1Q2CA

Crystal structure of tetrahymena gcn5 with bound coenzyme a and a 19-residue histone h4 peptide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
162
structure length
162
Chain Sequence
b'LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords histone acetyltransferase GCN5
publication title Structural basis for histone and phosphohistone binding by the GCN5 histone acetyltransferase
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Transferase/structural protein
total genus 46
structure length 162
sequence length 162
ec nomenclature ec 2.3.1.-:
pdb deposition date 2003-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1q2cA00
2FCKA 1YR0A 1M4GA 2JDCA 1R57A 1I21A 4AG9A 2GE3A 1S7LA 1P4NA 2IL4A 1MJBA 4E8OA 4KOUA 3TCVA 5J8CA 1Q2CA 2DXQA 3R9GA 4H6UA 5JQ4A 4KVME 2F5IA 1P0HA 1IICA 4YFJA 4QUSA 2H5MA 2ZXVA 4KZTA 3ZJ0A 4KLWA 3EY5A 4BMHA 2PDOA 2Q7BA 4AB7A 4AG7A 4GS4A 2JLMA 5I0CA 4CAXA 2R98A 4HNWB 5DWNA 4EVYA 4OLLA 4M85A 1GHEA 1S3ZA 2PQ8A 1VHSA 5C88A 4QC6A 2X7BA 1XE4A 1M4IA 3EXNA 2BUEA 3NE7A 4KLVA 3TO7A 3LD2A 5IB0A 1S5KA 4KORA 4XPKA 4R3KA 4MHDA 2G3AA 2QIRA 4JJXA 1YREA 2OH1A 4HNXB 4PK2A 1Z9UA 2BL1A 2R7HA 2AJ6A 2CNMA 3PP9A 4B5PB 5FVJA 4L8AA 4RS2A 2D4PA 4JXQA 3H4QA 5DWMA 2QECA 2P6FA 2PR8A 4ONUA 3JVNA 1S60A 2VQYA 3DNSA 3MGDA 5F46A 1QSNA 1J4JA 3D3SA 3N7ZA 2REEA 5JPHA 2AE6A 2ZPAA 1LRZA 1U6MA 1MJ9A 4QVTA 3PGPA 1MK4A 1QSOA 2WPXA 2B5GA 4R57A 2FT0A 1QSRA 4UWJA 2ZW7A 4R87A 3FB3A 4Y49B 4B5PA 3B8GA 4RI1A 3C26A 2EVNA 4HNYB 3SXOA 2B58A 2J8MA 3S6FA 5H86A 1B6BA 4KOXA 1XF8A 2P0WA 4J3GA 4MY3A 3T90A 4KOVA 2A4NA 3FYNA 3KKWA 3I3GA 2HUZA 1VKCA 4JWPA 1S7KA 2I79A 4MY0A 5F48A 4E2AA 2GANA 2Z10A 3R1KA 4KOWA 1YVKA 4K30A 2Q04A 2Z11A 4HKFA 1I12A 5E96A 2OB0A 4QB9A 2PC1A 3IGRA 1YVOA 3PZJA 3RYOA 3F8KA 4KOYA 3R9FA 2C27A 3GKRA 4U9ZA 3DSBA 1RXTA 3K9UA 1KUYA 3I9SA 4UBRA 5ISVA 1KUXA 5EBVA 3TTHA 2Q4YA 1FY7A 4AVCA 4I49A 4XPDB 4KUAA 3F5BA 3TOBA 1SQHA 3LODA 2P6EA 3S6KA 2CNTA 4JD6A 3TFYA 3WR7A 1V0CA 1S7FA 3FRMA 1QSTA 3FNCA 2B4DB 5KTCA 1IYLA 2FIAA 4II9A 2I00A 4FD6A 3R96A 3TOAA 2R1IA 2Z0ZA 3BJ7A 1PUAA 1QSMA 2G3TA 3TO6A 3DR6A 3W91A 1XIXA 2Q4VA 5F49A 3R95A 2FS5A 2PSWA 2JEVA 4ZBGA 2FXFA 2NMTA 1B87A 2J8NA 2OZHA 5H84A 1BOBA 1Y9WA 2CY2A 4H89A 4XPDC 4UA3A 3UY5A 4XNHB 1NE9A 3EO4A 5IX3A 4NXYA 4AVBA 4QBJA 3TE4A 4H6ZA 1RO5A 4CS0B 4E0AA 4MJ8A 1Y9KA 2VEZA 1ON0A 4R9MA 3TO9A 3SHPA 5GCNA 2VZYA 4R3LA 4PV6A 1Z4RA 3VWEA 1K4JA 1BO4A 5C82A 1CM0A 4MI4A 2RC4A 3P2FA 4KOTA 2FL4A 4PK3A 4AVAA 3ZZIA 3VWDA 2PR1A 5KTDA 3W6SA 3W6XA 1Y7RA 1XMTA 1CJWA 4U5YA 2J8RA 4XNHC 4CAWA 1I1DA 4CAVA 3CXPA 4KVOE 2B3VA 5EC4A 3G8WA 5F47A 3TT2A 1M44A 2ATRA 4XPLA 3T9YA 4B5OA 2G0BA 4YRHA 2R8VA 3S6HA 2BSWA 1XEBA 1WWZA 2JDDA 4L89A 5CNPA 1NSLA 4PSXA 1YK3A 3DDDA 4NCZA 2Y0MA 4IF5A 2VZZA 2ZW4A 2K5TA 5IV0A 3P2HA 4Y49C 1Q2DA 2KCWA 1Q2YA 2D4OA 1S7NA 2Q0YA 1L0CA 1N71A 2Q44A 3F0AA 3D2PA 4NSQA 2FIWA 3QB8A 3G3SA 4MBUA 4KOSA 2PRBA 2P6GA 3E0KA 2QMLA 3D2MA 4JXRA 5J8FA 2O28A 4KUBA 1YLEA 5KTAA 4FD5A 4KVXA 1YGHA 3EFAA 4OAEA 3BLNA 4LX9A 1M4DA 2HV2A 1KUVA 3D8PA 2EUIA 1M1DA 4PSWA 4U9YA 4UWIA 4X5KA 2FSRA 1IB1E 4IUSA 1UFHA 3FXTA 2B4BA 4FD7A 2B5GB 1PU9A 3EC4A 4FD4A 3BJ8A 4ORFA 2B3UA 2REFA 4NF1A 3JUWA 4LUAA 2ARHA 3FIXA 2ZW5A 3SXNA 2BEIA 3GYAA 2HQYA 2CNSA 2B4DA 1KZFA 1IYKA 3IWGA 3GY9A 3CXQA 2GIVA 2VXKA 3R9EA 5HMNA 4YGOA 1NMTA 1MJAA 2VI7A 3V8IA 2OZGA 4M3SA 1WK4A 4CRYB 4F6AA 2OU2A 5HH1A 4OADA 3CXSA 3FBUA 1OZPA 2ZW6A 2OZUA 4CRZB 3OWCA 4DNCA 3S6GA 4NEXA 1TIQA 2VBQA 2WPWA 4JLYA 3QAHA 1Z4EA 1IIDA 2FE7A 3DR8A 4F0YA 1YX0A
chains in the Genus database with same CATH superfamily
3WC6A 2FCKA 4R76A 1YR0A 1CX8A 4LQGA 2RFHA 4ZY0A 2PJ6A 1M4GA 2JDCA 4UEEA 2F8HA 1R57A 2PJ3A 1I21A 4PXBA 2GE3A 4AG9A 4KSFA 1S7LA 4ZY1A 1P4NA 2IL4A 1MJBA 2PRQA 5F09A 3GIUA 4P10A 4KOUA 4E8OA 4MFJA 3TCVA 5J8CA 4MHYA 5J1QA 3CPAA 1Q2CA 4NGNA 4TWEA 2I3CA 4B10A 1XBUA 2PJ5A 4MCRA 1F57A 2DXQA 3R9GA 5JGFA 3WC7A 3RZAA 5LRJA 2Z3LA 4H6UA 3B3CA 4MRIA 2DPSA 3K2KA 5JQ4A 3H8GA 3PFOA 3IJ3A 2ZEHA 4YU9A 4KVME 2F5IA 1P0HA 3FVLA 1IICA 4PQAA 4CYQA 4YFJA 4P4IA 2Q7SA 4QUSA 2H5MA 3FEEA 2ZXVA 4KZTA 3ZJ0A 4KLWA 3EY5A 2CXAA 4G1PA 4BINA 4BMHA 1TKJA 2AFXA 4FAIA 2PDOA 3IC1A 2Q7BA 3IEHA 4AB7A 1Y0YA 4AG7A 4GS4A 2JLMA 5I0CA 1BPMA 3A9LA 3IFEA 4UIAA 4CAXA 2R98A 2ZEFA 3H8FA 3IU2A 2PJ7A 4HNWB 5DWNA 3IU1A 4JZ0A 4EVYA 2QVPA 4OLLA 4M85A 3GLJA 1GHEA 1S3ZA 2PQ8A 4HPSA 3I1UA 4FBEA 1VHSA 2PJCA 2V77A 3HLPA 3NE8A 3SI2A 5C88A 4QC6A 3FMCA 5HVGA 2X7BA 3NH4A 5CBMA 4MFPA 3S9NA 1XE4A 3KZWA 1VGYA 3IIBA 1M4IA 3EXNA 4ZI6A 2BUEA 4DUKA 3NE7A 1EE3P 3MRUA 4KLVA 1ZG7A 4OIWA 1ZLIA 2BCOA 4WWVA 3D7HA 3TO7A 3KL9A 2DPTA 4Q36A 3LD2A 4RUHA 5IB0A 1S5KA 4KORA 4IK2A 4X3RA 4XPKA 4R3KA 2C6GA 4MHDA 2G3AA 4M6HA 2QIRA 4JJXA 1YREA 5LYIA 2OH1A 1NSAA 2XEIA 4HNXB 4PK2A 2YNCA 1Z9UA 2BL1A 2R7HA 2AJ6A 2CNMA 3PP9A 4OIDA 4B5PB 5FVJA 1LOKA 4L8AA 4RS2A 4YWYA 4P4EA 2D4PA 2EBJA 3VARA 4JXQA 3PB9X 2XEGA 3H4QA 5DWMA 4GM5A 2AFSA 2ZEMA 2AFZA 2QECA 2P6FA 2PR8A 4ONUA 4PPZA 1TKFA 3JVNA 3GUXA 4NGTA 1S60A 2VQYA 3WT4A 3DNSA 3MGDA 4KS9A 5F46A 1QSNA 4ZX9A 1Y0RA 1KWMA 1J4JA 2QJ8A 3D3SA 3V38A 1XFOA 3N7ZA 2REEA 5JPHA 1LANA 3SI0A 2AE6A 2PCUA 2ZPAA 2OR4A 1LCPA 2PJ1A 1LRZA 2Z3MA 5A27A 1U6MA 1MJ9A 4B11A 4QVTA 3PGPA 1MK4A 1QSOA 5AG4A 2ZENA 1BLLE 2WPXA 4W9YA 3JRUA 4ZYQA 2B5GA 4OC4A 4F0XA 1IOIA 8CPAA 4R57A 5IB9A 1Z2LA 2C1CA 4R6TA 1JQGA 2FT0A 1QSRA 2WUUA 3CDXA 4UWJA 4CYOA 4NFRA 2ZW7A 3HUVA 2QYVA 2V8DA 4OMEA 1YW4A 2Q43A 4KSAA 2Z3KA 2VL1A 3L2NA 4R87A 3FB3A 2XEJA 3H8EA 1F2PA 4Y49B 4B5PA 2WYRA 3B8GA 4RI1A 3KHXA 4MFKA 3C26A 1M4LA 3ISXA 2EVNA 1CP7A 2EWBA 2ZELA 4HNYB 3SXOA 2B58A 4MCQA 3K9TA 2J8MA 3S6FA 5HVHA 1YQEA 5H86A 1B6BA 4KOXA 1XF8A 2P0WA 4J3GA 4MY3A 4UEFA 4OKOA 4MCSA 3T90A 4KOVA 4MHZA 2PIYA 2ZEPA 4BBHA 2PIZA 2A4NA 1CPXA 3FYNA 3KKWA 2ZEEA 3I3GA 2HUZA 2PJ4A 1YW6A 1VKCA 2RB7A 3D68A 1S7KA 4JWPA 4ZY2A 2I79A 4Q38A 4MY0A 5F48A 4E2AA 2GANA 2JEWA 1IGBA 2Z10A 3LACA 3R1KA 4KOWA 1YVKA 5BWAB 4K30A 2Q04A 2Z11A 4HKFA 3KQZA 1AMPA 4K3NA 2GU2A 1I12A 5E96A 5LYDA 5G21A 2OB0A 5ELYA 4FUUA 2PC1A 2PJ0A 1YVOA 3IGRA 3PZJA 4QB9A 3RYOA 3KQXA 3PBEA 4R7MA 1YSJA 3F8KA 1TF9A 4KOYA 4UIBA 2AFWA 2NSMA 3R9FA 5K8MA 2C27A 3GKRA 4GXHA 2GLFA 3DSBA 4U9ZA 5JM6A 1RXTA 3K9UA 1KUYA 1TKHA 3FEDA 3I9SA 4UBRA 5ISVA 3PRTA 4UFWA 1KUXA 1ZG8A 4Q7AA 4OC0A 1ARLA 3LWUA 2C6PA 5D29A 5EBVA 3DGVA 3TTHA 2Q4YA 1Y7EA 2JBJA 2Z3PA 1FY7A 5A28A 4AVCA 1ARMA 3PB4X 2BO9A 4I49A 4XPDB 4A39A 3FJUA 1ZLHA 2PE3A 1IU8A 3F5BA 4KUAA 3TOBA 4NGMA 4EWTA 1SQHA 3LODA 2P6EA 3S6KA 4CGNA 2CNTA 3KASA 4UF4A 4X8IA 4UCMA 4JD6A 2C6CA 3PB8X 3TFYA 3WR7A 1V0CA 1S7FA 3FRMA 1QSTA 1VHEA 3FNCA 1XMBA 4IHMA 2B4DB 2POKA 1IYLA 1TF8A 2Z3NA 5KTCA 2FIAA 4II9A 2I00A 4BD9A 2IJZA 1DE4C 4FD6A 1X12A 1A2ZA 3R96A 3S9LA 3TOAA 1LFWA 4PXDA 2R1IA 2Z0ZA 5EMIA 3RO0A 3BJ7A 4AXVA 1DTDA 1PUAA 1QSMA 2ZEDA 3BI0A 4UCNA 4P4FA 2G3TA 4F9UA 3TO6A 4CYPA 4P6YA 3DR6A 4CAFA 4CYNA 3W91A 1Z8WA 3B3WA 1R43A 1XIXA 2NYQA 4MHPA 2Q4VA 4X2TA 5AG6A 5LYLA 3GB0A 5F49A 3R95A 2FS5A 2PSWA 4C2YA 4B13A 2JEVA 4ZBGA 2FXFA 2NMTA 4UCPA 1B87A 2J8NA 2OZHA 2ZOFA 5H84A 1BOBA 1Y9WA 4MFZA 2CY2A 4H89A 4XPDC 2EK9A 4UA3A 4OP4A 3NH8A 3UY5A 1CBXA 4XNHB 2HB6A 5THWA 1YLOA 5AG5A 1NE9A 3EO4A 5IX3A 4NXYA 4AVBA 4QBJA 5K8NA 3TE4A 2IMOA 2O4HA 3LMSA 4H6ZA 4NGRA 4M6IA 1RO5A 2CIJA 5G22A 5AG7A 4CS0B 4E0AA 1BAVA 3JTKA 3D4UA 1Y9KA 2VEZA 1ON0A 2F7VA 4MJ8A 4R9MA 3TO9A 3CT9A 3SHPA 2DF5A 4Z65A 5GCNA 2VZYA 1Z5RA 3KGQA 1VHOA 4R3LA 1PYTB 4OC2A 4P4BA 4PV6A 4RN7A 3VH9A 3PB6X 1LAMA 5D8NA 1FNOA 1Z4RA 3VWEA 1K4JA 1BO4A 5C82A 4A32A 1CM0A 3B35A 3KHZA 2HC9A 4MI4A 4P4DA 4A30A 2PVVA 1IOFA 2RC4A 3BHXA 4NGSA 3SJGA 3P2FA 1Q7LA 2JBKA 4P4JA 4C2ZA 2YGWA 4KOTA 2FL4A 4PK3A 4AVAA 4C2XA 3ZZIA 4P45A 3TX8A 3VWDA 3TC8A 3D7DA 4ZGYB 1R3NA 2PR1A 2YNDA 5KTDA 1RTQA 1FT7A 2V8HA 3D7FA 4M6GA 2GFQA 3NA6A 3W6SA 4CGMA 2V8GA 3W6XA 1Y7RA 3SJEA 4A94A 1XMTA 1CJWA 4A2ZA 5CPAA 4U5YA 4OC1A 2J8RA 4FWUA 4ONWA 4XNHC 4CAWA 3QNVA 1I1DA 3B3SA 3SJFA 3CPXA 4CAVA 3MN8A 3QAYA 3CXPA 3KI9A 4KVOE 4A95A 4EMEA 2B3VA 5EC4A 4CGOA 3RAMA 3IWWA 2ZEGA 1F2OA 3CZXA 3G8WA 5F47A 3TT2A 2CTCA 1H8LA 1M44A 2ATRA 4XPLA 2EK8A 3T9YA 4B5OA 2G0BA 2GLJA 4C68A 3D67A 4B14A 4YRHA 4CGLA 5DS0A 4B6ZA 1Z8TA 1PCAA 1HEEA 2R8VA 3S6HA 2BSWA 1XEBA 1WWZA 2JDDA 4L89A 4MFQA 2PJ2A 6CPAA 4A38A 5CNPA 1NSLA 4PSXA 5HXDA 3PB7X 4OC3A 4PXEA 5AGEA 1YK3A 2G9DA 3DDDA 5LRGA 1HDQA 2Y0MA 4IF5A 4NCZA 3IO1A 1XRYA 2VZZA 3N5FA 4NJRA 2ZW4A 4CAEA 1UWYA 2K5TA 1TXRA 5IV0A 3B2YA 3P2HA 1XOVA 4Y49C 4R8FA 1Q2DA 2KCWA 4H2KA 1Q2YA 2D4OA 1S7NA 2Q0YA 4UEZA 3NFZA 1L0CA 1N71A 2Q44A 3F0AA 4JYWA 2BOAA 1HDUA 3D2PA 5G20A 4NSQA 3RBUA 2EO8A 2FIWA 3SI1A 2ODFA 2Z3OA 3G3SA 3QB8A 1X10A 2CTBA 4KOSA 4MBUA 4O23A 1IY7A 2PRBA 3D7GA 4CPAA 2P6GA 4KSIA 2PJAA 2PVWA 3E0KA 4C7HA 2QMLA 1VIXA 3D2MA 5G1ZA 2WZNA 1AUGA 1GYTA 4JXRA 3S9MA 3V7ZA 5J8FA 3PFEA 3VATA 2O28A 4KUBA 3WABA 1YLEA 1CPSA 1ELMP 3FECA 4A33A 5JH9A 5KTAA 3SJXA 4FD5A 1OBRA 1BPNA 4KVXA 4UFXA 3T8WA 1YGHA 2XEFA 1ZO0A 3B3TA 3EFAA 3FX6A 4OAEA 4ZX8A 3BLNA 2AFOA 1ELLP 3NH5A 4LX9A 1M4DA 3ISZA 3H5ZA 7CPAA 2HV2A 2DEAA 1KUVA 4LQ6A 4MCPA 3D8PA 2EUIA 1M1DA 2IQ6A 5HVFA 4PSWA 4U9YA 4A37A 3PBBA 4UWIA 4X5KA 2FSRA 1YMEA 1IB1E 4MFLA 4IUSA 1UFHA 3FXTA 2B4BA 4B12A 4WJBA 4FD7A 4IAVA 4UFVA 4MMOA 3IWEA 2B5GB 1PU9A 1QQ9A 3EC4A 2GREA 2V8VA 4NGPA 4FD4A 2YNCC 3BJ8A 4ORFA 1XJOA 2B3UA 5LRKA 3KR5A 2ABZA 2REFA 4NF1A 3JUWA 4LUAA 2PJ9A 3RNZA 2AFUA 2Q51A 1CG2A 2ANPA 2WSAA 2YNEA 3B3VA 4NGQA 4DJLA 2ARHA 3FIXA 2ZW5A 3SXNA 2BEIA 4MXUA 3GYAA 2HQYA 4C7IA 4TNUA 4NJQA 2CNSA 1QMUA 2B4DA 1KZFA 1IYKA 3IWGA 1Z8LA 3WC5A 3GY9A 2AFMA 2GIVA 3CXQA 2VXKA 3KR4A 1LAPA 2ZEOA 3R9EA 5LYFA 2O53A 3BI1A 4F8ZA 4F9VA 4OC5A 2OOTA 5HMNA 4YGOA 1NMTA 1MJAA 2VI7A 3V8IA 2J9AA 2OZGA 5K8PA 1Z8XA 4PXCA 4M3SA 1WK4A 4CRYB 4MHNA 4F6AA 2ZOGA 2OU2A 1ZG9A 5HH1A 3BXMA 5K8OA 4P44A 4A31A 4OADA 3CXSA 3PEIA 2FVGA 3DLJA 2CF4A 1AYEA 1JWQA 3FBUA 5I4MA 1OZPA 2ZW6A 2OZUA 2PJ8A 3OWCA 4CGPA 4CRZB 4DNCA 3S6GA 4NEXA 3D66A 1TIQA 1CP6A 3FF3A 2VBQA 2WPWA 4DYOA 2PJBA 4EFDA 3B7IA 3QAHA 3FH4A 1Z4EA 1IIDA 2FE7A 3DR8A 4JLYA 4F0YA 1YX0A 2Q4ZA
chains in the Genus database with same CATH topology
2FCKA 1YR0A 1M4GA 2JDCA 1R57A 1I21A 4AG9A 2GE3A 4KSFA 1S7LA 1P4NA 2IL4A 1MJBA 4E8OA 4KOUA 4MFJA 3TCVA 5J8CA 1Q2CA 4B10A 2DXQA 3R9GA 2Z3LA 4H6UA 2DPSA 5JQ4A 4KVME 2F5IA 1P0HA 1IICA 4CYQA 4YFJA 4QUSA 2H5MA 2ZXVA 4KZTA 3ZJ0A 4KLWA 3EY5A 2CXAA 4BMHA 2PDOA 2Q7BA 4AB7A 4AG7A 4GS4A 2JLMA 5I0CA 3A9LA 4CAXA 2R98A 3IU2A 4HNWB 5DWNA 3IU1A 4EVYA 4OLLA 4M85A 1GHEA 1S3ZA 2PQ8A 1VHSA 5C88A 4QC6A 2X7BA 4MFPA 1XE4A 1M4IA 3EXNA 2BUEA 3NE7A 4KLVA 3TO7A 2DPTA 4Q36A 3LD2A 5IB0A 1S5KA 4KORA 4XPKA 4R3KA 4MHDA 2G3AA 2QIRA 4JJXA 1YREA 2OH1A 4HNXB 4PK2A 2YNCA 1Z9UA 2BL1A 2R7HA 2AJ6A 2CNMA 3PP9A 4B5PB 5FVJA 4L8AA 4RS2A 2D4PA 4JXQA 3H4QA 5DWMA 2QECA 2P6FA 2PR8A 4ONUA 3JVNA 1S60A 2VQYA 3DNSA 3MGDA 4KS9A 5F46A 1QSNA 1J4JA 3D3SA 3N7ZA 2REEA 5JPHA 2AE6A 2ZPAA 2Z3MA 1LRZA 5A27A 1U6MA 1MJ9A 4B11A 4QVTA 3PGPA 1MK4A 1QSOA 5AG4A 2WPXA 2B5GA 4F0XA 4R57A 2FT0A 1QSRA 2WUUA 4CYOA 4UWJA 2ZW7A 4KSAA 2Z3KA 4R87A 3FB3A 4Y49B 4B5PA 3B8GA 4RI1A 4MFKA 3C26A 2EVNA 4HNYB 3SXOA 2B58A 2J8MA 3S6FA 5H86A 1B6BA 4KOXA 1XF8A 2P0WA 4J3GA 4MY3A 3T90A 4KOVA 4BBHA 2A4NA 3FYNA 3KKWA 3I3GA 2HUZA 1VKCA 4JWPA 1S7KA 2I79A 4Q38A 4MY0A 5F48A 4E2AA 2GANA 2Z10A 3R1KA 4KOWA 5BWAB 1YVKA 4K30A 2Q04A 2Z11A 4HKFA 1I12A 5E96A 5G21A 2OB0A 4QB9A 2PC1A 3IGRA 1YVOA 3PZJA 3RYOA 3F8KA 4KOYA 3R9FA 2C27A 3GKRA 4U9ZA 3DSBA 1RXTA 3K9UA 1KUYA 3I9SA 4UBRA 5ISVA 4UFWA 1KUXA 5EBVA 3TTHA 2Q4YA 2Z3PA 1FY7A 5A28A 4AVCA 4I49A 4XPDB 4KUAA 3F5BA 3TOBA 1SQHA 3LODA 2P6EA 3S6KA 4CGNA 2CNTA 4UCMA 4JD6A 3TFYA 3WR7A 1V0CA 1S7FA 3FRMA 1QSTA 3FNCA 2B4DB 2Z3NA 1IYLA 5KTCA 2FIAA 4II9A 2I00A 4FD6A 3R96A 3TOAA 2R1IA 2Z0ZA 3BJ7A 1PUAA 1QSMA 4UCNA 2G3TA 3TO6A 4CYPA 3DR6A 4CAFA 4CYNA 3W91A 1XIXA 5AG6A 2Q4VA 5F49A 3R95A 2FS5A 2PSWA 4C2YA 4B13A 2JEVA 4ZBGA 2FXFA 2NMTA 4UCPA 1B87A 2J8NA 2OZHA 5H84A 1BOBA 1Y9WA 4MFZA 2CY2A 4H89A 4XPDC 4UA3A 3UY5A 4XNHB 1NE9A 3EO4A 5IX3A 4NXYA 4AVBA 4QBJA 3TE4A 4H6ZA 1RO5A 5G22A 5AG7A 4CS0B 4E0AA 3JTKA 4MJ8A 1Y9KA 2VEZA 1ON0A 4R9MA 3TO9A 3SHPA 5GCNA 2VZYA 4R3LA 4PV6A 1Z4RA 3VWEA 1K4JA 1BO4A 5C82A 4A32A 1CM0A 4MI4A 4A30A 2RC4A 3P2FA 4C2ZA 2YGWA 4KOTA 2FL4A 4PK3A 4AVAA 4C2XA 3ZZIA 3VWDA 4ZGYB 2PR1A 2YNDA 5KTDA 3W6SA 4CGMA 3W6XA 1Y7RA 1XMTA 1CJWA 4A2ZA 4U5YA 2J8RA 4XNHC 4CAWA 1I1DA 4CAVA 3CXPA 4KVOE 4A95A 2B3VA 5EC4A 4CGOA 3G8WA 5F47A 3TT2A 1M44A 2ATRA 4XPLA 3T9YA 4B5OA 2G0BA 4C68A 4B14A 4YRHA 4CGLA 2R8VA 3S6HA 2BSWA 1XEBA 1WWZA 2JDDA 4L89A 4MFQA 5CNPA 1NSLA 4PSXA 5AGEA 1YK3A 3DDDA 4NCZA 2Y0MA 4IF5A 2VZZA 2ZW4A 4CAEA 2K5TA 5IV0A 3P2HA 4Y49C 1Q2DA 2KCWA 1Q2YA 2D4OA 1S7NA 2Q0YA 1L0CA 1N71A 2Q44A 3F0AA 3D2PA 5G20A 4NSQA 2FIWA 3QB8A 2Z3OA 3G3SA 4MBUA 4KOSA 2PRBA 2P6GA 3E0KA 4C7HA 2QMLA 3D2MA 5G1ZA 4JXRA 5J8FA 2O28A 4KUBA 1YLEA 4A33A 5KTAA 4FD5A 4KVXA 4UFXA 1YGHA 1ZO0A 3EFAA 4OAEA 3BLNA 4LX9A 1M4DA 3H5ZA 2HV2A 1KUVA 3D8PA 2EUIA 1M1DA 4PSWA 4U9YA 4UWIA 4X5KA 2FSRA 1IB1E 4MFLA 4IUSA 1UFHA 3FXTA 2B4BA 4B12A 4FD7A 4UFVA 3IWEA 2B5GB 1PU9A 3EC4A 4FD4A 2YNCC 3BJ8A 4ORFA 2B3UA 2REFA 4NF1A 3JUWA 4LUAA 2WSAA 2YNEA 2ARHA 3FIXA 2ZW5A 3SXNA 2BEIA 4C7IA 3GYAA 2HQYA 2CNSA 2B4DA 1KZFA 1IYKA 3IWGA 3GY9A 3CXQA 2GIVA 2VXKA 3R9EA 5HMNA 4YGOA 1NMTA 1MJAA 2VI7A 3V8IA 2OZGA 4M3SA 1WK4A 4CRYB 4F6AA 2OU2A 5HH1A 4A31A 4OADA 3CXSA 3FBUA 1OZPA 2ZW6A 2OZUA 4CGPA 3OWCA 4CRZB 4DNCA 3S6GA 4NEXA 1TIQA 2VBQA 2WPWA 3QAHA 4JLYA 1Z4EA 1IIDA 2FE7A 3DR8A 4F0YA 1YX0A 5AG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCK A;  1YR0 A;  1M4G A;  2JDC A;  1R57 A;  1I21 A;  4AG9 A;  2GE3 A;  1S7L A;  1P4N A;  2IL4 A;  1MJB A;  4E8O A;  4KOU A;  3TCV A;  5J8C A;  1Q2C A;  2DXQ A;  3R9G A;  4H6U A;  5JQ4 A;  4KVM E;  2F5I A;  1P0H A;  1IIC A;  4YFJ A;  4QUS A;  2H5M A;  2ZXV A;  4KZT A;  3ZJ0 A;  4KLW A;  3EY5 A;  4BMH A;  2PDO A;  2Q7B A;  4AB7 A;  4AG7 A;  4GS4 A;  2JLM A;  5I0C A;  4CAX A;  2R98 A;  4HNW B;  5DWN A;  4EVY A;  4OLL A;  4M85 A;  1GHE A;  1S3Z A;  2PQ8 A;  1VHS A;  5C88 A;  4QC6 A;  2X7B A;  1XE4 A;  1M4I A;  3EXN A;  2BUE A;  3NE7 A;  4KLV A;  3TO7 A;  3LD2 A;  5IB0 A;  1S5K A;  4KOR A;  4XPK A;  4R3K A;  4MHD A;  2G3A A;  2QIR A;  4JJX A;  1YRE A;  2OH1 A;  4HNX B;  4PK2 A;  1Z9U A;  2BL1 A;  2R7H A;  2AJ6 A;  2CNM A;  3PP9 A;  4B5P B;  5FVJ A;  4L8A A;  4RS2 A;  2D4P A;  4JXQ A;  3H4Q A;  5DWM A;  2QEC A;  2P6F A;  2PR8 A;  4ONU A;  3JVN A;  1S60 A;  2VQY A;  3DNS A;  3MGD A;  5F46 A;  1QSN A;  1J4J A;  3D3S A;  3N7Z A;  2REE A;  5JPH A;  2AE6 A;  2ZPA A;  1LRZ A;  1U6M A;  1MJ9 A;  4QVT A;  3PGP A;  1MK4 A;  1QSO A;  2WPX A;  2B5G A;  4R57 A;  2FT0 A;  1QSR A;  4UWJ A;  2ZW7 A;  4R87 A;  3FB3 A;  4Y49 B;  4B5P A;  3B8G A;  4RI1 A;  3C26 A;  2EVN A;  4HNY B;  3SXO A;  2B58 A;  2J8M A;  3S6F A;  5H86 A;  1B6B A;  4KOX A;  1XF8 A;  2P0W A;  4J3G A;  4MY3 A;  3T90 A;  4KOV A;  2A4N A;  3FYN A;  3KKW A;  3I3G A;  2HUZ A;  1VKC A;  4JWP A;  1S7K A;  2I79 A;  4MY0 A;  5F48 A;  4E2A A;  2GAN A;  2Z10 A;  3R1K A;  4KOW A;  1YVK A;  4K30 A;  2Q04 A;  2Z11 A;  4HKF A;  1I12 A;  5E96 A;  2OB0 A;  4QB9 A;  2PC1 A;  3IGR A;  1YVO A;  3PZJ A;  3RYO A;  3F8K A;  4KOY A;  3R9F A;  2C27 A;  3GKR A;  4U9Z A;  3DSB A;  1RXT A;  3K9U A;  1KUY A;  3I9S A;  4UBR A;  5ISV A;  1KUX A;  5EBV A;  3TTH A;  2Q4Y A;  1FY7 A;  4AVC A;  4I49 A;  4XPD B;  4KUA A;  3F5B A;  3TOB A;  1SQH A;  3LOD A;  2P6E A;  3S6K A;  2CNT A;  4JD6 A;  3TFY A;  3WR7 A;  1V0C A;  1S7F A;  3FRM A;  1QST A;  3FNC A;  2B4D B;  5KTC A;  1IYL A;  2FIA A;  4II9 A;  2I00 A;  4FD6 A;  3R96 A;  3TOA A;  2R1I A;  2Z0Z A;  3BJ7 A;  1PUA A;  1QSM A;  2G3T A;  3TO6 A;  3DR6 A;  3W91 A;  1XIX A;  2Q4V A;  5F49 A;  3R95 A;  2FS5 A;  2PSW A;  2JEV A;  4ZBG A;  2FXF A;  2NMT A;  1B87 A;  2J8N A;  2OZH A;  5H84 A;  1BOB A;  1Y9W A;  2CY2 A;  4H89 A;  4XPD C;  4UA3 A;  3UY5 A;  4XNH B;  1NE9 A;  3EO4 A;  5IX3 A;  4NXY A;  4AVB A;  4QBJ A;  3TE4 A;  4H6Z A;  1RO5 A;  4CS0 B;  4E0A A;  4MJ8 A;  1Y9K A;  2VEZ A;  1ON0 A;  4R9M A;  3TO9 A;  3SHP A;  5GCN A;  2VZY A;  4R3L A;  4PV6 A;  1Z4R A;  3VWE A;  1K4J A;  1BO4 A;  5C82 A;  1CM0 A;  4MI4 A;  2RC4 A;  3P2F A;  4KOT A;  2FL4 A;  4PK3 A;  4AVA A;  3ZZI A;  3VWD A;  2PR1 A;  5KTD A;  3W6S A;  3W6X A;  1Y7R A;  1XMT A;  1CJW A;  4U5Y A;  2J8R A;  4XNH C;  4CAW A;  1I1D A;  4CAV A;  3CXP A;  4KVO E;  2B3V A;  5EC4 A;  3G8W A;  5F47 A;  3TT2 A;  1M44 A;  2ATR A;  4XPL A;  3T9Y A;  4B5O A;  2G0B A;  4YRH A;  2R8V A;  3S6H A;  2BSW A;  1XEB A;  1WWZ A;  2JDD A;  4L89 A;  5CNP A;  1NSL A;  4PSX A;  1YK3 A;  3DDD A;  4NCZ A;  2Y0M A;  4IF5 A;  2VZZ A;  2ZW4 A;  2K5T A;  5IV0 A;  3P2H A;  4Y49 C;  1Q2D A;  2KCW A;  1Q2Y A;  2D4O A;  1S7N A;  2Q0Y A;  1L0C A;  1N71 A;  2Q44 A;  3F0A A;  3D2P A;  4NSQ A;  2FIW A;  3QB8 A;  3G3S A;  4MBU A;  4KOS A;  2PRB A;  2P6G A;  3E0K A;  2QML A;  3D2M A;  4JXR A;  5J8F A;  2O28 A;  4KUB A;  1YLE A;  5KTA A;  4FD5 A;  4KVX A;  1YGH A;  3EFA A;  4OAE A;  3BLN A;  4LX9 A;  1M4D A;  2HV2 A;  1KUV A;  3D8P A;  2EUI A;  1M1D A;  4PSW A;  4U9Y A;  4UWI A;  4X5K A;  2FSR A;  1IB1 E;  4IUS A;  1UFH A;  3FXT A;  2B4B A;  4FD7 A;  2B5G B;  1PU9 A;  3EC4 A;  4FD4 A;  3BJ8 A;  4ORF A;  2B3U A;  2REF A;  4NF1 A;  3JUW A;  4LUA A;  2ARH A;  3FIX A;  2ZW5 A;  3SXN A;  2BEI A;  3GYA A;  2HQY A;  2CNS A;  2B4D A;  1KZF A;  1IYK A;  3IWG A;  3GY9 A;  3CXQ A;  2GIV A;  2VXK A;  3R9E A;  5HMN A;  4YGO A;  1NMT A;  1MJA A;  2VI7 A;  3V8I A;  2OZG A;  4M3S A;  1WK4 A;  4CRY B;  4F6A A;  2OU2 A;  5HH1 A;  4OAD A;  3CXS A;  3FBU A;  1OZP A;  2ZW6 A;  2OZU A;  4CRZ B;  3OWC A;  4DNC A;  3S6G A;  4NEX A;  1TIQ A;  2VBQ A;  2WPW A;  4JLY A;  3QAH A;  1Z4E A;  1IID A;  2FE7 A;  3DR8 A;  4F0Y A;  1YX0 A; 
#chains in the Genus database with same CATH topology
 3WC6 A;  2FCK A;  4R76 A;  1YR0 A;  1CX8 A;  4LQG A;  2RFH A;  4ZY0 A;  2PJ6 A;  1M4G A;  2JDC A;  4UEE A;  2F8H A;  1R57 A;  2PJ3 A;  1I21 A;  4PXB A;  2GE3 A;  4AG9 A;  4KSF A;  1S7L A;  4ZY1 A;  1P4N A;  2IL4 A;  1MJB A;  2PRQ A;  5F09 A;  3GIU A;  4P10 A;  4KOU A;  4E8O A;  4MFJ A;  3TCV A;  5J8C A;  4MHY A;  5J1Q A;  3CPA A;  1Q2C A;  4NGN A;  4TWE A;  2I3C A;  4B10 A;  1XBU A;  2PJ5 A;  4MCR A;  1F57 A;  2DXQ A;  3R9G A;  5JGF A;  3WC7 A;  3RZA A;  5LRJ A;  2Z3L A;  4H6U A;  3B3C A;  4MRI A;  2DPS A;  3K2K A;  5JQ4 A;  3H8G A;  3PFO A;  3IJ3 A;  2ZEH A;  4YU9 A;  4KVM E;  2F5I A;  1P0H A;  3FVL A;  1IIC A;  4PQA A;  4CYQ A;  4YFJ A;  4P4I A;  2Q7S A;  4QUS A;  2H5M A;  3FEE A;  2ZXV A;  4KZT A;  3ZJ0 A;  4KLW A;  3EY5 A;  2CXA A;  4G1P A;  4BIN A;  4BMH A;  1TKJ A;  2AFX A;  4FAI A;  2PDO A;  3IC1 A;  2Q7B A;  3IEH A;  4AB7 A;  1Y0Y A;  4AG7 A;  4GS4 A;  2JLM A;  5I0C A;  1BPM A;  3A9L A;  3IFE A;  4UIA A;  4CAX A;  2R98 A;  2ZEF A;  3H8F A;  3IU2 A;  2PJ7 A;  4HNW B;  5DWN A;  3IU1 A;  4JZ0 A;  4EVY A;  2QVP A;  4OLL A;  4M85 A;  3GLJ A;  1GHE A;  1S3Z A;  2PQ8 A;  4HPS A;  3I1U A;  4FBE A;  1VHS A;  2PJC A;  2V77 A;  3HLP A;  3NE8 A;  3SI2 A;  5C88 A;  4QC6 A;  3FMC A;  5HVG A;  2X7B A;  3NH4 A;  5CBM A;  4MFP A;  3S9N A;  1XE4 A;  3KZW A;  1VGY A;  3IIB A;  1M4I A;  3EXN A;  4ZI6 A;  2BUE A;  4DUK A;  3NE7 A;  1EE3 P;  3MRU A;  4KLV A;  1ZG7 A;  4OIW A;  1ZLI A;  2BCO A;  4WWV A;  3D7H A;  3TO7 A;  3KL9 A;  2DPT A;  4Q36 A;  3LD2 A;  4RUH A;  5IB0 A;  1S5K A;  4KOR A;  4IK2 A;  4X3R A;  4XPK A;  4R3K A;  2C6G A;  4MHD A;  2G3A A;  4M6H A;  2QIR A;  4JJX A;  1YRE A;  5LYI A;  2OH1 A;  1NSA A;  2XEI A;  4HNX B;  4PK2 A;  2YNC A;  1Z9U A;  2BL1 A;  2R7H A;  2AJ6 A;  2CNM A;  3PP9 A;  4OID A;  4B5P B;  5FVJ A;  1LOK A;  4L8A A;  4RS2 A;  4YWY A;  4P4E A;  2D4P A;  2EBJ A;  3VAR A;  4JXQ A;  3PB9 X;  2XEG A;  3H4Q A;  5DWM A;  4GM5 A;  2AFS A;  2ZEM A;  2AFZ A;  2QEC A;  2P6F A;  2PR8 A;  4ONU A;  4PPZ A;  1TKF A;  3JVN A;  3GUX A;  4NGT A;  1S60 A;  2VQY A;  3WT4 A;  3DNS A;  3MGD A;  4KS9 A;  5F46 A;  1QSN A;  4ZX9 A;  1Y0R A;  1KWM A;  1J4J A;  2QJ8 A;  3D3S A;  3V38 A;  1XFO A;  3N7Z A;  2REE A;  5JPH A;  1LAN A;  3SI0 A;  2AE6 A;  2PCU A;  2ZPA A;  2OR4 A;  1LCP A;  2PJ1 A;  1LRZ A;  2Z3M A;  5A27 A;  1U6M A;  1MJ9 A;  4B11 A;  4QVT A;  3PGP A;  1MK4 A;  1QSO A;  5AG4 A;  2ZEN A;  1BLL E;  2WPX A;  4W9Y A;  3JRU A;  4ZYQ A;  2B5G A;  4OC4 A;  4F0X A;  1IOI A;  8CPA A;  4R57 A;  5IB9 A;  1Z2L A;  2C1C A;  4R6T A;  1JQG A;  2FT0 A;  1QSR A;  2WUU A;  3CDX A;  4UWJ A;  4CYO A;  4NFR A;  2ZW7 A;  3HUV A;  2QYV A;  2V8D A;  4OME A;  1YW4 A;  2Q43 A;  4KSA A;  2Z3K A;  2VL1 A;  3L2N A;  4R87 A;  3FB3 A;  2XEJ A;  3H8E A;  1F2P A;  4Y49 B;  4B5P A;  2WYR A;  3B8G A;  4RI1 A;  3KHX A;  4MFK A;  3C26 A;  1M4L A;  3ISX A;  2EVN A;  1CP7 A;  2EWB A;  2ZEL A;  4HNY B;  3SXO A;  2B58 A;  4MCQ A;  3K9T A;  2J8M A;  3S6F A;  5HVH A;  1YQE A;  5H86 A;  1B6B A;  4KOX A;  1XF8 A;  2P0W A;  4J3G A;  4MY3 A;  4UEF A;  4OKO A;  4MCS A;  3T90 A;  4KOV A;  4MHZ A;  2PIY A;  2ZEP A;  4BBH A;  2PIZ A;  2A4N A;  1CPX A;  3FYN A;  3KKW A;  2ZEE A;  3I3G A;  2HUZ A;  2PJ4 A;  1YW6 A;  1VKC A;  2RB7 A;  3D68 A;  1S7K A;  4JWP A;  4ZY2 A;  2I79 A;  4Q38 A;  4MY0 A;  5F48 A;  4E2A A;  2GAN A;  2JEW A;  1IGB A;  2Z10 A;  3LAC A;  3R1K A;  4KOW A;  1YVK A;  5BWA B;  4K30 A;  2Q04 A;  2Z11 A;  4HKF A;  3KQZ A;  1AMP A;  4K3N A;  2GU2 A;  1I12 A;  5E96 A;  5LYD A;  5G21 A;  2OB0 A;  5ELY A;  4FUU A;  2PC1 A;  2PJ0 A;  1YVO A;  3IGR A;  3PZJ A;  4QB9 A;  3RYO A;  3KQX A;  3PBE A;  4R7M A;  1YSJ A;  3F8K A;  1TF9 A;  4KOY A;  4UIB A;  2AFW A;  2NSM A;  3R9F A;  5K8M A;  2C27 A;  3GKR A;  4GXH A;  2GLF A;  3DSB A;  4U9Z A;  5JM6 A;  1RXT A;  3K9U A;  1KUY A;  1TKH A;  3FED A;  3I9S A;  4UBR A;  5ISV A;  3PRT A;  4UFW A;  1KUX A;  1ZG8 A;  4Q7A A;  4OC0 A;  1ARL A;  3LWU A;  2C6P A;  5D29 A;  5EBV A;  3DGV A;  3TTH A;  2Q4Y A;  1Y7E A;  2JBJ A;  2Z3P A;  1FY7 A;  5A28 A;  4AVC A;  1ARM A;  3PB4 X;  2BO9 A;  4I49 A;  4XPD B;  4A39 A;  3FJU A;  1ZLH A;  2PE3 A;  1IU8 A;  3F5B A;  4KUA A;  3TOB A;  4NGM A;  4EWT A;  1SQH A;  3LOD A;  2P6E A;  3S6K A;  4CGN A;  2CNT A;  3KAS A;  4UF4 A;  4X8I A;  4UCM A;  4JD6 A;  2C6C A;  3PB8 X;  3TFY A;  3WR7 A;  1V0C A;  1S7F A;  3FRM A;  1QST A;  1VHE A;  3FNC A;  1XMB A;  4IHM A;  2B4D B;  2POK A;  1IYL A;  1TF8 A;  2Z3N A;  5KTC A;  2FIA A;  4II9 A;  2I00 A;  4BD9 A;  2IJZ A;  1DE4 C;  4FD6 A;  1X12 A;  1A2Z A;  3R96 A;  3S9L A;  3TOA A;  1LFW A;  4PXD A;  2R1I A;  2Z0Z A;  5EMI A;  3RO0 A;  3BJ7 A;  4AXV A;  1DTD A;  1PUA A;  1QSM A;  2ZED A;  3BI0 A;  4UCN A;  4P4F A;  2G3T A;  4F9U A;  3TO6 A;  4CYP A;  4P6Y A;  3DR6 A;  4CAF A;  4CYN A;  3W91 A;  1Z8W A;  3B3W A;  1R43 A;  1XIX A;  2NYQ A;  4MHP A;  2Q4V A;  4X2T A;  5AG6 A;  5LYL A;  3GB0 A;  5F49 A;  3R95 A;  2FS5 A;  2PSW A;  4C2Y A;  4B13 A;  2JEV A;  4ZBG A;  2FXF A;  2NMT A;  4UCP A;  1B87 A;  2J8N A;  2OZH A;  2ZOF A;  5H84 A;  1BOB A;  1Y9W A;  4MFZ A;  2CY2 A;  4H89 A;  4XPD C;  2EK9 A;  4UA3 A;  4OP4 A;  3NH8 A;  3UY5 A;  1CBX A;  4XNH B;  2HB6 A;  5THW A;  1YLO A;  5AG5 A;  1NE9 A;  3EO4 A;  5IX3 A;  4NXY A;  4AVB A;  4QBJ A;  5K8N A;  3TE4 A;  2IMO A;  2O4H A;  3LMS A;  4H6Z A;  4NGR A;  4M6I A;  1RO5 A;  2CIJ A;  5G22 A;  5AG7 A;  4CS0 B;  4E0A A;  1BAV A;  3JTK A;  3D4U A;  1Y9K A;  2VEZ A;  1ON0 A;  2F7V A;  4MJ8 A;  4R9M A;  3TO9 A;  3CT9 A;  3SHP A;  2DF5 A;  4Z65 A;  5GCN A;  2VZY A;  1Z5R A;  3KGQ A;  1VHO A;  4R3L A;  1PYT B;  4OC2 A;  4P4B A;  4PV6 A;  4RN7 A;  3VH9 A;  3PB6 X;  1LAM A;  5D8N A;  1FNO A;  1Z4R A;  3VWE A;  1K4J A;  1BO4 A;  5C82 A;  4A32 A;  1CM0 A;  3B35 A;  3KHZ A;  2HC9 A;  4MI4 A;  4P4D A;  4A30 A;  2PVV A;  1IOF A;  2RC4 A;  3BHX A;  4NGS A;  3SJG A;  3P2F A;  1Q7L A;  2JBK A;  4P4J A;  4C2Z A;  2YGW A;  4KOT A;  2FL4 A;  4PK3 A;  4AVA A;  4C2X A;  3ZZI A;  4P45 A;  3TX8 A;  3VWD A;  3TC8 A;  3D7D A;  4ZGY B;  1R3N A;  2PR1 A;  2YND A;  5KTD A;  1RTQ A;  1FT7 A;  2V8H A;  3D7F A;  4M6G A;  2GFQ A;  3NA6 A;  3W6S A;  4CGM A;  2V8G A;  3W6X A;  1Y7R A;  3SJE A;  4A94 A;  1XMT A;  1CJW A;  4A2Z A;  5CPA A;  4U5Y A;  4OC1 A;  2J8R A;  4FWU A;  4ONW A;  4XNH C;  4CAW A;  3QNV A;  1I1D A;  3B3S A;  3SJF A;  3CPX A;  4CAV A;  3MN8 A;  3QAY A;  3CXP A;  3KI9 A;  4KVO E;  4A95 A;  4EME A;  2B3V A;  5EC4 A;  4CGO A;  3RAM A;  3IWW A;  2ZEG A;  1F2O A;  3CZX A;  3G8W A;  5F47 A;  3TT2 A;  2CTC A;  1H8L A;  1M44 A;  2ATR A;  4XPL A;  2EK8 A;  3T9Y A;  4B5O A;  2G0B A;  2GLJ A;  4C68 A;  3D67 A;  4B14 A;  4YRH A;  4CGL A;  5DS0 A;  4B6Z A;  1Z8T A;  1PCA A;  1HEE A;  2R8V A;  3S6H A;  2BSW A;  1XEB A;  1WWZ A;  2JDD A;  4L89 A;  4MFQ A;  2PJ2 A;  6CPA A;  4A38 A;  5CNP A;  1NSL A;  4PSX A;  5HXD A;  3PB7 X;  4OC3 A;  4PXE A;  5AGE A;  1YK3 A;  2G9D A;  3DDD A;  5LRG A;  1HDQ A;  2Y0M A;  4IF5 A;  4NCZ A;  3IO1 A;  1XRY A;  2VZZ A;  3N5F A;  4NJR A;  2ZW4 A;  4CAE A;  1UWY A;  2K5T A;  1TXR A;  5IV0 A;  3B2Y A;  3P2H A;  1XOV A;  4Y49 C;  4R8F A;  1Q2D A;  2KCW A;  4H2K A;  1Q2Y A;  2D4O A;  1S7N A;  2Q0Y A;  4UEZ A;  3NFZ A;  1L0C A;  1N71 A;  2Q44 A;  3F0A A;  4JYW A;  2BOA A;  1HDU A;  3D2P A;  5G20 A;  4NSQ A;  3RBU A;  2EO8 A;  2FIW A;  3SI1 A;  2ODF A;  2Z3O A;  3G3S A;  3QB8 A;  1X10 A;  2CTB A;  4KOS A;  4MBU A;  4O23 A;  1IY7 A;  2PRB A;  3D7G A;  4CPA A;  2P6G A;  4KSI A;  2PJA A;  2PVW A;  3E0K A;  4C7H A;  2QML A;  1VIX A;  3D2M A;  5G1Z A;  2WZN A;  1AUG A;  1GYT A;  4JXR A;  3S9M A;  3V7Z A;  5J8F A;  3PFE A;  3VAT A;  2O28 A;  4KUB A;  3WAB A;  1YLE A;  1CPS A;  1ELM P;  3FEC A;  4A33 A;  5JH9 A;  5KTA A;  3SJX A;  4FD5 A;  1OBR A;  1BPN A;  4KVX A;  4UFX A;  3T8W A;  1YGH A;  2XEF A;  1ZO0 A;  3B3T A;  3EFA A;  3FX6 A;  4OAE A;  4ZX8 A;  3BLN A;  2AFO A;  1ELL P;  3NH5 A;  4LX9 A;  1M4D A;  3ISZ A;  3H5Z A;  7CPA A;  2HV2 A;  2DEA A;  1KUV A;  4LQ6 A;  4MCP A;  3D8P A;  2EUI A;  1M1D A;  2IQ6 A;  5HVF A;  4PSW A;  4U9Y A;  4A37 A;  3PBB A;  4UWI A;  4X5K A;  2FSR A;  1YME A;  1IB1 E;  4MFL A;  4IUS A;  1UFH A;  3FXT A;  2B4B A;  4B12 A;  4WJB A;  4FD7 A;  4IAV A;  4UFV A;  4MMO A;  3IWE A;  2B5G B;  1PU9 A;  1QQ9 A;  3EC4 A;  2GRE A;  2V8V A;  4NGP A;  4FD4 A;  2YNC C;  3BJ8 A;  4ORF A;  1XJO A;  2B3U A;  5LRK A;  3KR5 A;  2ABZ A;  2REF A;  4NF1 A;  3JUW A;  4LUA A;  2PJ9 A;  3RNZ A;  2AFU A;  2Q51 A;  1CG2 A;  2ANP A;  2WSA A;  2YNE A;  3B3V A;  4NGQ A;  4DJL A;  2ARH A;  3FIX A;  2ZW5 A;  3SXN A;  2BEI A;  4MXU A;  3GYA A;  2HQY A;  4C7I A;  4TNU A;  4NJQ A;  2CNS A;  1QMU A;  2B4D A;  1KZF A;  1IYK A;  3IWG A;  1Z8L A;  3WC5 A;  3GY9 A;  2AFM A;  2GIV A;  3CXQ A;  2VXK A;  3KR4 A;  1LAP A;  2ZEO A;  3R9E A;  5LYF A;  2O53 A;  3BI1 A;  4F8Z A;  4F9V A;  4OC5 A;  2OOT A;  5HMN A;  4YGO A;  1NMT A;  1MJA A;  2VI7 A;  3V8I A;  2J9A A;  2OZG A;  5K8P A;  1Z8X A;  4PXC A;  4M3S A;  1WK4 A;  4CRY B;  4MHN A;  4F6A A;  2ZOG A;  2OU2 A;  1ZG9 A;  5HH1 A;  3BXM A;  5K8O A;  4P44 A;  4A31 A;  4OAD A;  3CXS A;  3PEI A;  2FVG A;  3DLJ A;  2CF4 A;  1AYE A;  1JWQ A;  3FBU A;  5I4M A;  1OZP A;  2ZW6 A;  2OZU A;  2PJ8 A;  3OWC A;  4CGP A;  4CRZ B;  4DNC A;  3S6G A;  4NEX A;  3D66 A;  1TIQ A;  1CP6 A;  3FF3 A;  2VBQ A;  2WPW A;  4DYO A;  2PJB A;  4EFD A;  3B7I A;  3QAH A;  3FH4 A;  1Z4E A;  1IID A;  2FE7 A;  3DR8 A;  4JLY A;  4F0Y A;  1YX0 A;  2Q4Z A; 
#chains in the Genus database with same CATH homology
 2FCK A;  1YR0 A;  1M4G A;  2JDC A;  1R57 A;  1I21 A;  4AG9 A;  2GE3 A;  4KSF A;  1S7L A;  1P4N A;  2IL4 A;  1MJB A;  4E8O A;  4KOU A;  4MFJ A;  3TCV A;  5J8C A;  1Q2C A;  4B10 A;  2DXQ A;  3R9G A;  2Z3L A;  4H6U A;  2DPS A;  5JQ4 A;  4KVM E;  2F5I A;  1P0H A;  1IIC A;  4CYQ A;  4YFJ A;  4QUS A;  2H5M A;  2ZXV A;  4KZT A;  3ZJ0 A;  4KLW A;  3EY5 A;  2CXA A;  4BMH A;  2PDO A;  2Q7B A;  4AB7 A;  4AG7 A;  4GS4 A;  2JLM A;  5I0C A;  3A9L A;  4CAX A;  2R98 A;  3IU2 A;  4HNW B;  5DWN A;  3IU1 A;  4EVY A;  4OLL A;  4M85 A;  1GHE A;  1S3Z A;  2PQ8 A;  1VHS A;  5C88 A;  4QC6 A;  2X7B A;  4MFP A;  1XE4 A;  1M4I A;  3EXN A;  2BUE A;  3NE7 A;  4KLV A;  3TO7 A;  2DPT A;  4Q36 A;  3LD2 A;  5IB0 A;  1S5K A;  4KOR A;  4XPK A;  4R3K A;  4MHD A;  2G3A A;  2QIR A;  4JJX A;  1YRE A;  2OH1 A;  4HNX B;  4PK2 A;  2YNC A;  1Z9U A;  2BL1 A;  2R7H A;  2AJ6 A;  2CNM A;  3PP9 A;  4B5P B;  5FVJ A;  4L8A A;  4RS2 A;  2D4P A;  4JXQ A;  3H4Q A;  5DWM A;  2QEC A;  2P6F A;  2PR8 A;  4ONU A;  3JVN A;  1S60 A;  2VQY A;  3DNS A;  3MGD A;  4KS9 A;  5F46 A;  1QSN A;  1J4J A;  3D3S A;  3N7Z A;  2REE A;  5JPH A;  2AE6 A;  2ZPA A;  2Z3M A;  1LRZ A;  5A27 A;  1U6M A;  1MJ9 A;  4B11 A;  4QVT A;  3PGP A;  1MK4 A;  1QSO A;  5AG4 A;  2WPX A;  2B5G A;  4F0X A;  4R57 A;  2FT0 A;  1QSR A;  2WUU A;  4CYO A;  4UWJ A;  2ZW7 A;  4KSA A;  2Z3K A;  4R87 A;  3FB3 A;  4Y49 B;  4B5P A;  3B8G A;  4RI1 A;  4MFK A;  3C26 A;  2EVN A;  4HNY B;  3SXO A;  2B58 A;  2J8M A;  3S6F A;  5H86 A;  1B6B A;  4KOX A;  1XF8 A;  2P0W A;  4J3G A;  4MY3 A;  3T90 A;  4KOV A;  4BBH A;  2A4N A;  3FYN A;  3KKW A;  3I3G A;  2HUZ A;  1VKC A;  4JWP A;  1S7K A;  2I79 A;  4Q38 A;  4MY0 A;  5F48 A;  4E2A A;  2GAN A;  2Z10 A;  3R1K A;  4KOW A;  5BWA B;  1YVK A;  4K30 A;  2Q04 A;  2Z11 A;  4HKF A;  1I12 A;  5E96 A;  5G21 A;  2OB0 A;  4QB9 A;  2PC1 A;  3IGR A;  1YVO A;  3PZJ A;  3RYO A;  3F8K A;  4KOY A;  3R9F A;  2C27 A;  3GKR A;  4U9Z A;  3DSB A;  1RXT A;  3K9U A;  1KUY A;  3I9S A;  4UBR A;  5ISV A;  4UFW A;  1KUX A;  5EBV A;  3TTH A;  2Q4Y A;  2Z3P A;  1FY7 A;  5A28 A;  4AVC A;  4I49 A;  4XPD B;  4KUA A;  3F5B A;  3TOB A;  1SQH A;  3LOD A;  2P6E A;  3S6K A;  4CGN A;  2CNT A;  4UCM A;  4JD6 A;  3TFY A;  3WR7 A;  1V0C A;  1S7F A;  3FRM A;  1QST A;  3FNC A;  2B4D B;  2Z3N A;  1IYL A;  5KTC A;  2FIA A;  4II9 A;  2I00 A;  4FD6 A;  3R96 A;  3TOA A;  2R1I A;  2Z0Z A;  3BJ7 A;  1PUA A;  1QSM A;  4UCN A;  2G3T A;  3TO6 A;  4CYP A;  3DR6 A;  4CAF A;  4CYN A;  3W91 A;  1XIX A;  5AG6 A;  2Q4V A;  5F49 A;  3R95 A;  2FS5 A;  2PSW A;  4C2Y A;  4B13 A;  2JEV A;  4ZBG A;  2FXF A;  2NMT A;  4UCP A;  1B87 A;  2J8N A;  2OZH A;  5H84 A;  1BOB A;  1Y9W A;  4MFZ A;  2CY2 A;  4H89 A;  4XPD C;  4UA3 A;  3UY5 A;  4XNH B;  1NE9 A;  3EO4 A;  5IX3 A;  4NXY A;  4AVB A;  4QBJ A;  3TE4 A;  4H6Z A;  1RO5 A;  5G22 A;  5AG7 A;  4CS0 B;  4E0A A;  3JTK A;  4MJ8 A;  1Y9K A;  2VEZ A;  1ON0 A;  4R9M A;  3TO9 A;  3SHP A;  5GCN A;  2VZY A;  4R3L A;  4PV6 A;  1Z4R A;  3VWE A;  1K4J A;  1BO4 A;  5C82 A;  4A32 A;  1CM0 A;  4MI4 A;  4A30 A;  2RC4 A;  3P2F A;  4C2Z A;  2YGW A;  4KOT A;  2FL4 A;  4PK3 A;  4AVA A;  4C2X A;  3ZZI A;  3VWD A;  4ZGY B;  2PR1 A;  2YND A;  5KTD A;  3W6S A;  4CGM A;  3W6X A;  1Y7R A;  1XMT A;  1CJW A;  4A2Z A;  4U5Y A;  2J8R A;  4XNH C;  4CAW A;  1I1D A;  4CAV A;  3CXP A;  4KVO E;  4A95 A;  2B3V A;  5EC4 A;  4CGO A;  3G8W A;  5F47 A;  3TT2 A;  1M44 A;  2ATR A;  4XPL A;  3T9Y A;  4B5O A;  2G0B A;  4C68 A;  4B14 A;  4YRH A;  4CGL A;  2R8V A;  3S6H A;  2BSW A;  1XEB A;  1WWZ A;  2JDD A;  4L89 A;  4MFQ A;  5CNP A;  1NSL A;  4PSX A;  5AGE A;  1YK3 A;  3DDD A;  4NCZ A;  2Y0M A;  4IF5 A;  2VZZ A;  2ZW4 A;  4CAE A;  2K5T A;  5IV0 A;  3P2H A;  4Y49 C;  1Q2D A;  2KCW A;  1Q2Y A;  2D4O A;  1S7N A;  2Q0Y A;  1L0C A;  1N71 A;  2Q44 A;  3F0A A;  3D2P A;  5G20 A;  4NSQ A;  2FIW A;  3QB8 A;  2Z3O A;  3G3S A;  4MBU A;  4KOS A;  2PRB A;  2P6G A;  3E0K A;  4C7H A;  2QML A;  3D2M A;  5G1Z A;  4JXR A;  5J8F A;  2O28 A;  4KUB A;  1YLE A;  4A33 A;  5KTA A;  4FD5 A;  4KVX A;  4UFX A;  1YGH A;  1ZO0 A;  3EFA A;  4OAE A;  3BLN A;  4LX9 A;  1M4D A;  3H5Z A;  2HV2 A;  1KUV A;  3D8P A;  2EUI A;  1M1D A;  4PSW A;  4U9Y A;  4UWI A;  4X5K A;  2FSR A;  1IB1 E;  4MFL A;  4IUS A;  1UFH A;  3FXT A;  2B4B A;  4B12 A;  4FD7 A;  4UFV A;  3IWE A;  2B5G B;  1PU9 A;  3EC4 A;  4FD4 A;  2YNC C;  3BJ8 A;  4ORF A;  2B3U A;  2REF A;  4NF1 A;  3JUW A;  4LUA A;  2WSA A;  2YNE A;  2ARH A;  3FIX A;  2ZW5 A;  3SXN A;  2BEI A;  4C7I A;  3GYA A;  2HQY A;  2CNS A;  2B4D A;  1KZF A;  1IYK A;  3IWG A;  3GY9 A;  3CXQ A;  2GIV A;  2VXK A;  3R9E A;  5HMN A;  4YGO A;  1NMT A;  1MJA A;  2VI7 A;  3V8I A;  2OZG A;  4M3S A;  1WK4 A;  4CRY B;  4F6A A;  2OU2 A;  5HH1 A;  4A31 A;  4OAD A;  3CXS A;  3FBU A;  1OZP A;  2ZW6 A;  2OZU A;  4CGP A;  3OWC A;  4CRZ B;  4DNC A;  3S6G A;  4NEX A;  1TIQ A;  2VBQ A;  2WPW A;  3QAH A;  4JLY A;  1Z4E A;  1IID A;  2FE7 A;  3DR8 A;  4F0Y A;  1YX0 A;  5AG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...