1Q2XA

Crystal structure of the e243d mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with substrate aspartate semialdehyde
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
371
structure length
356
Chain Sequence
b'MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKDEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title The role of substrate-binding groups in the mechanism of aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
source organism Haemophilus influenzae rd
molecule tags Oxidoreductase
total genus 109
structure length 356
sequence length 371
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1q2xA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1q2xA01
2BMAA 2R00C 4G5HA 4ROSA 2VNSA 4BGUA 1Q0QA 3GZNA 4Z9FA 3TZ6A 1UXHA 5TRTA 4INAA 5CDUA 3ADPA 1KVRA 2QRLA 2NVUB 4BKOA 1T2AA 1ADFA 3PPIA 4XYBA 4BGEA 2P4QA 4EEZA 3CZMA 1H6CA 4YJDA 3IC5A 3IP1A 2X0RA 3EHEA 1QYCA 1VKOA 5BSHA 1E6UA 1GZ3A 1EDZA 2EGHA 2PD6A 3ICCA 3PEFA 5ENDA 3UGKA 4BUCA 4EI2A 4LN1A 3VAZA 3WMWA 3KZVA 1ZNQO 4OQYA 3IL2A 3GN2A 3I9JA 1K89A 4IDGA 2OBNA 5ER9A 2HAEA 1X15A 3IUSA 1OFGA 1YB4A 3B6ZA 3D4OA 1RYEA 1KEPA 4XQCA 2X86A 4BO4A 1A7AA 1BVRA 3PYXA 4NU5A 4YYZA 5L95A 4XB1A 5CHEA 3DL2A 1HDRA 4IZIA 4OKIA 4RF3A 4DC0A 1MC4A 1VL0A 5I7EA 1O95A 2Y1GA 1KVSA 1NM5A 3KO8A 3NJ4A 1WXDA 2GN8A 1NQOA 4WPGA 3I52A 3GAFA 2OMEA 4E5MA 5ICSA 3CPSA 1XQ1A 3D4NA 4CM9D 2ZKLA 1C0PA 4L8VA 3NTRA 4NNJA 2ZYAA 2CF6A 2C5EA 3D64A 1QYVA 2VWPA 5JLAA 2PZLA 1NYTA 4IS2A 1QYWA 3GC6A 3PI7A 4BMVA 4WE3A 3TF5A 4IBOA 3H65A 2FPIA 2YYYA 3NX4A 1A5ZA 5JW6A 5HS6A 4CMEC 3D5TA 4C7KA 2HKIA 1GFSA 3AI2A 4XEHA 3Q2KA 1HYHA 3QLJA 3RUHA 2Y66A 3NGXA 1Q2XA 3EVNA 1YQXA 4ZVVA 3GDOA 1AN9A 1G1AA 2Y1EA 1E92A 1EEHA 2D3TA 2HMVA 4I9HA 5JDIC 1KERA 3O03A 1YJ8A 4A5OA 1DRVA 4LVCA 2JD1A 1LU9A 3BTVA 2JKVA 1EK6A 2RHCA 4NBWA 4ZQEA 4GX5A 1NWHA 3QVOA 4I08A 4F6LA 4WNIA 3KYDB 4E5KA 4QFDA 4KOAA 3ZN2A 2FZWA 1N1GA 2FY8A 3I1JA 1R4MB 3VZSA 2ZJ1A 2C82A 3KV3O 4D0SA 1GUZA 3MJVA 3FNHA 1VJTA 3ROQA 3PIDA 3OEWA 3VPSA 4BKRA 3FI9A 5IFLA 2G17A 1I01A 5F1OA 2PD3A 3TDKA 3WNQA 1HKUA 3RI3A 2BFOA 1GYQA 3FHLA 4ALIA 2UYYA 4WOKA 1DIHA 3ITDA 1EBFA 3LC2O 1M66A 4OL9A 4PLCA 1NNUA 4QO7A 4RVGA 5IDQA 4NBUA 4UREA 4BNIA 1X1EA 2VUUA 1H6BA 1YL5A 4FC6A 5JO9A 2BD0A 3PRJA 3CMMA 2G5CA 3KYCA 1PJQA 2A35A 3N74A 3ONEA 3O9ZA 1B14A 3RBXA 3Q2IA 1JDJA 3CSDA 4CMKA 2GR9A 3GFGA 1UAYA 4MIYA 1L1FA 3UOGA 3GMSA 5L9AA 2GLXA 4I5EA 4E5NA 4J1TA 2W2KB 3RC1A 3E9NA 5L7WA 1VRWA 4RCVA 3GQVA 4YT4A 2JAPA 2HK9A 1X14A 3ZNNA 1PZEA 1AXEA 1X13A 4DPMA 1E1KA 4NJMB 1NXQA 1GZ4A 3RWBA 4BMNA 4WUVA 2EJWA 2EKPA 3VH2A 4U7WA 2GASA 3GEGA 2Q4BA 4P4LA 4ZRMA 3OQ1A 3U49A 1ISHA 1U4SA 5A05A 1ZEMA 5ADHA 4A73A 4UUPA 1P9LA 1XSEA 5ENVA 4B4VA 4DQUA 4QUKA 1LQTA 3OF2A 3L4SO 4GVLA 4R68A 1PGNA 3H4VA 5A5FA 5U9CA 4BNZA 2PTGA 3LSYA 3ONFA 3AFMA 2OGUA 1ARZA 2GNAA 4WCFC 3L6DA 4NJOA 3ST7A 3V2GA 2Q99A 3HFGA 3K8ZA 4WEQA 4QT0A 4Q3DA 1CIVA 3I9KA 3UW3A 1FXSA 4CLEA 5A9SB 3TOXA 3S2IA 1EVJA 3BIOA 3GDFA 3A9WA 3KTDA 3S2FA 3T7EA 1GQ2A 4DGSA 3RROA 1HE2A 4XA8A 2IDZA 3L07A 3Q11A 1F8GA 2WE7A 5B12A 5FYDA 5K6AA 4EJ0A 1HE5A 1HRDA 4OH1A 4FW8A 2I3GA 1AE1A 4JJGA 1UP4A 2PLAA 4M54A 1Z7BA 4CUKA 3Q9NA 5L7YA 4A03A 5ILGA 2A4KA 3KM0A 4YRDA 1P0FA 4XYLA 4M89A 2R2GA 3PHGA 3KHUA 1V3VA 4HNGA 3ASUA 2BKAA 3H3FA 3TRIA 3NT5A 3K2EA 4BO6A 5JYEA 4JBIA 4CV2A 5B4VA 4CM1A 3DBHB 5EINA 2WD7A 4ITUA 4YB8A 5GMOA 3IS3A 3UHAA 4ALJA 1HDXA 1QSGA 1XHLA 5MDHA 2AA3A 1EDOA 1HYGA 1H94A 1FF9A 1PS8A 2P2SA 5TJ9A 2E6UX 2EKLA 4J4TA 4EUEA 2D8AA 1YKFA 1J6UA 2P9GA 4E12A 2OXIA 3HG7A 3PHLA 1TVEA 1LSUA 1QYXA 4FFOA 3N58A 1X0VA 2CVZA 1P3DA 3RFVA 4QXMA 3AOGA 1TI7A 4E13A 3WGTA 3Q0EA 3KOUA 5IJZA 3E8XA 4R3WA 3UUWA 2BELA 3JTMA 5C7LO 1T24A 1EVYA 1NX6A 5T57A 3IKTA 3AU8A 4YJHA 4XDZA 4CODB 2OZPA 2OORA 3DBHA 3FWZA 1T2DA 3E6AA 3AY6A 4CV1A 4HFJA 4UVDA 5FFFA 3JQ7A 2BRUA 5G4KA 4DBZA 2HU2A 5A06A 2J5RA 3TFOA 4XYMA 1Z6ZA 3GR6A 3NV9A 4IZHA 2ZYGA 2FSSA 3ZV3A 4PN3A 1U28A 4CLHA 3ETEA 5C3MA 4NFSA 4IDEA 3GN1A 3U09A 5IG2A 1J49A 4WKGA 3DXFA 4JQCA 4KUGA 2X0IA 4MDHA 3DBRB 2VHWA 3OICA 4LCJA 5BNIA 2PR2A 2PKQP 4L9RA 4YTEA 3DONA 4YA6A 2FN7A 3OJ0A 3QJ5A 4HNHA 1PQWA 3AY3A 4J1NA 1DRWA 4MVJM 1CQIA 4PLVA 1SMKA 2Y93A 3GT0A 1XR3A 3PGXA 3ULKA 2W90A 4ZQBA 4AL4A 1E3LA 8ADHA 1ZK4A 3GVCA 5IXYA 1WZIA 2HRZA 2PKRA 3EC7A 2D1YA 1LEHA 4D43A 2AEFA 5K9ZA 1LJ8A 3JQ9C 4Z0TA 4IPTA 4EW6A 1WDKA 1FDVA 1ZK0A 2YZ7A 4HFMA 4MKZA 4YCAA 3DOOA 1CF2O 5I9LA 1C1DB 3UXYA 1ZCJA 1IE3A 1KEUA 1K0UA 2H6EA 5AVOA 3I4FA 2DC1A 2HLPA 2WJPA 2O2YA 2Z1NA 1P31A 3FTNA 5THQA 1U7TA 5I7FA 3OETA 4OXKA 4WLOA 2B0JA 3WYCA 1NP3A 1GU7A 4CJXA 3C24A 3ZWCA 4DIBA 4BNLA 3LDHA 4QO8A 4J1QA 4Q3EA 1XU9A 2X7HA 5KJCA 1RM3A 1RYDA 5DZSA 3ZWYA 3CH6A 1PTJA 4R69A 4U6QA 4EBFA 3ZW8A 3WTBA 1A9ZA 1EVIA 3C85A 3KEQA 1LBEA 4HX5A 5M6DA 4DLAA 3VPFA 4J91A 1Y9EA 2D4AA 1JWBB 5HRUA 4CLDA 1PJBA 1TXGA 1LA2A 2J8ZA 1J5PA 3K2BA 2RHRA 3FBTA 5HS4A 1L7EA 3ZWNA 1LRLA 1E3WB 4FCCA 1I3KA 4BMSA 5J9GA 4O6VA 4HFNA 1E3EA 4AJOA 1I3LA 2ZB8A 2AHRA 4YT8A 4GQAA 1N5DA 1LSSA 3X2FA 1E7MA 4ZA2A 3OIDA 1ONPA 4IJWA 2PA3A 2VOEA 3ETDA 3V1TC 5I9NA 4XD2A 2YHIB 5KKAA 3MOIA 1GDHA 2CF5A 3OEYA 4BNKA 3KYBA 4B3JA 1LC3A 1DRUA 2EIHA 4U5QA 3JD0A 2HMUA 4KQWA 1R0LA 3CMCO 2DQ4A 3S1LA 3WGGA 3WQSB 2PGDA 3AM4A 3JQBC 1BGVA 1I5RA 3KUXA 3ZWAA 2NLOA 3BZUA 2FHSA 4OO3A 4ESOA 1NBOA 1P1IA 3GA0A 4B3IA 3QVSA 4LSWA 3NAQA 1LLQA 4N54A 4ND2A 2IEDA 2ZB3A 4BKQA 1QV7A 4KP7A 4IMPA 4CQMA 3ANLA 4FOSA 4CLRB 1F0YA 1AHHA 3BHIA 4XQ9A 4K9DA 3ANNA 3QWAA 3RUDA 3JQFA 1NVMB 1YRLA 1VL6A 1XEAA 1H0KA 3PWKA 4A2CA 1U8FO 1Y8QA 3PVZA 4Y8VA 2J6IA 3DHEA 3IUPA 3WGYA 4PLHA 4KUEA 2GZ2A 4JCOA 1ONOA 2VWGA 5JYFA 5KVSA 2V7PA 1XLTA 2XXBA 3DFUA 1WW8A 4I5FA 5JCXA 1VKNA 2PK3A 5KTKA 2Q45A 3NTOA 1HE3A 1QG6A 3RKRA 4BO5A 5L40A 1ORRA 4J9UE 3AY7A 1SEPA 4CLRA 2EERA 3SLKA 3FR7A 4TRMA 3H9GA 3DZGA 2EF1A 1C3VA 1VLLA 4NBVA 4WGGA 3WLFA 2PNFA 4BO3A 1JU9A 2B37A 1H2BA 3F4BA 1XELA 4TKMA 4E5YA 1Y5MA 3JQ8A 4NI5A 3FD8A 2AQ8A 1S7CA 1H6AA 1F8FA 4MVJA 3GEMA 4WECA 1AHIA 1IPEA 3H3JA 3HN7A 1VM6A 5U4QA 3MJTA 4IIVA 2ZTMA 4RF4A 8LDHA 2OBYA 2B83A 1U3WA 4ALLA 2H1SA 2FSVA 2UUOA 2JJYA 3GMDA 3HADA 1EBUA 5IZCC 1HF3A 3WWYA 5CEEA 2ZTVA 3C8MA 5A9RA 2X5OA 1MFPA 1A71A 3BMCA 1WDLA 4AJEA 2DU8A 3AWDA 4BNJA 1U3UA 2Z95A 3RUCA 5KVCA 4CM3A 3ZDFA 2PGLA 1JWAB 2ZJ0A 3AM3A 5AXBA 3WIEA 4L0QA 4LVUA 3KLMX 3WXBA 3ZWOA 3ZV6A 1MA0A 2EW8A 4R54A 3AUUA 1ZIDA 2XAAA 1BXGA 1V6AA 2I9PA 5G0TA 3KETA 4JNKA 3GLQA 1UJMA 2WM3A 1PQPA 5TT1A 4CMIB 1YBAA 2YDYA 4AG3A 4CV3A 3DO5A 5EESA 3W4IA 3R3JA 5KOIA 2DBRA 5KCZA 4OSPA 1DLIA 3WGIA 4IJKA 1E6EA 5IAAA 4URFA 2Q3EA 3NEPX 2Y99A 4MP8A 1K6JA 5G0WA 5KKCA 1ISMA 3P5SA 2J5KA 1YQDA 4E4YA 1ONNA 7ADHA 4M87A 2E48A 3MJ4A 1DDOA 2EV9A 3PIIA 4RVDA 5T6BA 1C0LA 3ZWMA 1P1JA 3L77A 4PLWA 4ZQHA 1RKXA 1H9BA 4N5MA 2GZ3A 4CR8A 5CAEA 2FR1A 1T1RA 1KEWA 5A04A 4FPXA 1K6IA 1B8PA 4MVJP 4YEDA 1R6DA 2NU8A 4E2XA 4XYGA 1QYDA 3QVTA 1EUDA 1P1KA 1E0DA 5L4LA 1HETA 2WMDA 3N7UA 4Z0PA 3LVFO 2BH9A 1PR9A 2EW2A 3F9IA 1XKQA 1A4UA 4RPJA 3SEFA 1JA9A 3O8QA 1PGOA 4KDFA 1KOLA 1O0SA 5CP8A 3O4RA 1XIVA 4GI2A 1TT7A 4CQMD 4TZKA 4R3NA 3M1LA 1UDBA 2VHZA 5TJHA 1SPXA 1MXFA 3C1OA 2P91A 2Q4EA 3VKVA 1T2FA 4FB5A 1LSJA 2H63A 4FS3A 3AW9A 1DJQA 1GZ6A 3T4EA 3GFBA 1C14A 5TF4A 5JS6A 1DSSG 1Y81A 4OKNA 4LGVA 3UCXA 4B4OA 3E5RA 4JJFA 2X0NA 3RC2A 3NJ8A 2YY7A 1KS9A 4E2YA 3HDYA 3Q6IA 4TZTA 2AE2A 3TJRA 4D3SA 4QX6A 1MUUA 2CDCA 4YPOA 2EP7A 3G0OA 5EMHA 1PWXA 1E3JA 5JY1A 1GEEA 1ZH8A 5JMPA 4NDNE 1HSZA 2NTNA 3LYLA 3ZWVA 1YWGO 3I6QA 5DCUA 5GZ6A 3QVXA 1P44A 3QA9A 3GG2A 4M55A 4ZQGA 3L4BA 3I23A 4BO9A 1O8CA 4DBVO 2EJVA 2O23A 3W8DA 3ZWWA 4E32A 1NHWA 3F1LA 2EWMA 1PGQA 3SJUA 1FMCA 3FNFA 3GEDA 3ZW9A 1ZJZA 5DP2A 2P5UA 4N7RA 4MVJD 2HMWA 1DJNA 3NDIA 1BRMA 2EKQA 5BNTA 4MKXA 3PQFA 5F5LA 3DBVO 1ZFNA 2BI8A 4F46A 5T8KA 4E6PA 4FSHA 4K6FA 1IPFA 3AU9A 3NDJA 3ABIA 2XXJA 1LTHR 2J3HA 1BXZA 3H9QA 3MWDB 3DZFA 4Y6PA 4Z3DA 2IODA 3ZNOA 2NSDA 1ZSNA 5I8WA 2Q1UA 4FDAA 2Y1CA 2B4RO 1LLCA 4KZPA 3ZHZA 2JFHA 3PP8A 1EUCA 3FR8A 4RPKA 2NVUA 2Y0EA 2VWHA 3VPXA 2NTVA 3BXXA 4UUNA 4GWKA 4IXTA 1DPGA 4CLOB 5DBFA 1EFLA 4JP3A 1PWZA 1MB4A 1FDWA 5BQFA 2VRCA 5F1PA 3MTGA 2OHXA 1ENOA 3ZNPA 3PJFA 4D42A 5L53A 2C54A 2GD1O 3K92A 3OSUA 3R1IA 3UFXA 3OQ6A 4MVJG 2CY0A 3NTQA 3G1UA 1JTVA 2UAGA 3LF2A 3HJAA 2GZ1A 4XWYA 4RDHA 4LRTB 4HADA 1E7SA 2PZJA 2I67A 3V1UA 3EZLA 2YUTA 1QP8A 5HM8A 4JX8A 1BDMA 1R0SA 5JCJA 3UICA 3M2TA 1P33A 3GH3A 3UF0A 3D3WB 1GCOA 2ZB7A 3E9MA 4Q3CA 2Z5LA 4P22A 2HJSA 2C5AA 1V9LA 4Q3NA 1M2WA 1CQJA 2V6BA 3DAFA 2BFPA 1YL6A 1T4DA 2Q50A 3RUFA 3U4HA 4ZQFA 4NFYA 4YJGB 5THKA 4TVOA 3W8FA 3WX0A 1LDYA 4CUZA 1T2CA 3JCZA 5EPOA 1WAMA 1UAGA 1KY4A 3OH8A 5JDCC 5COBA 1WLYA 1AGNA 1VPDA 4GGPA 4WLUA 1I0ZA 1N7HA 2Q1TA 5DF1A 4WCDA 1G0NA 1PU2A 2FOIA 3QE3A 1K2WA 1C0KA 5AXDA 4BNXA 2EEZA 1KVUA 4ZU3A 3D3WA 2ZIZA 3BMOB 4OHUA 2WYWA 1CETA 4Q3BA 3DAPA 2EXXA 2RH4A 1TB4A 4OOEA 2XPCA 5FEUA 1DEHA 2VYVA 2IRWA 3QWBA 4YJGA 4AJ4A 2JD2A 3NYWA 3TQHA 4XQEA 5DN9A 5HBRA 1EMDA 3K96A 5LDHA 1SAYA 1PSDA 1NVTA 4YRBA 3RUEA 1ENYA 3KYDA 3DMYA 5A3JA 1D3AA 5JYAA 2O7QA 1WZEA 1SZJG 1PZHA 1HDGO 1R4MA 2CSUA 1WP4A 3AUAA 3WIDA 2A92A 4K1LA 1ENZA 2D59A 1Z75A 4R1NA 3LF1A 2DFVA 2JCXA 3H2SA 4IDDA 2FPGA 2O3UA 2OOSA 1ZK3A 3DDNA 3DZHA 3TSCA 4YACA 3KSZO 1E5LA 3BMOA 1N7GA 1I2ZA 4RF5A 3EZYA 2GO1A 2JAHA 3P7MA 1LLUA 4BO0A 1CJCA 5TLSA 1GR0A 3DTYA 3QWFA 1GYRA 2ZQZA 4G2NA 5A02A 1B2LA 2DLDA 1LI4A 3JYPA 3FRJA 4TRRA 3VKUA 3F5QA 4OXYA 2C59A 4Z9XA 4PZCA 3PJEA 4E2WA 5EQDA 6LDHA 2FR0A 1R4NB 2C2XA 3KB6A 4AJIA 3NKLA 2E49A 1R0KA 5GY7A 2NNLD 3INRA 2UUPA 3DBLB 4O59O 2QX7A 3ROPA 2ILTA 2IXBA 2HK7A 3JYLA 4K26A 4RO0A 4XX0A 2W2KA 4HKTA 4MVJE 1PJ2A 3RUIA 1Z7EA 2BFAA 4W7HA 1XG5A 5L4NA 4RQUA 2GGSA 2HUNA 1MX3A 4EEXA 3ZH2A 4A26A 2G76A 4EDFA 5H83A 3L0DA 4NJMA 3H5NA 1E3IA 1TEHA 1BWSA 4J3FA 1V8BA 4N5LA 4Y6SA 4CLXA 2VRCD 1N2SA 3BMNB 4YBZA 1NTOA 3I3OA 4PLTA 1FK8A 3VDQA 4AFNA 3D1LA 3GGOA 3DR3A 4WNCA 4FJ2A 3WMXA 4QSMA 1I3NA 3ZWPA 4JJIA 3RASA 4FBGA 4HY3A 4W6ZA 3DBLA 5CDSA 3FF4A 3LU1A 4YDRA 4GKBA 2POQX 1X0XA 3EGOA 3QHAA 4L74A 3H5AA 4NBTA 4PLZA 4PZEA 3KSUA 2B4TO 1U7HA 1NFFA 1U5CA 1X7HA 3SLGA 2ZK7A 4B4WA 4NIMA 3OA2A 2PD4A 3LT2A 5A9SA 7MDHA 2QZ9A 3ASVA 3L9XA 1UH5A 1DLJA 4J90A 4ZICA 1GUFA 3VVBA 1QKIA 3VH4A 5MGBA 1EFKA 4XYEA 1SO8A 1ZMTA 3A1NA 1JW9B 2VUTA 3GRPA 4PLGA 4E33A 1PJ3A 3GNSA 5JCJD 2DKNA 3ZU2A 3BMNA 4W9NA 1IULA 1A7KA 5DBIA 4GWGA 2A94A 4DQXA 3ZNQA 3G79A 4PZDA 3MOGA 2AEMA 1BVUA 3TL3A 4DUPA 3EDMA 1RM0A 3DTTA 3PHIA 3QY9A 3BAZA 1YB1A 2PKQO 3F46A 1CEQA 3W4KA 3E5MA 3QWHA 5EQFA 4P8RA 4J16A 1YDWA 1G0OA 2P9EA 4J4BA 2YFQA 4JIGA 4QFCA 1UDAA 3NRCA 5HA5A 3HWRA 2NQ8A 2R6JA 1I36A 3JV7A 2DVMA 2CDBA 3EYWA 2X5JO 3ONDA 3VPGA 4IXWA 1IHYA 4AJJA 3S55A 4OJNA 1NFQA 4IQ8A 1LRJA 3GHYA 4J7CA 3T4XA 4R5HA 1U4OA 3VTFA 3DOCA 4BNNA 4JXKA 4GL4A 4DA9A 5BNFA 2WEKA 4BOYA 3AOEA 1R37A 4A27A 1YONA 1XGKA 2DPGA 2IZZA 4IGFA 2VYVD 1UUFA 2O2SA 2C29D 3MWEB 4J7UA 4II3A 3UH1A 3RCBA 3D4PA 3MJCA 3M1AA 3GNQA 4MO2A 4NG5A 3W6UA 1YB5A 1OZAA 4BNWA 1K6XA 1DIBA 1UZMA 4B7XA 3SC6A 4NMHA 2HCTA 3DC2A 4WK6A 3SXPA 3WSVA 1U3VA 3VHRA 4BO8A 2JCYA 3I83A 1X1TA 1WDMA 5B4UA 3GUCA 3K5PA 2V6GA 4G65A 4LMRA 3K73O 1Q7GA 3JD3A 4RF2A 4I5DA 1U3TA 2GN6A 3I9NA 4BB6A 3ENKA 1VSVA 3ZWXA 1W4ZA 2D2IA 2XF8A 4FR5A 1HXHA 1U1IA 4YQZA 3RC7A 1PIWA 3LZ6A 1KEVA 4D79A 3PFFA 1OMOA 5K6AC 2I5PO 2ZATA 5ER6A 2PH3A 4BO1A 4WLNA 5TIIA 1PZFA 3E1KA 4RL6A 2C07A 3DBRA 4S3MA 3O26A 2DBVO 2ZQYA 5ITWA 1VL8A 4UULA 1HSOA 4E30A 4B8WA 4BNMA 2LDXA 5JMWA 5CPFA 4IUYA 2DBQA 4OYRA 1NPDA 1VE9A 3WLEA 2QRKA 3IJPA 1I8TA 4J7XA 4BHTA 2GF2A 4BVAA 4CQLB 1IL0A 3EW7A 3NT2A 4M8SA 1O89A 1UXIA 4ND4A 1ENPA 3VC7A 4XCVA 3EUWA 4XR4A 4EUFA 1C0IA 4E3ZA 5KJ6A 1O5IA 4TMFA 1M6HA 2BGMA 2PFGA 2V65A 3ON5A 3VPHA 1GPJA 4AJHA 1HT0A 4ND3A 1NPYA 3V2HA 3QSGA 1ZSVA 4HXYA 1LSOA 4HUJA 4M49A 1E7WA 1PZGA 3GGGA 3INGA 1XQ6A 4IDCA 5DDIP 2EGGA 4D3DA 1A9YA 4PIVA 1C1DA 2YV1A 1ULSA 5KWEA 1PS0A 5IF3A 4ZRNA 2Q1WA 2JHFA 2AMFA 4CQLA 6ADHA 3OIFA 4PVCA 2CFCA 4IJVA 3VOSA 1YDEA 4AJLA 3U9LA 3I6IA 2X22A 2WE8A 4RGBA 1E7QA 5TX7A 1T2EA 2LDBA 1CRWG 1OBFO 2B5WA 3G17A 4MIEA 3TFQA 3VZPA 3UCEA 4DMMA 4D41A 3RUAA 2NVWA 1Y6JA 5CG2A 3WQRA 2VZ9A 4UVGA 4MOWA 1H6DA 5ICMA 3WFJA 1G6KA 4WLEA 2BFMA 2RH8A 5CEJA 2QYTA 1ZUD1 1NQ5A 5I7VA 4IY1A 2GUGA 3DMTA 5A9TA 1TT5B 4BQRA 3FPLA 4KDEA 5TC4A 1E3WA 2WSBA 4L4SA 3WYEA 4R51A 4CM8B 5KJEA 3EMKA 1K3TA 1DIGA 2JFGA 2NM0A 2X23A 4GVXA 4XRRA 3PYLA 1BHSA 4YJFB 1VJ0A 3WWZA 1OC2A 1EE9A 3CE6A 3LLVA 3CXRA 1PJLA 1ZMOA 4U0JA 1QRRA 1LDBA 2NVBA 2YHIA 5FWNA 4YT5A 3DOJA 3WR5A 3JYNA 4P4NA 4XKJA 1MGOA 1SCUA 4YWJA 1BW9B 1NAHA 4FGWA 3C1TA 2OP1A 3WS7A 1B7GO 1NFRA 5DBGA 2V6MA 4DPLA 1QLHA 3O38A 4H7PA 1DC4A 2E82A 3A14A 4LCEA 4OM8A 4YT2A 2X5KO 3B1JA 2GDZA 2E4AA 4BNHA 4TWRA 4CM8A 2Q2QA 1U9JA 1U5AA 3KXDA 2UDPA 3GG9A 4YJFA 2AXQA 1QORA 2IEBA 3VH1A 3R6DA 1ZXLA 1Z45A 4FD3A 1D8AA 4I9NA 4G81A 3GDGA 1ISJA 2NUAA 3R3SA 1T1SA 4RLHA 2C7GA 5L45A 3L6OO 4PG5A 5AQ1A 1RWBA 3PFWO 1VI2A 3AJRA 4IJUA 5DOZA 2VHYA 4FFNA 4B3HA 3PWZA 1UXGA 3NT4A 2VT2A 5LCXA 1P0CA 3OJEA 1GTMA 1LQUA 4GH5A 5DULA 1EE2A 2C2YA 2X9NA 4R41A 4Q9NA 3RVDA 1NPTO 1YH3A 4R1UA 1GQQA 4AJPA 2G0TA 1ZSYA 4MIOA 3UKOA 3UCFA 3T7CA 1UP6A 2Y1DA 3HDHA 1Y8RB 3MJEA 1SBYA 5IN5A 3P19A 3OFSA 3ZI0A 3GVXA 4BV8A 4YQYA 1IZ9A 1H9AA 3VDRA 4IGEA 4BL5A 1I2BA 5K0ZA 2F00A 4DLLA 5TNXA 4B79A 4MINA 4J2HA 3SBOA 3ANMA 3DEYX 4II2A 1HL3A 1ISIA 1OOEA 5KNLA 2Y0CA 5CEFA 5J23A 2NTJA 2X4GA 5U1PA 1I10A 5G2OA 1GUYA 2QHXA 3GUYA 3RKUA 3I9LA 2I6TA 1HWYA 3AI1A 4MVJI 2C0CA 2GPTA 2R00A 4UEOA 2YQ5A 5IDXA 3DWFA 1C1XB 4CM7A 3FNEA 4OMUA 1N1EA 1M6WA 4CL8A 1Y1PA 1P1RA 4OQZA 4C7JA 3RU7A 4Q3AA 9LDBA 4BIIA 2DUWA 4U0KA 4I9UA 4YAGA 1GPDG 3E03A 1KC1A 1L7DA 1B3RA 3QRWA 3RSHA 4KMSA 1A72A 4GGOA 2GSDA 3C7DB 3JQFC 1SOWA 1M75A 3F3SA 4LMPA 5EJ2A 4CMIA 1PQUA 3FNGA 3PQDA 5TSDA 3LLSA 4J2OA 3IOYA 4NK5A 3HZZA 4BO2A 2QYSA 2O7SA 3A4VA 3JSAA 3C7AA 4IDBA 2O3SA 3KVOA 1C1XA 4FN4A 3EY4A 4XJTA 4RVFA 4CMAA 1EK5A 4EGFA 4Z3KA 2OO5A 3Q1LA 2AQIA 4FC7A 5ITVA 3HUDA 4IMRA 4R01A 2VUSA 1I33A 2RCYA 3DZKA 1K5HA 4M86A 1V35A 4YAIA 4B8ZA 1CWUA 3RQSA 3TPCA 4RJTA 1E77A 3JD4A 3DAGA 4PVDA 1PL8A 3OJFA 3STHA 4ALNA 1LDEA 1R66A 2WDZA 1P45A 4DIOA 2VZ0A 3AUSA 2Y67A 4JBHA 3SX2A 3ORFA 4XRGA 3RC9A 2Y68A 1JVSA 4PLFA 4PRKA 1I32A 2AG5A 1ZJYA 4D44A 1A27A 1GYPA 1DXYA 1QV6A 4NK4A 4OIMA 4BNGA 1B0AA 1HYEA 4YXFA 3G49A 4RVHA 2NWQA 3PQEA 4JBGA 3PDUA 5CDTA 2IXAA 4CMEA 3FPCA 3HSKA 4J6FA 4UEKA 4UVEA 3VZRA 4BGVA 4F6CA 2OL4A 3PYMA 4FFRA 4CMHA 1DC3A 2YFHA 3U3XA 3GZNB 3AK4A 4NR0A 2B5VA 1ZVMA 2PH5A 5JDIA 2C7VA 2QQ5A 2X8LA 3PDJA 2IYOA 4QEDA 4CL3A 1MG0A 3BMQB 1ZO8A 1OAAA 5IN4A 3NGLA 1IZ0A 2OUIA 5HWSA 3WFIA 2D0IA 2AW5A 3C1AA 1DFGA 1YE3A 3C7CB 3BA1A 4O63O 2J3KA 3IJRA 1ZXBA 4YRAA 3EVTA 1V3UA 1DHRA 4FFPA 5JAZA 3HDJA 2GCGA 4RZHA 2G82A 4GPD1 5JXWA 2VT3A 2VCYA 1DO8A 3S8MA 3MJSA 1UP7A 3IDSA 3H7AA 1B8VA 1MC5A 3B70A 4CPDA 4YAEA 2Y1FA 4PFJA 3TZQA 3R0IA 3VZQA 1E7YA 4WOJA 4FOOA 3BMQA 4RVUA 5FI3A 1BXKA 2Y05A 1BMDA 1YL7A 2ZCUA 3K31A 2JHGA 3PTZA 3BTOA 2EP5A 3H9JA 4Y67A 2OP0A 1YVEI 2YJZA 1SB8A 4MVJH 2IZ1A 4KTVE 1B16A 5L51A 5GZ1A 1GEGA 3IKVA 4UUMA 3IP3A 4Z0HO 1A4IA 5G0UA 2JL1A 4LW8A 3JYOA 1B3BA 5BR7A 3BTSA 4O1MA 5I9MA 5A3VA 5TT0A 4OAQA 3C3XA 3U5TA 3AUTA 3U4CA 2WTBA 3RU9A 5A03A 4WCFB 2VRBA 4GX0A 4ONEA 1XDWA 3MCVA 3TZHA 3ZGYA 5IZ4A 4QQRA 4TROA 3JQDA 2QIOA 1PR3A 3OA0A 4U6SA 1QR6A 2VOJA 4F3YA 1EQUA 2X9VA 2Z1MA 3L9WA 1F12A 4CR6A 2B35A 2BF7A 5G0VA 1XCBA 4CLOA 1JKJA 3GGPA 4KQXA 2CVQA 3GHHA 1KY5A 1XWFA 4AJKA 3PZBA 1D1SA 2W4QA 2DTEA 2VYNA 4DPKA 1KBZA 3PWSA 2BGLA 4RZIA 3HDQA 2DUUA 2ZTLA 3BHJA 1PEDA 2Q49A 1JLLA 4M1QA 5FI5A 5JE8A 4WCFA 3TN7A 5H81A 3WJAA 1P1FA 2Q1SA 4XDYA 1MP0A 2W2LA 1VC2A 3WQQA 2D5AA 1RPNA 4R16A 1IUKA 4TRJA 3E48A 1YXMA 1Z82A 4QECA 3RJ9A 3H2ZA 5KIAA 2CZCA 2FPPA 2GYYA 1HLDA 4BV9A 1FJHA 3RJ5A 2X58A 5AXCA 5T64A 4WJZA 3QV1A 3PXXA 1BTOA 1I24A 2ZB4A 5JNLA 2VTEA 4L73A 4UEJA 3WGZA 5L4SA 4IIUA 5JPIA 3LQFA 4E5PA 4PG8A 3L4BC 1UZLA 1ZZEA 1PJSA 1MXHA 3KYCB 4UAGA 4BB5A 3FSRA 2WYVA 1Z74A 4DC1A 2VTDA 4UVIA 4C4OA 4DQVA 2H9IA 3JQCA 2HMSA 5LC1A 4L4XA 1RM4A 2CVOA 4CR7A 5CDYA 4R5MA 1YO6A 3ROMA 4TVBA 3JQGB 4U8GA 3HB5X 4N18A 1R12A 5T8KC 3X2EA 4PRLA 1W0CA 1BDBA 4I8XA 2Q46A 4LISA 3BYZA 4WASA 4IQGA 3DB2A 3QQPA 4D0RA 2FRDA 2JFFA 4DYDA 1EZ4A 1HEUA 3GPDG 3F6YA 1GADO 1DOHA 2X6TA 3RD5A 5H82A 2PWZA 2RAFA 5C37A 2FZEA 3JYQA 2F1KA 3CKYA 3GY0A 4HFRA 1CERA 1E5QA 3Q9UA 4YAKA 1I30A 4Y6RA 1JAXA 2Y0DA 1Z73A 3I9OA 3JQGA 4A0SA 5B37A 1LUAA 1SEVA 5DP1A 2BHLA 1DC5A 4A7PA 1DC6A 2HMTA 1HDYA 3HE3A 1P77A 4ILKA 1PS9A 4J49A 3F4LA 1KYQA 4JROA 4H15A 3H8VA 2QRJA 4FIZA 4TRNA 2X1HA 4DRYA 4L4RA 3WGHA 1H5QA 1Q1NA 3SVTA 2PZMA 5JBIA 3S2GA 4JGBA 4L75A 2O3TA 3GPIA 2GN4A 2YW9A 1ADBA 3H6KA 3ZU4A 4W82A 2WYUA 1WNTA 1R16A 1W73A 4AVYA 1NVGA 2GN9A 3OHSX 3DQPA 2P68A 1NQTA 1R4NA 4CMBA 3ETGA 5F3RA 5A5EA 4N5NA 1Y7TA 3GF4A 3KLPX 4LRSB 3ROKA 2ZCVA 4XGNA 1D7OA 1LNQA 3KEOA 1S6YA 4NPCA 1YS4A 3U4DA 1SC6A 2X0JA 3W6ZA 4RLSA 3MTJA 2W98A 1ISGA 3DHYA 3OECA 3JQ6A 4IINA 4IS3A 4RV9A 1GY8A 1H2HA 1HDOA 3JQ9A 1ML3A 4NFHA 2WD7B 4J1SA 3IQDB 4EJMA 4FFMA 5JYDA 1IYZA 3GVPA 3GZ4A 3CUKA 3LT0A 4Y9DA 1O9BA 2Q2WA 1NQAO 2VYND 4WEOA 5JAQA 1ZW1A 2AEJA 2O4UX 4TSKA 3EAGA 3QP9A 4FJ0A 1PL7A 1BSVA 1I2CA 3QIVA 3WBFA 2PGJA 4MVJF 1DAPA 4GX2A 2IE0A 1JVBA 3GVIA 4H16A 4DIFA 3UAGA 4R9SA 2W2LD 3ZV4A 4IM7A 4JK3A 2WD8A 4D3FA 2CDAA 4EITA 5FF9A 4YJHB 3U0BA 4BNVA 3RIHA 4OGWA 1HDCA 1P1HA 3JQEA 4J43A 1KVQA 1V3TA 5AOVA 4NH4A 4Q39A 3TOZA 3JQ7B 5G4KB 1F06A 3FBGA 4OSOA 2A9FA 3K9QO 3QVWA 4XJSA 3EK2A 3AM5A 2XOXA 3DHNA 1LRKA 5KVQA 4MPDA 4MP3A 3TL2A 4E2ZA 5ILOA 1PGPA 4IDAA 4R1SA 2VN8A 3LK7A 2YHUA 1Q0HA 1ZK2A 2HK8A 4ALKA 5KVVA 4QTZA 2JD0A 1I3MA 3GK3A 3ZU3A 3PK0A 5AYVA 3WJ7A 1XYGA 4L76A 3PLRA 4D7AA 3D5QA 5JAMA 4XQGA 3B20A 4NBRA 3G3EA 2G1UA 2P4HX 3E9QA 1JKIA 4FJ1A 4BKPA 1KC3A 2YQ4A 4B7CA 4ZN6A 5EIOA 3RBZA 4B4UA 1E1LA 4FQ8A 3HQ4O 3K6JA 4J0EA 4EYEA 4W99A 3HHPA 1ADGA 3JQBA 3WYBA 3LC7O 1FDUA 3B1FA 4FFLA 3JQAB 3PHHA 2O4CA 4JN6B 1E6WA 4JLWA 3ZU5A 5B4TA 4OXNA 4GSLA 1B8UA 1YBMA 4HWKA 1XA0A 3CIFA 4H3VA 3H9EO 2GERA 1PJTA 1BG6A 2BGKA 2I76A 5IDWA 3KSDO 1F14A 3D0OA 4AJ2A 3D7LA 4XGKA 3OJLA 1LX6A 4XZ3A 3PZRA 2O3QA 2NU6A 1E3SA 3ZWBA 1PGJA 2I99A 2YV3A 3OQBA 2W8ZA 1J4AA 3OIGA 1GD1O 1YQGA 4E0BA 2PY6A 2Q2VA 1D1TA 1NR1A 3KBOA 4XB2A 5CFZA 2QW8A 3DZJA 3VTZA 2O50A 3HFSA 3KRTA 1W8DA 3JQAA 3I5MA 2BI7A 2QZZA 4DTIA 3P2YA 4GMFA 2DTXA 1N8KA 1YOVB 2FP4A 1FDTA 1KIFA 2DM6A 4O0LA 2D5CA 4D45A 4W9NC 1HZJA 1OI7A 1R15A 2AQKA 3JD1A 1TLTA 3GNTA 1U8XX 2HRBA 4Y98A 1NR7A 1GAEO 2P9CA 5T67A 3RFTA 4E21A 4UUOA 5IXSA 4O5OA 3WDSA 3LC1O 1J0XO 1DBVO 1D4FA 4BO7A 4BNUA 1ZK1A 3CZRA 1SNYA 4PG4A 4PLPA 1JKFA 2HDHA 2O3RA 5C5IA 1DFHA 1UDCA 2CNBA 3CEAA 5BSEA 1MG5A 2WWRA 3I9MA 3DZIA 2PZKA 4BNYA 1KVTA 4RPGA 4EUHA 5JAIA 4ZHSA 5GZ3A 1PL6A 1OC4A 2CUKA 2V6FA 3F47A 4GLLA 3WOHA 1WPQA 1MLDA 4I1IA 3M2PA 4ND1A 1M67A 1YOVA 5DCWA 3TZKA 2NQTA 3PHJA 1LDGA 4HBGA 3U4IA 1U2DA 3I4CA 5AXAA 3ICPA 4GBJA 3ZCXA 2NADA 1Q7BA 4CM4B 4CMGA 5F1KA 3AOEC 4WLVA 1O94A 4ZGWA 4HP8A 4GSKA 1GCUA 2DT5A 2H5LA 5IZCA 3HN2A 4MKRA 4R4JA 4IDFA 1T25A 5L7TA 2J3JA 4W4TA 4RVSA 5CDGA 4Z9YA 1CYDA 2NACA 2EHDA 3WICA 3WBBA 4RQTA 5CG1A 5JC8A 4CQMB 5G0SA 5COAA 5F21A 5JSFA 3MEQA 3OJOA 4RORA 5JC1A 3RAJA 1CDOA 1Y5RA 3PGJA 3M6IA 4OOFA 2P5YA 2TMDA 3WG9A 1H93A 1ADCA 4PCVA 4PG6A 3TZCA 1VJ1A 1Y8QB 4ZD6A 4WLFA 4YAJA 1WWKA 1UR5A 3D3EA 5DOVA 5B1YA 5A4DA 1X7GA 4CM4A 4B7UA 1IY8A 1DIRA 4XR9A 2I66A 3WSWA 4TKLA 1IHXA 3WTCA 4EZBA 4PLYA 3E82A 1ID1A 1GV0A 1TT5A 4RPLA 1E1NA 4Z6KA 5JY6A 2VQ3A 1NAIA 5JO0A 4CV0A 1DIAA 3H5RA 1W6UA 1TA4A 5TS3A 1EUZA 4DWVA 3F1KA 3W1VA 5CPBA 3GOHA 5C7IO 5ES3A 3AFNA 3CINA 2FWMX 1U2GA 1HLPA 3TNLA 5DT9A 3V8BA 1LXCA 3CTMA 1PJ4A 5L3ZA 4BNFA 4J4HA 3BTUA 5EERA 4NZ9A 2DTDA 4K6CA 4AJNA 1ZEJA 3JQ8B 2DAPA 1BW9A 4BS9A 3DFZA 4CMJA 1MFZA 5COQA 2J5QA 3UVEA 1P74A 2O3JA 4DXHA 1B15A 2B69A 2VZ8A 4MP6A 4CMCA 3INTA 4ND5A 2PV7A 2Q22A 2E37A 2DPHA 3COSA 5HTOA 5TQVA 2EG9A 4BGIA 2IYPA 1AUPA 1YJQA 1IB6A 3BMCB 3L6EA 4BKUA 2UV8A 4P38A 4D46A 3TWOA 3H9UA 1DAOA 1ZBQA 3G1TA 3ZHXA 5G4LA 3LT1A 3HNPA 4CM5A 2AQHA 1N92A 3DZBA 3QWIA 4DMLA 1JN0A 1E1MA 3JQAD 4A10A 1ZKMA 2C20A 1BXGB 1GQYA 9LDTA 1WMBA 3A06A 3W8EA 1HDZA 3HB4X 5JFOA 3IIEA 1DFIA 4GX1A 4LSMA 1MV8A 2FR8A 2I3AA 1WMAA 3K30A 4J0FA 1X7DA 2O48X 2HSDA 1QMGA 4K28A 3OM9A 4XGIA 3ZZNA 4BQPA 4GAEA 3WB9A 3DMTC 5DNAA 3OP4A 5T73A 1SB9A 2HQ1A 3LT4A 2CMDA 4KWHA 3UN1A 1AXGA 3VVCA 4YVFA 5BSGA 1GL3A 2TMGA 3ITKA 4JP2A 3B1KA 2BLLA 1T26A 2X9GA 1Y8RA 3F5SA 2VHVA 3MZ0A 2FMUA 5BT9A 2ET6A 3GVHA 5EL0A 1PJCA 2NU9A 1GV1A 1QXSA 1EVZA 4KTTE 2IZ0A 3FWNA 4RPHA 4HV4A 3Q3CA 3SJ7A 4CM9A 3WGQA 1F17A 1HZZA 3PLNA 5I7SA 4PGFA 4XIYA 4DVJA 4DL9A 3V5NA 1RJWA 1WVGA 4R9RA 1EQ2A 3VH3A 4CM6A 4GMGA 1NHGA 1HTBA 3QW2A 2UVDA 5DCYA 3WGOA 5C7OO 1HE4A 1Q0LA 4P4GA 2SCUA 3U62A 3WNVA 1DB3A 4EJ6A 1XU7A 1N9GB 1DHTA 3ZHBA 1KETA 3O8QB 4R1TA 1PX0A 5F5NA 4ALMA 2DFDA 3NUGA 1ULUA 3V2UA 4NQZA 3PJDA 3RFXA 3W4JA 1JQBA 3RBVA 2YDXA 3NDRA 5I8ZA 4LK3A 1UZNA 4PG7A 4W7IA 2HJRA 3FTPA 3S2EA 2RIRA 2NV6A 4E31A 2NU7A 5IDYA 4DLBA 1FDSA 1LDMA 3GAZA 1YBVA 2DBZA 3A28A 3FCOA 2QG4A 2Y1OA 4XIJA 1IOLA 5A1TA 3PJGA 4YR9A 1Q7CA 5KJ1A 4NHEA 3AI3A 4RDIA 4J9VA 4IQ0A 1QLJA 5LDGA 2AE1A 4ZJUA 1N9GA 1RM5A 2RBEA 1NASA 4NU6A 3OBBA 5BSFA 2CD9A 4S1VA 5KJFA 5T5QA 2HO5A 4ID9A 1T4BA 4I5GA 3ZV5A 2YV2A 3SC4A 4AICA 4F45A 4MJLA 2B4QA 1UXKA 3E18A 3P2OA 3V1YA 2VHXA 3JD2A 5EN4A 2GRAA 2B36A 4UVHA 1E7RA 2OFPA 4BNTA 3FN4A 1LDNA 1V0JA 2ZYDA 2AG8A 2VWQA 1Y9AA 3IMFA 3ZHYA 1ISFA 2I65A 4KWIA 1UXJA 3ADOA 4GLOA 1VSUA 4X54A 3GRKA 2VNAA 3ENNA 3OMLA 2JCVA 1B26A 1M76A 4TQGA 1YGYA 4KUHA 2ZTUA 2J3IA 5JDCA 3BHMA 4CUJA 1LC0A 1JAYA 4DYVA 4DREA 4AJ1A 5TGDA 4FGSA 1O6ZA 4GKVA 1SOVA 3IAHA 1LLDA 1NWCA
chains in the Genus database with same CATH superfamily
3CU5A 1Y1QA 1SUSA 1YTLA 1SHUX 5LSAA 3EGDA 2NZ2A 3MPOA 4ROSA 1I79B 2JGDA 2RAUA 3TF5A 4KC0A 4Z9FA 4BQFA 4UOEA 1VECA 4GP7A 4XM1A 2QY9A 2QRLA 3ILHA 4BKOA 4KHPB 1S2MA 2OCPA 1UT5A 1T2AA 1AKTA 3AC0A 3DCNA 4PZAA 4RZXA 1MMFB 2FGJA 3IUMA 4D6YA 1Q5PA 4JODA 1L6IA 3CB2A 4C4XA 1H6CA 1AY0A 1M8FA 4M0CA 4B2YA 1G8YA 1QYRA 5T4BA 1FRZA 3CT4A 1E4VA 5DNUA 3UAXA 1UMBA 3O95A 5IAOA 1Q95A 2EGHA 1EDZA 1PZNA 3UFXB 4BUCA 1OQAA 1WSBA 2GDJA 2PTHA 3F8TA 3KZVA 3H87A 3GN2A 3HA3A 1GP2A 3M6MD 3IA7A 3EXFB 4FLFA 4EQ6B 1X15A 1PJ8A 1E2NA 2ISCA 1TYDE 3A1SA 1KEPA 4FI3C 3NBKA 2I8AA 4Y1EA 5GAJA 2OO5C 1A7AA 1RYZA 3ZZMA 1TZ2A 1CKEA 1N1MA 1UINA 3LBHA 5K8JB 4IZIA 2D7JA 4KYTA 3W9UA 3ZR4B 4E5DA 3CVXA 1U5BB 3ECAA 3QBTA 2QTTA 3IFSA 4D9EA 3ECSA 3ELWA 1L4YA 3KO8A 4DLNA 3NOXA 3PSHA 2GN8A 1L1QA 1GNVA 2I7CA 3EVBA 4WPGA 3O94A 2H92A 3HBLA 5B3LA 2V1XA 1W4AA 3DMPA 2C4KA 3FVTA 3L18A 4DCNA 2HV9A 4B0PA 3NTRA 3BD8A 2ZYAA 5IW8A 1BJRE 2FWBA 3LNTA 3QEKA 1T6XA 4R84A 2HF7A 4TXMA 4DJAA 5JLAA 3B1WA 3D9QX 4C78A 4EQ6A 1E2BA 1GSOA 1XRJA 1MBZA 2Q8QA 4GI3A 4TXNA 4WE3A 4BMVA 4M7OA 1GRVA 1GQFA 1F60A 3IIKA 3MBOA 5FL3A 5E3HA 2H9YA 4LBVA 3K9WA 1PDWA 4RIHA 2MR6A 3O21A 2O2XA 1C7RA 2W9XA 1FS6A 2H51A 5K0NA 3R3XA 4P86A 4EHJA 1N9KA 4MQ5A 2RGYA 1N3LA 4D3XA 4CMEC 2PJDA 3D5TA 2IX9A 1U5BA 4C7KA 2HKIA 2YBDA 4IIYA 1WCWA 3ONVA 3I6BA 3QLJA 3IAS6 2ROQA 4U00A 4BZPA 1LBSA 5FWDA 4ZTZB 3S2YA 1L4GA 3GDOA 2HRRA 3VR1A 2Y1EA 1UFOA 3TTUA 1EEHA 4KAAA 4QJBA 3WL4A 4E1VA 2YR0A 4EG5A 4N5IX 4F0JA 2PWBA 3IT0A 3O03A 3GJYA 5JDIC 4O8ZA 4ZOEA 2O2EA 2XY4A 1QTIA 1TKCA 3OFVA 3T3EA 3CEHA 3PD7A 3BTVA 1NU8A 1EK6A 3M5WA 2IQ5A 2ZS8A 4DMCA 2R86A 1LKZA 2HU8A 4PAQA 4XAQA 4ZQEA 5BXQC 4KN6A 3ND9A 3ZWKA 3HJCA 4YLEA 2PVSA 4I08A 5ECGC 3MCUA 3PUJA 4G1MB 4GHWA 4M1SA 4WNIA 2XNHA 4BLTA 2FQ1A 4HZIA 4QFDA 1QR2A 4JI3B 1BX3A 1L5RA 1QH8B 1R4MB 3MT0A 3HC7A 2R6HA 2PHZA 2OZLB 3VZSA 2ZJ1A 4Q6WA 4D0SA 3MJVA 3U80A 1AUXA 3I8SA 4JEHA 3PIDA 1W1UA 1Y6QA 2FPGB 1I01A 1IMJA 4OFXA 5F1OA 3WNQA 1HKUA 5B1IA 1H1LB 2IXGA 1AKEA 4ZYLA 2QQ0A 1IHPA 1E4EA 1RI2A 2BFOA 1GYQA 5FDFA 2UYYA 3MT7A 1ZVJA 1RYNA 5GPBA 3K6SB 2QYHA 4YJ3B 3HM2A 4NBUA 2P2LA 3VR4H 4BNIA 3HB9A 3Q40A 4G0ZA 1ATZA 5FO1A 5LOVF 3OQMA 1KAHA 1H6BA 4WAUA 5FLYA 4FC6A 3W8RA 3H1EA 2AN1A 3OZFA 2G5CA 5T4FA 3RW9A 2IS4A 1LS6A 1XQXA 1N4AA 5F73A 3O9ZA 4G37A 3OTQA 2OV2A 4JZYA 4CMKA 2QD4A 5DRYA 2CXSA 3WLHA 1L1FA 2AEEA 3DM5A 4JLJA 5L9AA 4EGSA 2GLXA 3TRFA 1E60A 2GK6A 1BH2A 3WGJA 3VKHA 4I50B 4D6PA 3W2HA 2G0NA 3DXZA 4LF9B 5KYXB 4G8CA 3K6SA 3BMXA 4YJ3A 3WB1A 4B3DA 4DPMA 1E1KA 2HTEA 4NJMB 3ITEA 4HN4B 3UYKA 4WUVA 4OX9Y 2EJWA 2WI8A 2EKPA 2G6BA 2DETA 4A92A 4P4LA 2J9FA 4OU5A 1M2JA 1FE8A 4Q0MA 5SY4A 3TNDA 5A05A 2F2TA 4P5DA 3FJOA 4G3XA 2PL3A 1P9LA 5EHXA 1KH1A 2H7YA 3BGSA 5LMCA 4B4VA 1WUKS 2YS6A 5CB4A 3L4SO 1N2CB 3EODA 2AVDA 3H4VA 4GVLA 3HTXA 1HBJA 3TZEA 1AH2A 3K09C 3AFMA 1NG9A 2OGUA 5D3MB 5BV7A 3O4GA 2XTJA 1G19A 2PZGA 2I29A 3T94A 4HNVA 4DQ0A 2Q99A 2HL6A 4YRKA 3K8ZA 3QTLA 5IFKA 4IDNA 5K0GA 1WMSA 3R6WA 1GILA 2CNNA 2XE6A 1BXRB 2Q27A 5JZSA 4TKZA 3UW3A 5E6SA 4B2IA 4C4YA 3HL4A 3S2IA 5DNCA 2B8EA 5IM4F 1T5SA 4MKGA 4D82A 2D54A 2QTZA 4OHFA 2Y3IA 2IUEA 2ZYIA 4DGSA 1W0KD 3Q11A 1FYXA 5LP6A 1UM9B 3GT7A 1M72A 1NULA 4RWZA 3FCXA 1L4MA 2LR0A 3I5AA 4A1OA 4EJ0A 2OXCA 4LDZA 4ERNA 4EW3A 4GOKA 4PX9A 1XNRB 3EPAB 1U8CB 3B6IA 2I3GA 3KKPA 4C2TA 4QGGA 1KJZA 2CXHA 5DWQA 4DV4B 2A1TS 2C9CA 3KKKA 2PJUA 2Z09A 1QHFA 1R9NA 1GT91 1UP4A 3FW1A 4OB8A 1Z7BA 5D3MA 1X3SA 2X9LA 4MR7B 4WN9B 1HNWB 2Z2IA 2NOAA 5ILGA 3PA6A 3Q0IA 1O87A 3R74A 5BT8A 2CFRA 2ZPAA 1USIA 3TLJA 1UFKA 4XYLA 3MT8A 1MF7A 4EY4A 2YMMA 5KOYA 2I2BA 1AD2A 4FKMA 4GMHA 3RRYA 1XMOB 5EWLB 3SICE 3AO0B 5JCPA 4AX4A 3S5JA 2NO7A 2MYNA 2YZMA 3BT7A 5TXGA 3K2EA 4BO6A 3OT5A 3L3BA 1W9MA 3NRBA 3LHSA 1SA0A 4CM1A 3D59A 3DBHB 3MA0A 2GCNA 3BXFA 3JWEA 5BURA 3AXTA 3PJRA 1FL9A 3NAGA 5EZ6B 1XHLA 5D8DA 1G6OA 3FYUB 1JPJA 1EDOA 1BE6A 1H94A 1G2OA 2P2SA 1CP3A 1JMKC 2AFVA 2AD1A 3G89A 4QTXA 4W1RA 4DMGA 4J4TA 1ABBA 4FHDA 2D8AA 1C3JA 3G2PA 3UM9A 1Q17A 4D9BA 2C3YA 4MR7A 3Q88A 2QN9A 3WK7A 3VPBA 2ICAA 4J0IA 3MPUA 4Y18A 5EGNA 1E2KA 3U40A 3RYHB 4JASB 4FFOA 1K6MA 1X0VA 1Z6XA 3N58A 3RFVA 3SSOA 5B1SA 3UKJA 4BU1A 2XRZA 3GZJA 3H1GA 2NP7A 4TMWA 1ZW6A 5IJZA 1ZOIA 4N7JA 3E8XA 1KY2A 3ZVRA 3P94A 1SBZA 3GFOA 1T24A 3D4LA 1EVYA 2D8MA 3LP8A 4LNUB 3AU8A 3AZPA 4BE4A 5BWMA 2UYHA 1MT0A 3L8DA 1JE0A 3STYA 1U98A 1DAKA 2OORA 3OX3A 3DBHA 4ZT4A 4M76B 2R7AA 2C2HA 1T2DA 2AL7A 3E6AA 1AUVA 1PZXA 4QUAA 2Q5QA 3CW2A 2IDJA 3FWKA 4UVDA 5FFFA 4NMXB 1PLKA 3VPCA 2B7BA 3AGQA 1FC0A 2E4ZA 5I9BA 1GAQA 2FMFA 1L5YA 4KQJA 1EDDA 3TTVA 2ZOSA 3GR6A 1TK3A 2ZJBA 1FSSA 2MSDB 1DAEA 2H4JA 4G1VA 2C4NA 3NBZC 3OSZA 2D62A 4WNAA 4WXPA 1EBBA 5C3MA 4ZDJA 4PZYA 5IG2A 4WKGA 3HBJA 4YONB 4JQCA 3BFXA 3UC9A 4CEIB 1PSZA 3AL2A 2C57A 4V0ME 3ML1A 4M3NA 1W88A 1Y9JA 5EOVA 3UC5A 4IXDA 4DSTA 3HZRA 2YH2A 5TPZD 4MQLA 5HJ2A 4L9RA 1KQOA 4YTEA 3DONA 4UHHA 3I61A 1UFQA 2WNSA 4YA6A 2IOYA 2FN7A 3ZIAA 4EYOA 1PQWA 4X00A 4J1NA 2G7ZA 4XFJA 2NO6A 1DRWA 3VGPA 2TMYA 5SZJA 1CQIA 3WBKA 1GPBA 1EFTA 4U63A 1JFFB 3KPUA 3ZQ4A 4NBLA 1KO7A 1Q7EA 2Y93A 3PQ4A 2IH4A 5FBWB 2VA9A 4ZQBA 3ULKA 3GCWA 3LHIA 4QNNA 4B85A 4RMJA 1V43A 2Q4TA 4O2RA 2HRZA 2PSEA 3IPCA 4Z0TA 2G09A 4CI0B 5JJ5A 2ZITA 1XL0A 1ECCA 1COZA 4XOUA 1IEVA 1ZK0A 2YZ7A 1XTSA 1D5WA 1L5FA 3P1JA 1P4AA 1TF2A 5H4GA 3RANA 5E6RB 4HLCA 3HJGA 5BPHA 3OJWA 5I9LA 1C1DB 3ZYZA 1ZCJA 1KYZA 2VKQA 4Q4LA 1XEXB 4AZTA 1HGXA 2CLHB 5AVOA 2R6FA 2QM3A 2WJPA 2PLRA 3B3GA 3EZ7A 1P31A 4GZMA 4HWPA 1RTTA 2VHJA 2GXQA 1WLSA 5FKJA 3OETA 3B1ZA 1XXHA 1JFFA 1QIMA 2H3HA 5FNVA 2ZAGA 3C24A 4DIBA 4QDJA 1C1YA 3I2JA 1VDZA 4XD7D 1E59A 1TQDA 3RK1A 3FUUA 4J1QA 5H3LA 2X7HA 4WSOA 2BMVA 5KJCA 2CMKA 5LOVB 5BYBA 3QH4A 1A8QA 4JKIA 4QEKA 2WF8A 3K5HA 4XPIA 3ZWYA 1RFLA 2VI5A 4QOFA 4F5WA 2VTBA 4Q37A 4R69A 4U6QA 2CVHA 2IIBA 5PGMA 3WTBA 4F4CA 3K9GA 2EFGA 4CF3A 4IL5A 4MPRA 3R8FA 1ND6A 1XMPA 1UBLS 3K35A 4ZAXA 2D4AA 5CW1A 2E4VA 3ZK7A 4G0VA 1ULAA 2QN1A 3I04M 4CXMA 1GDTA 3VHXB 1LA2A 5BW4A 1XEXA 1A9OA 1PI3A 3K2BA 2RHRA 3F5DA 3HKEA 1C50A 3C8UA 3CNBA 1BFUA 4BMSA 1MW8X 5J9GA 4KVGA 4O6VA 4WVFA 3W06A 1G5IA 1VA4A 1I3LA 1X1AA 2ACKA 2WMNB 3EC2A 1Z07A 3SXUB 3TSOA 3ZK8A 1ULTA 1DELA 3QPAA 4FCTA 4KAXA 4KN9S 4B6PA 2OC4A 1ONPA 3LE8A 2IV7A 5A5VA 3REOA 2PA3A 3ETDA 3MUNA 4FONA 4LTMA 4FOLA 4XD2A 1EAMA 2ZU6A 3PVSA 1Z4IA 1QNFA 4QNMA 3I2YX 2GXUA 1ORIA 5KI6A 4ETNA 4B3JA 1E2EA 1GRQA 4IGKA 4EZIA 2M32A 3HXTA 4UU7A 1QGED 2IYVA 4G89A 4ZDWA 5C1IA 3JD0A 1KI6A 2QSZA 3KWJA 4HVCA 2W93A 1R0LA 2CWWA 4KQWA 5TVKA 1BGWA 1C9NA 1R88A 4MA5A 3WGGA 3WQSB 4HDRB 2PGDA 4BLSA 4DC9A 3JQBC 3TW8A 3NWEA 1L5VA 2EVWX 3VHXA 2H1WA 2GYUA 4RUKA 1I5RA 3KUXA 1XRSB 5JXJA 1KEKA 4F9EA 4RS4A 2GHIA 4ZT3A 2FHSA 4ESOA 4BVBA 5CA0F 2FWNA 5FA5A 4C3UA 2FG7C 2WWWA 1LLQA 4ZC1A 4N54A 1NKSA 3FPSA 3SIXA 1MAUA 2AN3A 4W8OA 3TW6A 2RI0A 4I6JA 3NEYA 5IHPA 3GJ4A 4IG9A 5DW3A 2LBPA 2F62A 1DKNA 2LE0A 5LQNA 1XKLA 3ANLA 2XE4A 1JH9A 1DNPA 4HUQB 1PW5A 1TIKA 4XQ9A 2JCGA 2W6QA 4PW0A 4K9DA 3O7MA 1E2QA 1EM8B 1K86A 1PJZA 3DV0A 2BHTA 4OLJA 4W8GA 5C4GB 4A3SA 5A7FA 1YHNA 2P9JA 1XEAA 3PWKA 5JHGB 4MPTA 3AUYA 4I1SA 3PVZA 2FFHA 3R7NA 4HWTA 1YK1A 3OT1B 4Y8VA 2J6IA 2R1TA 5AK3A 4D4MA 5FOQA 1PL0A 4B3CA 3WGYA 4YS6A 4EATA 2NGRA 1KMMA 1H8ED 3KZKA 3MGAA 4PLHA 4UPVA 5BUSA 2GZ2A 3H2HA 4IVNA 2VWGA 2XYPA 5JYFA 2GX6A 3C3BA 5DI9A 1U0BB 3SC2A 4N8SA 3LKDA 3KVRA 1OT5A 1T8PA 1WW8A 2W0SA 1DTSA 1QC5A 1WABA 4YALA 1XK7A 4NTZA 5L40A 3MRVA 4C7VA 5LXTA 1PRYA 2A78A 3SU8A 5BSWA 3TIIA 1CXZA 5I51A 1SEPA 3PUXA 4YGXB 1W36C 2AYYA 2OCGA 3FR7A 3F2VA 3H9GA 2O0JA 4JOQA 2WIBA 4Z5XA 1NP6A 2WV9A 1GL6A 1VLLA 1M8KA 4AX8A 4G0NA 1OASA 3OEED 2B99A 4BO3A 1MKYA 2OAEA 3P2IA 2R65A 1MX1A 3OT1A 4C5CA 4EMTA 3SVZA 1XTBA 3RS5A 5B64A 2FSHA 1NBAA 3JQ8A 4F8YA 3FD8A 2X3YA 3HP4A 3DE6X 3OJXA 3LI2A 1S7CA 1GPNA 1M34A 1XLVA 2A5LA 2X8AA 2ZVJA 4XDHA 3VOAA 3GLIB 2QTCA 2CLIB 3ZJ4A 1A8SA 1BE8A 4PAGA 1CY7A 4HAWA 4OATA 5A4AA 4O4HF 2PUHA 1HMPA 1JXMA 2ABWA 4MRAA 3WNBA 5EYPA 1XVAA 4N3GA 2ECOA 4KSYA 2WTUA 2IFTA 5LZ9A 4ALLA 2QD3A 2H1SA 4U7DA 5JYBA 3MFYA 2ZUDA 2VBCA 2Q3BA 1DUSA 1JT2A 3HADA 1HF3A 1Z36A 4AZ0B 4LZLA 4NQRA 1NLZA 3LP6A 5CEEA 4C0BA 2ZTVA 3AJ9A 4IO0A 1WDLA 2GA8A 4P7GA 4OHZA 3AWDA 1RYFA 4BNJA 3RUCA 4UARA 1KO5A 3VAYA 2G8NA 3E9YA 1RSZA 3AHFA 3M5CA 2PGLA 3NNNA 3DB1A 1CUSA 2J48A 1G8MA 5F35A 4LVUA 3KLMX 3N86A 1YZ3A 4JJZA 2WKPA 3ZV6A 1BDIA 2B8WA 1I1QB 3OFND 4WXYB 1BXGA 3HCOA 3AVWA 5DIFA 4IDHA 2ZBGA 4TWAA 3GLQA 3B9RA 1UJMA 2VJAA 3KOOA 3CF4G 3W5UA 2I22A 1HI9A 1ZPDA 2PLWA 3H97A 4N8DA 1KR2A 1XXLA 4X84A 3ROFA 4BQIA 3FCAA 4DLUA 1XB2A 3WRWA 2VQFB 3W4IA 2F3UA 2XSZA 1K2VN 3LUGA 1V7PC 3LUAA 2J67A 2OBXA 5KCMA 6YASA 1QFYA 2JFPA 4GBED 4AZ0A 3Q98A 1VHLA 1RWVA 3Q1KA 4NMLA 2BM0A 3AESB 4XIGS 4RFLA 1Z2CA 3BA6A 1QH0A 4CIBA 3O3CA 4M0LA 1OH5A 3E9ZA 5G0WA 1QGUB 2VNIA 5EPUA 7ADHA 4ASUA 2R1VA 4PZZA 1ESNA 1SBHA 2WA1A 3KQQA 3FKSD 2PN1A 3BORA 3HXQA 3PIIA 3Q7TA 2D4HA 3I04A 1NVEA 3PFNA 4KPUB 1C0LA 3WLLA 3MYYA 3RM3A 4QGFA 1E1CA 1M5UA 1VYVA 1H9BA 2WRZA 3DJYA 3UOWA 3A32A 2GZ3A 2OGTA 1OXTA 2DUNA 2VQDA 1H0SA 2GZSA 3VTKA 1G5HA 4CFSA 1QIKA 3AKYA 4KNVA 1R0RE 1RQ7A 2AX4A 2NSHA 5A04A 1MO5A 4IHQA 4DLYA 1JHDA 2X15A 2NU8A 2IHUA 3OZBA 1VCHA 2X42A 3COPA 3E9EA 4XYGA 3MN1A 3N6XA 4JUAA 1TTPB 3NV7A 5EHNA 1FMJA 3TH5A 2YN2A 4AUKA 1P1KA 1KPHA 3LNCA 3ZI4A 2WMDA 1B76A 4FHCA 2XKBA 2Z3VA 2V4MA 2FV8A 1PR9A 1XKQA 2ZWVA 1M2FA 1JA9A 4FDTA 2EFJA 2JK1A 1QUEA 4NZNA 2FEOA 1K7FB 1KOLA 4IDPA 4FQ7A 3EISA 1V5WA 3IDQA 4HPXB 1XIVA 2GD0A 4JBNA 4Q24A 2AMJA 5DO9A 2VG8A 1WQ4A 5E6UA 5FBKA 4B6QA 2R2AA 4R3NA 5JROA 4A8PA 3ZZTA 3GWZA 2F4NA 1U9IC 3EFEA 3KJZA 5TJHA 2B1GA 2P91A 2Q4EA 3COZA 3JAWA 1P9NA 2NXJA 3K5WA 1P5RA 1E2DA 2HA3A 4KBGA 2WDPA 5GOTA 3CVWA 4FS3A 3EIOA 1DJQA 3ZOZA 4V0KA 1U7DA 4C89A 1QP7A 1C14A 2LZ0A 1DSSG 5E4YA 4LGVA 1XOIA 4QWWA 4YCJA 3TPZA 4MS3B 4BFXA 2B0CA 2X0NA 2Z2YA 2X8JA 4F4IA 1TRKA 2FFJA 2YY7A 3HDYA 2DCMA 2FR8C 2AE2A 3Q6IA 1GUAA 1JA1A 3GJZA 5F33A 4QX6A 4H3KB 1GTL1 3LRXA 4BDTA 3QJGA 1MHMB 3G5UA 1IM5A 3WLMA 3F6PA 2MSCB 5D5PA 2D2FA 2JFXA 3RVLA 3G0OA 4YPOA 2YRWA 3L02A 4Z4EA 1PG2A 3CLHA 3ZGXA 5JY1A 5JZBA 4BYMA 1ZH8A 5JMPA 1HSZA 2FUNB 2UZ1B 2NTNA 4UUQA 2CUZA 3UYLA 3PL5A 4FGLA 3I6QA 3KQHA 2B2XA 2V7XA 5GZ6A 4LWZA 4N5HX 2DPMA 5IRCD 4ZQGA 4EX6A 1NN0A 3I23A 1Z8FA 1JSZA 3OCUA 3CE9A 1KSJA 4BO9A 1IBLB 1QFMA 2HDWA 4O33A 1QGOA 4BFTA 2QRZA 1T9ZA 2Q07A 1JEEA 3IELA 2ECQA 4MUYA 5IJAA 4W5NA 1P2UA 4YMTA 3ZJXA 1DJNA 4MS3A 5E0KB 1MRNA 3BKXA 4AUMA 1BRMA 5CA0B 5BNTA 3VR3D 4WZZA 1ILEA 2GKSA 3W9BA 5F5LA 4KR7A 1ZYUA 2BFWA 2VF7A 2QE6A 2ZUBA 3CKLA 3OU2A 3WFZA 1TK9A 1UDXA 2YWEA 5IC6A 1CYEA 3ESQA 4FSHA 1T3SA 3GJ7A 4EF4A 1RFGE 2XQGA 1RC0A 3NHRA 3DBOB 4C7XA 1KDOA 4Y9SA 2PH7A 4RFSA 5HFNA 4ZMSA 3ZNOA 1FS4A 1ZSNA 2XYGA 4AF7A 4BMPB 1KZ6A 5I8WA 2Q1UA 1ZIOA 3DE3X 3G2JA 3IQEA 2B4RO 2XUAA 3FAZA 1LLCA 3COYA 4LRYA 1LJUA 1B74A 4HVLA 3FR8A 3UANA 3VPXA 2D1TA 3ZQUA 1P4HA 4LDJA 1I5EA 1UKEA 4AMZA 4V1CB 1PYDA 5GM1A 4G0UA 1C8KA 1XJ5A 2WF6A 1FDWA 5AFSA 2L19A 2WSYB 4FT4A 1TVCA 1XCOA 3PJFA 1VL1A 1I4OA 1YQTA 2WT4A 1R0XA 3P4XA 4D42A 1WBDA 4OJQA 2GD1O 4QSHA 2KBFA 3OSUA 2WF5A 1QIJA 1CQJB 3WC4A 1JIIA 3LQRA 2CY0A 3MNFA 4M0PA 521PA 1A5BB 3KJEA 4KXMA 4OFWA 1T6YA 4C4AA 1SBNE 2Z0MA 1N6OA 2GZ1A 2IX3A 4A0QA 3NONA 2J3DA 2FWRA 3EEQA 2OV4A 2ZJ7A 4FGUA 3TXYA 3OESA 1E7SA 1SKYB 2ZVQX 3D7MA 4JVLA 4MUBA 4IVRA 1ZMRA 2C0QA 3GD5A 2YUTA 1QZTA 4G0OA 1X7XB 3B78A 4BEWA 1U7XA 2Q9CA 4GQBA 5EJIA 3NVKI 4ZO7A 2DPLA 1ODSA 1QHGA 3FAKA 4RSRA 2QW1A 1P33A 3O1LA 1NBHA 1CC1S 3DEAA 1H85A 2Z5LA 4XSVA 4AWXA 1FP7A 3KFXA 2C5AA 4B6EA 2FUKA 2ORED 3A1WA 3AR5A 2HPAA 4O4HB 4Q3NA 2F43A 1BDHA 1CQJA 4GXRA 3C5CA 1N5KA 3PE6A 4PCUA 3EFOB 1K8RA 4QJIA 1DKMA 1U0SY 4WESB 3OAAA 4G1CA 3RUFA 3G0BA 1MOPA 1QBKC 4NFYA 1WR8A 5HILA 2WPDD 2OD9A 1PJRA 1KSHA 3HSSA 3CUVA 2QL5A 3WHIA 1QF7A 1KY4A 2IZ7A 5JDCC 2O5RA 4XM0A 3VO1A 3RSCA 1VPDA 3WWOA 4BWVA 3Q8MA 10MHA 1BEUB 3QU4A 4KIGA 5KAMA 1EDBA 4UXIA 4WCDA 1PU2A 5EUCA 1Q1QA 4WBSA 5AXDA 3OLZA 4NV0A 5AP9A 2EEZA 3GLTA 3SCZA 3AKDA 1Y63A 4J07A 4IV5A 1Y7IA 2HUPA 3GV0A 2MSKA 1L4HA 3KQPA 1XTZA 4ZU3A 4BN4A 5CFQA 4E88A 1CW2B 2ZIZA 1P2TA 5MGNA 4OHUA 2WYWA 1UC8A 1TJNA 2OFOA 3L0OA 4AXBA 5B5SA 1ESMA 4Q4JB 4Z49A 2EXXA 3EFOA 2Y1LA 1NUSA 1GPAA 1O77A 1X8LA 4AJ4A 3AHJA 4GR4A 4D8XA 5EPEA 2VP2A 3NYWA 4LFCB 4K6HA 2JF0A 1QHHB 5C8VA 2PBLA 1EMDA 2HHAA 2VSYA 2W8BB 3QFSA 2D2EA 4OKSA 2OSVA 2ZBFA 4FGKA 4TQUS 2O7QA 4QNRA 2WWGA 1GGFA 3JPYA 3DEJA 1HDGO 2CSUA 3IQWA 1WP4A 3KKMA 3O3NB 4GC5A 4BATA 2ZM5A 3ICQB 4L2IA 2I2CA 4OJMX 2R7NA 4DN6A 1Z2EA 1Z75A 2D59A 4Q6BA 1JPUA 3BB4A 4W5JA 1W9HA 2DFVA 3H2SA 3NWBA 4RLQA 3DKVA 5LQJA 1LPBB 3PTLA 3GLGE 5FPSA 3KKLA 4MHTA 1SUFA 4WX2B 5EJMA 3BIWA 3LFUA 4O3FA 1Z38A 2FMKA 1B1AA 1O95C 2HU5A 3P7MA 4GC9A 4GYJA 4MV3A 4ARZA 4BO0A 4D57A 3W7BA 4HQNA 3MMPA 5A2GA 4Q1CA 1RC1A 1NM5C 5MN5A 1PNVA 3RFCA 5A0VA 1RCFA 1N75A 1ZITA 1QS0B 2GUWA 1QHHA 1QQ5A 1NQVA 2QL6A 3ZIDA 1O8BA 2VBIA 1DCMA 2FN4A 3JYPA 4DA6A 1R0ZA 2AJBA 4OHPA 1JFSA 5FULA 1XD9A 4DV7B 3A4NA 3TTTA 3TSYA 3KFLA 2G9QA 3NBAA 4H1VA 2GF0A 1R4NB 2F1IA 5EHZA 5K3FB 3W0LB 2RJOA 1LCIA 1TLFA 5GY7A 1EDEA 2XCSB 4N47A 4PHHA 3H5WA 3W3AA 2ILTA 3UVEA 4HKTA 1PJ2A 5FRDA 2FZ4A 1Z7EA 1LBIA 2BFAA 1S2OA 1RU3A 5KSPA 4ZOCA 4DCVA 2WAMA 3LPDA 4RQUA 1MX3A 4DEVA 4EEXA 4WK2B 4LDRA 2G76A 1X70A 4MLCA 1JT9A 1NI5A 1E1RD 1E5DA 5C52B 3H5NA 3L0YA 4LA4A 2CK3D 1QAMA 2VDJA 4GLFA 3UV6A 1TJ4A 3DO8A 1JR3D 4ZCLA 1V8BA 3CRZA 3AEKA 4X6UA 3K70B 2AN5A 3ACDA 1UBRS 2VRCD 3TAHA 4YBZA 3BMNB 1XVIA 1NTOA 2P9YA 3I3OA 4CDNA 1FK8A 2IHJA 2GTPA 2IE8A 3FKJA 3VDQA 1SUEA 4AFNA 3BXHA 4WNCA 4M1YA 5ALRA 1TEXA 3QFCA 1EE1A 2VAVA 3OC0A 4JJIA 1PCXA 1FUUA 2JG3A 2RHMA 4TMXA 4W6ZA 1YQ9A 3LU1A 2WINI 2H8KA 4GKBA 4PLZA 3KSUA 1U7HA 3FYTA 3UNXA 3KWFA 1R8XA 4PY2A 4Q4DA 3SLGA 3SY8A 2BEVB 1F9AA 4Q1FA 3SF0A 2FQXA 5A9SA 1O08A 1DO2A 2R8PA 5ICCA 2FJ0A 3QOFA 5FPHA 4JQOA 3VJMA 5THXA 1JL3A 1SUAA 4UFPA 3KPJA 3VH4A 4GZ3A 2I9KA 4XYEA 3LKZA 3R0ZA 4OTZA 2VUTA 2E5LB 4RJKA 1CE8B 1ISRA 1XLUA 4PC3A 2NZWA 5FV7A 2WKRA 5JCJD 2V4UA 1L4UA 3BMNA 4NMMA 4RY8A 3BD6A 3RYIA 3ZU2A 4FEGA 1X1SA 1GSHA 1B43A 1HT1E 3EUAA 4MUKA 3P20A 4KXVA 4D1YA 3DL0A 1NV9A 4OB6A 5J2UF 2AEMA 1SD2A 3PUYA 4AAYA 4DS3A 3T9AA 1NE2A 3ZX4A 3I4LA 1IDOA 4DUPA 3EDMA 1TM4E 4ZZ2A 5CA1F 3GLFE 3PHIA 4Q4CA 1H3NA 1YB1A 1CEQA 4X3OA 3CG4A 3E5MA 2W6ID 5E8JA 1O97C 3GYGA 5EQFA 4P8RA 4Y2SA 2PX0A 3HO8A 4FYMA 2CV0A 2IKSA 3OQHA 1CZKA 3CNEA 3NRCA 5BN5B 3EWNA 1YZLA 1PYOA 3EUFA 2DVMA 4P92A 2JGNA 3ZEIA 2EBUA 2RCNA 3NWJA 4P1ZA 1M74A 3S55A 4P7FA 4I8IA 3QE9Y 3KG2A 3T1VA 1CE8A 1LRJA 2JI7A 4J7CA 5CJJA 5ICFA 4ZV7A 3TGWA 4R5HA 1AS0A 4LYDA 5BUQA 1QRSA 2FKNA 3PGA1 2COUA 2WAOA 3DCYA 3K32A 3HY4A 4G9EA 4KQKA 4GL4A 1Q7TA 2FE1A 3ZHSA 4KPFC 4V1CA 1R37A 3INYA 1YONA 1AU9A 5CT8A 1G7RA 4C6TA 4EPXA 4IGFA 1E0SA 2VDLB 1MO3A 3H5VA 3KKQA 3M5PA 5HIIA 3IAS1 3MWEB 1F6DA 3SLRA 3IMEA 5A2QA 2ZPUA 1YOBA 3D4PA 1GNRA 2BY4A 4H77A 4MO2A 1YS9A 2ORWA 3S1AB 3W9SA 3W6UA 4NECA 3I2KA 2FX2A 5ALUA 3FZGA 2GVDC 3I3SR 1UZMA 1PR2A 3PXUA 2RJ3A 3QLUC 5IT4A 4V0RA 3ND6A 3ESAA 4JR1A 1FVHA 3R23A 2J3MA 2X76A 2QV0A 2H9AA 1THMA 2YWFA 3NJRA 3QEJA 4O2LA 3SS9X 1GRRA 3HU1A 2QL7A 2W83A 3GFTA 4ABTA 1A5AB 2WFLB 3K5PA 2V6GA 2RH9B 3QHPA 2G5TA 4KFSA 5PNTA 5JRZA 4ZAFA 5GONF 1U7OA 2ZU0C 5A6VA 1VSVA 1ZINA 1W4ZA 2EL7A 5AVQA 4RJJA 4RIFA 1WEKA 3IWBB 4FR5A 3ZHVA 3S1AA 1JIQA 3P2JA 2OZVA 4S24A 5DLDA 4D79A 3FPBA 2ZATA 1KJ9A 3T4PA 2ZS9A 3TEMA 3C43A 3DLCA 3IIIA 1OX4A 4ZT7A 2WUFA 1IVNA 1CX9B 5A1JA 3OEHD 1LNSA 1HTTA 3HPRA 3O26A 3P0HA 3SQOA 5ITWA 2H0RA 3ZY3A 4PNEA 5B7GA 1MX9A 2OT3B 5JMWA 1XVUA 2VAXA 5CPFA 1FLNA 4JBXA 1DX6A 2DBQA 3D7KA 1VE9A 3WLEA 2QRKA 1VI6A 4QM6A 4C43A 2GF2A 2WFLA 4PX2A 3HCEA 3QPVA 1FTSA 1CDZA 1ENPA 2UU9B 2C3UA 3VC7A 5E2IA 2CKMA 2PPVA 4EUFA 4UEWA 1C0IA 1LV8A 2EZUA 2JLCA 2GJSA 1O5IA 1FFDA 1M6HA 1FUYB 2V65A 5JSUA 1CP2A 1K8QA 1ZJ5A 3VPHA 1KYYA 1XDUA 5BMVA 3LUBA 3MVEA 1FLDA 1RHQA 2C7BA 4AJHA 1HT0A 4FQ5A 2WSMA 3HSYA 1EXNA 4ACBA 1ZSVA 4HXYA 3CRW1 1LSOA 5CR9A 4NNOA 1QIEA 2OV3A 3NPAA 4M49A 1SWVA 3GGGA 3K15A 3INGA 1S8NA 4OK6A 4S35A 4JI1B 3UK2A 5TVOB 3FNIA 2XRMA 4KO8A 4WMLA 4Q05A 4L85A 3WLRA 5J59A 3PKJA 2QMOA 1RAAA 1V8PA 3NXKA 4MQMA 1POWA 3SZ3A 5IF3A 2QM0A 4UZSA 6ADHA 1UXOA 3OIFA 5G3ZA 3FFWA 3VOSA 3R40A 4RACA 3U9LA 4G01B 3GU3A 1FFEA 1G291 1T2EA 3UUGA 2CLOB 2LDBA 1PSWA 1IHOA 1V8OA 1X1CA 2C4VA 2B5WA 2IYYA 3GJ5A 1M8JA 4KQHA 2XUHA 4TL6A 3UY4A 4AN4A 3T3NA 1PEYA 3ACBA 3UCEA 1YFJA 5C4IA 3RUAA 2GPBA 1Z39A 3WQRA 4UVGA 4MOWA 3DFIA 3NALA 1QIGA 2AK2A 3DO6A 3P27A 4R0MA 3G23A 2OGWA 5EKTA 3ZD7A 1U99A 3QLTA 2HNAA 2BRUC 2Y2VA 4IIFA 4LZWA 3MD0A 3ERCA 2A9VA 2P4UA 3AKZA 2JZCA 5CEJA 3PG5A 1NQ5A 3RSQA 1UCFA 1Y0BA 3H42B 3VKGA 2CHVA 2OZEA 3SJBA 3DMTA 2XYVA 1WHTB 4LGCA 4HNRA 4QRHA 3ZUGA 1TT5B 4NYIQ 5B3JC 3DZDA 5BRJA 4HL6A 3ABRB 4B09A 1U28C 2A0FA 4TV8F 3KU1A 3GYBA 4GDMA 4NRDA 4REMA 1KE2A 2R8EA 1E3WA 4ROTA 4FHZA 5TC4A 3HXMA 1IC6A 4LHVA 4R51A 3DE1X 2OILA 3CLRC 3EMKA 4XRRA 1D2RA 2ON6A 2VJKA 3AB7A 3AT1A 1J21A 4EELA 2GPAA 2CJXA 4QBGB 1OC2A 1Y4ZA 3FDJA 1DXOA 4AS1A 1NVXQ 1PLLA 4JI7B 1U8UA 3N2LA 4GZ5A 2QTFA 1PJLA 2DHCA 3V2IA 3SF8B 3PNOA 2FWIA 5TV2A 1JSXA 4K1XA 4M9RA 3OLYA 1SCAA 3ZKAA 2BMDA 2P9ZA 3KHSA 2A0XA 3WR5A 5F9HA 1Z15A 1BU8A 1IZ8A 1NW5A 4V0OA 4P4NA 4CZ2A 3I30X 3PWTA 1SCUA 3AR2A 1ZM9A 3MUFA 1BW9B 3IAXA 3WL5A 2OP1A 5KTPA 1B7GO 1NFRA 3ORHA 2QTWB 4Y2RA 3SN6A 4Q1EA 3GJXC 2HM7A 2K4MA 1IBRA 3AEUB 4Q9LA 5E2BA 4ZAZA 3C14C 3OC6A 1PX2A 3P9KA 1OFIA 2X5KO 4NNPA 5FH9A 1Y4AE 4QXPA 3LWZA 4TWRA 4D74A 1T9KA 4JLSA 1FQKA 1C9JA 1U5AA 5K05A 1RYMA 4OUDB 4B46A 4CG2A 3IH5A 4X9XA 2DLNA 5FNZA 5I48A 1MRSA 2XE7A 4TSRA 3V1MA 2DZDA 1F4VA 4BWGA 3KQWA 1Z45A 4FD3A 1D0SA 3DCJA 3SF8A 4CN9A 4LF5B 5KWVA 5GIOE 2B6NA 2X0EA 2AVNA 3B3QA 4G81A 3RC3A 4LBYA 2QMHA 3V8VA 2ECPA 2NUAA 2QZ4A 1WJGA 1VIAA 3LBNA 5KDDA 4YLYA 4GI7A 5KNDA 3R3SA 3Q8KA 4RLHA 3L46A 2R60A 1M2GA 2GRUA 3R6GA 4ANFA 1ZOPA 1RWBA 5J2UB 1M1NB 1F5NA 1GPLA 1OLSB 4IJUA 2YY5A 3AEUA 4X65B 1EP9A 5CA1B 1ZY2A 1JEYB 1IXSB 4BRZA 3MB5A 2A88A 5LCXA 1P0CA 3CJQA 5T4HA 1Y4UA 5KEIA 2C5FA 1EE2A 2C2YA 3BOSA 2LKCA 1A1VA 3IWDB 1YH3A 3SYRA 4OUDA 5LJLA 4R1UA 1GQQA 1S4MA 1N0WA 2YNMA 5C9ZA 1RRGA 4Q34A 1IOWA 3KPWA 4HLQB 2VBFA 4URZR 1Q20A 1ZM4A 5FADA 3T7CA 4AZ3B 5CW2A 1UP6A 1ZVVA 1N6KA 2FTKE 1E2JA 2W11A 1IB0A 2QBYB 2DEUA 2B1JA 1SBYA 4AY6A 1TCUA 3URKA 3NDBB 4HAVA 2EL9A 4PNHA 4YQYA 4AJ9A 3PS9A 4IGEA 1I2BA 1V48A 4JR0A 3VHQA 2XMQA 4ZMRA 2ID8A 4BWFB 4DLLA 4MW6A 2GXSA 5J2UA 2VDRB 4J2HA 1OLSA 5E1MA 4BCBA 4MDFA 3K5IA 1UEJA 3WZMA 4QUBA 2X0KA 3UTDA 3QF4B 5CA1A 1O57A 3DEYX 2INGX 1HL3A 4II2A 2EZ9A 2F3QA 3TECE 1OOEA 5CEFA 1E5VA 1I4WA 3DAYA 4MMZB 4U6NA 4ZANA 5HKLA 1WB6A 1KJNA 2X4GA 2B7LA 3FTDA 1JWLA 2Z5GA 1BVHA 3I37X 4GUAA 4LQ4A 3TYXA 3LCUA 1FXUA 1HWYA 2C2GA 2IP2A 4KW7A 1N33B 4AZ3A 1KBQA 2ZAOA 1SURA 2SCUB 2R00A 5DH9A 1V1RA 2PM8A 2C31A 2YQ5A 5FUXA 4CM7A 1GLNA 1W93A 1BROA 3BZBA 1M6WA 2QT9A 3EB9A 4P0PB 3B60A 1FFXB 4OQZA 2WTXA 4C7JA 4FYXA 5IKPA 1KK2A 3A31A 3HJHA 3MWGA 1H2AS 3QVLA 4UTXA 1ZNWA 2XUQA 1AQUA 4U0KA 5FOXA 4I9UA 4BIIA 1URPA 3BILA 3OPYA 3WK4A 1YB2A 3A27A 4YAGA 1E9VA 3PC8C 1KC1A 3HA2A 5A0FA 2ALJA 3QRWA 5CFLA 4KR6A 1VLMA 1DG1G 3WLKX 1A72A 4GGOA 3GBVA 5K0EA 1USWA 4CCYB 1SOWA 4PWZA 1K8ZB 1P6UA 2CDNA 2AJDA 1K7CA 3RS3A 2ZRIA 1TC2A 3WP1B 2X8BA 3FNGA 3VNUA 2FF7A 3TIXB 1FA9A 3T7TA 1Z2DA