4JA 4MI4A 5AG4A 3SI0A 3CT9A 4KOUA 4IF5A 3RO0A 1ARLA 3W6XA 4A94A 3FIXA 3R1KA 2WYRA 5LRKA 1XE4A 1X10A 2AFXA 1V0CA 3B2YA 4X5KA 2WPXA 2ZELA 4B14A 2QVPA 5F47A 3B35A 4C2YA 1YVOA 3FNCA 4QVTA 8CPAA 4OMEA 3D7GA 4PXCA 3TC8A 2C6PA 1KWMA 3ISXA 2WZNA 4P4IA 3GKRA 3KQZA 1JWQA 2D4OA 2QECA 4R3KA 5IX3A 3TFYA 2EK9A 1XMTA 3QAHA 1IU8A 4A31A 3FB3A 4AG9A 1XMBA 3F0AA 4CYNA 2R1IA 4IK2A 2OU2A 4X2TA 4CYQA 1VIXA 1Y7RA 2PJCA 2Q44A 1YLOA 4XNHB 3SI2A 2VQYA
chains in the Genus database with same CATH topology
1P0HA 2AE6A 1S7LA 2VI7A 1TIQA 2OZHA 3EC4A 3PZJA 5FVJA 4AVCA 1KUXA 2K5TA 5JPHA 2JDCA 4UWJA 4Y49C 2Z0ZA 1PUAA 3D2MA 1GHEA 4MHDA 4KOWA 5J8CA 1MK4A 5G22A 5GCNA 4MBUA 4RI1A 4RS2A 1QSRA 5E96A 2Q4YA 2R7HA 4CAVA 2QIRA 2A4NA 3JVNA 3LD2A 4CS0B 4QBJA 2ZW7A 4QUSA 5A27A 1OZPA 1CJWA 4HNXB 5F48A 1NMTA 1U6MA 4U9ZA 4PSWA 2X7BA 4MFKA 2VZZA 3D3SA 5ISVA 2YNDA 2B3VA 4F6AA 4UCMA 2B5GB 2GANA 4E0AA 2BSWA 3P2HA 3I9SA 3SXNA 2G3AA 5EBVA 4AG7A 4A2ZA 4OAEA 4YFJA 4DNCA 3GYAA 3DNSA 4KVXA 4I49A 2I79A 3PP9A 2YNEA 3B8GA 3D8PA 3R9EA 1IB1E 2FE7A 5J8FA 1I21A 3EY5A 4H89A 4B5PB 5KTAA 2ARHA 4ONUA 3V8IA 1N71A 2Z3MA 2ZPAA 4UFVA 2HUZA 5C88A 2FIAA 4R57A 1ZO0A 4KVOE 3TO9A 1KUVA 4AVAA 3EXNA 1YVKA 2P6GA 2IL4A 4QB9A 1BOBA 4ZBGA 2J8RA 3JTKA 2Q04A 2FSRA 3TTHA 4R3LA 1S3ZA 1M4DA 3TO7A 4MFLA 4MY3A 4XNHC 4XPLA 4KUBA 4ORFA 2B4DA 4KOTA 1Y9KA 3P2FA 4CAWA 4KLWA 3ZJ0A 2VZYA 2FIWA 4H6UA 4CYPA 3K9UA 4MFJA 1M4IA 3R95A 3T9YA 4A33A 3FXTA 1MJAA 4CRZB 4II9A 5G1ZA 2WPWA 4F0YA 4C7HA 4AB7A 1RO5A 4KOYA 4C2ZA 4E8OA 2AJ6A 3TOAA 4MY0A 4L8AA 4CGNA 3CXQA 2FCKA 4UWIA 2R8VA 1IYKA 3H4QA 3IU2A 4LX9A 5F46A 1YX0A 4R87A 4B10A 1B6BA 1NSLA 2FXFA 4FD7A 4A30A 3S6GA 2CNSA 2J8NA 4HKFA 4MFQA 3IWGA 2YNCA 2G3TA 2PR8A 1CM0A 2QMLA 3DR6A 1Z4RA 2J8MA 4B5OA 3LODA 1IICA 4KOSA 3R9FA 4KZTA 3E0KA 1QSNA 2Q7BA 2P6EA 4B11A 3NE7A 2B4BA 4HNWB 2B4DB 4FD4A 3W6SA 4KS9A 1M1DA 2JDDA 4NF1A 2CY2A 4CYOA 4CAFA 2FS5A 4BBHA 2PSWA 4KSAA 4PK2A 1YGHA 5HMNA 3MGDA 4UFWA 1MJ9A 1S7KA 1Z4EA 2RC4A 3TO6A 1IYLA 4UBRA 1PU9A 5I0CA 4H6ZA 4KUAA 4Y49B 5F49A 1KUYA 1RXTA 3A9LA 4CAEA 4KOVA 5KTDA 1FY7A 4M85A 5AG6A 1Q2YA 1R57A 4IUSA 3IWEA 1QSMA 2O28A 2P6FA 4ZGYB 1B87A 4AVBA 1QSTA 4PV6A 5G20A 5G21A 5HH1A 2WSAA 2ZW4A 4CRYB 5BWAB 4A95A 1YLEA 3W91A 4BMHA 4FD6A 2ZW5A 4EVYA 3UY5A 3SXOA 2ATRA 3JUWA 1XF8A 3S6FA 4UA3A 5JQ4A 1NE9A 5H86A 3EFAA 2H5MA 2VBQA 1LRZA 3R96A 3WR7A 5A28A 4XPDC 4UFXA 2F5IA 1XEBA 3KKWA 4UCPA 3F5BA 4Q36A 2REFA 1S5KA 4XPDB 2EVNA 4OADA 2Z3LA 3DDDA 2PC1A 1J4JA 3T90A 4C2XA 3BLNA 5DWNA 2PRBA 2B5GA 4PSXA 2DXQA 2PDOA 5C82A 1QSOA 2CNMA 4HNYB 3F8KA 4MJ8A 3EO4A 1YREA 4KLVA 4LUAA 1Y9WA 2FL4A 3S6HA 4CGLA 4MFZA 4B5PA 1KZFA 4C7IA 1S7FA 2DPSA 4PK3A 3DR8A 3BJ7A 1VHSA 3IU1A 5DWMA 1P4NA 4KSFA 2EUIA 3DSBA 2OZGA 2YNCC 2Z11A 4KORA 4CGMA 1Z9UA 2BUEA 2NMTA 4CGPA 4OLLA 4L89A 2GE3A 2PR1A 1I12A 2ZXVA 3FYNA 4F0XA 1ON0A 2KCWA 4JWPA 2REEA 4MFPA 1M44A 2HV2A 4UCNA 1SQHA 5EC4A 1Q2CA 2OZUA 2PQ8A 2R98A 4R9MA 3G8WA 4KVME 5KTCA 5AGEA 4M3SA 1Q2DA 2CXAA 2BEIA 3SHPA 3BJ8A 4K30A 4Q38A 2OB0A 3TOBA 2Z3OA 4U9YA 3D2PA 1XIXA 4B12A 2JEVA 4JJXA 4JXRA 5AG7A 4A32A 4QC6A 3TE4A 4CGOA 4GS4A 3N7ZA 3ZZIA 1S7NA 3QB8A 1S60A 2D4PA 1WK4A 3FRMA 4J3GA 3C26A 3I3GA 3IGRA 5IV0A 1MJBA 2FT0A 4U5YA 4FD5A 2JLMA 4JD6A 3FBUA 4JXQA 2Z3PA 1IIDA 2Z10A 3S6KA 1I1DA 2GIVA 5CNPA 3TT2A 2VXKA 2B3UA 3VWEA 5H84A 3G3SA 4NEXA 2C27A 2Z3NA 2P0WA 3H5ZA 3TCVA 2Q4VA 3RYOA 1UFHA 2OH1A 2B58A 3VWDA 1YK3A 2Q0YA 1L0CA 2DPTA 2YGWA 2ZW6A 2Y0MA 3OWCA 3R9GA 4CAXA 2I00A 4YRHA 4KOXA 4NCZA 3GY9A 2BL1A 2Z3KA 3CXSA 1VKCA 4C68A 4NXYA 4E2AA 2HQYA 4XPKA 2G0BA 5AG5A 1YR0A 4YGOA 4B13A 1WWZA 1M4GA 2VEZA 2WUUA 3CXPA 4NSQA 1BO4A 2CNTA 4JLYA 5IB0A 3PGPA 1K4JA 4MI4A 5AG4A 4KOUA 4IF5A 3W6XA 3FIXA 3R1KA 1XE4A 1V0CA 4X5KA 2WPXA 4B14A 5F47A 4C2YA 1YVOA 3FNCA 4QVTA 3GKRA 2D4OA 2QECA 4R3KA 5IX3A 3TFYA 1XMTA 3QAHA 4A31A 3FB3A 4AG9A 3F0AA 4CYNA 2R1IA 2OU2A 4CYQA 1Y7RA 2Q44A 4XNHB 2VQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P0H A;  2AE6 A;  1S7L A;  2VI7 A;  1TIQ A;  2OZH A;  3EC4 A;  3PZJ A;  5FVJ A;  4AVC A;  1KUX A;  2K5T A;  5JPH A;  2JDC A;  4UWJ A;  4Y49 C;  2Z0Z A;  1PUA A;  3D2M A;  1GHE A;  4MHD A;  4KOW A;  5J8C A;  1MK4 A;  5GCN A;  4MBU A;  4RI1 A;  4RS2 A;  1QSR A;  5E96 A;  2Q4Y A;  2R7H A;  4CAV A;  2QIR A;  2A4N A;  3JVN A;  3LD2 A;  4CS0 B;  4QBJ A;  2ZW7 A;  4QUS A;  1OZP A;  1CJW A;  4HNX B;  5F48 A;  1NMT A;  1U6M A;  4U9Z A;  4PSW A;  2X7B A;  2VZZ A;  3D3S A;  5ISV A;  2B3V A;  4F6A A;  2B5G B;  2GAN A;  4E0A A;  2BSW A;  3P2H A;  3I9S A;  3SXN A;  2G3A A;  5EBV A;  4AG7 A;  4OAE A;  4YFJ A;  4DNC A;  3GYA A;  3DNS A;  4KVX A;  4I49 A;  2I79 A;  3PP9 A;  3B8G A;  3D8P A;  3R9E A;  1IB1 E;  2FE7 A;  5J8F A;  1I21 A;  3EY5 A;  4H89 A;  4B5P B;  5KTA A;  2ARH A;  4ONU A;  3V8I A;  1N71 A;  2ZPA A;  2HUZ A;  5C88 A;  2FIA A;  4R57 A;  4KVO E;  3TO9 A;  1KUV A;  4AVA A;  3EXN A;  1YVK A;  2P6G A;  2IL4 A;  4QB9 A;  1BOB A;  4ZBG A;  2J8R A;  2Q04 A;  2FSR A;  3TTH A;  4R3L A;  1S3Z A;  1M4D A;  3TO7 A;  4MY3 A;  4XNH C;  4XPL A;  4KUB A;  4ORF A;  2B4D A;  4KOT A;  1Y9K A;  3P2F A;  4CAW A;  4KLW A;  3ZJ0 A;  2VZY A;  2FIW A;  4H6U A;  3K9U A;  1M4I A;  3R95 A;  3T9Y A;  3FXT A;  1MJA A;  4CRZ B;  4II9 A;  2WPW A;  4F0Y A;  4AB7 A;  1RO5 A;  4KOY A;  4E8O A;  2AJ6 A;  3TOA A;  4MY0 A;  4L8A A;  3CXQ A;  2FCK A;  4UWI A;  2R8V A;  1IYK A;  3H4Q A;  4LX9 A;  5F46 A;  1YX0 A;  4R87 A;  1B6B A;  1NSL A;  2FXF A;  4FD7 A;  3S6G A;  2CNS A;  2J8N A;  4HKF A;  3IWG A;  2G3T A;  2PR8 A;  1CM0 A;  2QML A;  3DR6 A;  1Z4R A;  2J8M A;  4B5O A;  3LOD A;  1IIC A;  4KOS A;  3R9F A;  4KZT A;  3E0K A;  1QSN A;  2Q7B A;  2P6E A;  3NE7 A;  2B4B A;  4HNW B;  2B4D B;  4FD4 A;  3W6S A;  1M1D A;  2JDD A;  4NF1 A;  2CY2 A;  2FS5 A;  2PSW A;  4PK2 A;  1YGH A;  5HMN A;  3MGD A;  1MJ9 A;  1S7K A;  1Z4E A;  2RC4 A;  3TO6 A;  1IYL A;  4UBR A;  1PU9 A;  5I0C A;  4H6Z A;  4KUA A;  4Y49 B;  5F49 A;  1KUY A;  1RXT A;  4KOV A;  5KTD A;  1FY7 A;  4M85 A;  1Q2Y A;  1R57 A;  4IUS A;  1QSM A;  2O28 A;  2P6F A;  1B87 A;  4AVB A;  1QST A;  4PV6 A;  5HH1 A;  2ZW4 A;  4CRY B;  1YLE A;  3W91 A;  4BMH A;  4FD6 A;  2ZW5 A;  4EVY A;  3UY5 A;  3SXO A;  2ATR A;  3JUW A;  1XF8 A;  3S6F A;  4UA3 A;  5JQ4 A;  1NE9 A;  5H86 A;  3EFA A;  2H5M A;  2VBQ A;  1LRZ A;  3R96 A;  3WR7 A;  4XPD C;  2F5I A;  1XEB A;  3KKW A;  3F5B A;  2REF A;  1S5K A;  4XPD B;  2EVN A;  4OAD A;  3DDD A;  2PC1 A;  1J4J A;  3T90 A;  3BLN A;  5DWN A;  2PRB A;  2B5G A;  4PSX A;  2DXQ A;  2PDO A;  5C82 A;  1QSO A;  2CNM A;  4HNY B;  3F8K A;  4MJ8 A;  3EO4 A;  1YRE A;  4KLV A;  4LUA A;  1Y9W A;  2FL4 A;  3S6H A;  4B5P A;  1KZF A;  1S7F A;  4PK3 A;  3DR8 A;  3BJ7 A;  1VHS A;  5DWM A;  1P4N A;  2EUI A;  3DSB A;  2OZG A;  2Z11 A;  4KOR A;  1Z9U A;  2BUE A;  2NMT A;  4OLL A;  4L89 A;  2GE3 A;  2PR1 A;  1I12 A;  2ZXV A;  3FYN A;  1ON0 A;  2KCW A;  4JWP A;  2REE A;  1M44 A;  2HV2 A;  1SQH A;  5EC4 A;  4R9M A;  1Q2C A;  2OZU A;  2PQ8 A;  2R98 A;  3G8W A;  4KVM E;  5KTC A;  4M3S A;  1Q2D A;  2BEI A;  3SHP A;  3BJ8 A;  4K30 A;  2OB0 A;  3TOB A;  4U9Y A;  3D2P A;  1XIX A;  2JEV A;  4JJX A;  4JXR A;  4QC6 A;  3TE4 A;  4GS4 A;  3N7Z A;  3ZZI A;  1S7N A;  3QB8 A;  1S60 A;  2D4P A;  1WK4 A;  3FRM A;  4J3G A;  3C26 A;  3I3G A;  3IGR A;  5IV0 A;  1MJB A;  2FT0 A;  4U5Y A;  4FD5 A;  2JLM A;  4JD6 A;  3FBU A;  4JXQ A;  1IID A;  2Z10 A;  3S6K A;  1I1D A;  2GIV A;  5CNP A;  3TT2 A;  2VXK A;  2B3U A;  3VWE A;  5H84 A;  3G3S A;  4NEX A;  2C27 A;  2P0W A;  3TCV A;  2Q4V A;  3RYO A;  1UFH A;  2OH1 A;  2B58 A;  3VWD A;  1YK3 A;  2Q0Y A;  1L0C A;  2ZW6 A;  3OWC A;  2Y0M A;  3R9G A;  4CAX A;  2I00 A;  4YRH A;  4KOX A;  4NCZ A;  3GY9 A;  2BL1 A;  3CXS A;  1VKC A;  4NXY A;  4E2A A;  2HQY A;  4XPK A;  2G0B A;  4YGO A;  1YR0 A;  1WWZ A;  1M4G A;  2VEZ A;  3CXP A;  4NSQ A;  1BO4 A;  2CNT A;  4JLY A;  5IB0 A;  4MI4 A;  1K4J A;  3PGP A;  4KOU A;  4IF5 A;  3W6X A;  3FIX A;  3R1K A;  1XE4 A;  1V0C A;  4X5K A;  2WPX A;  5F47 A;  1YVO A;  3FNC A;  4QVT A;  3GKR A;  2D4O A;  2QEC A;  4R3K A;  5IX3 A;  3TFY A;  1XMT A;  3QAH A;  4AG9 A;  3FB3 A;  3F0A A;  2R1I A;  2OU2 A;  1Y7R A;  2Q44 A;  4XNH B;  2VQY A; 
#chains in the Genus database with same CATH topology
 3B7I A;  1P0H A;  2AE6 A;  1S7L A;  2VI7 A;  1TF8 A;  1TIQ A;  2OZH A;  2PVV A;  3EC4 A;  5D29 A;  3PZJ A;  5FVJ A;  4AVC A;  1KUX A;  2K5T A;  3GLJ A;  5JPH A;  2JDC A;  4UWJ A;  4Y49 C;  2Z0Z A;  1PUA A;  2ZEH A;  3D2M A;  1GHE A;  2PRQ A;  4MHD A;  1ZLI A;  4KOW A;  5J8C A;  2PIY A;  1YQE A;  1MK4 A;  4MXU A;  5G22 A;  5GCN A;  3PB7 X;  3PFO A;  4MBU A;  3PB6 X;  4RI1 A;  4RS2 A;  1QSR A;  3PB8 X;  5E96 A;  3SJF A;  2Q4Y A;  4YWY A;  1AMP A;  4A37 A;  2R7H A;  4CPA A;  4CAV A;  2QIR A;  2A4N A;  2ABZ A;  3JVN A;  3LD2 A;  4NGT A;  4CS0 B;  4QBJ A;  3WC7 A;  2ZW7 A;  2V8D A;  1UWY A;  4QUS A;  4R8F A;  4ZI6 A;  3HUV A;  5A27 A;  5F09 A;  4OC2 A;  3RZA A;  2QYV A;  1OZP A;  1CJW A;  4HNX B;  4XPD C;  2J9A A;  1NMT A;  5F48 A;  1U6M A;  4UIA A;  1ELM P;  1IOF A;  4U9Z A;  4PSW A;  2IJZ A;  2X7B A;  3ISZ A;  3GUX A;  5I4M A;  4NGN A;  2JBK A;  4MFK A;  5THW A;  2VZZ A;  3D3S A;  2ZEP A;  5ISV A;  2PJ7 A;  2YND A;  3LMS A;  2B3V A;  4F6A A;  1ZG9 A;  4UCM A;  2B5G B;  3FED A;  2GAN A;  4E0A A;  2BSW A;  3P2H A;  4P4D A;  4JYW A;  3I9S A;  3SXN A;  2G3A A;  2EWB A;  3FEE A;  5EBV A;  4MCR A;  2RB7 A;  1ZLH A;  4OAE A;  4A2Z A;  4AG7 A;  4BIN A;  4YFJ A;  4DNC A;  3GYA A;  1TF9 A;  3DNS A;  4KVX A;  2ZOG A;  2I79 A;  3PP9 A;  4I49 A;  2YNE A;  3DGV A;  3B8G A;  3D8P A;  4R6T A;  1IB1 E;  3R9E A;  2POK A;  3D67 A;  4OID A;  2FE7 A;  1CP7 A;  1I21 A;  4GXH A;  5J8F A;  2GLJ A;  3EY5 A;  4H89 A;  4NFR A;  4B5P B;  5KTA A;  3K2K A;  2ARH A;  3D7D A;  4ONU A;  3V8I A;  1N71 A;  3B3C A;  2Z3M A;  2ZPA A;  4UFV A;  1DE4 C;  2Q51 A;  2CIJ A;  2HUZ A;  5C88 A;  3MN8 A;  2FIA A;  3BXM A;  4R57 A;  1Z8T A;  1ZO0 A;  3D66 A;  4KVO E;  3TO9 A;  1HDU A;  2JEW A;  3SI1 A;  1KUV A;  2ZEM A;  4AVA A;  1PCA A;  3MRU A;  2PJ9 A;  3EXN A;  1YVK A;  2P6G A;  2IL4 A;  4QB9 A;  5JH9 A;  3IO1 A;  1BOB A;  4MHN A;  4UEZ A;  4WWV A;  4ZBG A;  5K8M A;  2J8R A;  3JTK A;  1XBU A;  4P4E A;  2Q04 A;  3S9L A;  2FSR A;  3TTH A;  1TKH A;  4R3L A;  1S3Z A;  1M4D A;  1AYE A;  1ELL P;  2C1C A;  1Z2L A;  5J1Q A;  3KI9 A;  3TO7 A;  4MFL A;  5HVG A;  4MY3 A;  2IMO A;  4XNH C;  4XPL A;  4UF4 A;  3CPX A;  4KUB A;  1VHE A;  2B4D A;  1CPX A;  1Y9K A;  1CX8 A;  1YW4 A;  3P2F A;  4KOT A;  4CAW A;  4KLW A;  1DTD A;  4NGR A;  3IIB A;  3ZJ0 A;  3KGQ A;  7CPA A;  2VZY A;  2FIW A;  4H6U A;  3FJU A;  3PBB A;  4X3R A;  4CYP A;  3K9U A;  2F7V A;  4MFJ A;  4ORF A;  1IY7 A;  3B3T A;  4F9V A;  1M4I A;  4P45 A;  3NE8 A;  3R95 A;  3T9Y A;  4A33 A;  5JGF A;  3FXT A;  1MJA A;  4CRZ B;  4II9 A;  3NH8 A;  2PIZ A;  2VL1 A;  3FX6 A;  4TWE A;  2I3C A;  5G1Z A;  2WPW A;  4GM5 A;  4F0Y A;  3T8W A;  4LQ6 A;  3CPA A;  4C7H A;  1XFO A;  3SJE A;  4AB7 A;  1RO5 A;  3LAC A;  4KOY A;  5LYD A;  2AJ6 A;  4C2Z A;  4E8O A;  4PPZ A;  1Y0Y A;  3TOA A;  4MY0 A;  3SJG A;  2PE3 A;  3IWW A;  4L8A A;  4CGN A;  2JBJ A;  3CXQ A;  4ZYQ A;  2FCK A;  3L2N A;  4UWI A;  2R8V A;  2EO8 A;  1IYK A;  4A30 A;  1Z8L A;  3IC1 A;  1YSJ A;  3H4Q A;  3IU2 A;  4LX9 A;  4LQG A;  5F46 A;  1YX0 A;  4R87 A;  4B10 A;  1B6B A;  3KR5 A;  4KSI A;  2FXF A;  4FD7 A;  4FUU A;  4P4B A;  1NSL A;  3S6G A;  2CNS A;  2J8N A;  4HKF A;  4MFQ A;  4X8I A;  3VAT A;  1A2Z A;  4UIB A;  2EBJ A;  3D4U A;  3IWG A;  5ELY A;  2YNC A;  2G3T A;  2PR8 A;  4NGS A;  1CM0 A;  2CF4 A;  2QML A;  3SJX A;  3DR6 A;  1Z4R A;  3QAY A;  2J8M A;  3WT4 A;  4B5O A;  4B6Z A;  4BD9 A;  3LOD A;  1IIC A;  3PFE A;  4KOS A;  3R9F A;  4KZT A;  2HB6 A;  1H8L A;  4PXB A;  3E0K A;  4P4F A;  4OKO A;  4P6Y A;  1QSN A;  4F9U A;  1LAM A;  3VH9 A;  2XEI A;  2Q7B A;  1TKF A;  4UEF A;  2P6E A;  4B11 A;  3NE7 A;  2B4B A;  3IJ3 A;  4HNW B;  2B4D B;  2PJ3 A;  4M6I A;  3N5F A;  1BPM A;  2PJ0 A;  4FD4 A;  3W6S A;  2ZEO A;  4KS9 A;  1M1D A;  2JDD A;  1CBX A;  4NF1 A;  1YME A;  2CY2 A;  1NSA A;  1ARM A;  3FMC A;  4CYO A;  2FVG A;  2PJ1 A;  2FS5 A;  1CP6 A;  4CAF A;  3KHZ A;  4BBH A;  5IB9 A;  2PSW A;  4KSA A;  4OIW A;  4PK2 A;  1YGH A;  3NH4 A;  4FAI A;  4ZX8 A;  1TKJ A;  5HMN A;  3MGD A;  4UFW A;  4IHM A;  5DS0 A;  1MJ9 A;  5LYL A;  1QQ9 A;  5K8N A;  1S7K A;  1Z4E A;  2RC4 A;  4K3N A;  3TO6 A;  1IYL A;  4UBR A;  1PU9 A;  5I0C A;  4H6Z A;  4KUA A;  4Y49 B;  5F49 A;  2HC9 A;  3LWU A;  1KUY A;  1RXT A;  3A9L A;  4DUK A;  4TNU A;  4KOV A;  4CAE A;  5KTD A;  1FY7 A;  4M85 A;  5AG6 A;  1Q2Y A;  1R57 A;  4IUS A;  4P44 A;  1JQG A;  1VHO A;  3IWE A;  1QSM A;  5LYI A;  2O28 A;  2P6F A;  4ZGY B;  1B87 A;  4AVB A;  3IFE A;  1QST A;  4PV6 A;  4M6H A;  5G20 A;  5G21 A;  5HH1 A;  2WSA A;  3PB9 X;  2ZW4 A;  4IAV A;  4CRY B;  2PJ5 A;  5BWA B;  4A95 A;  1YLE A;  1VGY A;  1YW6 A;  3W91 A;  4BMH A;  4M6G A;  1CPS A;  4P4J A;  4FD6 A;  4MMO A;  2ZW5 A;  4EVY A;  3UY5 A;  3SXO A;  2AFS A;  2ATR A;  1IGB A;  3JUW A;  1XF8 A;  3S6F A;  4UA3 A;  5JQ4 A;  4R76 A;  4JZ0 A;  3D7F A;  1NE9 A;  1F2O A;  5H86 A;  4G1P A;  5K8P A;  3EFA A;  2H5M A;  2VBQ A;  3VAR A;  1XOV A;  3PEI A;  1LRZ A;  4OC4 A;  3R96 A;  3WR7 A;  1Z5R A;  4OC3 A;  1HEE A;  2F8H A;  1XJO A;  2BCO A;  2O53 A;  3BI0 A;  4NGP A;  4UFX A;  2F5I A;  1XEB A;  2DEA A;  4W9Y A;  2QJ8 A;  3KKW A;  4UCP A;  3F5B A;  4Q36 A;  2REF A;  1LFW A;  3S9M A;  1S5K A;  4XPD B;  2EVN A;  4OAD A;  2ZEN A;  2OOT A;  2Z3L A;  3V7Z A;  5HXD A;  3DDD A;  3BI1 A;  2O4H A;  1J4J A;  2PC1 A;  4PXD A;  1CG2 A;  3T90 A;  5K8O A;  1RTQ A;  4C2X A;  2ODF A;  3BLN A;  5DWN A;  5LRJ A;  2PRB A;  1XRY A;  4HPS A;  2B5G A;  4PSX A;  3RAM A;  2DXQ A;  2PDO A;  5C82 A;  3IEH A;  1QSO A;  2PJ8 A;  2CNM A;  3KAS A;  4HNY B;  4MHY A;  3F8K A;  4EWT A;  4MJ8 A;  1PYT B;  3EO4 A;  2NYQ A;  4FWU A;  4MRI A;  3S9N A;  1YRE A;  4KLV A;  3WAB A;  4LUA A;  1Y9W A;  2FL4 A;  4R7M A;  3S6H A;  4CGL A;  4MFZ A;  2DF5 A;  2ZOF A;  4B5P A;  1KZF A;  2ANP A;  4C7I A;  3GB0 A;  5HVH A;  3KL9 A;  4O23 A;  1S7F A;  2DPS A;  3FEC A;  4PK3 A;  2GU2 A;  3DR8 A;  3BJ7 A;  3WC6 A;  1VHS A;  3NH5 A;  1BAV A;  2Q7S A;  3IU1 A;  4MCS A;  2BOA A;  1X12 A;  3I1U A;  4PXE A;  5DWM A;  1P4N A;  4KSF A;  2EUI A;  3CDX A;  3DSB A;  3KHX A;  4OC0 A;  2PCU A;  2G9D A;  2ZEF A;  2OZG A;  2YNC C;  2Z11 A;  4KOR A;  2BO9 A;  4CGM A;  4R9M A;  3RBU A;  2GLF A;  1Z9U A;  2BUE A;  2NMT A;  3HLP A;  4CGP A;  3K9T A;  4OLL A;  1ZG8 A;  1LCP A;  4L89 A;  2ZEE A;  2GE3 A;  2PR1 A;  3KQX A;  2CTC A;  1I12 A;  2ZXV A;  3KZW A;  1FNO A;  3FYN A;  4AXV A;  4OC1 A;  4F0X A;  1ON0 A;  1GYT A;  2Q43 A;  2KCW A;  4JWP A;  4OP4 A;  2REE A;  3RNZ A;  4MFP A;  1M44 A;  2HV2 A;  4UCN A;  1SQH A;  2ZED A;  4RN7 A;  5EMI A;  2XEF A;  5EC4 A;  4A38 A;  2PQ8 A;  1F2P A;  1Q2C A;  2OZU A;  2PJ6 A;  2R98 A;  3G8W A;  3PB4 X;  3CZX A;  4KVM E;  2PJA A;  5LYF A;  5KTC A;  5AGE A;  4M3S A;  3H8G A;  1R43 A;  1Q2D A;  2CXA A;  4EME A;  3D68 A;  2CTB A;  2BEI A;  3SHP A;  1LAP A;  3BJ8 A;  1R3N A;  5D8N A;  1Y7E A;  3FF3 A;  3PBE A;  4K30 A;  4Q38 A;  2GFQ A;  1Y0R A;  2RFH A;  2OB0 A;  4H2K A;  1ZG7 A;  3TOB A;  2Z3O A;  3NFZ A;  4U9Y A;  5HVF A;  1F57 A;  1XIX A;  2C6G A;  3D2P A;  4B12 A;  1BPN A;  4ZY0 A;  5A28 A;  2JEV A;  4JJX A;  1LAN A;  4JXR A;  5AG7 A;  4A32 A;  4QC6 A;  3TE4 A;  5CBM A;  1HDQ A;  3BHX A;  2V8H A;  3WC5 A;  4GS4 A;  4MHP A;  5CPA A;  4CGO A;  2V77 A;  4EFD A;  3JRU A;  2AFU A;  3N7Z A;  4NJR A;  3ZZI A;  3FH4 A;  1S7N A;  3PRT A;  3QB8 A;  1S60 A;  2D4P A;  1WK4 A;  3FRM A;  4YU9 A;  4F8Z A;  4J3G A;  3C26 A;  2OR4 A;  2PVW A;  3H8E A;  3I3G A;  1OBR A;  3B3W A;  1AUG A;  3IGR A;  1MJB A;  2AFW A;  2FT0 A;  4U5Y A;  5IV0 A;  3V38 A;  4FD5 A;  3D7H A;  2JLM A;  4JD6 A;  3H8F A;  3FBU A;  4UEE A;  1Z8W A;  4JXQ A;  2Z3P A;  4MHZ A;  1IID A;  2V8V A;  2Z10 A;  3FVL A;  3S6K A;  1I1D A;  2GIV A;  5CNP A;  4NGM A;  1TXR A;  4ZY2 A;  1QMU A;  2XEG A;  3TT2 A;  1IOI A;  2VXK A;  3GIU A;  3KR4 A;  2B3U A;  3B3S A;  4OC5 A;  5H84 A;  3VWE A;  3G3S A;  1Z8X A;  3QNV A;  2AFZ A;  4WJB A;  4NEX A;  2C27 A;  2Z3N A;  2P0W A;  2PJ2 A;  2GRE A;  4FBE A;  3H5Z A;  1BLL E;  3TCV A;  3B3V A;  5JM6 A;  1FT7 A;  2Q4V A;  1UFH A;  3RYO A;  4DYO A;  2V8G A;  4NJQ A;  2OH1 A;  1Q7L A;  2B58 A;  3VWD A;  1YK3 A;  6CPA A;  2Q0Y A;  2AFO A;  4PQA A;  1L0C A;  2DPT A;  2YGW A;  2ZW6 A;  2Y0M A;  2NSM A;  3OWC A;  4ZY1 A;  3R9G A;  4CAX A;  2XEJ A;  2I00 A;  2PJB A;  4YRH A;  1LOK A;  4KOX A;  4NCZ A;  3GY9 A;  2IQ6 A;  4DJL A;  2C6C A;  4P10 A;  2BL1 A;  2Z3K A;  3CXS A;  1VKC A;  4C68 A;  4Z65 A;  4NXY A;  2ZEG A;  4ONW A;  4E2A A;  2PJ4 A;  2HQY A;  4XPK A;  2G0B A;  1M4L A;  1YR0 A;  2AFM A;  5AG5 A;  4YGO A;  3NA6 A;  4ZX9 A;  4B13 A;  3DLJ A;  3TX8 A;  1WWZ A;  5LRG A;  4A39 A;  4MCP A;  1M4G A;  2EK8 A;  2Q4Z A;  4RUH A;  2VEZ A;  2WUU A;  3CXP A;  4MCQ A;  4NSQ A;  1BO4 A;  1EE3 P;  4NGQ A;  2CNT A;  4JLY A;  4Q7A A;  5IB0 A;  3PGP A;  1K4J A;  4MI4 A;  5AG4 A;  3SI0 A;  3CT9 A;  4KOU A;  4IF5 A;  3RO0 A;  1ARL A;  3W6X A;  4A94 A;  3FIX A;  3R1K A;  2WYR A;  5LRK A;  1XE4 A;  1X10 A;  2AFX A;  1V0C A;  3B2Y A;  4X5K A;  2WPX A;  2ZEL A;  4B14 A;  2QVP A;  5F47 A;  3B35 A;  4C2Y A;  1YVO A;  3FNC A;  4QVT A;  8CPA A;  4OME A;  3D7G A;  4PXC A;  3TC8 A;  2C6P A;  1KWM A;  3ISX A;  2WZN A;  4P4I A;  3GKR A;  3KQZ A;  1JWQ A;  2D4O A;  2QEC A;  4R3K A;  5IX3 A;  3TFY A;  2EK9 A;  1XMT A;  3QAH A;  1IU8 A;  4A31 A;  3FB3 A;  4AG9 A;  1XMB A;  3F0A A;  4CYN A;  2R1I A;  4IK2 A;  2OU2 A;  4X2T A;  4CYQ A;  1VIX A;  1Y7R A;  2PJC A;  2Q44 A;  1YLO A;  4XNH B;  3SI2 A;  2VQY A; 
#chains in the Genus database with same CATH homology
 1P0H A;  2AE6 A;  1S7L A;  2VI7 A;  1TIQ A;  2OZH A;  3EC4 A;  3PZJ A;  5FVJ A;  4AVC A;  1KUX A;  2K5T A;  5JPH A;  2JDC A;  4UWJ A;  4Y49 C;  2Z0Z A;  1PUA A;  3D2M A;  1GHE A;  4MHD A;  4KOW A;  5J8C A;  1MK4 A;  5G22 A;  5GCN A;  4MBU A;  4RI1 A;  4RS2 A;  1QSR A;  5E96 A;  2Q4Y A;  2R7H A;  4CAV A;  2QIR A;  2A4N A;  3JVN A;  3LD2 A;  4CS0 B;  4QBJ A;  2ZW7 A;  4QUS A;  5A27 A;  1OZP A;  1CJW A;  4HNX B;  5F48 A;  1NMT A;  1U6M A;  4U9Z A;  4PSW A;  2X7B A;  4MFK A;  2VZZ A;  3D3S A;  5ISV A;  2YND A;  2B3V A;  4F6A A;  4UCM A;  2B5G B;  2GAN A;  4E0A A;  2BSW A;  3P2H A;  3I9S A;  3SXN A;  2G3A A;  5EBV A;  4AG7 A;  4A2Z A;  4OAE A;  4YFJ A;  4DNC A;  3GYA A;  3DNS A;  4KVX A;  4I49 A;  2I79 A;  3PP9 A;  2YNE A;  3B8G A;  3D8P A;  3R9E A;  1IB1 E;  2FE7 A;  5J8F A;  1I21 A;  3EY5 A;  4H89 A;  4B5P B;  5KTA A;  2ARH A;  4ONU A;  3V8I A;  1N71 A;  2Z3M A;  2ZPA A;  4UFV A;  2HUZ A;  5C88 A;  2FIA A;  4R57 A;  1ZO0 A;  4KVO E;  3TO9 A;  1KUV A;  4AVA A;  3EXN A;  1YVK A;  2P6G A;  2IL4 A;  4QB9 A;  1BOB A;  4ZBG A;  2J8R A;  3JTK A;  2Q04 A;  2FSR A;  3TTH A;  4R3L A;  1S3Z A;  1M4D A;  3TO7 A;  4MFL A;  4MY3 A;  4XNH C;  4XPL A;  4KUB A;  4ORF A;  2B4D A;  4KOT A;  1Y9K A;  3P2F A;  4CAW A;  4KLW A;  3ZJ0 A;  2VZY A;  2FIW A;  4H6U A;  4CYP A;  3K9U A;  4MFJ A;  1M4I A;  3R95 A;  3T9Y A;  4A33 A;  3FXT A;  1MJA A;  4CRZ B;  4II9 A;  5G1Z A;  2WPW A;  4F0Y A;  4C7H A;  4AB7 A;  1RO5 A;  4KOY A;  4C2Z A;  4E8O A;  2AJ6 A;  3TOA A;  4MY0 A;  4L8A A;  4CGN A;  3CXQ A;  2FCK A;  4UWI A;  2R8V A;  1IYK A;  3H4Q A;  3IU2 A;  4LX9 A;  5F46 A;  1YX0 A;  4R87 A;  4B10 A;  1B6B A;  1NSL A;  2FXF A;  4FD7 A;  4A30 A;  3S6G A;  2CNS A;  2J8N A;  4HKF A;  4MFQ A;  3IWG A;  2YNC A;  2G3T A;  2PR8 A;  1CM0 A;  2QML A;  3DR6 A;  1Z4R A;  2J8M A;  4B5O A;  3LOD A;  1IIC A;  4KOS A;  3R9F A;  4KZT A;  3E0K A;  1QSN A;  2Q7B A;  2P6E A;  4B11 A;  3NE7 A;  2B4B A;  4HNW B;  2B4D B;  4FD4 A;  3W6S A;  4KS9 A;  1M1D A;  2JDD A;  4NF1 A;  2CY2 A;  4CYO A;  4CAF A;  2FS5 A;  4BBH A;  2PSW A;  4KSA A;  4PK2 A;  1YGH A;  5HMN A;  3MGD A;  4UFW A;  1MJ9 A;  1S7K A;  1Z4E A;  2RC4 A;  3TO6 A;  1IYL A;  4UBR A;  1PU9 A;  5I0C A;  4H6Z A;  4KUA A;  4Y49 B;  5F49 A;  1KUY A;  1RXT A;  3A9L A;  4CAE A;  4KOV A;  5KTD A;  1FY7 A;  4M85 A;  5AG6 A;  1Q2Y A;  1R57 A;  4IUS A;  3IWE A;  1QSM A;  2O28 A;  2P6F A;  4ZGY B;  1B87 A;  4AVB A;  1QST A;  4PV6 A;  5G20 A;  5G21 A;  5HH1 A;  2WSA A;  2ZW4 A;  4CRY B;  5BWA B;  4A95 A;  1YLE A;  3W91 A;  4BMH A;  4FD6 A;  2ZW5 A;  4EVY A;  3UY5 A;  3SXO A;  2ATR A;  3JUW A;  1XF8 A;  3S6F A;  4UA3 A;  5JQ4 A;  1NE9 A;  5H86 A;  3EFA A;  2H5M A;  2VBQ A;  1LRZ A;  3R96 A;  3WR7 A;  5A28 A;  4XPD C;  4UFX A;  2F5I A;  1XEB A;  3KKW A;  4UCP A;  3F5B A;  4Q36 A;  2REF A;  1S5K A;  4XPD B;  2EVN A;  4OAD A;  2Z3L A;  3DDD A;  2PC1 A;  1J4J A;  3T90 A;  4C2X A;  3BLN A;  5DWN A;  2PRB A;  2B5G A;  4PSX A;  2DXQ A;  2PDO A;  5C82 A;  1QSO A;  2CNM A;  4HNY B;  3F8K A;  4MJ8 A;  3EO4 A;  1YRE A;  4KLV A;  4LUA A;  1Y9W A;  2FL4 A;  3S6H A;  4CGL A;  4MFZ A;  4B5P A;  1KZF A;  4C7I A;  1S7F A;  2DPS A;  4PK3 A;  3DR8 A;  3BJ7 A;  1VHS A;  3IU1 A;  5DWM A;  1P4N A;  4KSF A;  2EUI A;  3DSB A;  2OZG A;  2YNC C;  2Z11 A;  4KOR A;  4CGM A;  1Z9U A;  2BUE A;  2NMT A;  4CGP A;  4OLL A;  4L89 A;  2GE3 A;  2PR1 A;  1I12 A;  2ZXV A;  3FYN A;  4F0X A;  1ON0 A;  2KCW A;  4JWP A;  2REE A;  4MFP A;  1M44 A;  2HV2 A;  4UCN A;  1SQH A;  5EC4 A;  1Q2C A;  2OZU A;  2PQ8 A;  2R98 A;  4R9M A;  3G8W A;  4KVM E;  5KTC A;  5AGE A;  4M3S A;  1Q2D A;  2CXA A;  2BEI A;  3SHP A;  3BJ8 A;  4K30 A;  4Q38 A;  2OB0 A;  3TOB A;  2Z3O A;  4U9Y A;  3D2P A;  1XIX A;  4B12 A;  2JEV A;  4JJX A;  4JXR A;  5AG7 A;  4A32 A;  4QC6 A;  3TE4 A;  4CGO A;  4GS4 A;  3N7Z A;  3ZZI A;  1S7N A;  3QB8 A;  1S60 A;  2D4P A;  1WK4 A;  3FRM A;  4J3G A;  3C26 A;  3I3G A;  3IGR A;  5IV0 A;  1MJB A;  2FT0 A;  4U5Y A;  4FD5 A;  2JLM A;  4JD6 A;  3FBU A;  4JXQ A;  2Z3P A;  1IID A;  2Z10 A;  3S6K A;  1I1D A;  2GIV A;  5CNP A;  3TT2 A;  2VXK A;  2B3U A;  3VWE A;  5H84 A;  3G3S A;  4NEX A;  2C27 A;  2Z3N A;  2P0W A;  3H5Z A;  3TCV A;  2Q4V A;  3RYO A;  1UFH A;  2OH1 A;  2B58 A;  3VWD A;  1YK3 A;  2Q0Y A;  1L0C A;  2DPT A;  2YGW A;  2ZW6 A;  2Y0M A;  3OWC A;  3R9G A;  4CAX A;  2I00 A;  4YRH A;  4KOX A;  4NCZ A;  3GY9 A;  2BL1 A;  2Z3K A;  3CXS A;  1VKC A;  4C68 A;  4NXY A;  4E2A A;  2HQY A;  4XPK A;  2G0B A;  5AG5 A;  1YR0 A;  4YGO A;  4B13 A;  1WWZ A;  1M4G A;  2VEZ A;  2WUU A;  3CXP A;  4NSQ A;  1BO4 A;  2CNT A;  4JLY A;  5IB0 A;  3PGP A;  1K4J A;  4MI4 A;  5AG4 A;  4KOU A;  4IF5 A;  3W6X A;  3FIX A;  3R1K A;  1XE4 A;  1V0C A;  4X5K A;  2WPX A;  4B14 A;  5F47 A;  4C2Y A;  1YVO A;  3FNC A;  4QVT A;  3GKR A;  2D4O A;  2QEC A;  4R3K A;  5IX3 A;  3TFY A;  1XMT A;  3QAH A;  4A31 A;  3FB3 A;  4AG9 A;  3F0A A;  4CYN A;  2R1I A;  2OU2 A;  4CYQ A;  1Y7R A;  2Q44 A;  4XNH B;  2VQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...