1Q2XA

Crystal structure of the e243d mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with substrate aspartate semialdehyde
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
371
structure length
356
Chain Sequence
MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKDEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title The role of substrate-binding groups in the mechanism of aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
source organism Haemophilus influenzae rd
molecule tags Oxidoreductase
total genus 109
structure length 356
sequence length 371
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1q2xA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1q2xA01
4L8VA 2ZYGA 2IE0A 1ZK2A 3OJFA 4OO3A 1GAEO 1Z73A 1YL6A 4YQYA 2WDZA 4KWHA 4HFRA 4YJDA 1JN0A 2PTGA 2FRDA 3JQ9A 4MJLA 3VVBA 5JO9A 3SJ7A 5CDSA 4BKQA 4HKTA 1I3MA 1MX3A 1T2EA 1E7SA 1VSUA 2GCGA 2BFMA 3JQBC 5IZ4A 2P4QA 1OMOA 5ILGA 4IJVA 3IMFA 3B20A 2FPIA 2OP0A 3W4KA 5F1PA 1I3KA 4RF4A 4QO8A 2JD1A 5L4NA 1PGJA 5DF1A 4UUOA 1HDXA 1ZCJA 2JFFA 3TOXA 5IFLA 1H93A 1KC3A 1CETA 1KYQA 4XRRA 4ZQHA 2RIRA 1GPDG 3K6JA 4BV8A 4E2ZA 3ETEA 3MTJA 1E3SA 2VUSA 3VKVA 4XGNA 4DPMA 3AY6A 3JQAD 5J9GA 2GERA 5KJCA 2PFGA 1R0SA 3R1IA 5H83A 3UF0A 2EV9A 4GGPA 5DZSA 5F5LA 3RI3A 3PZRA 2PH5A 1H6DA 3IKVA 1F14A 5L7WA 1HYEA 5HWSA 5BSEA 3JQGA 3HWRA 1LRLA 1RKXA 5KJFA 2HQ1A 4IGFA 4TSKA 4RZIA 3P2YA 4CMCA 3RAJA 3FSRA 1D3AA 5TX7A 3ZHYA 4CV0A 3AW9A 1CWUA 1XQ6A 2WSBA 4B8ZA 3LC2O 2IRWA 4YJHB 3OA0A 4E2YA 4A2CA 2Q1TA 2QG4A 4QO7A 1T25A 1A7KA 2VN8A 2VYND 3PWSA 5JE8A 3ZWWA 5TIIA 4JBIA 1UZLA 4KTTE 3LT1A 1YVEI 4O5OA 4RGBA 2BLLA 3ZW8A 2NVUA 4AJKA 2PKQO 2NU6A 2C0CA 4RZHA 4J49A 1SAYA 2UV8A 3DZKA 4IY1A 2AE2A 1GZ6A 2DU8A 1GDHA 2E82A 4ZD6A 5B4TA 4NFHA 3FBGA 2P9EA 2BFPA 1H6BA 4JIGA 1GR0A 3BMQA 4J16A 4ND2A 4MIYA 4NDNE 2IXBA 3RKUA 3F1LA 4TRNA 1JVBA 2GRAA 5I8WA 2HK7A 4A5OA 1SC6A 4NBRA 1AUPA 2RH4A 3GAZA 4QFCA 4BO4A 1RPNA 1WMAA 3X2FA 2WE8A 4R1TA 3HDQA 4GMFA 1O95A 2PZLA 2Z1MA 1FK8A 2ZB7A 3GH3A 4L4SA 3DMTA 4XDYA 3BTVA 1D1TA 3AU9A 2H9IA 1HDGO 3PYLA 4RDHA 4Z9YA 4CV2A 4LK3A 1YB1A 3ZNNA 3ONEA 4E6PA 3JQGB 4CLXA 2HK9A 3DHNA 3HFSA 1RYDA 5CFZA 3OEYA 2F00A 3D4NA 3M1LA 1U9JA 4ZRMA 2X9NA 4W7IA 2G82A 1IHYA 3ZWNA 3QV1A 2A4KA 4BVAA 3NDJA 3D5TA 3K2EA 4RF2A 3O8QA 5KKCA 3ZW9A 1ZK3A 3CXRA 2IYOA 4OSPA 2FZEA 4YAEA 1I5RA 5TQVA 5B4VA 1H9BA 4RO0A 2RH8A 3ONDA 4Y6RA 5K0ZA 4CLEA 5JAZA 4YBZA 3D4PA 5FFFA 4ZICA 4YRAA 3KYDA 1IZ9A 4NNJA 5HBRA 4DXHA 7ADHA 3NV9A 1KBZA 1UXGA 4JBHA 3INGA 3HZZA 4CL8A 2PK3A 4OXYA 4XWYA 1WVGA 1IULA 2OZPA 3GG2A 3E6AA 4GH5A 1CYDA 1TVEA 5I7FA 4UVDA 2V6GA 5T8KC 3PIIA 3FWZA 2NTNA 3OICA 1PWZA 1MFPA 3QVXA 1UXHA 3WGGA 2XF8A 1TEHA 2OP1A 1TT5B 3VC7A 3D64A 1R15A 1ZW1A 5HA5A 1VL0A 3ULKA 1YJ8A 3F47A 3KRTA 2B4TO 3OA2A 3ROMA 4G81A 4NU5A 3ICCA 3G3EA 1T2DA 2G76A 2HMSA 2AMFA 1Z45A 2CNBA 4WLOA 4B7XA 3OJOA 4QX6A 4CMHA 4YT5A 4ALNA 3IAHA 5H82A 3QVTA 1UDAA 2X9GA 5KVQA 3H5NA 3CIFA 2Y99A 4OL9A 5F1OA 4U6SA 3AI2A 4XX0A 3SC4A 1RYEA 1F12A 5JDCC 5FEUA 3UW3A 1O89A 3TZQA 2NU7A 4BKUA 4IS3A 1J0XO 4H16A 3NAQA 3I1JA 4MKRA 1DIHA 2BKAA 3QQPA 4YCAA 3UOGA 1IHXA 3QVOA 5F1KA 3EK2A 2B36A 1IYZA 1JKFA 4OM8A 1OC2A 3ZNOA 4MVJA 3EGOA 4UVHA 1YKFA 4NPCA 5U1PA 3MZ0A 1O9BA 3ZNQA 3C8MA 4ALJA 4J91A 1FDWA 1XDWA 3IUPA 4NBWA 2I65A 5ITVA 2NADA 1PQPA 3PHGA 1FDUA 3IDSA 4DPKA 3WIEA 5IF3A 3KYDB 4XKJA 3WIDA 4FGSA 3K5PA 3HG7A 1MV8A 4IZHA 3A9WA 1NHWA 4RPGA 4ESOA 3EHEA 3WTCA 1IY8A 4M89A 4FCCA 4KMSA 2RAFA 2V6BA 3NGLA 1QORA 2VHXA 4CV3A 3K73O 1UZNA 3GVCA 3NUGA 3U0BA 3FR8A 3KVOA 3MCVA 1U5AA 3NKLA 5C5IA 1NBOA 2VQ3A 4GSLA 4ALMA 1ZXBA 1HZJA 4XR9A 1HF3A 4S3MA 2VYVD 4B79A 2AHRA 4CUKA 4W4TA 3IKTA 1NXQA 2VYNA 4U0KA 3GPDG 3GVHA 5G0SA 1E92A 1DJQA 4PZDA 1Y9AA 4FOSA 4R9SA 2V65A 4GAEA 3PVZA 4OQZA 1T4DA 2X0JA 3GFBA 1OC4A 4X54A 1GYQA 2HKIA 4Q3DA 4XYGA 2C82A 3LF2A 5C37A 3FRJA 1K6JA 4YEDA 1JDJA 2CVOA 4L4XA 3AOEA 2QZZA 4BO1A 1HLPA 5DT9A 1KOLA 5KTKA 5L7TA 1SZJG 1YBVA 2QRKA 3KEOA 4Y6SA 4R3WA 4MVJE 3ZV5A 2AA3A 4J9VA 1F0YA 5THQA 3L4BC 1HXHA 1WDLA 4ZHSA 4EEZA 4TVBA 3A14A 1K2WA 1GV1A 3DOJA 3DZHA 3FPCA 4CMEC 4WLFA 4MVJI 3MWDB 3O38A 3V8BA 5T6BA 1ARZA 2R00A 3NDRA 3K2BA 4F46A 4YJGB 5F5NA 3NT4A 2BGKA 1PEDA 3DL2A 3OQ6A 3PHJA 2E49A 2X4GA 1H94A 2JFHA 1X0XA 2ZTLA 1V0JA 5GMOA 2Q1SA 1NFQA 3E9NA 4HNHA 1HZZA 4Q3AA 1NAHA 3DFZA 4H15A 4CLHA 2EIHA 1LBEA 4OXKA 1QG6A 3MJCA 3EVTA 5C7OO 3H9JA 2NNLD 3W8DA 5JPIA 5IDWA 4D45A 1QYDA 5A9SA 5L95A 4II3A 1BXZA 3ORFA 2C20A 3VH4A 4GSKA 1DHTA 1WAMA 3I6QA 5I9LA 1VL8A 2QIOA 1NQTA 1O6ZA 1B8PA 1EVJA 2DBVO 4KUEA 1BW9A 3EC7A 1D4FA 3K8ZA 2Q50A 2X7HA 4OMUA 4P4NA 5AYVA 5I8ZA 1RWBA 2PGJA 1YL7A 1Z74A 3WSVA 1V8BA 3X2EA 1T4BA 1LSOA 3ENKA 3GGOA 2GZ2A 3Q6IA 2WYWA 1SBYA 4AJIA 3CMCO 3ZI0A 1DLJA 1ZMOA 2XAAA 3UCFA 4DUPA 1A4UA 1ZUD1 5ER6A 2FZWA 3PHLA 2JD2A 3GUCA 3EVNA 4FFPA 4WPGA 5L53A 4MVJH 4AJPA 3RFVA 3FNFA 1HWYA 1E3JA 4MP6A 5THKA 5IXYA 4CMIA 5K9ZA 1EUCA 5I7SA 3D7LA 1DC6A 1JA9A 2FPGA 1YB4A 5JAIA 1N9GB 4JROA 4BS9A 5L3ZA 3O9ZA 4ILKA 3EAGA 4UREA 3FD8A 1LUAA 4DQXA 4AJLA 3KTDA 4GWGA 4EI2A 1M6WA 4D0SA 3V2HA 3GVPA 5JCJD 1AE1A 5JBIA 1A72A 4OKNA 3DBRA 1ONNA 2GN6A 3FTPA 3O26A 1LXCA 3JYQA 3EZYA 4PLFA 5HRUA 2J3HA 2AXQA 3F4LA 3LVFO 2X9VA 3PQFA 3SLKA 4J0EA 2IZ1A 4J1SA 4E5KA 2HMVA 2JD0A 4J7UA 3K31A 2VT3A 1E5LA 3I6IA 3JQ7A 5JYAA 2VTEA 1UR5A 4YXFA 2BD0A 2WMDA 2GUGA 4FBGA 3BXXA 3RUAA 2PZJA 1C3VA 3RC1A 2I99A 5COBA 2GD1O 1EEHA 1PJCA 4GGOA 1I2CA 4RJTA 1H2HA 4BGEA 2DUUA 2X86A 3DDNA 3DQPA 4B4UA 3MJVA 1Z82A 3IOYA 3MTGA 2VUTA 1CF2O 3I52A 1BG6A 3LLSA 1VRWA 4Z3DA 3GA0A 4L9RA 3WFIA 1KC1A 4RVFA 1DXYA 3RUEA 3GPIA 4PLTA 3RD5A 4CM9D 2B5VA 3I9MA 1TI7A 5DP1A 2DFVA 3HB5X 1GEEA 2CFCA 1LDEA 3D5QA 2BH9A 2C5EA 1A27A 4PG8A 4IXWA 3WQSB 4ZU3A 5A4DA 5JMPA 1ADGA 1QSGA 4NHEA 3GLQA 1LA2A 4M55A 2I9PA 4AFNA 2OGUA 4Q39A 4F3YA 4ND3A 4RVUA 2H6EA 1GZ4A 4J2HA 2FHSA 4IUYA 4N5LA 2E4AA 3ZDFA 3C7DB 3BMNA 3N74A 3U4CA 1H6AA 4MVJM 1YJQA 3NGXA 1GADO 3L6OO 4BNXA 4BQPA 3OQ1A 1QV7A 2VOEA 4FIZA 3WQRA 1XEAA 4JLWA 1YO6A 3TF5A 5KOIA 3GEMA 4EUFA 1F8GA 3L4SO 2VZ0A 4TMFA 1DEHA 4WLUA 2EJWA 1XELA 5CPBA 4HFMA 2NACA 5EMHA 1TXGA 3AWDA 3JQ7B 4MPDA 1X13A 4ND5A 4TVOA 2VUUA 3GGGA 2POQX 1WWKA 3CEAA 2CF5A 1UZMA 2W90A 4Y8VA 5DBIA 4II2A 1X7DA 4ND1A 2BHLA 1QYWA 3G17A 3E9MA 1BDMA 1WXDA 3HB4X 1NQ5A 3KSUA 1K89A 1XHLA 5FWNA 1KEUA 1PSDA 3INTA 1B15A 3WOHA 4B4WA 2XXBA 1P33A 4XB1A 2AW5A 4QT0A 1A9ZA 2JJYA 3JQCA 1C1DA 5A1TA 2AG8A 4I9NA 5TT0A 4BHTA 2D5AA 4WECA 1PS9A 2BF7A 1PQUA 4YJFA 4L0QA 4J1NA 1AN9A 4I9HA 2IZZA 3R3JA 4E5NA 1AHHA 2O3SA 1U3VA 2BMAA 5A3VA 2O50A 2AEJA 2BELA 3PWZA 4KQWA 1NP3A 3V2GA 1B16A 4JGBA 3JQ9C 1U8FO 3WGZA 1ENYA 3FWNA 2JCXA 4DYVA 3MJ4A 5CHEA 4BNGA 4YAJA 3WJAA 5L45A 4E2WA 4OKIA 3EUWA 1GPJA 1H0KA 3VDRA 4FD3A 4UAGA 3BHJA 3VHRA 4P8RA 2BFAA 2Z1NA 3P7MA 1U3UA 4HY3A 4P4GA 4BMSA 2EJVA 3H6KA 3H9UA 2GR9A 4NZ9A 3INRA 5G2OA 2VWPA 5TSDA 4HADA 3OIFA 4YR9A 5KVVA 2NUAA 4HFJA 1PGNA 4OAQA 1LRJA 4BNKA 1E7QA 3SXPA 3M6IA 4FR5A 1ISIA 3WYEA 4LCEA 4K6FA 4WLVA 4CV1A 2VWQA 1MFZA 1PIWA 2W2LA 2CUKA 1EUDA 3PIDA 4FFNA 4G65A 4BNUA 5LDGA 3T4EA 2UYYA 1H9AA 4PVCA 4TKLA 4GL4A 1EE9A 3ETGA 3OJLA 4E32A 2O7SA 1LTHR 2J5KA 3L6EA 4R5HA 2WE7A 4NK5A 1NFRA 3DHYA 1WMBA 5DCYA 1C1XA 1VJTA 5JCJA 3T4XA 3C7CB 5F3RA 3BMCA 3JD0A 4F6LA 4W82A 2Q4EA 2C5AA 4XQEA 2I3GA 5CEJA 1P1IA 2FMUA 3I9LA 4XGIA 1X7GA 4B4OA 3RBVA 5KJ1A 3H4VA 1BXGB 1LI4A 5TJHA 1OOEA 2Y0DA 5T5QA 3IQDB 3V1UA 1ONPA 4CQMD 1U2GA 4K6CA 1P0CA 1JKIA 1DO8A 1TA4A 4JQCA 4BB6A 1C0IA 3K96A 4PG6A 4N5NA 1MG0A 5JLAA 4CMAA 4WCDA 5M6DA 3I9NA 3PI7A 3AU8A 4FFMA 4AJEA 4CQLB 3DTYA 1LDNA 3L6DA 4WKGA 4J1TA 1UXKA 1V35A 2GLXA 1I33A 1H5QA 1U7HA 4N7RA 3WWZA 3GDGA 3Q11A 1HE3A 1NR1A 5BSGA 1YQDA 5FI5A 1GYRA 2HUNA 1C14A 1Y8RA 3BTOA 1XCBA 2B83A 1ISHA 4GBJA 1UAYA 2D8AA 1VC2A 3L9XA 3RWBA 3ZWXA 2BI7A 2DPHA 4YDRA 1E3IA 4NMHA 1O94A 4CM9A 2X1HA 4JBGA 3WB9A 2G0TA 3DMTC 4JJFA 5ES3A 4RQUA 2BGLA 2HSDA 5BT9A 3W8FA 1ZNQO 1VE9A 4CUZA 3ZNPA 3ZU4A 2I3AA 1KERA 3W6ZA 4LSMA 4WNIA 2CSUA 4YWJA 5A05A 2PGLA 1GCUA 5C7IO 4DC0A 1ZMTA 2TMGA 4DWVA 1XSEA 1ENOA 1C1XB 3TZKA 5IXSA 5L40A 1HYGA 2VNAA 3BMCB 4QFDA 4QUKA 3SEFA 4G5HA 1PJBA 4FJ2A 1ZXLA 1YDWA 1HDYA 3F6YA 5AOVA 2PNFA 5HS4A 1MP0A 1YWGO 3IL2A 1YBAA 4BV9A 4RVDA 5BNFA 4RDIA 1KVQA 1XU7A 4CR6A 4MDHA 3ROQA 5A02A 1LLQA 2P68A 2O4CA 7MDHA 1BVRA 4MVJP 3W1VA 5I9NA 1UXIA 1HETA 4CM8A 2NQTA 3I3OA 4HUJA 2ZCUA 4QXMA 3WWYA 5L9AA 4GX5A 1F17A 1JKJA 3GRKA 4DVJA 2H1SA 3I23A 1ZO8A 1MLDA 3DBHB 3WYCA 3BYZA 3KZVA 2J5RA 3JSAA 2UUPA 1ZSNA 4KOAA 1BVUA 1E3WA 1NNUA 4NQZA 5CG1A 4AL4A 3NEPX 1SEPA 1ZFNA 3B70A 4FFRA 3Q3CA 4B7UA 4BMNA 3WYBA 3DZFA 3P2OA 4R51A 4PLCA 3F3SA 4DIFA 2PA3A 3CKYA 3I9OA 3KYCA 1NWCA 1PJLA 3DO5A 4RLSA 2O3QA 2X5KO 4DTIA 1P1JA 4CJXA 1R4MA 4YT8A 3QA9A 5KKAA 4J1QA 5H81A 4EEXA 4UEKA 1PJ2A 1C0KA 2UDPA 3GY0A 1I36A 3RC9A 3C1AA 4MVJF 4PZCA 1X14A 4XIJA 1YL5A 3ICPA 1D7OA 3QRWA 3DAFA 5ITWA 4S1VA 1E7WA 4RPKA 2OXIA 5IG2A 1LJ8A 1ZEJA 3TNLA 2G17A 3VPGA 1DRVA 1NQAO 4AJHA 2Y1CA 3GHYA 1PWXA 4ND4A 3GZNA 3FNEA 3ON5A 4LISA 1LLUA 1YH3A 2I6TA 3CMMA 3K92A 1YB5A 2GN9A 4J2OA 4J9UE 2Q49A 1EDOA 1O0SA 2DC1A 3E5RA 4CM8B 3BTUA 5TRTA 1D8AA 4IIVA 1P31A 3DZIA 1A4IA 3EZLA 3HN2A 4F6CA 3WGQA 2IZ0A 4J4BA 1YGYA 1P1RA 4A7PA 4YAGA 5MGBA 3NT5A 1ZK4A 3FPLA 3DZGA 1EDZA 1Z7BA 2X0IA 3AFNA 3U62A 4DQVA 5L4SA 2OL4A 3IIEA 5AXAA 3PGXA 2QZ9A 1E3WB 4YB8A 1E6EA 9LDTA 3L9WA 2PKQP 2IEBA 2ZB3A 3SVTA 4CM6A 5AQ1A 1UUFA 3I9KA 3PPIA 2VZ8A 3TJRA 3F1KA 1I3NA 2QQ5A 3F9IA 1WNTA 5CDUA 3STHA 5FI3A 3ZWBA 3GT0A 4EJ6A 1T26A 1Q7BA 3G0OA 4BNLA 3EDMA 3FBTA 4Z9XA 3OM9A 4CQMA 3DXFA 1NHGA 3NX4A 1R4MB 4IJWA 3U5TA 3DR3A 1KEVA 3H2SA 4Q3CA 3I4CA 1ISGA 3OBBA 2NU9A 1VM6A 1Y7TA 1WDMA 1ZJYA 1PQWA 4QSMA 4W9NA 5BSHA 3HUDA 2CDAA 5DBGA 3AOEC 3B1FA 4QECA 4ZQEA 4B3HA 1HLDA 1Q0QA 2OMEA 5F21A 4NI5A 4MIEA 4ZQFA 4I5EA 2NVUB 3HDYA 2DBZA 3N7UA 5COQA 4KWIA 1VJ0A 4IM7A 4GQAA 1HE2A 2B0JA 1FDVA 2YV2A 1EMDA 4KZPA 3BMQB 3HFGA 1ZSVA 4JP3A 2Q2QA 3FI9A 1MG5A 3WJ7A 1W0CA 3LT2A 4AJ2A 5IDXA 2R00C 4IDGA 4IXTA 2RHRA 4XYMA 2IEDA 2Q3EA 2DLDA 1Z7EA 2GF2A 1HDCA 3AK4A 4WOKA 4BO6A 1KETA 4EJMA 3AUTA 3R6DA 2NSDA 4Q3EA 1BMDA 4A73A 2WD8A 5JAQA 4N18A 4CR8A 4D41A 3JD2A 2GZ3A 4IS2A 1H2BA 2YV3A 3PJGA 2FWMX 1PGOA 2W8ZA 3ANMA 3RCBA 1B8UA 2P4HX 4I08A 3WBBA 3IC5A 3CE6A 2VNSA 3W8EA 4LN1A 3RBXA 2JCYA 3DAPA 3QHAA 1HDOA 3GVXA 3VOSA 5G4LA 3CH6A 4KUHA 4K1LA 2JAHA 4B4VA 4EGFA 3A1NA 2CY0A 2XXJA 3U4IA 4P4LA 4DL9A 5TF4A 5A5FA 2OOSA 2I76A 3UH1A 2AE1A 2AQHA 4WUVA 3O8QB 1LDBA 1G6KA 4M86A 5B4UA 4DLBA 3HSKA 2Y1FA 3GDOA 3DONA 1J49A 2X0RA 2J3IA 1LLCA 4E21A 4AICA 4RF3A 2DKNA 3JQAA 2P5UA 3BTSA 3VZRA 5ICMA 3WGYA 3MWEB 6LDHA 1EBUA 1OI7A 5C3MA 5JW6A 3SJUA 3PJDA 4R16A 1NVMB 3VH1A 1GU7A 4RVHA 3ZWAA 1WLYA 1JWBB 3DBLA 1DIRA 2WTBA 1DAOA 4EZBA 3ZWCA 4P38A 3RJ5A 4MINA 3WSWA 4NU6A 4QTZA 2IXAA 3KB6A 3VH2A 4CM3A 4NBTA 1QYXA 3LC1O 2Y1DA 4TWRA 1LLDA 3H9EO 2PLAA 3GN1A 4UVIA 1KEPA 3AM3A 1KVSA 4KDEA 1PL6A 2DQ4A 3VH3A 4E2XA 4MP3A 1GUYA 4LMPA 3E82A 2CVZA 4FGWA 3DZJA 5JSFA 4GPD1 5A9TA 5CAEA 4DMLA 3OF2A 3OP4A 3JQDA 3OFSA 1PL8A 3QWAA 3KOUA 4DREA 1XLTA 4OSOA 5CG2A 1YONA 1WPQA 2Q99A 4FDAA 3B6ZA 1YQXA 4R3NA 3T7CA 2PY6A 3O03A 1DBVO 4O59O 2BFOA 4CLOA 2OBYA 1G0NA 1LSUA 3DB2A 2E37A 2HJSA 1ISJA 2D4AA 3L77A 5CDYA 3JQAB 2WEKA 5A06A 3FNHA 3VZQA 3BHIA 1E6WA 4JP2A 4BNHA 1WP4A 5DULA 1ULUA 2EEZA 4NFYA 3RUFA 4BO2A 5DBFA 5JY1A 1MC5A 1N5DA 3AY3A 1M2WA 3NJ8A 1LRKA 4Z0TA 2HU2A 2DTDA 1WW8A 2NM0A 5B37A 3OJ0A 3ASUA 2C7VA 3PLNA 1MXFA 3DBLB 1KS9A 4Z0PA 1E1MA 1AXGA 1VKNA 2IDZA 4NJMA 3KUXA 3GUYA 1PJ3A 4B8WA 3HQ4O 4E0BA 1DHRA 2O2YA 1JTVA 1FXSA 1UP7A 2EHDA 3DZBA 1E1LA 1PX0A 3QIVA 4G2NA 3RU7A 3ZGYA 3P5SA 5DP2A 2EWMA 4HWKA 2P9GA 4U0JA 1V3TA 1EBFA 2V6MA 3OMLA 3TFQA 1U8XX 3RROA 5U9CA 5DOVA 1N1EA 3U9LA 1QR6A 3FN4A 2NLOA 3FHLA 3ZU3A 1MC4A 4DRYA 1OBFO 2W4QA 1EE2A 1Q0HA 1E1NA 4UUPA 1M76A 2V6FA 1CQIA 1HE5A 3AY7A 4BNVA 2GASA 1E7MA 5IAAA 4ZGWA 3Q2KA 2C7GA 3BIOA 3NJ4A 2JHGA 4FJ0A 3VDQA 5JDCA 1Q2XA 2HO5A 4ID9A 1E77A 4INAA 3E03A 2ZQYA 2RCYA 2CF6A 3CUKA 4PZEA 1E0DA 1ID1A 1PJTA 1XKQA 2YZ7A 4IDFA 1DAPA 2EKQA 3I4FA 3HNPA 2B35A 4IIUA 4ROSA 4W7HA 1S6YA 4NJMB 3KBOA 4PGFA 3JQFA 2YYYA 1L7DA 5BNTA 5A3JA 4FC7A 5KVSA 2WJPA 2PD6A 4IDCA 3L0DA 2X58A 3EYWA 2B4RO 4ALKA 1R66A 1DFIA 4WEQA 1V6AA 5A9SB 2DBRA 4AVYA 3PRJA 5BNIA 2IYPA 2HK8A 3UAGA 2AG5A 5HM8A 2I5PO 1R4NA 1TB4A 1XA0A 3VPHA 4BGVA 1SB9A 1BW9B 4Z0HO 2I66A 3QP9A 1PR3A 3CPSA 2NTJA 4IDAA 5T64A 3WS7A 5L51A 3F4BA 2JKVA 4A26A 3E1KA 1T2CA 3KSZO 1U3WA 1GQQA 8LDHA 4I8XA 1R37A 3CTMA 4Z3KA 4M49A 3OHSX 4NH4A 3WGOA 1O5IA 3ADOA 2Y67A 2WYVA 1P0FA 5KWEA 5DDIP 2ET6A 4E30A 4ZQBA 3WLFA 1Y1PA 4OJNA 5JYDA 4XIYA 2VYVA 4K28A 4YVFA 2H63A 2GSDA 1A9YA 1CEQA 4H3VA 2ZYAA 5AXBA 2H5LA 2O3RA 2WD7A 3JYOA 4E13A 1EQ2A 8ADHA 4CMIB 4AJOA 4IQ0A 3OSUA 5A5EA 2EERA 3AUUA 2OORA 2VHYA 3NTOA 2QX7A 5TLSA 2CDBA 2HCTA 3RBZA 1CQJA 5GZ6A 4QEDA 1BGVA 3ZV6A 3IUSA 1YS4A 4ITUA 3KHUA 5JC1A 3DOCA 4GVLA 3OIGA 1OAAA 4URFA 3ETDA 1U4OA 2HJRA 2O23A 1U5CA 2JL1A 1EZ4A 3DBRB 1GZ3A 1HTBA 1R0KA 4PRKA 4PVDA 4ZQGA 4EYEA 4WGGA 1GY8A 1YOVA 2QYSA 1HSZA 2YQ4A 1PZHA 4RF5A 2NQ8A 2Q1WA 4J0FA 4R1SA 1A7AA 2CDCA 4IMRA 4EDFA 1T1RA 1BXKA 3E48A 1NAIA 3LU1A 2B5WA 1VLLA 4TZKA 5IJZA 3E9QA 1IPEA 2VHWA 1VPDA 3ZWVA 4EUHA 4IDEA 1IL0A 4P22A 1I2ZA 4XA8A 1SMKA 5I7VA 4RPHA 4KQXA 4TQGA 4JNKA 1N7GA 2GGSA 3FNGA 3AI1A 1HYHA 1R16A 1DFGA 4RVSA 3ZV4A 1G0OA 2B4QA 3QWBA 4PLPA 3WDSA 4XRGA 3HDHA 3H3JA 1Y8QA 3UFXA 2PGDA 3PYXA 4WJZA 2WD7B 4B7CA 4OOFA 1PU2A 3IJRA 1EVIA 3GNQA 1YXMA 1P77A 3ST7A 3SX2A 3ZWMA 2YDXA 5K6AA 2X5JO 3PTZA 1PJSA 4Y9DA 1FDTA 1DJNA 1K0UA 4OYRA 1GYPA 4WK6A 3BMOA 3UCXA 3TL3A 1NPYA 4HV4A 3DC2A 3C1TA 3BMNB 2E6UX 4PLZA 4WE3A 3ZV3A 1FDSA 3PFWO 3H9GA 4KP7A 1LDMA 4I1IA 1E5QA 3UICA 2EG9A 3S8MA 4KUGA 3JQ6A 1QYCA 4NBUA 1YOVB 2DPGA 3JYPA 5CP8A 1SPXA 5L4LA 1Y9EA 1AGNA 2FY8A 2YHIA 1Y81A 4LCJA 4UULA 3MOGA 4LW8A 5IZCA 2VOJA 4M87A 3ITDA 2EKLA 4YAIA 1PL7A 4JX8A 3GNTA 4LVCA 5LC1A 1RM0A 3OJEA 2LDBA 3LSYA 1PZGA 3HADA 1OZAA 5IN4A 5ENVA 1KIFA 3F5QA 1I32A 4D79A 5EJ2A 3C24A 3GNSA 1HDRA 5CPFA 3UHAA 4BIIA 4BO3A 3PHIA 3PP8A 1X0VA 2FSVA 4LSWA 2DT5A 3H7AA 2V7PA 2R2GA 1C1DB 1Y8QB 2EP5A 1HKUA 3PFFA 1SNYA 3V1TC 1I30A 2JFGA 2VZ9A 1CDOA 3UN1A 1YE3A 2ZQZA 4YJFB 4B3IA 4A0SA 4NIMA 5IDYA 2GO1A 3WNVA 1DB3A 4CM1A 4DBZA 1KEWA 5J23A 4BB5A 4XCVA 2DFDA 4O6VA 1ADBA 1HEUA 1K6IA 2PH3A 3CZRA 2W2KA 4DPLA 3PDUA 1N8KA 1LNQA 5JC8A 3G49A 3TFOA 2RBEA 3RC7A 1K5HA 2ZTMA 4RPLA 5EQDA 5ENDA 3UGKA 2Z95A 3GN2A 2I67A 3D1LA 4HNGA 2YHIB 2VRCD 1I2BA 3OEWA 3QWFA 5KNLA 3RUCA 1ADFA 2PWZA 3DAGA 3RSHA 4E3ZA 1BHSA 4JK3A 4TKMA 1VJ1A 5G4KA 3H8VA 3MJTA 3A4VA 4IJUA 5HS6A 1Y5RA 2DUWA 3GK3A 3S2IA 3ZWOA 1QP8A 1U4SA 1W8DA 3WMWA 3H2ZA 5B12A 4BNZA 5COAA 1HE4A 2OUIA 3ZU5A 3VVCA 3AJRA 3AUAA 1KY4A 3ABIA 4BGUA 3VTZA 3D4OA 3OH8A 4HBGA 4Z9FA 4BNYA 1GQYA 2IODA 1Y5MA 1GD1O 3BHMA 1SOVA 5EN4A 5JCXA 4A10A 4E4YA 4FOOA 3NRCA 2X6TA 3ASVA 1U2DA 4IPTA 1XWFA 1W6UA 5KIAA 1I8TA 1T1SA 4DIBA 1ZEMA 1S7CA 4PG5A 3FF4A 4XR4A 3TZCA 1F8FA 1GV0A 3H3FA 4CLDA 3AI3A 4FJ1A 1YRLA 4GLOA 2X8LA 4L4RA 3ZZNA 4O63O 3GZ4A 2Z5LA 2UUOA 4EUEA 3WQQA 2VRBA 4E12A 1U1IA 5JDIA 2VCYA 3Q1LA 3H65A 1IPFA 2Q45A 2ZB8A 4A27A 4D3SA 2Q2VA 3ZWYA 1Y8RB 4CR7A 2FN7A 4TZTA 3KV3O 1FF9A 1ZSYA 1EFKA 2B37A 1HDZA 2ZB4A 5DOZA 1KVRA 2EGGA 1VSVA 4I5FA 2GDZA 1DDOA 1M67A 3C85A 5A03A 3KXDA 2Y1OA 5G4KB 5AXCA 2OFPA 5CDGA 1T2AA 1HL3A 3MJEA 4WNCA 1PZEA 2J6IA 2DBQA 1GL3A 1VKOA 1J5PA 3MOIA 2A35A 4IZIA 4XYBA 3RUIA 1N7HA 1PR9A 1XU9A 2ZJ1A 3RUDA 1ZJZA 4MVJD 4YTEA 4BKRA 3Q0EA 1JAXA 3WLEA 1EVYA 5EIOA 3GMDA 4IMPA 1PJ4A 5GY7A 4BNJA 4FSHA 1KVUA 2CD9A 5L7YA 3VTFA 2QYTA 3ANNA 3LK7A 4TRRA 3VPFA 5JAMA 2NU8A 1XG5A 1DOHA 1NVTA 4M8SA 3L07A 4CMGA 1E1KA 3PHHA 2HRBA 4R4JA 5ER9A 1DIBA 3GOHA 4U5QA 3QVSA 2BRUA 2D2IA 4PFJA 4E5YA 3D3WA 4E5PA 1B14A 4IQ8A 2PZKA 1ZVMA 3PQEA 4UVEA 4D3FA 4CLRA 4WOJA 4D42A 3LQFA 4YAKA 2Y0EA 4ZN6A 2O3JA 1B0AA 4FQ8A 5G0TA 1EK6A 4ZRNA 4CM4A 4J7XA 4R68A 5JFOA 1I3LA 4XYEA 3UXYA 1V3UA 4R5MA 3PQDA 4TROA 1LQTA 2P2SA 4DA9A 3JQ8A 4WCFA 2E48A 2TMDA 2QRJA 1YBMA 5I9MA 3C1OA 2X5OA 3C7AA 1EK5A 1SEVA 3KYCB 4CMBA 1TT7A 1QLHA 4R69A 4RVGA 3W4IA 3G1TA 3NTQA 3WGTA 4BOYA 3PGJA 2GYYA 4OIMA 3FCOA 1W73A 4UVGA 4XEHA 1TT5A 2VWGA 2ZATA 3ROKA 4J7CA 3JTMA 3PDJA 4OQYA 1IZ0A 2EP7A 1WZIA 4MIOA 1NX6A 2HAEA 3RFXA 1D1SA 3E18A 4CL3A 4AJ1A 2VRCA 2PR2A 1RM4A 3GZNB 3LDHA 3ROPA 3GVIA 4BGIA 3RJ9A 3M2PA 1M6HA 4J90A 3HDJA 1N2SA 1PGPA 2LDXA 3GG9A 3D3WB 3GR6A 4D44A 3D0OA 1P1KA 2WYUA 4CLRB 1ISFA 4RLHA 3U3XA 1A71A 1NM5A 4NBVA 3TPCA 3QJ5A 3JQBA 4L73A 4J3FA 1LU9A 4U7WA 3VPXA 4CM4B 5HTOA 1CJCA 3QVWA 4U6QA 3WGIA 2VT2A 4D46A 2UAGA 4UEOA 4JN6B 4DMMA 4XJSA 1LDYA 2P91A 3CZMA 3JQ8B 5JS6A 3EW7A 4PG4A 1Q7CA 4WCFB 3N58A 2EW2A 4W99A 1P3DA 3VKUA 5EESA 3WTBA 3T7EA 1EQUA 2A94A 2NWQA 1PGQA 1CERA 1OFGA 4CQMB 1PZFA 4BQRA 3V1YA 3CINA 3G1UA 3PJEA 3ZU2A 3JD3A 2ZCVA 1ENPA 1L1FA 4BUCA 1B7GO 5FYDA 4GVXA 5DNAA 1DRUA 1Q1NA 4JJGA 1P1FA 1VI2A 1JLLA 4D0RA 3DWFA 1IB6A 1JU9A 3NYWA 3C3XA 3FR7A 4I5DA 1X1TA 1PTJA 4OXNA 1Z6ZA 1IUKA 4XGKA 2CMDA 2YJZA 2YV1A 3DOOA 3H5AA 2ZTVA 1DIGA 3JYLA 1N92A 4DQUA 3OQBA 1G1AA 2FSSA 4CMKA 5ADHA 4ALLA 1ZIDA 1A5ZA 4XDZA 1UH5A 4DGSA 5AVOA 4XYLA 3JCZA 1R12A 1Z75A 3TDKA 5KJEA 5TNXA 4K9DA 2O3TA 1N1GA 2EKPA 4AG3A 1AHIA 2P9CA 3Q9UA 3TZHA 1H6CA 2JHFA 2VHVA 3PWKA 4NK4A 4EW6A 5IDQA 5JNLA 1QKIA 4J4HA 4UUMA 5CDTA 4GKVA 3JQFC 2OO5A 4PLGA 5BR7A 1NR7A 3IS3A 1P44A 3HJAA 1DLIA 1LSSA 3F46A 1P74A 3ANLA 1LDGA 1UXJA 1P9LA 1YDEA 4Y98A 4YJGA 1Y6JA 4YQZA 2FR0A 3S1LA 4YPOA 3GGPA 4J4TA 4H7PA 2OBNA 4LRSB 1NWHA 5EINA 1GFSA 1RJWA 3G79A 2NVBA 4L75A 4AJ4A 3TZ6A 4R1UA 4BO5A 3LZ6A 1X15A 5A04A 3WG9A 1PS0A 4FW8A 4TRMA 4D3DA 5EPOA 2Y93A 3V5NA 2ZJ0A 1AXEA 1M75A 4YRBA 2Q22A 3GF4A 3AM4A 4RV9A 1ZBQA 1B26A 4HP8A 5FF9A 2PKRA 5JYEA 3DEYX 3HN7A 1XGKA 5EL0A 4IGEA 5TGDA 4BKOA 4IJKA 3RU9A 4BO9A 3U4DA 1J6UA 2HRZA 3ZN2A 4J6FA 3M2TA 1DC5A 2PD3A 4RPJA 3AUSA 4WLNA 1LX6A 9LDBA 1CRWG 4FN4A 4GLLA 3KO8A 3A28A 2ZK7A 4GX2A 1C0PA 1LQUA 2QRLA 3WXBA 4FC6A 2AQIA 1UDBA 1BDBA 5I7EA 5DCUA 1WZEA 1EVZA 3JD1A 5TS3A 5JO0A 4HFNA 1PS8A 2ZTUA 1X1EA 3NDIA 1DC4A 1EFLA 3S2GA 2HDHA 1V9LA 4JXKA 1I10A 3BZUA 4Y6PA 1BWSA 4GX1A 4BKPA 5A9RA 1ZK1A 1U7TA 4JCOA 4OHUA 1KVTA 1FJHA 2HMUA 2R6JA 5T8KA 5CEEA 3SC6A 4ONEA 2O7QA 2VHZA 4BL5A 2Y0CA 1N9GA 1V3VA 1I01A 1E3LA 4CUJA 3A06A 4YT2A 5EQFA 2Q46A 4N5MA 4FS3A 4GKBA 4N54A 4B3JA 4DBVO 3KEQA 1R0LA 3JQEA 4XJTA 2YUTA 1ADCA 4K26A 1DRWA 1U28A 2A9FA 1Q0LA 4LMRA 3VAZA 3ZH2A 1NASA 4CLOB 5T67A 5MDHA 2DVMA 1KY5A 4Y67A 2HMWA 4M1QA 4F45A 2Y1EA 4XD2A 3U49A 3WR5A 4GI2A 2EF1A 1XYGA 1E6UA 1F06A 4XQ9A 4OGWA 3ZHXA 3FTNA 2WWRA 1T24A 1UP4A 1Q7GA 3RVDA 4AJJA 5BSFA 1IOLA 3TL2A 3LLVA 3BA1A 3O4RA 4A03A 4LRTB 1P1HA 3SBOA 3QSGA 4MKZA 2PV7A 4BNFA 4R54A 4MP8A 3VZPA 1GEGA 3S2FA 5K6AC 3UVEA 1PJQA 5JY6A 3GC6A 1GTMA 2O48X 2J3JA 3P19A 5GZ3A 4W6ZA 3KM0A 1W4ZA 2C29D 1VL6A 4HXYA 2FPPA 3IP3A 1HRDA 1QLJA 1SOWA 1DFHA 1ORRA 2UVDA 4CPDA 1NFFA 3RASA 2EXXA 1JWAB 5IN5A 2P5YA 2W2LD 4I5GA 4R41A 3JYNA 3QY9A 2YY7A 2Y68A 4CODB 1BSVA 1HSOA 4RORA 2C54A 2XOXA 4UUNA 1NYTA 4C7JA 1E7YA 2FR8A 4I9UA 2DM6A 1E7RA 4E33A 4YJHA 1UP6A 1B2LA 3JV7A 4UEJA 1E3EA 4E5MA 1UDCA 2F1KA 3TN7A 1SO8A 5TJ9A 3WX0A 5IZCC 2Y05A 4KDFA 2O4UX 1JQBA 1ZZEA 2XPCA 3RUHA 4BO7A 1I0ZA 3ADPA 3WICA 1QYVA 4EJ0A 4YYZA 4ZA2A 2SCUA 4BO0A 4YACA 3E8XA 2GN4A 4WEOA 1LSJA 1ZKMA 1U3TA 3VZSA 1J4AA 2EW8A 3KLMX 1BTOA 1RM5A 2C07A 4DLAA 5KJ6A 1BRMA 3DHEA 4IDDA 4DIOA 2DAPA 5DN9A 3ITKA 3L4BA 4PCVA 4R01A 3RQSA 3B1JA 2PD4A 3AOGA 2D59A 4R1NA 4CMEA 3PJFA 3TRIA 4PRLA 4L76A 1SCUA 3JD4A 4Q9NA 3WBFA 2FP4A 3WNQA 3ZHZA 2PZMA 2BI8A 2AQKA 2GN8A 2GZ1A 5ILOA 3I5MA 3V2UA 1MGOA 3WGHA 2BGMA 3IP1A 3LF1A 3UKOA 4O0LA 4NFSA 1I24A 1ONOA 4EBFA 3ZHBA 2GNAA 1MA0A 5TT1A 2HLPA 4MVJG 2WM3A 4GX0A 1R4NB 1DC3A 1QMGA 4J43A 1XIVA 1JVSA 1ZK0A 4BO8A 2NTVA 1GCOA 4PLVA 4ALIA 2B69A 4CM5A 2ZKLA 2AQ8A 1L7EA 3LYLA 4R9RA 2A92A 2QHXA 1ZH8A 5BQFA 2X22A 3R0IA 3CSDA 5T57A 3LC7O 1MXHA 3U09A 1B3BA 3GDFA 2VWHA 3ZWPA 4WLEA 2O2SA 4IINA 4PIVA 4CMJA 2ZYDA 5DCWA 3R3SA 2JAPA 4BMVA 1NPTO 2D5CA 3W4JA 3GMSA 1NQOA 1CIVA 3PYMA 2YHUA 3RKRA 4OOEA 5LDHA 3NT2A 3S2EA 3RFTA 4XQGA 3AFMA 1GQ2A 5CEFA 3GQVA 3TWOA 1LEHA 4LGVA 3H9QA 1FMCA 2DTEA 2Q1UA 3PXXA 4WASA 3RIHA 4TRJA 4O1MA 4DLLA 5EERA 2QW8A 3EMKA 3NTRA 3Q2IA 5U4QA 4Q3NA 3DTTA 3M1AA 5JXWA 2YFHA 1X7HA 3QE3A 4IQGA 4OH1A 3OETA 1TLTA 4FFLA 4C4OA 1ULSA 3IJPA 3WFJA 4GMGA 4DC1A 4BNMA 4MO2A 3HHPA 3GEDA 5T73A 3D3EA 4LVUA 2J8ZA 4YA6A 3ZCXA 3S55A 4FFOA 2Y66A 2HMTA 1BXGA 2YQ5A 3DMYA 1QRRA 4RL6A 3GFGA 5JDIC 2Q4BA 4IBOA 2NVWA 3K9QO 5KCZA 3TSCA 3KLPX 2X23A 4BNWA 1RM3A 4PLHA 1SB8A 4PLYA 3COSA 2D3TA 2O3UA 2VTDA 2CVQA 1LC0A 4CQLA 2D0IA 3QLJA 2G1UA 4XB2A 5C7LO 2W98A 2CZCA 2D1YA 4Q3BA 3SLGA 2C2XA 4XZ3A 4FPXA 3KSDO 1DIAA 4Z6KA 3QWHA 1DPGA 5KVCA 4DYDA 4RCVA 1GUFA 1YQGA 3I9JA 5B1YA 1ENZA 4ZVVA 5G0UA 3QW2A 4GWKA 1XR3A 4NR0A 1QXSA 3F5SA 5ICSA 4MOWA 3QWIA 5GZ1A 2J3KA 3TQHA 1NVGA 1ML3A 3UUWA 2NV6A 2FOIA 3WMXA 1LC3A 2C2YA 4E31A 3H5RA 4C7KA 6ADHA 2EGHA 4QQRA 4L74A 3BMOB 1O8CA 4XQCA 1GUZA 4M54A 4PLWA 2ZIZA 5LCXA 5G0VA 1R6DA 3UCEA 3GEGA 3ENNA 1K3TA 1XQ1A 2RHCA 2OHXA 2YW9A 1MUUA 3DBVO 1UAGA 3LT4A 3PEFA 4PG7A 4BNTA 3K30A 1B8VA 3RC2A 3GRPA 3B1KA 3W6UA 2YFQA 4CM7A 1K6XA 5JYFA 3KYBA 1IE3A 2FR1A 3OIDA 4IDBA 5G0WA 1DSSG 1NPDA 3HE3A 3Q9NA 4U8GA 1JW9B 2JCVA 2Y1GA 3PK0A 1EUZA 3TOZA 1HT0A 1T2FA 3LT0A 5TC4A 1P45A 4FB5A 3GAFA 4BNIA 4WCFC 1WDKA 2X0NA 3DBHA 1JAYA 4KTVE 4HX5A 3PLRA 4YRDA 3KETA 4NJOA 2AEMA 3DFUA 3ONFA 1ISMA 4MKXA 3I83A 5AXDA 2C59A 4ZJUA 3GHHA 3BAZA 4YT4A 1B3RA 3E5MA 4W9NC 5JMWA 2GPTA 4PN3A 2AEFA 3MJSA 1MB4A 2G5CA 4NG5A 2DTXA 3PZBA 4D7AA 4EITA 1UJMA 4AJNA 4BNNA 3MEQA 1C0LA 2Q2WA 4RQTA 4D43A 1M66A 3VPSA 3AM5A 1QV6A 1NTOA 4JJIA 3EY4A 2YDYA 3U4HA 2W2KB 3OECA 2ILTA 2J5QA
chains in the Genus database with same CATH superfamily
4L8VA 4ZQCB 3RGGA 1ZK2A 3A2MA 1PTKA 4MRSA 2B21A 2XQGA 1JN0A 2EL9A 2FRDA 2PTGA 1X7YA 1QG4A 2ZZKA 3AG6A 4MJLA 2WWGA 4RNDB 4RHFA 3PUZA 3SJ7A 4BKQA 3HLKA 1NIPA 2GYVA 2J41A 5DNEA 3V80A 2GB4A 1NM5C 1E7SA 2ATVA 3W7VA 1Q2UA 2ZTSA 4TLDA 2G70A 5ILGA 1GPMA 3B1VA 2YY6A 3ZHQA 1FDOA 3JZDA 2CLDX 2ZYVX 4JA0A 5EGSA 3MS4A 1I3KA 1R3UA 2H5JA 2PANA 4OK3A 5EIAA 3N6XA 2L18A 3R5TA 1HDXA 4RVNA 2MR6A 5IFLA 2PCJA 3H8JA 4XRRA 4ZQHA 2RIRA 3K6JA 4EELA 1JX6A 2CNOA 4FZVA 4MAFA 2WJJA 2H7YA 2VUSA 4RAOA 5LNK6 3EVCA 4DPMA 3JQAD 1YACA 2Z2JA 4LHVA 1U81A 2EOAA 4P2BA 4Q15A 4RIEA 2GN2A 4R98A 4PGHA 4RE6A 2HNKA 2CLMB 4QSHA 4O5AA 3DAYA 3RVBA 4IWNA 4P34A 3UF0A 3D43A 3GEEA 2JNWA 4GGPA 3EX7C 1YRAA 1XZFA 2KJQA 2NSJA 3H5IA 4KWCA 4OJMX 3PZRA 1H6DA 3KLNA 3IAUA 3TSYA 2B30A 4CG3A 4D5GA 5L7WA 3UY4A 5HWSA 4Z5XA 2HWUA 2B7BA 2P2LA 1RKXA 5DO9A 5BSMA 2X4DA 2AG6A 1SZCA 3D7SA 4IGFA 5EXTA 3RH0A 2BFDB 4TQUS 1UPFA 3NWEA 4RJLA 4BLRA 1PTJC 1U7UA 1XBTA 1ZGCA 1XAGA 2G6BA 2P6PA 3GGSA 4ZPJA 3RAJA 3KCQA 4CV0A 1CWUA 1XQ6A 5EXXA 4B8ZA 5HOQA 1OTHA 2C03A 3LPDA 4EMUA 3ADDA 3OA0A 1GITA 2R62A 4BB9A 1JEYA 1TOAA 4LTDA 4RSRA 1X3LA 2GEKA 3HEBA 2EJBA 3AESB 4AX4A 3H2JA 3CW8X 2EYQA 2VYND 3A9CA 3KT8A 4HXGA 4JA2A 1SD1A 1L5OA 4CCYB 5CXXA 5TIIA 4NV1A 1SKAA 3PFBA 2AR0A 3MD0A 2AR7A 3GZJA 1GILA 4ETNA 1RLIA 4ZOBA 2BLLA 3HCBA 5JEEA 3ZW8A 4AAYA 3I6YA 2PKQO 5EYPA 4DR5B 1DPFA 2G5PA 4ZI7F 1ZN9A 3TKLA 3DZKA 1GZ6A 4CBVA 5B4TA 4NFHA 2UXDB 3ZEIA 2TSYB 1X9GA 2ZAGA 2OO5C 2P1RA 4HDSA 3EG9A 4ND2A 1RC8A 5IC4A 2C3PA 4F84A 4JR2A 2ZIVB 1JVBA 1VKZA 3PQCA 4LMAA 5I8WA 5CDFE 3B5EA 1NJ5A 2XDWA 3E61A 3MSCA 3GRVA 4NBRA 4QFCA 3GAZA 1WMAA 1T5LA 5FOVA 1G2IA 2OK7A 2PHZA 3FAZA 1CR4A 4MYDA 4I4TA 2FX3A 4R1TA 4URHA 1W2WB 2XZPA 3SYLA 4MYUA 1TO6A 2HU7A 3OJCA 4P3PA 4XDYA 4L4SA 3DMTA 2GO7A 1SKQA 1RQ7A 4WUTA 1HDGO 4UMEA 5JT1A 4MQFB 2Z3WA 4Z9YA 4EJ6A 3LCJA 5C5EA 1WSDA 4DEYA 3Q3EA 4E6PA 4CLXA 2HK9A 1QIEA 2X3YA 4WBSA 2JBAA 1HG0A 4IKOA 4M0PA 5CFZA 3R20A 1TAQA 1N2CA 2WBLC 4UUQA 3D4NA 3FHJA 5K3EA 2OHFA 1TZMA 2X9NA 3T9AA 2G82A 1HA3A 2PG3A 4BVAA 2CLHB 1D2MA 1U1DA 2P0YA 3TW8A 1SVUA 5TGZA 4KSBA 4DV2B 4ITRC 3ACBA 5KKCA 5HTKA 1BOOA 4JLNA 3ZW9A 3VYRB 3CJTA 1RQGA 5FWAA 1COWA 1GCIA 2IYOA 2ZJ6A 1IN7A 1CF9A 1TQDA 1OR8A 4I55F 4JMLA 4OQFA 4P3OA 1H9BA 2PLNA 4YAEA 1O6BA 3VVLA 3EFEA 2P67A 4K88A 2AYXA 2D1TA 1Q3HA 4GXQA 3OF5A 5FFFA 1W29A 2PUWA 1KY2A 1F6WA 1IZ9A 3X0DA 2Y9PB 1O96B 3OFJA 1KBZA 1O57A 2F3TA 1ECGA 1YRHA 4P3NA 1C4XA 3LCVB 2D54A 1IULA 4DVGA 4RZ2A 3K1YA 2PH1A 4GH5A 1II8A 2EC5A 4QDTA 2D0PB 4B84A 5I7FA 1EJ6A 2RGWA 3UUFA 4QOJA 3W6NA 2W2XA 2FZLA 1KA9H 3RAPR 5IH7A 4BU0A 2ONZA 4AF8A 5CYFA 3BWXA 3QVXA 1T5OA 3NC1C 4TLLB 3M34A 3TTYA 5KYUB 5GM1A 4X1KA 4XIFA 1R15A 1ZW1A 2CVFA 1VL0A 5HA5A 1YJ8A 5E3JA 3KRTA 4DWJA 3I5AA 3GT7A 3Q0IA 1ZN8A 5H3HA 3CW2A 3H8WA 4OM7A 1Z26A 1Z45A 3WDMA 3CLKA 3B3GA 3V32A 3PCTA 4QX6A 1SN7A 5E7QA 1CEEA 3IAHA 2MDTA 5DNDA 1UDAA 3ZS8A 1OBVA 2XKBA 4U6SA 3AI2A 4EPXA 1CE8A 3TUJC 3KL4A 4XX0A 1RYEA 4EB0A 1RLUA 2AD5A 1F2VA 1F12A 5JDCC 3V1LA 4MV3A 4F2PA 4Q05A 1EM6A 2NU7A 1L0BA 2P2DA 3ANTA 4MKRA 1G8YA 4YCAA 4BKUA 4D9HA 1IOZA 1M10A 4NC9A 5K03A 3QVOA 1KYZA 3EK2A 2B36A 4WKNA 4WBNF 1KYTA 4OM8A 4YNBA 4INJA 4IUBS 4CM5A 3EGOA 4UVHA 5CDHA 3C4JA 1VLJA 3MZ0A 1G8SA 1X38A 3C8MA 2Q29A 2RGCA 3G2LA 1FDWA 1MAWA 1WZUA 4G5OA 4NBWA 5CA0A 2GXUA 1PQPA 4OMDA 2I9KA 1FDUA 4LHZA 3FI0A 1WD7A 3OLYA 1G2PA 1BS1A 3KYDB 4GOJA 4XKJA 5AD1A 5C0OE 4A8TA 3HG7A 4KDRA 2HBYA 4S24A 2ECOA 5IBPA 1D2RA 1W8IA 1YQ9A 2WMYA 3A05A 4TTAA 5AP9A 4ESOA 4ZCTA 1VIAA 2XA2A 3WTCA 1VYTA 1IY8A 1Y1SA 2FMKA 4KQ1A 5AJVB 2A0KA 3NHPA 3THWB 2O7RA 2ZIUB 2ECKA 3KEGA 5JWHA 3BN3A 3GVCA 1Y6RA 1UKAA 3KVOA 5BQ3A 5J1TB 2ZETA 4YR7A 2IDMA 4DC9A 1D2GA 2IF0A 1ZXBA 3GLUA 4GOOD 2OV1A 1UOOA 4CDNA 2VYVD 2KS6A 1TLLA 2XQIA 1UXOA 1TK9A 4W4TA 7REQB 4UNIA 4IHJF 4L15A 5KSZA 1QQAA 2JW5A 3WL7A 4BFCA 4U0KA 1X7ZB 4C78A 2FW6A 1E92A 1ELOA 1NF3A 1QGUA 4O4JB 2UUAB 4ZDWA 1DJQA 3MCZA 1DTEA 2VRWA 3GGJA 2WUWE 3COZA 3OLVA 4QTXA 4QKQA 1AS3A 3L93A 1JQAA 4P32A 2H9AA 5D6NA 4GAEA 4C0KA 4TWIA 2I34A 2ZYHA 1TVKA 1T4DA 2QG9A 2X0JA 1J9EA 2FETA 1KP9A 2WG0A 1GYQA 2XGGA 2QMQA 2C82A 3LF2A 5AVRA 1K88A 5C37A 4RM2A 3H0KA 1ZD2P 3MQFA 3UMVA 4B44A 1T1JA 5DHUA 3SVLA 5DHTA 5DT9A 5JQGB 4KV9A 3LI2A 3TH5A 1SZJG 5IVKA 2OMKA 2CYBA 3EZGA 4DBLC 3D8TA 1F0YA 4X84A 3OQHA 3LPNA 1HXHA 3GJ6A 4R2MA 5FPTA 1XKXA 3C8HA 4MLCA 4HT3B 1K2WA 3HS3A 2JEYA 4P31A 3UIEA 3DOJA 1RFLA 3FPCA 1OLSB 4CMEC 2PV0A 2XKJE 2YVLA 2H8GA 4FLEA 3V8BA 3NBXX 1WABA 2PMCA 3AEKB 4PYIA 5CXQA 5P21A 3UFBA 1GPAA 3DP9A 3H1TA 3LUKA 2ZPTX 1WXXA 2PGAA 2PVSA 3BOSA 3NP9A 4GEKA 4P35A 3NT4A 3JALB 4ZANA 1Q0UA 3A11A 3OQIB 4CNBA 1I1NA 3PHJA 3S1SA 3SIXA 4HYQA 2ZTLA 3HUUA 2HU8A 3C3WA 5C46F 4JASB 3WWEA 1FFEA 1YOBA 2GPBA 3Q7EA 4R9UC 4H15A 5KHLB 1WSAA 4CL2A 2EIHA 1RAIA 3KVVA 1QG6A 1LNSA 2G9VA 3MJCA 5FBKA 2G80A 1F60A 1DEAA 5UKDA 5CXUA 2X42A 3PC3A 1P0QA 5GONF 4N9WA 1QYDA 4NCBA 5L95A 1N2GA 3ORFA 1XJQA 2C20A 3Q7QA 3MLEA 2FVXA 4II3A 4WACA 3VH4A 4EPRA 5HF5A 5I9LA 4AKTA 1VL8A 2JH9A 3CBQA 3H5TA 1EVJA 4RTNA 1IIRA 4QGAA 3IILA 3K72B 4L6IA 1S9HA 1VB3A 1BW9A 3L92A 4TL6A 2BBTA 1DJMA 1D4FA 2X7HA 4TMXA 3F71A 2HA7A 4UHCA 5JSZB 5I8ZA 1ZN2A 4B76A 4DDUA 1Z74A 1RD4A 1S2DA 4ARAA 1NJSA 3ILYA 2OBBA 2ZIXA 1N2JA 3KKKA 5DV9A 4EHJA 4LTNA 1LSOA 2Q28A 2R5WA 4M76B 3O2SB 2ID4A 3Q6IA 4B31A 4FWBA 1ODSA 2W2MA 2ZPAA 2QTVB 3A1UA 4GHWA 3TIGA 1HRKA 4HRXA 221PA 1U6KA 3ZI0A 3BF7A 4ED9A 4HUQA 1CFZA 3OCCA 2P9JA 2FZWA 5CD9A 5KOYA 4QICA 4HOYA 3F4KA 3ZDEA 1K5GA 4KFTA 1J1UA 2NO6A 4FFPA 1OF1A 2GEDA 2HNAA 3PQ5A 1CKEA 2PT9A 4BRZA 4EAAA 4EO9A 5JSUA 4XJVA 1O77A 5FL7A 3TCXB 3FNFA 3FBWA 4F8EA 4JI1B 4PAOA 4DIUA 2ENWA 3DUWA 4KPGA 1GA6A 1EUCA 1RWVA 2E89A 1TKAA 1Z0JA 1RHMA 5I7SA 1QFZA 3COJA 3CLRC 4GDFA 1CY0A 2B9EA 3NATA 5C81A 2P1DA 3IELA 4CDRA 5ABPA 1K0FA 3ZHOA 2PO5A 4BS9A 5C8YB 3O9ZA 2IX3A 5ARCA 3PXCX 3CWCA 3M9LA 2BOVA 3R23A 5H4HA 3RRFA 4DQXA 3SYNA 2LPMA 2MSEB 2Y3IA 5D5HA 3V2HA 2XRYA 3FUVA 1GNVA 4H7HA 2HT6A 2NZWA 1D5CA 3SZGA 2IOYA 4F4IA 5KX5A 3ZVMA 1D5WA 4MPTA 4BAGA 1ONNA 2ORIA 2GN6A 4FUTA 5EKSA 3TBKA 4C0WA 3TBHA 5AKXA 3EZYA 3BUSA 4ZDJA 1VSTA 2AXQA 1B93A 1J5XA 3IE2A 4J1SA 1B41A 4K2HA 2ON6A 2V97A 3IQIX 4O1HA 4BZXA 3K31A 2VT3A 2JLVA 4I6EA 4ZYYA 4QATA 5ERGB 5F77A 2I6SA 4H0CA 3IDFA 2ZI3A 1UR5A 2OV8A 4OL0A 1XNQB 2WMDA 3A6DA 3TQQA 3UQZA 4FBGA 3ICEA 2AOTA 1G9XA 3OKAA 3RUAA 4Q9KA 5M34A 1RJGA 3BGOS 5GJCA 5COBA 2GD1O 1RAAA 1ULTA 1EEHA 4ZXFA 3C7KA 2A7XA 2ZT8A 1ZD4A 3IQFA 3CEJA 1H2HA 4BFWA 2DUUA 1A4XA 2G36A 2PGXA 1G4UR 2JFQA 2X86A 3MJVA 5FPKA 3WY9A 3LPLA 3TKYA 1QZXA 1T3TA 2X13A 1CF2O 3UATA 1K98A 2A59A 2PKCA 3BH7A 2JC3A 3C1UA 1ACMA 4D6XA 3RUEA 3GPIA 4PINA 1S2OA 3N3BC 4NMLA 3T41A 4CM9D 3R9WA 1SXJC 1XC7A 2FSFA 1IUNA 3HACA 3HB5X 2O5VA 3OFNA 1GEEA 4YROA 1LDEA 2CFCA 5DP1A 5H9VA 1A27A 4LOIA 4E03A 4J0IA 1QU2A 5CT8A 2AJBA 2FPGB 3ZHVA 3GLQA 3NFYA 4K7JA 4TOIA 4M55A 4AFNA 5I45A 4RVUA 2QUAA 2H6EA 1GZ4A 5A6SA 4IUYA 2V59A 2PU7A 1E1CB 3ENQA 4UBKA 4PO1A 4DHEA 4NBSA 3RDPA 3OQVA 5CRIA 5JJCA 2BFFB 1H6AA 4HX9A 2E0IA 3PRKE 1GADO 2BKLA 4RHTA 4H6XA 3DDOA 1WSBA 1F7UA 1VHQA 4KACA 2VQDA 4IO1A 1XEAA 4R31A 2G8LA 3JZMA 4JUBA 4DCNA 3P9ZA 1I7LA 1A9TA 2YVKA 3BK2A 4A5SA 2W6NA 3FFXA 1KJZA 1R4AA 3GEMA 1G19A 4KIFA 1F8GA 4R8KA 5B2FA 3L4SO 1P9OA 3LPMA 4TMFA 5AKKA 3U16A 1B6TA 2EJWA 3NOOA 1AKMA 5CPBA 1CVRA 1QQTA 2L82A 1SOMA 2Q3BA 1C9MA 1IRIA 2I0FA 4RV5A 3OE5A 2G40A 1WWKA 4C3UA 3IVGA 4Y8VA 5DBIA 2AF4C 1UOQA 3WKEA 3BT7A 4II2A 4RDXA 1NU6A 1X7DA 1ZM7A 3USES 1C7JA 2PMEA 3N1UA 3E9MA 1U9ZA 4Q9HA 3IHWA 3DDHA 4RCYA 3LKZA 4GUDA 3KSUA 2PKEA 4FXPA 3PGMA 3N07A 4TLMB 1XHLA 2XADA 5L6MB 3WIUA 2NG1A 3MAAC 1JYFA 3G23A 1QDEA 3IE0A 1EXDA 3SS7X 1PSDA 4E4TA 4Z54A 4AN0A 5TVOB 1G20E 1CS0B 1B15A 5CM9C 4BX3A 3WFZA 2XZDA 3CEHA 1EVEA 4QASA 4CIVA 2QTTA 1A9ZA 2JJYA 1NRXA 3ICVA 4INOA 1CIJA 2XVAA 3JR3A 4NYIR 1U0BB 3TNFA 1XHFA 3AO0B 4WECA 1EP3B 1R0XA 2PS3A 4J1NA 3KLOA 4I9HA 2IZZA 3B9QA 3R3JA 3KV1A 5DEIA 1FBTA 4YHBA 4B45A 1A04A 2AI2A 2VTVA 4E5VA 1XPRA 2A5JA 2O50A 2AEJA 1NOIA 1DKOA 1NP3A 3P9QA 3V2GA 4A2WA 1KMIY 4DA0A 3DOFA 5EY5B 2JLAA 3GJ4A 2ARKA 1ENYA 1VB5A 3FWNA 2CNLA 4QPPA 4U02A 4DYVA 2XWBF 5CHEA 1QVAA 4YJ2A 3TXXA 4E2WA 4F85A 2ASVA 5DNCA 3N70A 1XDUA 2ZAOA 1M1YE 2IYWA 5CH8A 3P7MA 3HYRA 1ZS9A 3PT5A 1L7PA 4BMSA 5DWVA 5AI6A 2XEXA 5TSDA 5FV7A 2WJ6A 4HADA 2C5BA 1UWLA 3IQXA 4ARZA 1KO4A 4YR9A 3B9BA 2PXAA 2NUAA 4D4LA 4HXFB 3O8RA 3NHFA 3KPUA 1JEQA 4TKUB 1WXFA 4N6NA 5A6VA 2XB6A 1LRJA 2AT1A 2ID9A 1E7QA 1N6RA 2V7XA 3EE6A 4Y7CA 4EHAA 4AS1A 3LPCA 4FR5A 1RZUA 4EG5A 2HI0A 1ISIA 3L1UA 4ZVRA 3LNTA 2QPAA 2O59A 4KCGA 2W58A 2W2LA 4MO9A 5KTSA 4FFNA 4LWOA 1ZGBA 5LDGA 1RPTA 4TKLA 3T4EA 3JR7A 1EE9A 3ABRB 4E32A 3T3PB 2VHTA 1Z13A 2I6FA 4Z0NA 3IP8A 1JI0A 3ET4A 2IUEA 2QVGA 2WE7A 3D1JA 3IMEA 3P32A 4NK5A 4J29A 1V95A 3DHYA 3UA3A 1XQXA 3GFVA 5DCYA 1TD9A 3T4XA 1FL9A 2F6RA 1QF7A 3C7CB 4N5IX 5EMKA 1ZC3A 1NMEA 2Q4EA 2PZEA 5BMVA 2PUHA 5CEJA 3HJFA 3P2EA 3RVQA 2XTNA 1S01A 5KJ1A 4KREA 5T5QA 1ANKA 2R8EA 2J30A 2G5TA 2I4NA 1P0CA 4GBED 1JKIA 4JT4A 3DKKA 1TA4A 4PZZA 1Z2NX 2ZRIA 4OUKX 3KHSA 4RH1A 3ETNA 4MV8A 1JHMA 4ZEOA 3CN7A 3BSWA 4MUEA 1M6VA 4CQLB 4NAHA 1HFJA 1OHHD 4Y2UA 1U63A 3T94A 2JIQA 4X45A 1V1MA 1UXKA 2GLXA 2GVNA 2QD1A 2CHUA 2FSUA 1YASA 4HQFA 4J16C 2IU0A 1XJWA 3A1VA 1Z4JA 4XASA 1S2MA 1B73A 3UMFA 4XUEA 3AR3A 1WRBA 3RSOA 1AUQA 4GBJA 2D8AA 1QIMA 2HWYA 4MMZB 3L9XA 1B0UA 4AIIA 1YKGA 1YVRA 2W2VA 5KWIA 2QMYA 2XGOA 4YWHA 2C94A 1Q17A 3KSRA 1O95C 1DJPA 2C1EA 4LXTA 2HSDA 3BKWA 1ITZA 1D2CA 5BT9A 1ZNQO 1VE9A 2Q5HA 4ZI7A 5AIAA 3T1OA 1C30B 3BL8A 1GGJA 4KN8A 3IUEA 1DAKA 4Z99A 5LSAA 2CJPA 2NP7A 2CUZA 3P4UA 3KXKA 1JIKA 1T36A 4Q18A 4UM5A 2G09A 3ZJ4A 4BDTA 1ZMTA 2TMGA 3EUEA 3QQ5A 2H2DA 4CEHB 4CCSA 1OH5A 1P6XA 4JL6A 5KUTA 3SEFA 1C3XA 4GG1A 4FJ2A 1ZXLA 1WY5A 1HDYA 3EUFA 3F6YA 1W5AA 3FJ1A 3O82A 3TRJA 3W5VA 2DP4E 1MP0A 3ZGOA 3RVJA 1YWGO 4M38A 5ITZA 2ZSIA 3L82B 5BYAA 3IL2A 1NY5A 3K09C 1A7UA 4RVDA 3Q98A 3OTOB 3PTLA 1GPWB 1N2EA 2YWXA 3L8DA 3KT6A 1RLTA 1IQ0A 4MDHA 4TSFA 3N8NA 4RTMA 4C06A 3HBAA 4NENB 2VYQA 3QLUA 4LYEA 6CHYA 1YCHA 3QOFA 3H0WB 2VT7A 3NS7A 4AF7A 5LDDC 1I6KA 1N2OA 3RS2A 4G1FA 5I9NA 3CWZA 3I01M 4JKIA 1FJXA 4AZVA 4Q3OA 3WWYA 4ZT4A 2OBFA 2P40A 1F17A 1JKJA 2MSLA 1B6SA 3G8AA 4PSUA 3VR0A 4C2AA 5KINB 1WBBA 1MLDA 2X4LA 3GDWA 3HXPA 4V0NA 2WIAA 4MGKR 5LZ7A 3V4LA 1XAIA 3RYCB 3B36A 1QP4A 3DSRA 1UMCA 4X64B 5K8LA 2YWFA 4BE9A 3O84A 4TTQA 3UXMA 2OFFA 2JLYA 4W5TA 2OBXA 2YJTD 4ZXPA 3O8DA 2CBGA 1NNLA 3WHKA 4ETWA 1HO3A 1YBFA 1O58A 3IB3A 4RTJA 1OVMA 4D3ZA 2IU6A 3Q3CA 4G09A 4MX8A 3WYBA 3KVYA 4IGKA 5BP7A 3SPXA 3PL5A 1Q57A 4C4PA 2VI5A 5A3QA 4DIFA 3K94A 4F3RA 5BXQC 3KYCA 3E8MA 4AK1A 1U0EA 1YZKA 3GJ5A 5IJ0B 2JAQA 2X5KO 1EDDA 3STUA 4DTIA 4EA8A 3L0BA 1JFLA 1U8EA 3MC1A 4CJXA 5DHRA 1R4MA 3F5FA 2PRZA 4N8EA 4WI1A 2K2QB 1R0WA 5AW5A 4YT8A 4IG4A 2J9YB 5DXAA 5H81A 1XPOA 2CL6X 4EEXA 3YASA 1SD5A 1PJ2A 3OTIA 1PFQA 5IBQA 2H85A 1Z56C 3QZUA 5CFQA 3NM5A 1EH5A 1YL5A 3RIGA 1U11A 1H1TA 2IXDA 1UEJA 3ICPA 5CURA 3QRWA 5CA0F 6REQB 1ADYA 3E3MA 2Z43A 1XFAA 3DT9A 1WPRA 1L4YA 1LJ8A 2G17A 4P4SB 1W7AA 4AJHA 3PV0A 1YZQA 2Y1CA 1V47A 2C1ZA 2JLBA 3U2QA 1KK1A 1OXKB 1S4QA 3GLSA 3OTQA 2ZR9A 3KR2A 1LLUA 2I6TA 3QKUA 3OE4A 2GN9A 4J2OA 1ZAKA 3WV4A 1YUNA 2FPIB 2DC1A 3EIWA 4HLNA 3BTUA 3CRW1 2ADOA 2ODQA 3VI3B 4F4CA 4BJHB 1A4IA 3EZLA 3HN2A 3TGPA 1T3HA 4HAZA 3UMJA 4Q7JB 1U02A 4D9NA 1WKCA 3SMVA 3OX3A 4V38A 1GZ7A 2CXQA 3SFTA 1MJNA 2XMRA 5FFNA 3TAHA 1JFFA 3Q3JB 4BXOB 3LXMA 4M9ZA 2EJCA 3FOZA 1J0DA 5I4IA 1E6EA 3K20A 2QQEA 3L9WA 1DAIA 1XD2B 3K1AA 4B34A 5AQ1A 1US8B 1HURA 1HORA 3I9KA 3PPIA 4YK7A 4ZOLA 5TPWB 4B2PA 1WNTA 2ZSHA 2W6MA 1BROA 2C2KA 3E70C 4B2IA 4EY3A 4KHPB 4KN5A 1I7PA 1Q7BA 4AZTA 1FDIA 2WWFA 4TKVB 3JWIA 2OCKA 2R87A 4I3FA 3OTHA 4NCIA 4CQMA 2PL5A 3PSAA 2H31A 2HC9A 3QKSA 2DOKA 4P2GA 3Q1KA 2VJMB 1AB5A 2VDJA 3ECCA 4GXNA 3DVAB 3MRSA 3C5WP 2O5CA 2B92A 1CUCA 2NU9A 4GNKA 4DR2B 4FFSA 1NN0A 1WB6A 5FOSA 1I3OA 1QIGA 2FQQA 3FGZA 4RY9A 4B8YA 2BCGY 1WU7A 2NYRA 3HCFA 2C4UA 1C3LA 3HUDA 3LO8A 4H18A 5E2AA 5DBGA 1JUDA 3IRUA 4EFLA 2O8EA 1K4YA 3EP3B 4ZQEA 1FSZA 4QECA 4HQ0A 4KFCA 3E2PA 2OMEA 3DKVA 4P3XA 1I13A 3FFTA 2QW0X 4I5EA 2NU6B 3IVAA 3HDYA 4JL8A 3VM6A 5COQA 3B9RA 3OI7A 4CHGA 2FEAA 1DBSA 1KO8A 1NLMA 5KX5B 3V8PA 1ZI8A 3R6LA 1OYYA 1EMDA 1JJBA 4KZPA 1MN6A 1QRAA 1SVLA 2Y4NA 3E9DA 4HWPA 4JP3A 5EOVA 4V0RA 2Q2QA 5H70A 2RHTA 3EFOB 1MG5A 2WUDA 3WJ7A 5KTOA 4Q9LA 5I9BA 2L42A 3JU3A 1W52X 2RHRA 4XYMA 5ALRA 2M2IA 3KXIA 2GF2A 3DLAA 4LNUA 1HDCA 4WOKA 3BG5A 2BLNA 3VX4A 3KQHA 2PMFA 4C2BA 1H2EA 4ZVOA 3R6DA 4MW0A 2NSDA 4MVCA 4Q3EA 3AJ8A 2CLLB 2XYRA 3V6MA 2Z4TA 4LDQA 3UMYA 4A73A 1YS7A 5BWBA 3CBGA 3SOZA 3RVPA 1JG2A 4Q93A 4D41A 3IV7A 2RJOA 3CR3C 1SK8A 1QVVA 3AQIA 1XAJA 3R3UA 1H2BA 2AWOA 2IGBA 2H7VA 2YV3A 2QN8A 3LQYA 2ST1A 3PJGA 4WY2A 3VSCA 4B6OA 3RCBA 1H4TA 4I08A 4KXYA 3WBBA 3IC5A 3CE6A 4B33A 1W88A 5ICCA 3VR2A 1N36B 2A1TR 3RBXA 2VHQA 3QOXA 2IWRA 2JCYA 3DAPA 3MCTA 1F8YA 1KOJA 5I4CA 2Q6LA 3VOSA 1JECA 1EFPA 1XCLA 4ZAFA 5JNWA 3I9V1 3EC1A 1XN1A 2JAHA 3EHDA 3JZIA 2ODTX 2W8BB 4KUHA 5A5GA 4DL9A 2BEUB 4P4LA 5KNBA 3H19A 3BBLA 3P2MA 3TBFA 2OOSA 1JLRA 1YIDA 5C9ZA 4IFTA 5F73A 5ETJA 3AR7A 5CM2Z 4DUZB 3PRYA 1EFVA 1YR1A 2QKYA 5DMXA 4LZLA 5LU9A 3BVPA 5B4UA 2X2EA 4X1IA 5DJ5A 3FCYA 3AETB 5FTLA 5KNCH 5FT9A 4KSYA 2DKNA 3AY0A 3KR9A 4ZT2A 1XOIA 1J99A 2R1UA 4YO8A 4UCXA 2OC9A 2H59A 4FS8A 3BTSA 3N2EA 2ZG6A 1GGMA 1XVLA 2R1TA 1DUVG 4MMYB 4L0MA 1EBUA 1HK7A 4OUDB 4D0LB 4JOBA 2RI6A 3EXG2 1H3NA 4H3SA 4K81B 4HB2A 1M33A 2A0UA 4FQ7A 4L3OA 3ANSA 4D96A 4EABA 2X6RA 4LEIA 1GU7A 4RVHA 3RANA 1ZJ4A 1WLYA 3MWYW 1EP2B 5K8IA 3HCEA 1IVYA 2AJTA 1W5TA 2GMWA 1VBFA 1PI3A 4RD0A 1P0IA 4JFRA 3ZWCA 2H2FA 5EZ6B 1NBMD 2JJ2A 5EHQA 3WSWA 3RV4A 2IXAA 1AVTA 5FTWA 3VH2A 4K9NA 3GYGA 3ZIDA 5JHHB 5KX5F 5IHPA 2A9PA 4QBFA 2IV2X 2WKQA 4CM3A 4U2EA 4NBTA 1C3OB 4TWRA 3E9RA 1LLDA 3PFGA 3IA2A 5FLKA 1CRLA 3P52A 4E51A 5G1OA 3P9RA 1PL6A 2ZIFA 3K2QA 5ESDA 1E61A 3TR5A 5LU8A 4GKJB 3KGDA 1GUYA 2EDCA 5DYWA 3UNXA 5BW6B 1J8QA 2C9YA 2KM1A 1CZHA 1BHQ1 3H5WA 4MVYA 5JSFA 4GPD1 2BPOA 4CN9A 1UPCA 4OP2A 4QXAA 4DMLA 1YVUA 5J63A 3F6CA 4RTOA 4AK9A 3QH4A 3V1NA 3PC6A 4FLFA 2GILA 4FOPA 4HX2A 2OLEA 1PL8A 5JAHA 2ZROA 2QAIA 3O94A 5I7UA 1N0VC 5CG2A 1YONA 2I29A 1WPQA 2JCSA 4DZZA 4KPYA 1E2JA 4LX8A 2ANBA 1HNXB 1PX2A 2WHPB 1NI4A 1XJ0A 2O1WA 3T7CA 4LY3A 2DZDA 1KH2A 2PY6A 4KXVA 4O59O 2BFOA 2GFQA 4YAFA 5BW8A 1G0NA 2BMEA 3DB2A 2E37A 2V5UA 2EZTA 3SHVA 3FUCA 1TCCA 1SUSA 3AJEA 1CNMA 4LYAA 5JVDB 3PD0A 4L9SA 2H0AA 3VGJA 5KNDD 3RTDA 1IZ8A 2BUCA 2ZRDA 3RUFA 1UK8A 4BNDB 4BO2A 5JY1A 1N5DA 1M5TA 4HTAA 1JF8A 3PD7A 1SBIA 1J22A 1ETUA 1QGAA 2DTDA 3QVGA 4LQDA 5B37A 4ENSA 5K0JA 3ND9A 1USIA 2BFCA 4R2KA 4F3TA 3PLNA 4XGQA 1Y8AA 1C7EA 4MB2A 4FDUA 4I4CA 4D9IA 2HFJA 4RWZA 1QHHB 3KUXA 4D4JA 4XLLA 5IC5A 2BSQA 4X8OA 5L3QA 5E9JA 3PUHA 4IV0A 1PJ3A 4B8WA 2BFBA 2I4MA 1Z4OA 4TMYA 4E0BA 1V7ZA 3NYQA 3EP6B 2CFOA 4RQBA 2YIJA 3H2HA 4FFWA 4EYSA 4E22A 4LJ9A 4JKOA 3ZGXA 3ER8A 1N6PA 1EJ0A 2ZVPX 1A2OA 4Q3KA 2VP4A 4AS2A 3RU7A 3ZGYA 3LX6A 5BSWA 2D74A 3M5WA 3P5SA 5DP2A 5LD2C 4HWKA 4JDPA 1QMHA 3C70A 3BD6A 1EBFA 2PFKA 2H7CA 3K9FC 1GFIA 3RROA 1XQVA 2AFIB 3PR1A 5DHAA 3ZJ5A 3ZI4A 5U9CA 2ICAA 4RD4A 4PQYA 5LQRA 3ZU3A 1I6MA 1YGPA 1OBFO 2E6KA 5JJLA 1CB7A 1Q0HA 1E3QA 5B3JA 3LMKA 1UKBA 4P7BA 1NUHA 3UJHA 4R1QA 3V8QA 2V6FA 4FNOA 1P91A 3VU9A 1R5NA 4BNVA 2XUQA 4XCXA 3HTXA 4H08A 4M53A 4R1MA 2GASA 1PV2A 1NMSA 3N2GA 3GCDA 2WIDA 3TLYA 5KTMA 1XLVA 5IAAA 4HLQB 4ZGWA 1TJ4A 3ZE1B 2C7GA 2P6MA 1VRCA 4GBMA 3U31A 5HIAA 3SDSA 4ZVMA 3HI4A 4EFMA 1U2PA 4OYHA 4DNXA 1UF9A 4D9GA 3GLGE 3A9TA 3K0CA 2PEYA 4CI9A 4TTIA 1HTWA 4INAA 4ROTA 3L7BA 3SZMA 3NORA 3TAXA 3CUKA 2OC4A 2OEPA 2Q8QA 4AZ3A 1UBOS 1YU6A 5ALOA 4ER0A 4QUAA 1DAPA 1GFWA 2BDUA 2YBDA 3LUPA 4OREX 4W7HA 4YJ2F 4YQFA 1TIBA 1JWLA 4QGHA 1S6YA 3CRMA 4NJMB 1WOYA 3TZBA 5BV7A 1L7DA 5IK2A 3LBYA 4FC7A 3TSOA 1Q16A 3AEZA 1G3UA 2WJPA 1VLZA 4B3DA 3HO1A 3VC3A 1TYZA 2E1RA 2PMKA 4IDCA 4UQOA 4CZ2A 5CIYA 4LG1A 1M34E 3GUUA 3L0DA 4HEJA 4PYMA 2X58A 3VUEA 2NUBA 4OI2A 4RK6A 1Z29A 5KQLA 1R66A 5DYGA 1DV2A 1ML4A 1U3FA 3Q8XB 1JJFA 2BF4A 4WEQA 3BULA 5CNJA 4DTCA 1XRQA 3IP5A 4PFQA 4Y2YA 2JIMA 2Z4SA 5ALYA 5BNIA 3HXMA 1J0CA 1AKUA 2Q6OA 4FSDA 2V7QA 3ORHA 3DD1A 3QTTA 4QLOA 3FFAA 4FX5A 4HNQA 4AKHA 1M1NB 2FUNB 4IDAA 4RY8A 4ZZ0A 1YJ5A 3DW3X 3F4BA 2R2AA 2JKVA 4JH0A 1IBRA 2O5RA 3EOBI 4A26A 1T2CA 4ZZ1A 1U3WA 1H8HA 4FEYA 4ZV9A 4I8XA 1R37A 3CTMA 4MCJA 4EWLA 1U6JA 4CQNA 4HDNA 5IJAA 3OHSX 4EFKA 1EVLA 3G0IA 2Y67A 4IX9A 5G1NA 1P0FA 4EHDA 2IS1A 4ZRDA 4QA9A 2VPXA 1G9SA 3ZCVA 3W5AA 4ZQBA 2FW7A 1NVWQ 3WLFA 2X77A 1B2RA 2HWKA 2ZJOA 3OLWA 2GRUA 1A8QA 1UZAA 2E3JA 3AJAA 3QSYA 2H63A 4JJKA 2R6ZA 4F60A 4H3VA 4C7MA 5A62A 1IBSA 1KH3A 4U2FA 5HW0A 3AI7A 3WO0A 1E6KA 1EQ2A 4HTFA 1MV5A 4AX8A 4IQ0A 3BRWA 1VECA 4M0FA 3RRXA 4TYMA 4D92A 5E3IA 4E15A 4D3XA 2WP8J 3N0XA 1E2EA 2PUBA 5CA1B 3RBZA 1CQJA 2J9FB 2JA1A 5GZ6A 3SQDA 2P8SA 2ZAIA 2O8DB 2GA9A 3VO2A 2LE0A 2WU8A 3O4FA 4MS1A 3UC5A 3R0QA 5DNYB 4BLWA 1U2GC 4GVLA 1L7OA 3VR6A 1GQOA 3NVDA 4PTLA 2HJRA 2CNWA 1Z4MA 2O23A 3ABQB 3F7OA 3KOXA 5B6IA 3DBRB 1ZD3A 1FLAA 1HTBA 3ODPA 2JF0A 4PRKA 4BRSA 1QJCA 4HGPA 1A9XA 2YFKA 1UFQA 4WGGA 4G6ZA 1XMXA 3VI4B 1H2WA 3C39A 1PZHA 4KLAA 4RF5A 3VR5H 2Q1WA 4N76A 4DQ0A 4FWTA 2CDCA 1LF5A 4EDFA 2UXCB 1T1RA 1BXKA 3E48A 1NAIA 1OI3A 4O29A 1VLLA 2ETXA 1AKWA 3R7AA 5IJZA 4LXYA 4MA0A 5A5EA 1Q91A 4KITB 4MUKA 4IDEA 3NBAA 3W9SA 1I2ZA 2VDRB 3LQ4A 2ZSKA 4KQCA 3PGLA 1WA5A 3LW8A 5FBWB 2LGJA 4XWOA 1YZLA 2G9ZA 2PX2A 3FHOA 3M6MD 4QVGA 4RSMA 4GMDA 5KOJB 3OZGA 3EGIA 2VJOA 2ZBPA 2Q0QA 2GGSA 5KBYA 3LP5A 1NVUQ 4J75A 1XP5A 3EP7B 1T2VA 3ZV4A 4XRGA 4PLPA 2W71A 5B58T 4QYTA 1PW7A 1I9GA 1YULA 1Z16A 4W9RA 4WJZA 2WD7B 2XNDD 2VLIA 4C43A 1CUZA 4MPPA 2AL7A 1EX6A 3IJRA 4LUCA 5T3YA 4K0KB 1SVNA 1R3DA 2WWTA 1YXMA 3I9V6 3EJWA 4WZAB 4RFVA 2WWXA 5EPEA 1W0KD 3ZIAD 2JIPA 2JGDB 2OB2A 4Y9DA 1K0UA 3E3NA 1GYPA 4OYRA 5CR9A 2DULA 3R5FA 3H6KA 5FIUA 2XWPA 5LVAA 1GDTA 4HV4A 2ZB2A 4BC1A 3BMNB 2E6UX 1QZUA 4KNWA 4QBKA 1FDSA 1P7WA 3LYUA 3WP0A 2XYHA 4TUYA 4B35A 4YS6A 2NP6A 1E5QA 2F55A 1Q0TA 1JMKC 3FW1A 3JWPA 4OY3A 4ZOEA 3P2IA 4X0EA 4JT8A 1KMHB 2EG9A 2BMVA 1XL0A 1XXLA 1GTVA 1ZPDA 2QJRA 1QYCA 1K3UB 1OWMA 3EF1A 3GIWA 3JQ6A 1YOVB 3MPUA 3EXEB 4FWIB 2CHEA 3B6JA 3JYPA 1MB3A 5H80A 1ZCBA 1ZAYA 4PY2A 1KPGA 2W43A 2OXCA 5LJLA 5SY6A 2O06A 3EC2A 4JUCA 4UULA 2VPTA 3UT0A 3ACDA 3ZWKA 5CB4B 2VOJA 2AV6A 3GU3A 4M87A 3SC2A 1YHNA 5HRCA 4LK2A 1G38A 1SBQA 2R6CA 2W6JD 3GNTA 4JX8A 4V0MA 3ACCA 2ZBVA 5LLSA 3AUFA 3OJEA 4UE2A 3U0VA 4FGZA 3QNWA 3NBMA 3SHWA 1MKYA 4R8MA 2A58A 2HXYA 5IN4A 2H07A 1VBKA 1E0JA 4D79A 3BE4A 4MR7B 2RK4A 3GNSA 4RKYA 3NCHA 1RRPA 4F4DA 1CDDA 1HFWA 4BIIA 3TW3A 4EHIA 3KOZA 4NHOA 3H7AA 4HGRA 3TR6A 4YV2A 2R2GA 4DT1B 5HQ3B 1C1DB 1G66A 3BRCA 1JSRA 3LL7A 5K0EA 1FYWA 2CVHA 1R8JA 4N65A 3V1TC 1I30A 4ZCSA 3UN1A 1CDOA 5IVIA 4IVQA 1EP1B 2ZQZA 3PDWA 2Z83A 1K9VF 4JJ6A 2WABA 2TMYA 4YJFB 1KBOA 1FYEA 4ZU6X 3RW9A 2GO1A 3EIQA 2WLSA 3LNCA 2VF8A 4KJXA 3ORYA 4AZ0B 3CB2A 4EFNA 2IK8A 3PE3A 4WJLA 5AVTA 5GJBA 3G0GA 3QBVA 1HT1E 2IZ6A 4RTLA 5I5GA 4A9AA 3ZUGA 1XLUA 4BB5A 5KI6A 1RBYA 2DFDA 3IDZA 1N5LA 3CZRA 4MUYA 2W2KA 4IX1A 3MA0A 4LSZA 4HNAA 1NXVA 3PDUA 4OATA 3K8YA 1E1RA 3HFRA 1E2HA 2B78A 3M4JA 3T7RA 1MQAA 3G49A 5J5CA 1ZBDA 1JZQA 5KWJA 1VLHA 4ZODA 3G5LA