1Q2XA

Crystal structure of the e243d mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with substrate aspartate semialdehyde
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
371
structure length
356
Chain Sequence
MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKDEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of substrate-binding groups in the mechanism of aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
source organism Haemophilus influenzae rd
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase
total genus 109
structure length 356
sequence length 371
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1q2xA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1q2xA01
1E1NA 3FTNA 1U1IA 4NBVA 5KVQA 1SOVA 2ZATA 2HK9A 1VM6A 4N7RA 2P9GA 1KC1A 4Q3DA 4HKTA 5H83A 1T25A 1YO6A 3CH6A 2Q4EA 1PJTA 4CQMA 4JBHA 3QJ5A 3UVEA 4XB2A 1EFLA 1G1AA 1K6JA 3TWOA 1ML3A 2P5UA 3F3SA 3FI9A 4IIVA 1LQUA 3I6IA 1Z73A 1P44A 1Z45A 2W4QA 4DPMA 3ZCXA 1B8PA 2BGKA 1LSJA 2HK8A 1TA4A 4XD2A 2O2SA 4ND2A 3GVXA 5F1OA 3DBVO 5A4DA 4H3VA 3PQFA 4IGEA 5CEFA 4J7XA 1EQUA 3S2EA 1GAEO 1JWAB 2AXQA 3U3XA 5AQ1A 2EXXA 3DQPA 5AXAA 2GO1A 4KP7A 1D8AA 2CSUA 4YRBA 5IG2A 4JQCA 4FS3A 1YGYA 3RSHA 3E18A 3L6OO 3D0OA 4FFPA 5A9SA 3H5RA 4XYEA 2IYOA 5DNAA 4AL4A 4KWHA 3OP4A 2YW9A 4FFLA 1OZAA 4TKMA 4IDFA 2YY7A 4CLRA 4WCFC 3K5PA 3HG7A 4AJNA 3ZU4A 4CMIB 5L7TA 1MP0A 3JQEA 3C24A 3JQGB 4CM6A 5KJEA 1E6UA 2PD6A 2RAFA 1LTHR 1VL8A 3U4IA 5TLSA 1FDVA 1NR7A 3KYDB 1DFIA 3ANNA 3FNFA 5KOIA 1HYGA 1WZIA 3VH4A 2HLPA 3OIDA 1HXHA 1A27A 5J23A 2FP4A 1H2HA 3GFBA 3DFUA 2VZ8A 4D3FA 4AJLA 4OQYA 1O95A 4QFDA 3UKOA 4EEXA 3PWKA 3RWBA 1H0KA 4C7KA 3ITKA 3JQAD 3MJTA 5TSDA 4BGUA 4FR5A 2AQKA 3I1JA 2ZB8A 4AJ2A 4YVFA 4CV3A 4GWGA 5CPBA 4J1TA 3G1TA 3F46A 4ZJUA 3AM4A 4CV0A 4AJJA 6LDHA 1DRVA 4H7PA 1EUDA 1YVEI 2CUKA 1DRWA 2CDBA 1E3WA 1KEVA 4WJZA 5A5EA 4IZIA 3H3FA 2VTEA 4R1SA 1AE1A 3AW9A 4MVJA 2IYPA 2NUAA 2X22A 1R12A 3RFXA 3JQ9A 3NDJA 4OYRA 2BFMA 4ZD6A 1E7QA 5KVCA 4J9VA 2DBZA 3ZV3A 5A03A 1PGOA 4N5LA 1CF2O 2I5PO 3AOGA 1YB5A 5AYVA 1M76A 5GZ3A 1BRMA 4UVHA 1NPYA 2GYYA 2JJYA 3IUPA 5A05A 3JV7A 4JNKA 4WCFB 4K26A 2OFPA 2DFDA 1HT0A 1JAXA 3JQ9C 4B3HA 1HSZA 5T67A 4NZ9A 3SEFA 3T4XA 4BKUA 2O3JA 4M87A 3BMCA 5JAIA 1IHYA 2J5QA 1C3VA 4CMIA 5L51A 2VQ3A 3PLNA 1B15A 4OQZA 3F9IA 3TL2A 2PGLA 1NVTA 4Z9FA 3OJOA 3PJGA 4MPDA 1EBFA 3RROA 1AN9A 5EIOA 1Q7GA 1E0DA 1HDXA 3T7CA 2HMVA 3F47A 1ZKMA 3UHAA 5JSFA 4A5OA 2AEMA 1I30A 3RJ9A 4E32A 1QYDA 1B3RA 3EAGA 3IP3A 1DEHA 4F3YA 2DKNA 4YBZA 3I3OA 4BL5A 4P4LA 1W73A 1M6WA 4WGGA 1KVSA 1YL5A 1LC0A 1ZW1A 2I66A 2Y67A 3RUHA 5L7WA 3KV3O 3SLKA 3WG9A 4WUVA 1XGKA 4HFJA 4PZDA 4TRNA 3A4VA 3K2BA 4WCDA 2OOSA 4UULA 1NWCA 4RPLA 3UFXA 3BMQA 4TWRA 4PLVA 3GDOA 2B69A 3ADPA 3TZCA 1E7MA 1P0CA 3AY7A 1XIVA 3HDHA 4YQYA 4J0EA 5EPOA 4B7XA 4A10A 1NVGA 2H6EA 1JVSA 4FFOA 1ZVMA 3WGHA 4Z9XA 3KO8A 4OIMA 4LCJA 2A92A 5HTOA 5AXDA 4PG5A 3RFVA 4IZHA 2O3SA 3QE3A 3TZKA 3ENKA 1SPXA 3VTZA 4D0RA 3MOGA 4W7IA 2NM0A 1LJ8A 4A7PA 4NH4A 4JROA 3E1KA 1ZCJA 1ZZEA 1W8DA 5FEUA 3DBRB 2NVUA 2FRDA 3M1AA 1UZNA 3GMSA 4EEZA 1E6EA 5BQFA 4HP8A 1PQPA 5ILOA 3RKRA 1Y1PA 3BMCB 2Y0CA 2B4TO 1MV8A 1K89A 4FB5A 2D3TA 2D59A 3CUKA 3W6ZA 2I67A 4BS9A 2UUOA 3LK7A 4M86A 5EESA 4OKIA 3WSVA 2R00C 1PJCA 3IKVA 1DIAA 4NMHA 5C7LO 2IXAA 1NR1A 4A73A 3KSDO 2O23A 5HA5A 4IMRA 2GUGA 3NX4A 1HDYA 3UW3A 3DBHB 3FF4A 3OMLA 4BO0A 2J3HA 3WQQA 1GTMA 4EI2A 3UGKA 2ZKLA 2FN7A 1A72A 1LXCA 4YDRA 4INAA 1A4UA 4I5EA 1DOHA 4XGKA 3SXPA 4XCVA 1UP4A 3PVZA 2YV3A 3Q9UA 3WYBA 1TEHA 1LSSA 3QV1A 3VH3A 4CMEA 1JDJA 1UUFA 4YJFB 1CERA 1N2SA 2X86A 1C1XB 4WE3A 1ONOA 1AXEA 5DZSA 1NFFA 3C7AA 4JP2A 1X1EA 3ETEA 1LNQA 3D64A 1W4ZA 5TT1A 5JO0A 4LMRA 3ZWXA 5U1PA 4GKBA 3JQAB 3PZRA 4XRRA 2QYSA 4E21A 4CLRB 5JYDA 3TOXA 3LF1A 2O4CA 4AJ4A 1QRRA 4M89A 1U3UA 1YXMA 3WYCA 4TQGA 1PL7A 4JJFA 2O48X 4DPKA 1DIGA 1HLDA 4NPCA 5G0TA 5G2OA 2YZ7A 4CM4B 2EV9A 2YQ4A 1M67A 4L4RA 1WWKA 4ZU3A 3CINA 5FFFA 1IZ0A 1IHXA 1DSSG 1K5HA 3RUIA 2BFOA 4B4OA 1J6UA 5I9NA 3TN7A 2WSBA 3ZU2A 4W9NC 4BO7A 3Q0EA 5JAZA 1JW9B 1XWFA 2HK7A 2ZJ1A 3TZ6A 3C7CB 4Y6PA 3MOIA 3JYQA 4KTTE 3ROKA 5JXWA 2TMGA 1D1TA 3FPLA 5IXYA 2B83A 3GQVA 2EG9A 1PS0A 4DWVA 4PCVA 4CMJA 5EL0A 3I4CA 1VJ0A 3H5AA 2HUNA 2C07A 2X0JA 2DM6A 3H2ZA 1PL6A 2GR9A 5G0VA 3DHEA 3Q2IA 4XA8A 5BSHA 1T4DA 2NNLD 1BDMA 1CYDA 5F1KA 3KYBA 1V0JA 2C7VA 1XU9A 4BB5A 4D3DA 1X0VA 3TFOA 2W2KB 2PZKA 3PFFA 1N8KA 3JYOA 3F6YA 3Q1LA 4BO1A 4OL9A 4RPJA 4URFA 3ZWYA 1KYQA 4IS3A 3C85A 2QHXA 1P77A 2A94A 2J3KA 2VWGA 3D4OA 5DOZA 4R9RA 4FOSA 1Q0QA 4YJHB 3LT2A 4BMSA 3NRCA 5CDGA 3HDQA 2BELA 4FOOA 1K2WA 4TZTA 1CWUA 1YOVB 5JCJA 5C7IO 4UEKA 3KUXA 5B1YA 1F0YA 3OQ1A 1PJQA 3L4SO 1U8FO 3BTSA 1ZJZA 3GEMA 1BW9A 3NDIA 1YBVA 3PHHA 1A5ZA 2BMAA 5EINA 1GQYA 3K8ZA 4CM4A 2DTXA 4YAJA 5B37A 2E4AA 3CIFA 2Q2QA 2GF2A 3PRJA 2PZMA 4U6QA 1N9GA 4JLWA 4WEQA 2Q3EA 2Y66A 3LT0A 5HRUA 3FHLA 3DMTC 4BNLA 5I8WA 3GDGA 4ID9A 3MJSA 1GUFA 3PYXA 4B4WA 3VDQA 3WS7A 5A1TA 4RORA 4DBVO 2Y1DA 3L6DA 5JBIA 2IE0A 5DBGA 3ZHBA 2PA3A 2FR0A 5F1PA 3I4FA 3OFSA 4UVIA 2DUWA 1GZ4A 4DRYA 3G49A 2PZJA 1YE3A 3OECA 5IXSA 1GY8A 4D79A 3QVOA 1GDHA 5DN9A 3D3WB 5KKAA 5IJZA 4PZCA 4OAQA 3BMNA 5C7OO 1J0XO 2CMDA 4IDCA 2Q1WA 1U5CA 2P9CA 4GX5A 3LYLA 3DL2A 3BHJA 3WYEA 2ZQZA 2GN8A 1SMKA 1ADGA 1BMDA 2D5AA 4I5GA 4KDEA 4OXNA 4TROA 4D3SA 2A4KA 2FPIA 3QIVA 1SZJG 4CUZA 1YDWA 3WLFA 1NHGA 1Y5RA 2OHXA 1AGNA 2Q45A 1E1MA 1XSEA 3CSDA 5H82A 1YQDA 3P2OA 4PLTA 2ZYGA 5TRTA 4B7CA 3PIDA 3ROMA 4BOYA 2YUTA 3HJAA 1SBYA 3GVPA 1EFKA 3WGIA 3WGOA 1LEHA 3NV9A 2NTNA 3VVCA 3O8QB 4BQPA 1Y8QB 1P1IA 4KQXA 3GC6A 3RUEA 1NAIA 4Y98A 2Q22A 2BGMA 2BGLA 3C3XA 3ZNOA 2PFGA 2AE2A 1QYVA 4NJMA 4F45A 1DLIA 3PPIA 3E8XA 4MJLA 4OSOA 1UDBA 4CLOB 4FDAA 5IF3A 1ZMTA 4LK3A 3K30A 3GMDA 3ASUA 2DC1A 5JYFA 1P1FA 1QYXA 1ZSYA 2WD8A 4LVCA 5DCWA 1T2CA 4BNVA 5M6DA 2VRBA 3TSCA 1KVQA 1DIBA 3PI7A 4I9NA 1LRJA 5IDQA 3JQ7B 4J2OA 4MVJM 1PJ2A 3HN7A 4ESOA 3IUSA 2DUUA 3WWYA 4E2ZA 2YHIB 4LMPA 2P68A 2PKRA 4PLZA 3EZLA 3VPFA 3VPXA 1XA0A 3WBFA 2D1YA 3I83A 1RM4A 4XR9A 1VSVA 2C29D 3WJAA 3WMWA 1FJHA 1YWGO 3KBOA 3LT4A 4L0QA 1NX6A 3ZNQA 4UVEA 1UZLA 1ZFNA 1H6AA 2EP7A 4EJ6A 3GVHA 4E33A 4GBJA 1T4BA 3GK3A 1U2GA 1ZK2A 2EWMA 3JD4A 3D7LA 3U0BA 2RIRA 3C1AA 1M2WA 3JTMA 4YXFA 2RCYA 3KYCB 1NNUA 5K0ZA 1XR3A 4EDFA 1OFGA 1LSUA 4HX5A 4WASA 4CM9D 3LT1A 1NPDA 3BAZA 3UICA 5KVSA 2IEBA 2FR8A 2J3IA 4QQRA 3LLSA 2IRWA 4RF3A 1DB3A 3BIOA 3UCFA 3AI3A 4DC1A 3DZHA 3H3JA 5ILGA 4BNIA 1IPEA 2VUSA 1YONA 3PDUA 4J9UE 1JKIA 3EY4A 4LW8A 1LLUA 4D43A 4UUPA 3I9LA 1RYEA 3K9QO 1RWBA 1W6UA 2BHLA 1YRLA 3KETA 3NT5A 4DQUA 2Y1GA 1R15A 3NJ4A 4J90A 1AUPA 2Y0DA 2VRCA 2NQTA 1DC6A 3VPGA 4BNMA 1Z82A 2Q46A 4WCFA 3D4NA 4NFSA 5L4LA 5DF1A 1UP6A 2GNAA 2PK3A 1A7KA 1F17A 3B20A 3HN2A 1ZNQO 3FNGA 2FPPA 3I9MA 2B4QA 1UAYA 1MB4A 1LRKA 4G81A 4Q3AA 3H9EO 3DZJA 2QRKA 5A3JA 4KUHA 5KNLA 2OP1A 1UDAA 3QVTA 2YV1A 5B4TA 1PX0A 1NM5A 3IKTA 1NPTO 2C2XA 4MKRA 3FBGA 1DHTA 4XX0A 4BIIA 2EF1A 3OIGA 2SCUA 1E5QA 2E37A 5CHEA 2Y0EA 1IB6A 1SCUA 4CPDA 2PWZA 3EGOA 1ISFA 2NU6A 2PGDA 2BI8A 3PHLA 3ZNNA 2CZCA 1GU7A 1ULSA 4L8VA 4GGOA 1LU9A 1A4IA 4JN6B 4L4XA 1ORRA 5I9LA 1U7TA 1AHIA 4GMGA 2O3QA 3BZUA 2AE1A 1ZJYA 2OUIA 4MVJD 4GSKA 4JJIA 5IZCA 5A06A 2VYNA 3CTMA 1GPJA 2I9PA 3E5RA 1Q7BA 2P2SA 3WIDA 2O2YA 3IS3A 1FMCA 3WR5A 3N7UA 2WYWA 5K6AA 3ZV5A 4OGWA 3IOYA 1HDZA 3BMOA 3OA0A 3ZWNA 2ET6A 2WYVA 3EVNA 4LCEA 4BNZA 2VT2A 1EBUA 4CQLA 3K73O 3AI2A 4XEHA 5IZCC 4I08A 4OM8A 3U4HA 2NV6A 2DU8A 1U3VA 4OOEA 5H81A 3RI3A 1P1HA 4XR4A 2WD7A 4MINA 5FF9A 4JGBA 4TKLA 4AJPA 5HWSA 1NTOA 1V3UA 5BT9A 4EGFA 1MX3A 5CEJA 4RVHA 2VOJA 4BGEA 1P0FA 4XQCA 2EEZA 5L53A 2YHUA 4NR0A 3FBTA 1E3JA 5L3ZA 1FDTA 4DIBA 1H6CA 1C1DA 1RM0A 1PJLA 2IZ1A 4ILKA 1I2ZA 2AQ8A 1K6IA 3H9GA 4JIGA 4R51A 4KDFA 3WJ7A 3DBHA 3HQ4O 4DIOA 4DL9A 1KVRA 3WXBA 5CG2A 4GKVA 4PG6A 3O38A 5JYEA 1PJSA 3P5SA 3QSGA 1VJ1A 2JD1A 3TDKA 4JK3A 2O50A 4RZHA 1GYRA 1I33A 5DCUA 4E12A 3NTOA 3E48A 2ZYAA 4BNTA 3W8DA 3EVTA 1VRWA 4Q39A 1HTBA 2QZZA 3NGXA 1A7AA 3OJ0A 2F00A 5JO9A 4XIYA 2LDBA 4B79A 2EJVA 2B37A 4AJKA 3IIEA 1FDUA 3KLMX 3PXXA 2UDPA 3W4JA 3CMMA 4NG5A 3TFQA 5KJ6A 4MKXA 1P74A 1ISHA 1UXIA 1W0CA 3AK4A 4PG4A 2CF6A 4F6CA 5JDCA 5JDIC 3PYLA 2GLXA 3U49A 3PYMA 2QYTA 1UH5A 2Y05A 1GYQA 3M2TA 2OZPA 4QTZA 1FF9A 4RLHA 1YL7A 3ANMA 4CL3A 3NJ8A 5CDTA 5BNIA 3OEYA 2EGHA 2NTVA 3VKUA 4LN1A 2P4QA 4BNNA 1ARZA 3SJUA 4RZIA 5JC1A 1PS9A 3HDYA 3B1KA 2GN4A 4YJDA 2BRUA 2A9FA 1R6DA 8LDHA 4E5MA 5EQFA 4H16A 4J4BA 1Y5MA 1WMAA 3M1LA 2EHDA 1VLLA 3EZYA 3H65A 3KYCA 1X0XA 4TRMA 3DTYA 1V8BA 2VCYA 1SO8A 1OMOA 5ITWA 3WFJA 1DXYA 4I5DA 1LLCA 5DULA 4CQMB 1SB8A 3PJDA 1CJCA 2F1KA 4L76A 3D5TA 5FYDA 3R3SA 4YJGB 4E2WA 3TF5A 3IP1A 1I24A 3DHNA 3GVCA 5COAA 5G0UA 3INGA 5TJ9A 4BNWA 2E49A 5CDYA 4W82A 4AJHA 5JCJD 1Z7BA 2E82A 1H9AA 2JHGA 1E7WA 4C4OA 4PZEA 2HAEA 3U4CA 3RC7A 3KLPX 2EJWA 2UVDA 3VZPA 1DIHA 2X5KO 4YAKA 4L4SA 1GFSA 1PS8A 1QLHA 4G65A 3DBLB 3A9WA 3O9ZA 1BTOA 1TXGA 1ZK1A 2Q1SA 2WEKA 3FPCA 3MEQA 1J49A 3GDFA 3ZV4A 1YDEA 2X7HA 2V65A 3KEOA 4GI2A 4I1IA 4ND1A 1PJBA 5KJCA 4YQZA 5ITVA 3AY6A 1EDZA 3AU9A 3DFZA 2O3TA 2B36A 4CM8B 3EW7A 1EVYA 3KOUA 3RBZA 1HE3A 4WLOA 2DQ4A 2R00A 4CMCA 4YT8A 4CODB 3IJPA 2Z5LA 3NKLA 4R01A 4QT0A 5DP1A 4BNUA 4HV4A 4XQEA 2NVWA 2VHWA 2Y99A 4IJVA 1DHRA 4XDYA 5GY7A 2C2YA 3GR6A 1YJ8A 1WW8A 4MP6A 3SJ7A 1A9YA 4UUOA 3UCXA 1KEPA 4UUMA 5A9RA 1J4AA 3WX0A 4FBGA 4GLLA 5BNFA 1AXGA 4KOAA 4GAEA 1KERA 3OHSX 3S1LA 1F14A 1ZEMA 4N5NA 3I9NA 2J3JA 1YQGA 4PVCA 1ADFA 2G0TA 1Q2XA 2E48A 3ZW8A 4QO8A 3MJEA 2C54A 4XGIA 4YA6A 2C59A 4IQ8A 3VZRA 2CF5A 1Z7EA 5L4NA 3QVXA 4ND3A 2UAGA 2C5EA 4B3IA 4R41A 4ND5A 4D46A 4K6FA 3AOEC 4ND4A 1T1RA 2AG5A 3DC2A 2X4GA 2J8ZA 1O8CA 1PZFA 3Q2KA 4Z0HO 2VNSA 3KHUA 1BHSA 4QXMA 4BNJA 4CMEC 3ZWVA 4HWKA 4GVXA 1N92A 4B4UA 1ZK0A 1B7GO 3LF2A 3WTCA 4CUJA 1XELA 4OO3A 4NJMB 1T2FA 3LQFA 4IY1A 1YS4A 5T6BA 4CLHA 4N54A 5MDHA 5JC8A 4DREA 4BKQA 2FZEA 4CLOA 3G0OA 3AM3A 1E3LA 1H9BA 1MLDA 5F5LA 4HBGA 3BTVA 1ONPA 1JLLA 1LDNA 1G0NA 1HEUA 2OBYA 5HS6A 4DBZA 3ZNPA 2OO5A 3PK0A 3ZN2A 4H15A 1ID1A 3JQFA 4IDBA 4D41A 2DBQA 3Q6IA 4JXKA 1GZ3A 3PGXA 5TT0A 2H5LA 1BXGB 4NDNE 3LC2O 1G6KA 2HJRA 4R16A 4Y6RA 4AJIA 4W9NA 4BKOA 4EJMA 3L07A 4PLWA 4CMHA 4FFRA 3IDSA 3VPSA 1GEGA 4UAGA 1BVRA 1DFGA 1HRDA 2WWRA 4DGSA 4R4JA 3H4VA 2BI7A 3V1UA 1JWBB 1WMBA 4L74A 2ZIZA 3S2GA 1WAMA 4KUEA 2RHRA 3P7MA 4MKZA 1B8UA 1CQIA 1E92A 1TB4A 3PLRA 2DBRA 2X1HA 3HFGA 3GUYA 2VN8A 4XYBA 2WE8A 1GCOA 2JHFA 2CNBA 5LDGA 1X7HA 4HFNA 3RCBA 9LDTA 3SBOA 2CD9A 1B14A 1ZH8A 2ZK7A 3UCEA 1DFHA 4IPTA 4II3A 2D2IA 3WGQA 2H63A 4IM7A 4ZA2A 1Y9AA 1L1FA 1KETA 4JCOA 4XZ3A 1I8TA 5TX7A 1EUCA 2X0RA 3SLGA 1DDOA 1BWSA 4LGVA 1MC5A 1O6ZA 2DPHA 4BO8A 1X14A 4Z0PA 4NI5A 3ZWWA 1LC3A 3KYDA 1PQUA 1LQTA 1P3DA 2ZTVA 3LU1A 4GLOA 3EMKA 3DHYA 7MDHA 2B0JA 1VL0A 1U4SA 1BDBA 1T26A 2OMEA 2BH9A 1Z75A 2WDZA 4BQRA 4D7AA 5ENVA 1YH3A 3TRIA 1ZEJA 4WPGA 1LBEA 4QX6A 3QWHA 1KBZA 2FR1A 1HDCA 2NACA 2EW2A 3DZBA 3OICA 5JDCC 2FHSA 3GHHA 5GZ1A 3K96A 3OQBA 4P4NA 1QV6A 5KKCA 5CAEA 2YYYA 3OQ6A 2GD1O 3LSYA 1R0LA 4FQ8A 1M6HA 1S6YA 2HQ1A 4XJTA 1V3TA 4LRSB 3DZFA 3V2GA 3RBVA 2W8ZA 2NADA 1BVUA 1EK5A 1VPDA 4YCAA 4YT5A 1JU9A 4ROSA 4E5YA 2GPTA 4DVJA 4MVJF 2JCVA 3ZHZA 3RUAA 3SX2A 3VH2A 4B3JA 3GRKA 1NQ5A 4IUYA 4BMNA 1R0SA 4PRKA 1EMDA 3H5NA 4MP8A 3H2SA 1HZJA 3IMFA 2FOIA 3ASVA 1LLQA 3JQAA 1ZK4A 1XDWA 1VKNA 2H1SA 3PQDA 4LSWA 4YTEA 1D1SA 4D0SA 3GF4A 5JFOA 2HRZA 3Q11A 3TJRA 1MFZA 3HZZA 3PHIA 3GPIA 3ITDA 2V6FA 1DRUA 3R6DA 5EERA 1LDBA 2VNAA 1F06A 2VHYA 4I5FA 4ZRNA 1I2BA 5TNXA 2PLAA 3L4BA 1M75A 1C1DB 2GRAA 2EERA 2Q2VA 1Z74A 1F8GA 1HE2A 1R4MA 4BV9A 1R4NA 3BTUA 1NASA 5JPIA 1C0LA 2OBNA 2VTDA 3S2IA 5T57A 1UR5A 5JS6A 4RQTA 1DJNA 4TVOA 1IY8A 1P33A 2JAHA 2CVQA 5J9GA 3ZHXA 4EZBA 3DZGA 5G4KB 3RUFA 2AHRA 2B35A 2J5RA 3WIEA 4R54A 3S8MA 2VRCD 3ORFA 4O1MA 4ZN6A 4HNGA 4FW8A 3TZQA 3RASA 3DMTA 3WQRA 1DLJA 1PL8A 1I10A 3AJRA 4RLSA 2WE7A 3QHAA 1ZUD1 1EVIA 4OXYA 4XYLA 4ALIA 4GWKA 3W1VA 1IPFA 5EMHA 2FMUA 1Y81A 1KVTA 5KTKA 1PR9A 8ADHA 1Z6ZA 5BNTA 2B5VA 3JQCA 2QG4A 4K6CA 4LSMA 2HRBA 2VHVA 3RJ5A 3UN1A 2I76A 3ICPA 3ON5A 2ZTMA 2BD0A 3JYLA 3ZHYA 2PH3A 3GN1A 3RU9A 1IZ9A 5BR7A 4MIEA 5B12A 4J43A 5A9TA 3ZZNA 5C37A 3CZMA 3L9WA 2QZ9A 2EGGA 2BFAA 2WJPA 3NUGA 3PIIA 4N18A 3WNQA 1EEHA 4WOJA 3K31A 4FSHA 3WICA 3SVTA 5CDUA 5I7EA 3K92A 1P1JA 1DAOA 5IDYA 3ZV6A 4CM1A 4E13A 2HKIA 1B2LA 4PGFA 2IEDA 3G3EA 2GN6A 1J5PA 3DMYA 3UH1A 1LDMA 5IAAA 3MWEB 3RBXA 1KY4A 1NQTA 2AW5A 3IJRA 4N5MA 5FI3A 3ZI0A 2VYVA 2DTDA 3EK2A 4TZKA 1I0ZA 2CDCA 4O63O 4BKPA 4EUEA 1PR3A 1GQQA 1WDLA 3ABIA 4E5NA 4Y9DA 2VHZA 4CR6A 5L4SA 5AOVA 3V2HA 5HBRA 3NDRA 4JP3A 1NP3A 5IZ4A 2C7GA 3JQ8B 3OA2A 4RVGA 3F5QA 2VZ0A 1JKJA 2HCTA 3QRWA 4E4YA 3I9OA 4RL6A 3WLEA 2Y1OA 4CUKA 2X6TA 3BHMA 3ZGYA 3E03A 1B3BA 4G2NA 1U28A 2ILTA 4O5OA 2D8AA 3WGTA 1CETA 5LDHA 1I5RA 3VC7A 5LC1A 4DMMA 4IS2A 1Y9EA 3ZWMA 3WTBA 3C1TA 4IDDA 3M6IA 4U8GA 4XRGA 2XXJA 3NT4A 3UF0A 4GQAA 4WLNA 4RGBA 4RQUA 3TOZA 5TF4A 2O4UX 3AUAA 4MVJH 4RV9A 1F8FA 5CP8A 4J1QA 1IL0A 2GGSA 2I99A 4JX8A 5TS3A 2GCGA 1I2CA 3R1IA 1YB1A 2CY0A 4ZQHA 1GPDG 2Q1TA 3OETA 4NNJA 4CMGA 4YAGA 4J4TA 4YJGA 4CM8A 1E7SA 4TVBA 2PR2A 1QYWA 2Z95A 4Q3NA 4YPOA 4GSLA 2XOXA 1E1LA 3DONA 4NBUA 2RH4A 3GZNA 5T8KA 3QW2A 3C1OA 1XQ6A 1WPQA 4XQGA 1OC4A 1B0AA 3BYZA 2FSSA 3IAHA 2YDYA 2Q2WA 2VUUA 4BHTA 1ZXBA 3RC9A 3MJCA 5EJ2A 4XJSA 2QRJA 3T4EA 1KEUA 2IODA 2EKQA 2JAPA 1U9JA 5L40A 1PQWA 3JD2A 3PJEA 4YT4A 1NBOA 4IXTA 2IDZA 4IINA 1C0IA 4E5PA 4CMKA 2CVOA 2YFHA 3A14A 3NTRA 5A02A 4UVDA 4LRTB 1PJ3A 3AUTA 1EZ4A 1DAPA 1E5LA 3HUDA 3WBBA 2PNFA 3JQBA 3SC6A 4R1TA 2ZB7A 4NBWA 1F12A 2W2KA 3INRA 3NTQA 3GEGA 1R66A 2W90A 3GVIA 2AQIA 4R5HA 2EP5A 3AI1A 4EYEA 3LZ6A 3W8EA 5ER9A 2P9EA 4BNGA 3D3EA 3PFWO 4QEDA 1GV1A 3OBBA 4RPKA 2FWMX 4TRRA 3DAGA 1MG5A 4IXWA 3AUUA 4GH5A 4Z3DA 2NU9A 1HDRA 3VDRA 5JYAA 1GV0A 4B4VA 2NLOA 1ZO8A 1Y7TA 4A26A 1E3SA 4Z0TA 3I6QA 2V6GA 1E3WB 2J5KA 4NQZA 4WKGA 1ENOA 4L75A 3S2FA 4B7UA 2Y1EA 3ZWAA 3WSWA 4NK4A 3GRPA 4Z9YA 3U9LA 1BW9B 2JD0A 3U09A 4R3NA 4IIUA 3PHJA 4BMVA 4ZQEA 3COSA 3N58A 5THKA 2HMUA 2VZ9A 3V8BA 3GHYA 5AXCA 1K6XA 4R69A 5I7VA 3PP8A 1C0KA 1SC6A 1QSGA 3ONDA 3N74A 1E3IA 1YBAA 3D4PA 3GEDA 1KY5A 2FZWA 5IDXA 1BXGA 4J0FA 4EJ0A 1HYEA 2DFVA 3O8QA 4MOWA 4PLCA 4R1UA 3E5MA 4PIVA 1PGQA 5JCXA 5TJHA 3E82A 2D4AA 4RDIA 3A28A 4CMBA 4J6FA 3AUSA 3DOOA 2GSDA 4W7HA 3MZ0A 2OP0A 2LDXA 4U0KA 4ZVVA 3M2PA 1LDYA 5KVVA 3D5QA 4IQ0A 4R3WA 4OSPA 4BNKA 3GN2A 3GPDG 3JQ7A 4WLFA 2NU8A 5FI5A 1HSOA 1NYTA 3OJEA 1E1KA 4NBRA 5KJ1A 3ICCA 1N1GA 1O0SA 1QV7A 4G5HA 3WGGA 3WGZA 4CM3A 1JKFA 1JTVA 3NYWA 1UDCA 2Q4BA 3BMOB 4BGIA 3BHIA 2VYVD 2IZ0A 1BXZA 3RKUA 1XLTA 4XGNA 1ADCA 1Y8QA 5TIIA 1EE9A 3DOCA 4HUJA 1VL6A 4AJEA 3VHRA 1SB9A 1ENPA 3DEYX 5COBA 5A04A 1NQOA 4OOFA 3AU8A 4Z3KA 3HE3A 3KM0A 1MFPA 1RKXA 3A06A 4Y67A 3GNQA 4LISA 2P5YA 1UJMA 1PIWA 2G76A 3QWAA 5ER6A 3VZSA 1DJQA 3JD1A 2D5CA 3GOHA 5BSEA 4ONEA 4QO7A 1GUYA 3W4IA 3GUCA 4ALLA 4RPHA 1GD1O 4RF2A 3WGYA 3PHGA 1HWYA 1NWHA 1XQ1A 2C5AA 3GGGA 2EKLA 5THQA 3E9MA 4CM7A 1SEPA 1I3LA 2YFQA 4IDGA 3C8MA 3MJ4A 3ONFA 1P1RA 4L9RA 3RUCA 4KMSA 4NFHA 3GAZA 2QX7A 2VUTA 3OIFA 3R0IA 2NVUB 2YQ5A 1C0PA 1M66A 1HDGO 4Q9NA 1E3EA 1GADO 1GR0A 1Q0HA 3LLVA 4AVYA 2FPGA 1VKOA 3S55A 2X8LA 2VOEA 1ZXLA 4I9UA 3RC2A 3RFTA 1I3NA 3VPHA 5JDIA 5ENDA 1V3VA 5JAMA 3VKVA 5JW6A 4J91A 5G0WA 3U4DA 1UP7A 1WLYA 4MVJP 1VI2A 4J1NA 2JKVA 1T1SA 4KUGA 4XQ9A 5B4UA 5KWEA 4ALNA 1PTJA 1SNYA 2PTGA 2BFPA 1WVGA 4LVUA 5T5QA 4E31A 1QG6A 4M8SA 1BSVA 1RJWA 1UXKA 3H8VA 2O7SA 4ZHSA 4HNHA 4ALMA 3KRTA 1EVZA 1R4NB 3QLJA 1QR6A 4YT2A 1BG6A 4J16A 5JAQA 2I6TA 3NT2A 1MG0A 3H6KA 2ZTUA 3UUWA 3DOJA 2PD4A 3EDMA 4BNXA 1O9BA 2IZZA 1VJTA 4J2HA 4BO3A 4WEOA 1LI4A 4W4TA 1HL3A 4FD3A 2UYYA 1PGJA 3PWSA 3AOEA 3DR3A 1LUAA 1XG5A 1Y8RA 5JLAA 1SOWA 3TNLA 1KEWA 4XKJA 4DLAA 4ITUA 2GERA 1H93A 3LC7O 3CMCO 1MA0A 2C82A 1B8VA 3K6JA 5TGDA 2X0NA 5CEEA 3HWRA 4MP3A 2ZJ0A 2O3RA 1JA9A 3QY9A 4FC6A 5C5IA 3FTPA 1XYGA 3FRJA 4I9HA 1RYDA 1VC2A 4YAEA 5A3VA 4CV1A 3VAZA 1PWZA 1P9LA 3PZBA 1QLJA 1OI7A 2W98A 4FCCA 1RM3A 4PLFA 4YJFA 1NXQA 1SEVA 3I5MA 4NK5A 3GLQA 3TZHA 3F5SA 1HDOA 2RHCA 1OAAA 4D44A 4NIMA 3FWZA 4UVGA 3H9QA 1D7OA 2V6MA 4TMFA 3DTTA 4JJGA 4A0SA 4BV8A 5JNLA 2JL1A 1EK6A 4QUKA 3ZU5A 1MXFA 2BF7A 4NBTA 2Z1MA 3G1UA 4DYDA 4BKRA 2PKQP 2AG8A 2NSDA 4X54A 3K2EA 4E0BA 4WNCA 1L7DA 4OHUA 2FY8A 3W6UA 2UV8A 4FFMA 1CEQA 3OJFA 3WB9A 4PG7A 3ULKA 5C3MA 1O89A 4IGFA 4A03A 2OORA 2POQX 4J1SA 3CE6A 5ADHA 1CIVA 1WZEA 5GMOA 1EQ2A 4IJKA 4R5MA 4CM5A 5U4QA 3DBRA 4RPGA 3RQSA 1L7EA 1GUZA 1HE5A 1UXHA 4PFJA 4WLVA 4PLYA 3GGPA 3WOHA 1U3WA 5F21A 1Y8RB 5GZ6A 3LVFO 2Y1FA 3ZU3A 5BSGA 5I8ZA 4E2YA 3GNTA 2NWQA 3AFMA 4EBFA 3O03A 4RJTA 4YR9A 3P2YA 2CFCA 1ISMA 4BUCA 1ZBQA 2WD7B 2BLLA 1N7HA 1OBFO 1E7RA 2QW8A 4II2A 1FDWA 4FFNA 4UEOA 3H7AA 3RUDA 1NFQA 3W8FA 4WECA 4GVLA 4CJXA 4J3FA 1WP4A 3EUWA 2X9VA 2UUPA 1WNTA 5T64A 3UAGA 3NGLA 4BB6A 4E6PA 4NU5A 1LLDA 4RVUA 1HETA 1ISJA 1V35A 3DXFA 1Y6JA 3FCOA 5A5FA 5U9CA 3DAFA 3JYNA 1GYPA 2W2LD 1ZSNA 3ST7A 4OXKA 3CXRA 1TT5A 1YOVA 5COQA 3D3WA 4PLPA 1LA2A 3JSAA 5BSFA 1CDOA 3JQFC 1JAYA 4BNYA 3P19A 3H9UA 4M49A 3I9KA 5IN5A 4BO6A 2E6UX 3VH1A 1IOLA 4Y8VA 4E5KA 4ALJA 1H94A 4ZQFA 4YWJA 5JE8A 3I23A 4NHEA 1RPNA 2DLDA 5KJFA 2NQ8A 5IN4A 5FWNA 2X23A 2PV7A 3GT0A 4W6ZA 2B5WA 5HM8A 1EVJA 4GMFA 3RD5A 4HXYA 4RF4A 1U2DA 1DBVO 2I3AA 4PRLA 3HB4X 1MUUA 4GL4A 3DZKA 2Z1NA 1XEAA 1X13A 3GZNB 3INTA 3O4RA 2Q49A 2ZCVA 2VWHA 3HNPA 1PZHA 5JMPA 5HS4A 2V6BA 3AM5A 2NU7A 3RAJA 4AJOA 2O3UA 3F1LA 3ROQA 3WMXA 1VSUA 3OF2A 1C1XA 2OGUA 4A2CA 1LX6A 4OH1A 4CLEA 1S7CA 3ONEA 1UXJA 3AFNA 5DOVA 3CEAA 1T2AA 1E7YA 2X9GA 2CDAA 3GGOA 4M1QA 3E6AA 3HDJA 4CLDA 3OEWA 4RVDA 4DC0A 4OMUA 1B16A 3RU7A 1IULA 3PDJA 4BGVA 3NEPX 3STHA 3E9NA 4BVAA 2C20A 1LDGA 2I65A 4Q3EA 3ADOA 4DIFA 3QA9A 4YRDA 1E77A 1AHHA 3KTDA 5MGBA 4RDHA 5ICSA 3QP9A 2AA3A 1B26A 4MVJI 2IXBA 1PU2A 1WDMA 2D0IA 5L9AA 2Y93A 3TQHA 4GGPA 5A9SB 1NVMB 3GFGA 2V7PA 2TMDA 2EIHA 3ZW9A 4E3ZA 3HFSA 1I3MA 3AWDA 2QRLA 5CFZA 1JQBA 1YKFA 3AY3A 1N5DA 2GASA 4XIJA 5DDIP 3BXXA 4ZQGA 3DZIA 5TQVA 4ALKA 4BNHA 5IDWA 4XYMA 3SC4A 1GL3A 4KZPA 1ENYA 4FJ1A 3KSUA 4D45A 1DC4A 2YHIA 3JCZA 4E2XA 4IJWA 4CV2A 1NFRA 5K6AC 1X1TA 3CPSA 1KVUA 1V6AA 5DCYA 4JBIA 4BNFA 5TC4A 2JFHA 4S1VA 1PWXA 1U7HA 1ZIDA 3WFIA 3H9JA 2A35A 3ZWBA 4DLLA 2ZB4A 4CR7A 2X9NA 4WLEA 1R0KA 4GPD1 4P8RA 3JD3A 3VOSA 4QECA 2FSVA 4DPLA 1HZZA 5DBIA 3ENNA 2AEFA 1X15A 2ZB3A 4J7CA 1KOLA 1DC5A 1IYZA 1H2BA 1GEEA 4BO9A 1QMGA 3KEQA 1DIRA 1N1EA 1NHWA 4Q3BA 3V2UA 1I32A 1K0UA 5CDSA 1D3AA 1XHLA 5CPFA 4AICA 4O6VA 3DDNA 1T2EA 4UREA 4RVSA 2PGJA 4FIZA 4CR8A 1FK8A 3BMNB 2J6IA 2YV2A 1E6WA 3JQGA 5ES3A 1O94A 3ZH2A 1ZMOA 4QFCA 2WMDA 3PTZA 5G4LA 4J7UA 4IQGA 2DT5A 1TI7A 4Q3CA 3U62A 4HADA 3FD8A 2G82A 4IBOA 5JY1A 1R4MB 3UXYA 3FR8A 3PJFA 3QVWA 1RM5A 4ZICA 1H6BA 3WDSA 2Q1UA 3RC1A 2X58A 4DUPA 4ZQBA 3QWFA 3WQSB 4R1NA 2PD3A 1CRWG 2VHXA 5I7FA 2W2LA 1YL6A 3LDHA 3VZQA 4EUFA 2C0CA 4DYVA 4I8XA 4E30A 2DAPA 4KTVE 3JD0A 2BKAA 1R37A 1MGOA 3CZRA 3JQ6A 3IQDB 1U4OA 5I9MA 5L7YA 3C7DB 2B4RO 4CLXA 2RH8A 5CG1A 1TLTA 3DB2A 4PLHA 1HYHA 4U6SA 4B8WA 3OH8A 1LRLA 4XB1A 3FNHA 1JN0A 3QQPA 9LDBA 2ZYDA 1UAGA 2GZ3A 2XF8A 4RF5A 4FPXA 4MVJE 4DMLA 1X7GA 3I9JA 2P4HX 1FDSA 3HADA 3EC7A 3MTJA 1XKQA 4RVFA 4BO2A 4YYZA 5T73A 1ONNA 1V9LA 4P22A 2Q99A 4WLUA 5K9ZA 4U5QA 1TT5B 3PWZA 2PZLA 4KWIA 3G79A 3V1TC 5AVOA 3PGJA 2OXIA 2HMSA 2HU2A 3VTFA 3FSRA 2HMWA 1C14A 2Y1CA 3JQBC 2XXBA 4R9SA 4W99A 4J49A 1P1KA 1LSOA 1HLPA 4F6LA 2I3GA 1A71A 1I01A 3BA1A 3QWBA 3ZWOA 4DA9A 3R3JA 1EE2A 3QVSA 2OL4A 3W4KA 3V5NA 4YACA 4D42A 2ZCUA 3MWDB 3ZDFA 4M55A 1XCBA 3KXDA 3ROPA 2Q50A 1ISIA 3ETGA 3GA0A 1G0OA 1T24A 3O26A 5ICMA 3JQ8A 4U7WA 5DT9A 3T7EA 1Q7CA 4MIOA 1K3TA 2XPCA 2JD2A 2Y68A 1U8XX 3RVDA 3U5TA 4FGSA 3FNEA 1PGPA 3G17A 2AQHA 2R2GA 3ZWPA 4A27A 4CQLB 7ADHA 1O5IA 3F4LA 1LDEA 3V1YA 5EN4A 3E9QA 4IMPA 3BMQB 4UUNA 1JVBA 3LC1O 2H9IA 2PKQO 4K1LA 4MO2A 3DAPA 3BTOA 4AFNA 3GH3A 4WOKA 4MVJG 2GZ2A 3HSKA 1ZSVA 1DO8A 4MIYA 4DLBA 1SAYA 1QKIA 4NFYA 1D4FA 2GN9A 2PY6A 3B1FA 3I52A 1UXGA 1HKUA 1NAHA 3KSZO 3X2EA 2DPGA 2X5JO 4WNIA 4TSKA 4HFRA 2WTBA 3PQEA 4O59O 1TVEA 1P45A 4FGWA 4ZRMA 1PGNA 1QORA 2VWPA 4IJUA 1PJ4A 2HO5A 4YRAA 5IFLA 2ZTLA 2HJSA 1KC3A 1EUZA 1Q1NA 4J4HA 2YJZA 4NU6A 3KVOA 1IE3A 1VE9A 3QWIA 2G1UA 4CL8A 2X5OA 3DWFA 4XWYA 1WXDA 2HMTA 5G4KA 1MC4A 3KB6A 3MCVA 1Q0LA 1ZK3A 2ZQYA 2O7QA 4KQWA 4BO4A 5L45A 4GX0A 4EUHA 4Z6KA 5L95A 3JYPA 6ADHA 4UEJA 5AXBA 3CKYA 4GX2A 5JMWA 5KCZA 1KIFA 4U0JA 1P31A 1PSDA 3A1NA 2JCYA 3L0DA 4FJ0A 3FN4A 2X0IA 2QIOA 1ULUA 4GX1A 2YDXA 2NVBA 4OJNA 3HHPA 5T8KC 3WNVA 4EW6A 3D1LA 4PLGA 2HDHA 2VT3A 4PVDA 4DXHA 4JBGA 4P4GA 3EHEA 1KS9A 3HB5X 5DP2A 4CMAA 4K9DA 1IUKA 4FJ2A 3DBLA 4DTIA 4L73A 1QP8A 3JQDA 4M54A 1ENZA 2NTJA 3ANLA 3F1KA 2P91A 3GAFA 2XAAA 1WDKA 1N7GA 5KIAA 4EITA 4YAIA 4HFMA 3GY0A 1X7DA 3L77A 3ETDA 4PG8A 1I36A 3GG9A 3KZVA 4XYGA 1HF3A 2QQ5A 3B70A 1ADBA 3F4BA 4R68A 3RIHA 5F5NA 1H5QA 3ZWCA 1TT7A 1YB4A 4YEDA 1NQAO 2RBEA 4QSMA 2VYND 4P38A 1HE4A 3OJLA 4RO0A 1I3KA 2EKPA 4FN4A 3MTGA 4IDAA 2JFGA 3TL3A 4Y6SA 3IC5A 1YJQA 2JCXA 3Q3CA 1GCUA 2DVMA 1T2DA 4C7JA 4O0LA 4DQVA 4DQXA 1CQJA 3L6EA 3B1JA 3GG2A 3EYWA 2AMFA 1OOEA 4IDEA 3FWNA 4ZGWA 3NAQA 4CQMD 1PZGA 4F46A 1DC3A 3FR7A 3L9XA 5DBFA 2DTEA 2CVZA 2GDZA 5JY6A 2WYUA 4TRJA 3X2FA 3TPCA 1GQ2A 4HY3A 4CM9A 1MXHA 1R16A 1QYCA 3OSUA 5EQDA 1N9GB 4MDHA 5F3RA 2WM3A 3OM9A 1DPGA 2EW8A 2PH5A 3PEFA 3WWZA 4FC7A 1FXSA 1ISGA 3B6ZA 1XU7A 5LCXA 1H6DA 4WK6A 2G5CA 3Q9NA 4XDZA 1PZEA 3VVBA 4BO5A 1YQXA 4RCVA 2JFFA 4K28A 4S3MA 1EDOA 2VWQA 3UOGA 2DBVO 1UZMA 1GZ6A 1U3TA 4YJHA 3DO5A 2AEJA 2HSDA 4PN3A 1U5AA 4OKNA 2GZ1A 4B8ZA 3L4BC 1BXKA 1YBMA 3GNSA 4AG3A 1A9ZA 5B4VA 3IL2A 2R6JA 3GZ4A 1OC2A 5G0SA 2G17A 3MJVA 4AJ1A 4NJOA 1QXSA 4YB8A 1BGVA 5I7SA 1PEDA
chains in the Genus database with same CATH superfamily
4NBVA 3QX9A 5HYVA 1TQ4A 3Q40A 4IVRA 4F0JA 3REFA 1S1MA 3E61A 4AWXA 3OZEA 1N8TA 3CH6A 4QGBA 4RELA 3TNYA 1Z5NA 2Q4EA 3CNBA 2IYUA 2YVLA 4DV6B 1K5DA 3LUJA 1G1AA 1JBEA 2JIPA 1ML3A 2P5UA 2Q6OA 1N7IA 3C70A 1LQUA 3OWOA 4G6ZA 4PXYA 3TLBA 1Z45A 1P44A 3LJKA 5GVSA 2W4QA 4DPMA 3DNMA 3ZCXA 5FBHA 1RWXA 1U2QA 5ADUS 1B8PA 2QTNA 1LSJA 5EPEA 4HDMB 3ZE0B 1YR7A 2O2SA 4F8JA 3GVXA 4RD6A 1X7ZA 5JNTA 2C3YA 1ZD5A 1EQUA 3S2EA 3PV0A 1GAEO 1JWAB 3U3XA 4HG2A 5AQ1A 2HLHA 4U7HA 5AXAA 3WKDA 4BVGA 4EX6A 1JDSA 1OBVA 4NZPA 2FE1A 2IOFA 3OQPA 1RWOA 1P9RA 4JOSA 4MR8B 1P0MA 5FBRB 3TK1A 1MVOA 3UYLA 1IC6A 5JBQA 4INZA 1KJQA 2OXCA 3CH7A 1R0RE 2FZKA 4MJ3A 2OR3A 2X1LA 5E9AA 3RSHA 4NDAA 3E18A 5MDHA 3F4KA 3H5RA 5FA5A 3ZDDA 1U0SY 2Y9MB 3P4YA 2IXTA 5DNAA 5BSRA 1ZGJA 4AL4A 2YW9A 4FFLA 1ICIA 1NW4A 4IDFA 3ES9A 1J9ZA 1VMDA 1H2EA 3HG7A 3ZU4A 1P6XA 2XCSB 4P84A 3NMUF 2RGCA 1EYZA 2QTBA 2MSDB 3DZ3B 3FTCA 4GBED 4CM6A 2GXAA 5KJEA 4UBNA 3OVMA 2E55A 1TD9A 3UMYA 6PFKA 4OG2A 1FDVA 4GNKA 3SHOA 3KYDB 1GPYA 1TTHA 1NNLA 1K4MA 3BK1A 3LGSA 2IP1A 1BOFA 4IH1A 3U19A 1CJVC 1HYGA 4KIWA 1KO1A 3VH4A 1LPNA 3UV6A 1G16A 4M53A 1R6BX 1EE1A 3Q7PA 1H2HA 5K0CA 2HOQA 2JATA 2D5IA 5DIFA 2VZ8A 1KKLA 3NNSA 4ZZ2A 3GU3A 4OQYA 2WF9A 4KXWA 1BEZA 1E2IA 1U3CA 3E5HA 1QHNA 4Z51A 4C7KA 3ITKA 3JQAD 3MJTA 5TSDA 4E51A 4EB8A 1POWA 4EAAA 4M0FA 1K8YB 4CV3A 2PRSA 2YJ3A 1ZCZA 2BZSA 4KCGA 4GWGA 5D1NA 4Q1AA 3R77A 1C3XA 2A9VA 4AJJA 1JA1A 1DRVA 4ZAVA 5HBGA 1WF3A 1JSRA 5BSWA 2CDBA 2BDUA 1T6ZA 1KEVA 4WJZA 5A5EA 3G23A 4IZIA 3AR3A 4F3TA 4MVJA 2IZOA 3FCUB 1WNFA 3NAZA 2NUAA 1KNXA 1NUTA 3O3MB 4KE9A 4MDFA 2G80A 3RFXA 3JQ9A 4LNAA 1UWLA 3A3NA 3IOMA 4UZSA 2BFMA 1NJ5A 1RLJA 1E7QA 1TQ2A 3PKJA 2NTYC 3INNA 4N3GA 5B1EA 5A03A 1Q0SA 5CD9A 5AM3A 1CF2O 2CW5A 3T9DA 1Z08A 5AYVA 4MQUA 1M76A 5LD2B 4URYR 3KQOA 1WKCA 1EUYA 4AKGA 1Y3IA 1MIOA 1F48A 3H2KA 1ML4A 2CK3D 1Z25A 2JJYA 1A5TA 3RAGA 4KHPB 5A05A 1W94A 3JV7A 3N39C 4JNKA 4KQEA 2OFPA 4P1ZA 4ENVA 5CB6A 1NVAA 1QRUA 4C08A 1HT0A 2GYUA 4HDCA 1PNQA 3S8EA 1E64A 4N40A 1CZLA 1UMCB 3PI6A 1AVTA 4PZZA 1VLJA 1L5WA 3WHKA 3HXKA 5IM4A 2FNAA 1RU3A 2J5QA 2YIVX 4CMIA 4GXRA 2W5UA 4X6UA 2VQ3A 3STVA 3U3DA 3VYSB 5KQGA 5K3OA 4HEHA 4MTCA 4JJ4A 3OJOA 3PJGA 2B1IA 1T1EA 2WI8A 4Z9FA 4LJAA 4MPDA 3OCJA 2E21A 2Y77A 4HNSA 4W7SA 4YP9A 4LHEA 1EBFA 4I66A 2J9RA 3D6VA 2I34A 5LQNA 2CSXA 3VR6A 4JEHA 4WZAE 5FPHA 5AW9A 3F47A 3DYIA 1I30A 3RJ9A 1VE5A 3RYHB 4E32A 2Q62A 3EAGA 4JUFA 1SM4A 4BZZA 1DEHA 3LT5A 1OWPA 4RE5A 3ZEIA 2ZBEA 3I3OA 4GPAA 2W22A 4P4LA 1T10A 3UC9A 4RE6A 4AF8A 3EP7B 5I5EA 2A0KA 1QHIA 1EJBA 3L06A 4AECA 2YCBA 5IYZB 1MDBA 4CXMA 1YL5A 3QEJA 1J42A 2I6FA 2EZTA 4FYIA 3A4NA 4R2KA 3ZLVA 2CLCX 2MYPA 2JHAA 3OFND 4IWXA 4V3BA 5DNVA 3HLYA 3KV3O 4EP1A 5L7WA 2BKUA 1XGKA 3A0RB 1SC4A 3WDLA 2UYGA 3WK5A 5D3ZA 3ROTA 1JR3A 2DFNA 4J94A 1BROA 3SOPA 5SZIA 3A6JA 4I19A 4PICA 3UFXA 1GZHB 4PFSA 3DULA 3A2MA 2JA1A 1NY5A 4PLVA 3HBNA 3H1EA 1VDMA 3GDOA 2VHCA 3A9TA 3OZGA 3H0WB 3C87A 3TZCA 1E7MA 1GITA 1BN7A 1XIVA 4B7XA 3B5IA 4Y18A 5E2IA 2H6EA 1GTRA 3GD5A 4M0DA 4OAPA 4A0FA 4BFWA 3ZGOA 4AZWA 2QTVA 4FE4A 4OIMA 4ITRC 1T8RA 4RFLA 1XCGB 4IZHA 2O3SA 2CWWA 3TZKA 4NXNB 1U31A 2H1VA 4D0RA 5I4KA 4HB3A 3M6FA 4KE6A 1KTIA 4W7IA 1PT8A 4JP1A 5F4ZA 4MWZA 1QDUA 4A7PA 4KDRA 3AVYA 3D1JA 5ALEA 1UCFA 1VFNA 2P8JA 4JROA 5AESA 3E1KA 4N47A 3ZHRA 2WDPA 3ZGXA 2ZJAA 2JZOA 4IZ6A 2NVUA 2FRDA 2ISQA 1UZNA 2PAAA 2F3RA 1NGSA 4KJXA 1PQPA 4HEJA 1OWLA 4YCBA 1KZHA 4D56A 3JWEA 2D3TA 1LBTA 4BS9A 4CRWB 2UUOA 1DQPA 1P4GA 3ZLJA 3AV0B 4M86A 1XX6A 3AV3A 4O8ZA 3MJFA 4OFWA 4UUAA 1TPYA 5JMTA 3I92A 4P3XA 1DIAA 1KHTA 3ZS9A 5C7LO 2IXAA 3RHFA 1B0PA 3SLRA 2J48A 1R0BA 1V8ZA 2YJNA 3NO4A 1P2VA 2H1FA 4QC2A 1TQ8A 3EMDA 5JJKA 5EC8A 3DBHB 3TBHA 3WYDA 1REQA 1WCV1 2GS9A 4BO0A 3NGMA 1UMDA 4HQ0A 1GTMA 2FN4A 4EI2A 5AUPB 3ELWA 3MGKA 2IHZA 3FUXA 1XI2A 2FN7A 5LA6B 1VMEA 3AIIA 2P1RA 4INAA 1JJBA 4N41A 1DOHA 4NULA 2ZJ8A 1HMPA 2CYCA 4DMHA 2A1TR 1YS2X 1UP4A 1SHLA 2R6HA 3FCCA 4KQGA 4ZQIA 2O59A 1A1VA 2HZ7A 2YV3A 1YR1A 3LXUX 3UAWA 2IYNA 3I0ZA 4AWBA 3WYBA 1TEHA 5E95A 1Z63A 4EVRA 2GK4A 4Q4HA 1XRPA 3FTDA 3QFCA 2X2PA 4UXHA 1XNGA 4EHDA 2XVAA 3LLUA 1E2MA 2X86A 1C1XB 3QE4A 4QEZA 4C20A 1XZMA 4U8HA 1NFFA 3EP9B 2RG1A 1X1EA 3IVAA 3KT8A 3NP7A 1W4ZA 2PMBA 5ALZA 4U7TB 1NX9A 3MSCA 4AZSA 5JYDA 1A9SA 1NW9B 1RE0A 3A31A 3ZVRA 1KQPA 1IY9A 1RZRD 3KQQA 1H1LA 2EJTA 1F9AA 1MNQA 1NJGA 1JGTA 1UFRA 3HSYA 3JYHA 1ZH0A 3Q3VA 2HTFA 3WMRA 5K0TA 3ZI7A 1V8OA 4JJFA 1HLDA 4WMLA 3SIWA 3ENVA 2ZPTX 4YP1A 5G0TA 3WLHA 3KJGA 3TQOA 3I37X 1M67A 3LQKA 2AG1A 1U9ZA 1F2TA 1GKLA 5FFFA 3TSYA 1IBRA 1ZVQA 3L8FA 4L8WB 1Y6FA 1K5HA 3OLVA 3OOWA 5CA1A 5I9NA 1E79A 3AUYA 4DANA 4MCHA 1O94D 5JAZA 3G5TA 4YUXA 3PX7A 1Q44A 2VPPA 4U5XA 4M99A 3ZIUA 1V9CA 1JW9B 1RAFA 1XWFA 1G21A 2HK7A 2ZJ1A 3TZ6A 3C7CB 3HI4A 1PR0A 4X8OA 2XUDA 4Y6PA 1JEYB 1B6GA 3B6MA 3PQ2A 1TE2A 3HJUA 4Y0VA 5H3LA 3W5VA 1GPNA 5JU6A 1QGUA 5EA2A 2UZ0A 4TN1A 2AX3A 2OM6A 3LKBA 4XEUA 2YBEA 5AHXA 4AY2A 3MINB 4CMJA 4NU8X 1YS6A 3DMPA 1VJ0A 3IB3A 3RB8A 1CJBA 4L72A 2XH8A 1DKNA 3I64A 3TM5A 4US1R 2BFBB 4C0WA 3S2YA 3O83A 4PCAA 2GHTA 5SZJA 4PR3A 5LQAA 1T4DA 3KU1A 2F64A 2NUTA 1YULA 2NNLD 5F1KA 3NV7A 4BQQA 4CF4A 2C7VA 3G9XA 2F90A 3KQSA 2ZYRA 1BHO1 3DVLA 2W2KB 2GBFA 3M6MD 5AI5A 2IS6A 1P6UA 2GH1A 2RAUA 1EP3B 4MPTA 2GRUA 4K0KB 3Q1LA 3OIUA 4NYIR 4OL9A 4RPJA 2R62A 1Z7YA 4AY3A 2XRZA 4MAFA 1TCUA 4K86A 2J3KA 2A14A 1N6OA 1KMQA 4GICA 4BLWA 1RKQA 2PCLA 3LT2A 5BQOA 3HDQA 1X86B 3SGLA 3DE7X 1CWUA 2GAOA 4U7GA 1ECGA 5GV7A 2B8TA 2OCKA 2ZRJA 4M4SA 5JCJA 5C7IO 5KQRA 5C52B 4UEKA 4DMRA 3KUXA 4C4YA 2J08A 2Z2ZA 2ZSKA 3FSGA 1DQRA 4XB6B 5HGXA 3G8DA 5C80A 1KJYA 2WU8A 3CRMA 1AZLA 4UXJA 2BMAA 5EINA 2ZSBA 4L1KA 1SHKA 4YS6A 1BE8A 1XJWA 5B37A 3BB3A 3MTBA 1QMPA 3M6XA 3WMEA 2PZMA 4Y3UA 4U6QA 4XM0A 1E3DA 3KKOA 3P9XA 2Q3EA 4WEQA 2O8CA 3LT0A 2DRIA 5FNVF 3ORYA 3DR5A 1CBUA 2FW9A 5I8WA 1J1ZA 4ID9A 3TMAA 1GUFA 4TL6A 3PYXA 1VMIA 4HDQB 4Q1FA 3K4QA 4B4WA 5A1TA 3P9RA 4YJ2A 4S2EA 4CKWB 1JDBB 1FFAA 3QMWA 4UM9B 3VPDA 3QPWA 2R4TA 3C8DA 3CUVA 4FIDA 1CUDA 1FP6A 2OWEA 4CCYB 1YTUA 3NHZA 5DYGA 3CLSC 3OFSA 5D01A 4UVIA 3ZE1B 4CGZA 3NM6B 2JLQA 4R2WA 1M0WA 3EXAA 3HNOA 4KBGA 1NURA 1GRQA 2GN0A 2AI2A 1YE3A 3EWAA 2MINA 3B6IA 3KL4A 3OECA 5KYUB 4DEVA 2QVLA 4YASA 4L6IA 4UHFA 3T6KA 4HAWA 1Y5LA 4EHAA 3PG5A 4OAQA 1F2DA 2XOEA 3BMNA 2NV2B 5FV4A 3R0ZA 2EX4A 4IDCA 2HHCA 2Q1WA 3N1UA 2VAMA 2J3EA 5TV2A 1D4OA 4GX5A 2C31A 2HU8A 3LY5A 3WYEA 2R1UA 2ZQZA 2CHGA 1SMKA 1BMDA 4Q05A 1A0OA 4GYYA 4OXNA 4TROA 1RWQA 3WMFA 4EZIA 2OV8A 4LBVA 2NP7A 1M6VA 2FPIA 2Z2YA 4CUZA 5AVSA 5KBYA 4GR9A 1Y5RA 2OHXA 3O5AA 3LY9A 1L9XA 3VSEA 4LZNA 1XDUA 1G2QA 3NBUA 4LQLA 5H82A 1MB0A 3EXEB 2JKZA 3OLQA 2DPLA 2ZYGA 4X71A 1TYCA 3MUFA 5CLGA 4ZODA 2ZJYA 2HMYB 4ON9A 5BUQA 3GXOA 3NV9A 3ELYA 1CVLA 1FRZA 4CTMA 5AW2A 1IM2A 1KI9A 3RUEA 1QFYA 4KVGA 1ELOA 1DXOA 4C1NA 1Z16A 1Z0ZA 3PGA1 2PFGA 4B80A 4DDVA 2JGIA 2YHSA 5IJ9A 3O82A 1TJ3A 4R8RA 4D6PA 1MJGM 1V16A 1VB5A 4D3XA 4EB6B 1QFMA 821PA 1Z8HA 1U2SA 2R48A 4QBKA 2G3YA 5BV1A 1RQGA 1LI7A 4YAFA 1IWPB 4AY5A 3K30A 1Z0FA 3D5EA 4BJ1A 4HUQB 4MJXA 1MX5A 1ZSYA 5CM2Z 1XRLA 4F86A 2Y1WA 2FEXA 3CO5A 3ODPA 4ZOLF 3IQGX 5TARA 3TOCA 1JFFB 2CLLB 4E22A 3LQ2A 4MVJM 3CUUA 1AMUA 1PJ2A 1D04A 1UEJA 1UMDB 2VAXA 3N8NA 3P20A 4FHEA 1MB9A 4XSHA 3IUSA 2EYUA 3NEAA 3IWCB 4E2ZA 4CNQA 1TOAA 3H1PA 4LMPA 4CI9A 3GJ0A 3SIRA 3VPFA 3L7MA 1JQLB 3WGMA 3A6ZA 1FMFA 1XYYA 2JS7A 3IUEA 2BEJA 1P39A 4URWR 2H9YA 1NRXA 2RGNC 3CWZA 3OG9A 4L8GA 4R8SA 3DTVB 3K9CA 4BMDA 1OX5A 1YWGO 3JQPA 3KBOA 1A82A 2PT7A 4BWGA 1QZTA 4DYHA 1YA8A 5CFMA 4PC6A 4NCAA 1ZFNA 1HTTA 3IAM1 4HH4A 1H6AA 1D8TA 1WBJB 2VNHA 2GD0A 1N2GA 4K88A 4E33A 4KFUA 1T4BA 4LY6A 2F43A 3TW0A 3D7KA 2BFFB 5EGNA 5FWXA 2NU9B 3U0BA 4UTNA 4H31A 4JLKA 5HIAA 2W83A 2XMRA 3JTMA 3AKDA 4G23A 4YXFA 3EPHA 2O2CA 4EFLA 1XR3A 3RS4A 1X7WA 1Y7HA 1OFGA 4WASA 1EZZA 2ZJBA 4CM9D 2ZCJA 1Z06A 3QOWA 1NLUA 4DBLC 5K03A 1RI3A 4DILA 5CFQA 5EJGA 1NI3A 2VJDA 1E2PA 4X95A 1SRQA 4G01B 3F7NA 1DB3A 1T5IA 2VSXA 3AHDA 3B5JA 3BIOA 2R66A 2G08A 3NUQA 3CYFA 2EFCB 2V45A 4BNIA 1IPEA 3C4VA 3PNQA 1C8BA 1RRVA 1YONA 4J9UE 4WRRA 5G3YA 2YY6A 5FADA 2A0FA 2FPLA 3EY4A 4HD8A 4LW8A 4AKEA 1XJQA 3Q7IA 1CU1A 1E5VA 4UUPA 5NLLA 2OKCA 4PWYA 4M7WA 1Y4ZA 4CT4B 3BCRA 4Z5XA 2B92A 2FP3A 1W85B 4ZO6A 5KZMB 5FQOA 1ZGCA 1E96A 1JENB 3BXPA 2BTOA 4UZEA 2VRCA 2VKTA 2A8YA 2QY6A 2GA9A 3H42B 2ADFA 4WZAB 1CUHA 2PS1A 2Q46A 5F2KA 1SVMA 3KXLA 4O4IB 4Q9IA 3ADDA 3BXOA 4NFSA 3FETA 2I4NA 3FYHA 1UP6A 3UXMA 1A7KA 3QPDA 4ACAA 4JUBA 2P2YA 1P75A 2DWCA 2ZUBA 3CLTD 3BCUA 3HN2A 5FR1A 5BYAA 3TPZA 1OXUA 1C3JA 1Z0DA 1JH9A 3CNLA 1CHDA 1I3OA 1WCWA 4GI7A 4W8OA 1S2LA 5A4IS 4V1CA 1RRCA 3TUIC 1P2UA 4Q3AA 3H9EO 3BB1A 3DPIA 1N36B 2OP1A 5DBHX 4RHFA 3ZXXA 4KN8A 1GL7A 2CXXA 2ONYA 4QREA 4RKFA 5DLYA 3U31A 3KB2A 4I55B 2QMHA 4FCTA 1A9PA 4ER6A 4JT8A 1RCUA 1WXQA 3KDPA 3WDMA 3A4MA 1PX0A 1NM5A 3S27A 4MRPA 2AFHA 2XRFA 3YASA 1A77A 1XPOA 2N46A 3OIGA 4Q02A 4QBTA 3U4QB 1VSTA 4HYYA 3UMBA 1KI4A 1TDJA 1SCBA 1E5QA 1YHYA 3O8OB 3CW8X 3H5OA 5CHEA 3WA6A 4ZOLB 1T9DA 1IB6A 3TW6A 2VJOA 2AZDA 3PCXA 4IHAA 4V39A 3CE9A 1CR0A 4LYEA 1EXWA 1ISFA 2NU6A 2PGDA 4CT0A 3BGOS 2OV4A 3ZCTA 2WF6A 3KAKA 2CZCA 1OW3B 2ZU0C 1ZCFA 3KL2A 4GPEA 4P3OA 1ULSA 1NJ1A 2RHWA 4FI3C 4EY7A 4OYHA 5DJ5A 2C77A 1A4IA 3ENZA 3F3YA 5KAPA 1XZIA 1ILEA 4EHJA 5LP6A 4GMGA 1QLWA 3Q12A 2O3QA 1QCDA 3FYTA 2XUIA 4ABYA 4ZEMA 2RGDA 4FBLA 2OUIA 4MVJD 1U2EA 4JJIA 1HTWA 5BSUA 1OV4A 4Z4IA 2VYNA 5LXTA 4HEA1 3E5RA 1SKAA 1ZXXA 3EP8B 4DIDA 1L4HA 1WOYA 2DCUA 2H8GA 4JJ6A 1XZBA 1DEAA 3TVTA 5E6UA 2O2YA 3L1JA 1XZKA 3TNJA 3WR5A 3LX6A 3N7UA 4MV0A 1SN7A 2YINC 1JT2A 5FWYA 5KYYA 3ZWNA 4F92B 1KMHA 4OPMA 2IXDA 1IPHA 3OLXA 1KORA 1AT1A 5KYKA 1DARA 2DUJA 4XEHA 2PIAA 3QFSA 4OM8A 2F3TA 2NV6A 3UQYS 1HEIA 1ZI8A 2GPBA 4LKOA 4M8KA 1QWOA 4GZLA 4OHKA 5H81A 4TKVA 4DY4A 5FF9A 2H08A 5HWSA 1NTOA 1W30A 4N0QA 2QTCA 3UT5B 4NBNA 1G9XA 1SVKA 4NMWA 5LA6F 1JPUA 1UBFA 5SICE 1JECA 4F2DA 1E3JA 5L3ZA 1FUEA 3AHGA 4F56A 1E62A 2JFVA 4F9FA 3LPDA 2XZTA 1Q1BA 1M8JA 1AKYA 2YC4C 2AQ8A 3I5UA 4LE0A 2JFWA 1OROA 2PZGA 4KDFA 4ARVA 1AK2A 2VSNA 2VJKA 1PT7A 4XX1A 4YRMA 3B9RA 5BN1A 4KPYA 5CG2A 1I7LA 3RYCB 3II6X 4KGXA 1F2TB 1PJSA 1UZAA 2DFKB 4OVKA 4F3CA 3UENA 1KEEB 3WL5A 5KAMA 2O50A 3LFUA 1DAKA 1UC9A 1O5TA 1I33A 1CKEA 3TVYA 2R87A 3G0IA 3M4ZA 3NIBA 4BNTA 4MARA 4MYDA 2GUWA 1DV1A 1ONBA 1XO1A 1MNAA 2OY0A 3NGXA 4LOAA 5AJHA 1D5CA 2EDAA 2XSZA 4WZ6A 3PU6A 1Z6QA 4HVCA 5HHTA 2ECOA 1R0XA 4X7PA 1R27A 2Z09A 3IKLA 4NTZA 1UOPA 1DDGA 1E6MA 1ZJ5A 1XTSA 5KNBD 3HCRA 4D0NA 1WCIA 3FF1A 4OI2A 3PFNA 4PYMA 2QROA 5CLLA 3UMSA 5AIBA 1Y48E 3MM4A 5HMLA 4NNPA 1H5NA 4V2UA 4GE0A 5EWMB 4EVSA 2QX6A 3UUEA 2OCLA 2Q4OA 4FYMA 4NSNA 2FEMA 2QS9A 5HUQA 3PYMA 4QTZA 1NBME 3VZCA 1DE0A 1TNDA 5IXJA 2ZE6A 2ZANA 4QSHA 5ALIA 3QUBA 3RFFA 2H06A 4ETIA 4IFEA 2NSHA 5CNJA 3STYA 3FYCA 1W581 1J8YF 4HMOA 4L07A 4PYQA 4QGGA 4G84A 1KE2A 3I32A 3IQEA 4RZIA 4XXHA 5T3YA 3SJUA 5IT9A 2GX6A 1FFGA 4KZKA 3HDYA 4QU5A 1JAZA 1G8JA 1WCYA 2YFKA 2GEVA 2A9FA 3FGNA 4LBZA 4LC9A 3TSWA 2GD2A 3BC1A 4LJ8A 5EQFA 1O3YA 4H16A 2GPNA 2J0UA 2WAYA 4Q19A 2DGDA 2H4FA 4PHTA 2CLMB 2PUGA 1CZNA 2EHDA 3HY4A 1G3RA 1UT8A 2EZ8A 5DISB 3H65A 5DSTA 2BUBA 2X14A 3SC2B 5FFMA 2QXUA 1MO4A 3P2EA 3CRRA 1DXYA 3WFJA 4AIRA 1LLCA 5DULA 4A0HA 2FZVA 3MHPA 4CQMB 3UO8B 2QM8A 3PJDA 5KNCA 4OHYA 1JAIA 2ODWA 2F1KA 2VDLB 1ULTA 3THWB 3DE3X 4FILA 1FFWA 4UUBA 3B2NA 3OZXA 2ZR0A 3IP1A 1I24A 2OT3B 3DHNA 3P0IA 5COAA 1SBQA 3UMRA 3FUVA 5TJ9A 4K9LA 1XZLA 4W82A 4E5DA 4DY6A 3UWKA 1ND5A 1K68A 1BZYA 2XMZA 5K3SA 3NXKA 4ZT6A 1XTZA 1EWYA 5K0BA 2JGAA 5FB3A 3VMMA 3GLTA 1BC5A 1Y1KE 4KVAA 4GMHA 2B61A 3RIMA 2W6PA 1II8B 4M0CA 2ATIA 2UVDA 4OHZA 5E38A 3X1MA 1KSHA 3SYLA 1E1DA 1X8XA 2QR5A 3OU7A 1DAGA 1H3FA 1JR6A 3L41A 2XVXA 3R40A 2RKWA 3R7DA 3BZWA 4PZLA 4G0NA 4PRZA 4H77A 1U2TA 5HFAA 4C6TB 4JYAB 3ZV4A 2V65A 4LYAA 4GI2A 5CFOA 3ZVKA 4ZQCB 4I1IA 5KNDH 1TAUA 5ITVA 3WO1A 1EDZA 4OQFA 1XTPA 3A1SA 3DFZA 2EATA 2VPYA 4B3TB 1KJ8A 4R9UC 1K7EB 3KOUA 3N7AA 1D6JA 3ODGA 5IARA 5SY9A 4BMCA 4PPGA 3TG2A 2DQ4A 1QP7A 1Z0IA 2ZWOA 4YT8A 2OEPA 3IJPA 3NKLA 3QLVC 2DQZA 1PVDA 4P53A 5F5XA 3M5CA 3PA6A 5IKMA 1Q19A 1V26A 2FZLA 2QX8A 2Y99A 4XDYA 5GY7A 4EFNA 3GR6A 4DR2B 4IIJA 1WW8A 1I72B 1BE0A 2ZI4A 2JI9A 2I55A 1A9YA 3E9CA 5JH7A 4X1IB 1KEPA 3PUJA 4LOLA 3S2UA 4BX0A 3THYB 1O5OA 1Z6TA 5HVNA 2YJ6A 2JW5A 5D84A 1U2ZA 3SF0A 4REOA 1RJEA 5CURA 4KOAA 1J7JA 2CYBA 3IJEB 2XVZA 4QUGA 1EJ2A 5KTNA 1C9MA 2JBWA 2A67A 3ANTA 3I9NA 2XNDA 1PDOA 3BVPA 1YQGA 2YWJA 3QLVA 1EIWA 2FH5B 4CCWA 1M7GA 3TDNA 5HFJA 5J1TB 4AK9A 2JK0A 4KRYA 4KQ9A 2M6KA 4F38A 5DM0A 3SVZA 3ZW8A 5KSOA 5KYNA 2OO5C 1C2YA 4B45A 2ZWMA 3EZ6A 1HQYE 4B6EA 4TUYA 1C7QA 3OQIB 1GA6A 3ZJ5A 5L4NA 3P2MA 3QMVA 3M9WA 4CCYA 4C0AC 3B53X 3T7DA 1U81A 2IOHA 2JK1A 4CIWA 1NY6A 4PIMA 2WYHA 2ZI5A 3E5NA 4K6FA 3SX0A 5BPFA 4XDGA 1T1RA 2AG5A 3DZ4B 2AYZA 2J8ZA 3QKWA 4KAAA 4ODIA 4QXMA 5LKRA 1BHSA 4BNJA 3KZXA 4XVUA 3IMEA 3UJ7A 3C8UA 1EP2B 3N0VA 1EVKA 4B4UA 1B7GO 1PNRA 4DMKA 1XELA 5IT0A 2RJ3A 2HSJA 5LWQA 4NJMB 2XUHA 4G37A 5AK4A 1GDTA 5JC8A 3HYSA 2GB4A 3IDAA 2VHTA 3AUXA 4EIWA 3M0EA 3G5LA 4IEEA 3AM3A 1E3LA 4ICIA 3KPVA 3MT8A 1N2OA 3PDIA 4PTLA 4IV0A 4HJXA 1LDNA 1HEUA 1G17A 5CT6A 1SD1A 1TEVA 1OGJA 2ZDQA 3IBYA 3ZNPA 1RXSA 2UU9B 1Y8CA 2OO5A 3BWDD 3KKNA 3PQ4A 5K8CA 2WIFA 1BHJA 3IIJA 3QPCA 2JCGA 3KZNA 3M83A 1B8NA 4GQIA 4JXKA 4I4TB 5AMXA 1D2HA 2H5LA 4NDNE 3SKYA 2GT1A 1NULA 1UM9A 3ND7A 4R16A 3ZLTA 4D4HA 3BH7A 4EJMA 2PS0A 2FPUA 1JIIA 1RXIA 1X1RA 1GEGA 2HYDA 1DFGA 3P1JA 4L5JA 4D3ZA 1HRDA 2WWRA 4QYXA 2LBPA 2ZIXA 3H4VA 2ARKA 4G41A 4KGVA 2BI7A 3B7PA 3E35A 4O2BA 3R7NA 4UU1A 4LZWA 1YI0A 1J9GA 2H1HA 3GP5A 1WAMA 4KIJA 1TW3A 2XNHA 5EKDA 4KUEA 4IX9A 3RTGA 2M1XA 5ELXA 2CLHB 3H75A 1YF3A 1W87A 2J7PA 1QHXA 5CX1B 1CEEA 1B8UA 4P58A 4S0ZA 2WG2A 3FMIA 3PLRA 5EWJA 3HFGA 2VN8A 1WSDA 3PLAE 1GCOA 2BFEB 4YCLA 1FQJA 3AR9A 4QDUA 4UM5A 3SBOA 1R5OA 9LDTA 4W5TA 1ZH8A 2RJNA 3BRSA 3B85A 2C4UA 1DFHA 3IESA 4HYTA 4IPTA 4II3A 2H63A 1QM5A 1YKSA 2PT9A 4IM7A 4V0SA 3V8EA 4MWCA 4RH1A 4AU1A 2P6RA 3RADC 3MS4A 4JCOA 3L7CA 4M7RA 5K09A 4XZ3A 1I8TA 1LPBB 5AKIA 3N2YA 5LBIA 3QVJA 1DDOA 1BWSA 2JDID 3BGVA 4LGVA 4MQLA 3PXGA 5CFLA 3NHBA 1DCMA 2C4VA 3ZWWA 4O5AA 5EIEA 1LC3A 2FJ0A 1TM5E 4B85A 2ZJ5A 4Q34A 3JWGA 3U6KA 2HT6A 5IBCA 4HVAA 4XM2A 4TWBA 4OK6A 4Z4HA 4DV5B 1ULZA 1FP2A 4FSDA 1IFXA 1QANA 4O2RA 3RSGA 1VL0A 3WVNA 2PQ6A 4XX0B 2HA5A 2OMEA 1FFBA 1FFXA 4HB2A 4UMDA 3OWHA 2BH9A 1L5MA 1Z75A 3K5HA 4LYFA 1YH3A 3E7XA 4MK4A 3RTDA 2HREA 3SC2A 1LBEA 2XITA 4C21A 2Y1KA 3LBYA 2Q6LA 3GFOA 4QUHA 2ZM6B 2ACWA 4EA6A 2VVTA 1HDCA 3O91A 4RADA 1BD3A 1GGEA 3CLUC 3HP4A 3HO6A 3TNDA 2FHSA 2Q1YA 1E8NA 1QS0A 1NVWQ 1NW6A 3T5CA 3HBJA 3QBEA 1PFWA 3GJSA 2G83A 5KKCA 1KJIA 3PF8A 3DL0A 3QYFA 3HVJA 3ZDAA 5HQTA 2HQ1A 4MS3B 4EO9A 3BZBA 4YBRA 3DZFA 3V2GA 3W2GA 3RBVA 1VJDA 1XN1A 1N2BA 2FU5C 4U2BA 1VPDA 2YWDA 3PEYA 1U7DA 2GPTA 4XCQA 1SXQA 3KT3A 1ZYUA 4B48A 3SQLA 1RC8A 1UC4B 1X1BA 2JCVA 4DQKA 3ZHZA 1VTKA 1WF6A 1NQ5A 1SA0B 3NEJA 2VCHA 4UD6A 3WI7A 1RYMA 2OORC 4LDAA 2VP9A 1XFAA 2KI5A 1TEZA 4QXPA 1EMDA 1MQAA 3H5NA 3Q3JB 3H2SA 5DNUA 3PNPA 2H59A 3WL7A 2FOIA 3ASVA 3O8OA 4R2HA 1ZK4A 1PUIA 2ZRAA 1ZPDA 1E2EA 2ZT7A 3OC6A 1N9ZA 3PQDA 1HLFA 3I76A 4M9QA 1IZYA 4U2FA 4WTOA 3WZMA 1FYDA 4QLBA 3PUYA 1AB5A 4LWOA 1MFZA 2COEA 4I4TF 1UBSB 1R5NA 4ZZ3A 3R6DA 4V0QA 2B1RA 4FKMA 1PYDA 4DW8A 4IVPA 2YWEA 1XZEA 2IW1A 5DRTA 5TNXA 4WOPA 4ENSA 1SUPA 2PLAA 2WJVA 3L4BA 3AQIA 4JOQA 4QDXA 4LBYA 5KCMA 3RK4A 2NZUG 5FWAA 4PX3A 4AY6A 2Q2VA 3ZJVA 2Z8XA 1RLTA 3EDQA 4YLEA 1LLFA 2IUTA 4J3NA 2D8MA 3BBPA 1PG0A 3STUA 3BTUA 1NASA 2BEWA 1YMUA 4FBMA 4QYIA 1C0LA 4RIGA 3DWGA 4V02A 1THZA 5G1OA 3S2IA 3TQIA 4RQTA 3OAAD 3K1TA 3R5KA 1IY8A 1P33A 2FSPA 3HJNA 2O8BA 1FL9A 1JNXX 3C6QA 3GIDA 3QI7A 5HE9A 4AZVA 1PK9A 1P5RA 3AR5A 4XWTA 1HL7A 1ATIA 1OILA 2OAGA 3RUFA 4F96A 3S8MA 2VRCD 4O1MA 5ALWA 1PF7E 2BEKA 3EVFA 3S1AA 2QXYA 4MKIA 3L6CA 4JI7B 1M7BA 1DLJA 4RK7A 1OLXB 4RLSA 4G8DA 4ZEVA 3QHAA 3H8SA 1ES9A 5ECDA 1T6NA 1JH8A 2RKOA 2HXYA 4ALIA 1IPFA 2H00A 2OO3A 3SXJA 1Y81A 1GPH1 1KVTA 1PR9A 4MW5A 4RTRA 1L5RA 1K06A 3I05A 2B5VA 1TF5A 1NN5A 3IAM6 3UY4A 2WK1A 4DNFA 2FW0A 2XHZA 1GTL1 3UN1A 1J1IA 1VBNA 3FPGA 4CKEB 3V4SA 1W7AA 1TU0A 2OCGA 2IWHA 4EG7A 2BD0A 4XUEA 1QC5B 2DOKA 3IEPA 4KPUA 3NKVA 1GVNB 4LXIA 3VYWA 1WUIS 1TD1A 3K53A 1ZH2A 4EL5A 1PWYE 1JNYA 4J43A 1RFLA 3G0GA 4HDSA 3L9WA 2WJPA 1DS6A 1T29A 2HWUA 4N18A 3VR3D 4FZ3A 4QZVA 4WOJA 3TINA 3WICA 1IZZA 2PU5A 3F67A 2IUEA 1YVUA 3K92A 1P1JA 5IDYA 4U39A 2ODQA 2WNHA 2HYIC 2F4NA 1NRJB 2HKIA 4ES6A 1TCBA 2WMOB 2P9BA 3M5DA 2IEDA 3UH1A 5C5DA 2CLSA 3IUYA 3UJBA 4QM7A 2XDQB 3MWEB 4QRIA 1P72A 4PZPA 1KY4A 1NQTA 2AW5A 2VYVA 2QN7A 3HCCA 3FVQA 4K05A 2AUNA 4TZKA 4XGRA 5JXHA 1LVGA 4O63O 4HNUA 3CJTA 1EB9A 4E5NA 2UZ3A 3ABSB 4UBKA 5B3JC 1UADA 2W42A 2J6CA 3UK2A 1ZRMA 1OAOC 3MWFA 5YASA 3LRTA 4D6XA 5L4SA 3I0MA 5J47A 2RGBA 3UV7A 2VUHB 1S4QA 5DWDA 1MX9A 2PR7A 1W5TA 3K5IA 3GFTA 3NDRA 3DJFA 4JP3A 2C7GA 5HBRA 4DG8A 5IZ4A 1N25A 1QF7A 3OA2A 4JB2A 1OV6A 3IUNA 3KJIA 5CLIA 4ARUA 4Z8YA 3QRWA 4R81A 2EOAA 4RL6A 4JYMA 3WIUA 1RMTA 4R3UC 3ZGYA 3E03A 1B3BA 1U3FA 4YAWA 2ILTA 1SWWA 4Y1EA 3E9DA 1BGXT 3H2GA 4DB2A 4DMMA 4AKTA 1JX6A 1XXLA 2QRPA 2BC9A 1RMYA 4A8JB 4IS2A 5HQJA 5F7XA 2WIKA 2Z04A 4X92A 1YR6A 2PBLA 3GJ3A 4U8GA 2J1LA 4XRGA 2P6NA 2P9ZA 3IV7A 4OJKA 3STTA 3MF4A 3WRWA 2Z5VA 4ARBA 1ZD9A 4C0XA 3G5AA 1B6TA 3HCDA 1GSIA 3R6TA 4IVNA 2RHOA 4WLNA 1CFZA 3OIYA 4RGBA 3USES 2P3OA 4JFAA 1HH4A 2BONA 1X7XB 2FKNA 4RQUA 5TF4A 2PUAA 1Z36A 1RVDA 2AR9A 1ABEA 1FFHA 4DFDA 5CP8A 4L4YA 1MO3A 1GA1A 3AJ8A 3K71B 3MMZA 3GLFB 3F78A 2RK3A 2MSCB 1XXHA 2KQUA 1OJ7A 4HPXB 2GCGA 4JX8A 3N6RA 4IYRA 5TS3A 3S28A 3T0FA 3I2YX 1BMFD 4D9HA 1UBRS 1YB1A 2GZDA 2VJMA 1GPDG 1TLFA 2Q1TA 4YONB 4EKYA 4YAGA 4FYKA 1N77A 4TYYA 1AKUA 3FMFA 4MGKR 2EQ5A 4UAUA 3IPAA 4Q3NA 4ZPJA 1E1LA 2RH4A 3GZNA 1CHNA 3F8TA 2ONJA 4XWOA 3PR3A 4X6YA 3FUTA 3H4IA 3I73A 1HFJA 3JAWB 5FL7A 4D9KA 4RK6A 1JIKA 5FIUA 1WPQA 3ZDCA 3V3KA 3ROEA 1FYFA 3PC8C 5C32A 3BE4A 1UK8A 1WD7A 1RLIA 2J4FA 1B0AA 3UPUA 5DM2A 5CIYA 1NVBA 3IAHA 2YDYA 1QK3A 2VUUA 1KZ4A 2G1KA 4TTIA 4BHTA 3K0FB 4EFKA 1U0JA 1W47A 4GHWA 4YFVA 4OI0A 1NZDA 1CZKA 2Q2OA 2XQGA 4WSOA 1R74A 5L40A 3DLBA 3KG2A 3PJEA 4RMNA 5DTEA 3G5UA 1PZNA 2EF0A 1T9CA 3E3NA 1PE0A 4B9EA 1Z6YA 1JRLA 2VDMB 4P4UA 4X97A 5EFOA 2UXDB 1P0IA 4ZCMA 4FLFA 4UCFA 4OFXA 4JDPA 5IKPA 2CVOA 1TAHA 3A14A 3CUWA 1OLUB 3OTIA 4A9AA 5JSKA 1EXVA 5IKXA 2P2ZA 4XH9B 1ZMRA 1M2GA 2XQIA 1G2IA 5AW5A 3WBBA 2FGKA 2VQ6A 3BQ9A 5EOVA 2ZB7A 4NBWA 1C4WA 1P7YA 4LXGA 4FYVA 3NTQA 1V5IA 4GI1A 3GEGA 1R66A 3L49A 5DMHA 2AQIA 3T52A 1JPJA 3LO5A 3LZ6A 3D3QA 1P4HA 4NYJR 1OXTA 3IBGA 3L8GA 4E14A 1YNSA 3GT7A 2RGXA 2LPMA 4R9NA 4M7PA 4QTXA 3A3KA 2QMQA 1RI5A 3AUUA 5FUYA 5JRJA 2A4MA 3AM1A 5FEMA 5CT8A 1TK9A 3M7IA 4JR2A 1K3FA 4B4VA 5DHRA 4PX9A 5JCOC 3SOZA 3O4HA 4A26A 3L0PA 1U63A 1UMKA 2QQGA 4XVHA 3UJ9A 1W5AA 3EZ9A 4UHKA 3T3PB 1F6DA 3BFJA 2Y1EA 2X4IA 4Y30A 1X8KA 2ZRHA 3WSWA 2HJ9A 3ZWAA 4MUMA 2QAJA 1LPOA 4LY3A 2QPAA 3VDNB 3U9LA 1BW9B 3G2KA 3GEBA 1OIXA 4ZARA 2B4KA 1QP4A 3L79A 5H7XA 1D0SA 5NULA 3EPRA 3PHJA 4P36A 3N58A 2P11A 3OFJA 1EA7A 4X93A 2HMUA 4NS4A 3V8BA 1RI1A 3SHTA 5CBPA 4R69A 3W2FA 4JC4A 1OXBB 3F6SA 1QSGA 1SWVA 3ONDA 4I0WB 2WTUA 4WN9B 3P0HA 4XQ0A 3AEZA 3KUCA 1KMNA 3N07A 2I7DA 1MR3F 1BXGA 1T6YA 3LRPA 1WXXA 1J56A