1Q2YA

Crystal structure of the protein yjcf from bacillus subtilis: a member of the gcn5-related n-acetyltransferase superfamily fold
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
140
structure length
140
Chain Sequence
MKAVIAKNEEQLKDAFYVREEVFVKEQNVPAEEEIDELENESEHIVVYDGEKPVGAGRWRMKDGYGKLERICVLKSHRSAGVGGIIMKALEKAAADGGASGFILNAQTQAVPFYKKHGYRVLSEKEFLDAGIPHLQMMKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords similar to hypothetical proteins
publication title Crystal structure of the protein YJCF from Bacillus subtilis: a member of the GCN5-related N-acetyltransferase superfamily
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 39
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1q2yA00
1P4NA 5JPHA 1S7KA 1KUXA 4FD4A 4NXYA 2P0WA 5IV0A 3CXPA 3F8KA 2I00A 4PK2A 5H86A 3FBUA 4CAVA 2BUEA 2P6EA 1Z4RA 3TE4A 5F47A 5GCNA 1PU9A 2A4NA 3EO4A 5EBVA 4L8AA 4KUAA 4Y49C 3TTHA 2VI7A 4X5KA 3W6SA 3T90A 3R9EA 3I3GA 4LX9A 5IX3A 3KKWA 2GE3A 1IYLA 1PUAA 3QAHA 2ZXVA 4IUSA 3TOBA 2R98A 4CRYB 4ORFA 1M44A 4XNHC 2OZUA 4CAWA 4MBUA 3PZJA 3V8IA 3TCVA 2G3AA 3GY9A 3FB3A 4NCZA 3P2HA 1N71A 2O28A 4LUAA 1Z9UA 3TO6A 1YK3A 3FRMA 2Z0ZA 2FIWA 5HMNA 1M4IA 2HQYA 1YGHA 4HNWB 3LODA 4KVOE 3B8GA 2Q44A 4U5YA 5HH1A 2FT0A 1M4GA 2PC1A 4HKFA 1WK4A 2IL4A 3PGPA 4E8OA 1IIDA 2NMTA 2EVNA 2R7HA 2VQYA 4MHDA 5C88A 3IWGA 1M4DA 4YGOA 1TIQA 4NEXA 1CJWA 4KUBA 4KOSA 5DWMA 1CM0A 4OAEA 2AJ6A 3TO7A 3R9FA 5E96A 3WR7A 3FNCA 3EXNA 2PSWA 2FCKA 4UWJA 3CXQA 5C82A 1YLEA 2J8MA 2Z11A 4AVCA 2FE7A 2JDCA 4AVBA 2Q04A 4R3KA 2FSRA 2FIAA 1XE4A 2QECA 3DR6A 2FS5A 5ISVA 1Y7RA 3W91A 4B5PB 3D2PA 2PDOA 3IGRA 1R57A 3FIXA 1RXTA 4U9YA 3CXSA 5KTDA 3TFYA 3LD2A 1Q2DA 1SQHA 4XPLA 4BMHA 3EC4A 4CAXA 2Q4YA 1MJBA 2ZPAA 4XPKA 3N7ZA 2B5GA 1S60A 3G3SA 5JQ4A 4PV6A 4H6UA 4FD7A 1QSTA 3DR8A 3F0AA 2G0BA 1I21A 1P0HA 1Y9WA 1MJAA 4XPDB 3ZJ0A 4KOVA 4AG9A 1Z4EA 2P6GA 5I0CA 4I49A 4E0AA 5F49A 1YVKA 4AG7A 2H5MA 4II9A 2Q7BA 3MGDA 4J3GA 1S5KA 3BLNA 2J8RA 4HNYB 3RYOA 1RO5A 4F6AA 3G8WA 2B3VA 2REEA 2Q4VA 4PK3A 3DDDA 4MJ8A 2OU2A 3H4QA 1KUYA 4NF1A 2OB0A 3BJ8A 2B5GB 1Q2CA 3W6XA 1IB1E 2PR1A 2X7BA 2EUIA 3UY5A 4EVYA 2QMLA 4U9ZA 2F5IA 4FD5A 1Y9KA 5CNPA 2ARHA 4B5OA 2B3UA 4B5PA 2VBQA 3FXTA 4JLYA 2K5TA 1WWZA 2BL1A 3P2FA 5J8FA 4XNHB 4PSXA 2VZYA 4JD6A 4IF5A 2JDDA 4NSQA 4CS0B 3D8PA 3PP9A 3S6KA 5J8CA 3ZZIA 2Y0MA 1YREA 1VHSA 1U6MA 4KLVA 2R1IA 4R3LA 2P6FA 2CNSA 3T9YA 1QSRA 2FL4A 4R57A 5H84A 1LRZA 3F5BA 4MI4A 4QC6A 4R9MA 4RI1A 4UWIA 4H6ZA 3K9UA 4QVTA 1XMTA 1GHEA 3D3SA 2KCWA 4YRHA 1L0CA 2R8VA 4CRZB 2B58A 1VKCA 3JUWA 2ATRA 4UA3A 4M3SA 3TOAA 1QSNA 2ZW4A 2BEIA 1I12A 5EC4A 2GIVA 4OLLA 3R96A 2CY2A 2VZZA 1Q2YA 2PR8A 4KOTA 2OZHA 4M85A 1MJ9A 4PSWA 4JXQA 1B87A 3OWCA 4KOYA 1J4JA 2BSWA 5FVJA 1S7LA 2DXQA 1B6BA 1BO4A 1FY7A 2JLMA 2RC4A 3DSBA 4UBRA 3SHPA 4JXRA 3SXNA 5KTCA 2PQ8A 2VXKA 1S7NA 2C27A 2ZW5A 4KLWA 2I79A 1YR0A 4OADA 2GANA 3S6HA 1IYKA 4HNXB 3R95A 1QSOA 4KOWA 4L89A 1NMTA 2QIRA 1S7FA 1KZFA 4DNCA 1BOBA 4MY3A 4JJXA 4ONUA 1XEBA 1XF8A 5DWNA 3FYNA 3S6FA 4QB9A 2D4OA 1YVOA 2Q0YA 1XIXA 3NE7A 4Y49B 1V0CA 3R1KA 3GYAA 3S6GA 3EFAA 3VWEA 2JEVA 4R87A 2WPXA 2Z10A 1IICA 2OH1A 3JVNA 4QUSA 3SXOA 4KOUA 3R9GA 5KTAA 4GS4A 2B4DA 4KVME 2D4PA 2CNTA 4FD6A 4H89A 4MY0A 4KZTA 2WPWA 2VEZA 1QSMA 2J8NA 1S3ZA 4AVAA 5F48A 4YFJA 4QBJA 4JWPA 1KUVA 4K30A 3QB8A 4F0YA 4KORA 2PRBA 1OZPA 2ZW6A 2B4BA 3BJ7A 4KVXA 3EY5A 4RS2A 1ON0A 1UFHA 2AE6A 2HUZA 1M1DA 1I1DA 2REFA 1YX0A 3TO9A 5IB0A 1MK4A 3C26A 3VWDA 4KOXA 2B4DB 3D2MA 4AB7A 5F46A 3DNSA 2HV2A 3TT2A 2FXFA 3I9SA 2ZW7A 3GKRA 4XPDC 3E0KA 1NSLA 4ZBGA 2CNMA 1NE9A 2G3TA 1K4JA 2OZGA 4E2AA
chains in the Genus database with same CATH superfamily
3BHXA 1P4NA 5JPHA 1S7KA 1KUXA 3KGQA 4FD4A 4NXYA 4EMEA 2P0WA 4MMOA 3D67A 1LANA 3CXPA 5ELYA 5IV0A 3F8KA 2I00A 5A28A 3WT4A 4PK2A 1ELLP 5H86A 3SI2A 3FBUA 4CAVA 5JM6A 2YNCA 2BUEA 2OOTA 3DGVA 4CAEA 2P6EA 1Z4RA 2C6CA 3TE4A 5F47A 5GCNA 4O23A 1ZLIA 1PU9A 2A4NA 2ZOFA 4KS9A 3EO4A 5EBVA 4M6GA 4CGNA 2RB7A 2Z3NA 4P4FA 2Z3MA 4L8AA 4CGLA 3KZWA 4C7IA 3SJGA 4KUAA 4Y49C 1CG2A 5AG5A 3TTHA 2VI7A 4X5KA 2ZEDA 3W6SA 3T90A 3R9EA 4MHYA 4A39A 3WC7A 3LMSA 1R3NA 2RFHA 3I3GA 4LX9A 5IX3A 4WWVA 3H8FA 4F9VA 5AGEA 4MFLA 2PCUA 3KKWA 2GE3A 1IYLA 1PUAA 3QAHA 1JWQA 2ZXVA 4IUSA 3TOBA 2R98A 3N5FA 4FAIA 4CRYB 4ORFA 1M44A 2PJ0A 4XNHC 4B13A 2OZUA 3NH4A 4CAWA 3IIBA 4A31A 4MBUA 1Z2LA 2ZENA 4B14A 4CGMA 3PZJA 3V8IA 3QAYA 3TCVA 2PJ2A 2G3AA 1F57A 4LQ6A 3GY9A 3FB3A 4NCZA 3NH8A 3RZAA 4NGPA 1YW4A 2PJ1A 4NGNA 3TC8A 4NFRA 3P2HA 4UFWA 1TKHA 1N71A 2XEGA 2GFQA 1CX8A 2O28A 3CT9A 4F8ZA 2GLJA 1XRYA 4LUAA 4P44A 3FEDA 2V77A 4ZGYB 4CGPA 1Z9UA 3TO6A 1YK3A 3FRMA 2Z0ZA 2FIWA 3D4UA 4OC4A 1NSAA 5JH9A 2HB6A 1M4IA 5HMNA 5I4MA 2HQYA 3TX8A 1YGHA 4HNWB 3LODA 4KVOE 3B8GA 1XJOA 1F2PA 5G20A 1DE4C 2Q44A 4U5YA 4MHNA 5HH1A 2FT0A 1TKJA 1M4GA 1JQGA 2PC1A 4HKFA 1LFWA 1WK4A 2IL4A 4NGMA 3PGPA 4E8OA 1IIDA 3FMCA 4EFDA 4AXVA 2NMTA 3CDXA 2AFUA 3D7GA 2EVNA 2R7HA 2VQYA 4MHDA 1R43A 4B10A 1TF9A 5C88A 2HC9A 3IWGA 1M4DA 2WSAA 3CPAA 4YGOA 1RTQA 2EK9A 5K8MA 4KSIA 4MFJA 1TIQA 3L2NA 1CJWA 4KUBA 4KOSA 4NEXA 4OC0A 5DWMA 4ZX8A 1X10A 3B7IA 5HVGA 2WYRA 1Z8XA 2PJCA 1ZG9A 4YWYA 1CM0A 4OAEA 1CPSA 2AJ6A 3TO7A 3R9FA 2C1CA 3FECA 2I3CA 4G1PA 5E96A 1UWYA 5LRKA 3WR7A 2Q51A 4OC3A 3FNCA 3IFEA 3VATA 1XBUA 4IHMA 3EXNA 2PSWA 2FCKA 4UWJA 1ARMA 3CXQA 5C82A 2AFXA 4CYPA 1YLEA 1IY7A 2GREA 2J8MA 1LAPA 1PYTB 2Z11A 3S9LA 2BCOA 4AVCA 2FE7A 2JDCA 3V7ZA 2Z3LA 1VGYA 3H5ZA 4AVBA 2Q04A 4R3KA 4FBEA 2FSRA 5LYLA 2FIAA 1XE4A 2QECA 3DR6A 5K8OA 5K8NA 3QNVA 1HEEA 2ABZA 2FS5A 4ZI6A 5ISVA 1Y7RA 3W91A 8CPAA 4B5PB 1LCPA 3D2PA 3FH4A 2PDOA 3IGRA 1TF8A 1R57A 3B35A 3B3VA 3FIXA 3IJ3A 2PIYA 3A9LA 1RXTA 3PB8X 4PQAA 3CXSA 4ONWA 4U9YA 5KTDA 3TFYA 1YLOA 4NJRA 3LD2A 2PRQA 4RN7A 4X8IA 1Q2DA 1SQHA 4XPLA 1YW6A 5G22A 4BMHA 4CYQA 4OC1A 3S9MA 4ZYQA 4UEZA 2PJ7A 2AFZA 1Y7EA 3EC4A 2Q4ZA 3HLPA 1EE3P 4CAXA 2POKA 2Q4YA 2WUUA 3PRTA 4PXCA 1MJBA 1OBRA 2ZPAA 4XPKA 2JEWA 3N7ZA 2B5GA 5EMIA 1S60A 2XEIA 3G3SA 5JQ4A 4PV6A 5JGFA 1TXRA 3SI0A 2Z3PA 4H6UA 3SI1A 1YSJA 1QSTA 4FD7A 3IU2A 4MFPA 2ZEFA 1XFOA 4A94A 2CTCA 2EWBA 2V8HA 3DR8A 3F0AA 3JRUA 2G0BA 4DYOA 4MFQA 4H2KA 4PPZA 1I21A 1P0HA 3VARA 1Y9WA 1BPMA 1MJAA 5K8PA 4A95A 3LWUA 4XPDB 3ZJ0A 3PBBA 4ZY2A 2PE3A 2YNCC 4KOVA 4M6HA 2ZEOA 2EK8A 2V8DA 4AG9A 1Z4EA 4P4BA 2EO8A 2FVGA 2PJ9A 5D29A 5LRJA 2P6GA 4M6IA 5I0CA 2OR4A 4I49A 4C68A 4E0AA 4X2TA 4Z65A 1CP6A 5F49A 1YVKA 3BXMA 2H5MA 1CPXA 4AG7A 4II9A 2Q7BA 3MGDA 4J3GA 1S5KA 4C2YA 3BLNA 4IAVA 2J8RA 4NGQA 2WZNA 4HNYB 5G21A 4UFVA 3FJUA 4KSAA 3RYOA 1RO5A 4LQGA 4MXUA 4F6AA 3G8WA 3KI9A 2B3VA 2REEA 2Q4VA 4EWTA 1IU8A 4PK3A 1ELMP 3DDDA 2OU2A 4MJ8A 3H4QA 1KUYA 5F09A 4NF1A 2OB0A 4R8FA 5A27A 3BJ8A 4UF4A 2B5GB 1Q2CA 3KHZA 3NFZA 4RUHA 1Y0YA 4MCRA 1IB1E 2PR1A 3W6XA 2X7BA 3IEHA 1QMUA 3GB0A 4UFXA 2EUIA 2F7VA 3B2YA 5LYDA 1CP7A 3MN8A 3UY5A 4EVYA 1BLLE 4HPSA 4A2ZA 2QMLA 5AG6A 3B3WA 1M4LA 4U9ZA 2Q7SA 2F5IA 4A38A 3PB7X 4FD5A 1Y9KA 1Z8LA 5CNPA 5CBMA 3SJXA 2ARHA 4B5OA 2B3UA 4P4EA 4B5PA 4P4DA 2VBQA 3FXTA 4JLYA 4NGRA 3WABA 2ZEHA 4P4JA 2BO9A 2PJ3A 3CPXA 2PJ5A 1QQ9A 2K5TA 3RNZA 1AYEA 1WWZA 2BL1A 4UEFA 3P2FA 3KR4A 4P6YA 4OIDA 5J8FA 4F9UA 4XNHB 7CPAA 3BI0A 4OMEA 2JBKA 3IWWA 5IB9A 4IK2A 4PSXA 2VZYA 4ZX9A 1VHEA 3RO0A 1Z8TA 3KHXA 4JD6A 2CIJA 2QYVA 1IOFA 4IF5A 2JDDA 3KASA 1ZG8A 2YNDA 3CZXA 4NSQA 1BPNA 3D8PA 5DS0A 4CS0B 3PP9A 2GU2A 3GIUA 4OIWA 2DF5A 3S6KA 5J8CA 3ISZA 3ZZIA 3D7FA 2Y0MA 1YREA 1VHSA 3DLJA 1U6MA 4KLVA 1AMPA 2R1IA 2P6FA 2CNSA 4R3LA 4UIAA 3T9YA 2G9DA 2QJ8A 2JBJA 1QSRA 3WC5A 3SJFA 4MCQA 2FL4A 2ZEGA 4R57A 2EBJA 5H84A 3VH9A 1LRZA 2XEFA 2PJ8A 4TNUA 4B11A 3F5BA 4MI4A 4QC6A 4R9MA 4RI1A 4UWIA 4DUKA 5AG4A 3D68A 4H6ZA 3K9UA 4QVTA 1GHEA 1XMTA 3D3SA 4Q38A 2KCWA 4YRHA 1L0CA 3PEIA 5D8NA 2R8VA 2GLFA 1GYTA 4B6ZA 1YQEA 2B58A 4CRZB 1VKCA 3JUWA 2ATRA 4UA3A 2PJBA 4P4IA 4M3SA 3TOAA 1QSNA 4C2XA 2ZW4A 4B12A 4CYNA 2BEIA 1I12A 5EC4A 2GIVA 4MRIA 3NA6A 4A32A 2ZELA 2C6GA 4OLLA 2CTBA 5LYFA 3R96A 2CY2A 2VZZA 1FNOA 1Q2YA 2PR8A 2YGWA 4KOTA 4MFKA 4R6TA 1ZLHA 2OZHA 3B3TA 4M85A 4Q7AA 4A37A 1MJ9A 3FVLA 3KQZA 4PSWA 4JXQA 3B3SA 1B87A 3OWCA 5CPAA 1VIXA 4KOYA 5LYIA 1J4JA 1F2OA 2BSWA 3JTKA 5FVJA 5HXDA 4NGSA 4UCNA 1S7LA 1LAMA 2Z3KA 4CPAA 1IOIA 4MHPA 4F0XA 2F8HA 1KWMA 2DXQA 1B6BA 1BO4A 1FY7A 1H8LA 2JLMA 2ODFA 2RC4A 3BI1A 3DSBA 3ISXA 2BOAA 4TWEA 1TKFA 1X12A 1ARLA 1Y0RA 4PXEA 4BD9A 4UBRA 3NE8A 2O4HA 3SHPA 4JXRA 2PVWA 3SXNA 5KTCA 2PQ8A 4DJLA 2DEAA 2VXKA 2PJAA 1S7NA 2C27A 2PJ6A 4OKOA 2ZW5A 3GLJA 2I79A 1YR0A 2YNEA 4KLWA 4MCPA 3D7HA 4OADA 2GANA 4MHZA 4CAFA 4CGOA 3K2KA 3S6HA 3D66A 1IYKA 4HNXB 3R95A 1QSOA 4KOWA 3PB4X 4L89A 1NMTA 2QIRA 2AFWA 1S7FA 1YMEA 2IMOA 3RAMA 1BAVA 1KZFA 4DNCA 1BOBA 4MY3A 4JJXA 5BWAB 3S9NA 3IU1A 3PB6X 4ONUA 1XOVA 4OC2A 4P10A 1XEBA 4CYOA 3I1UA 1XF8A 5DWNA 3FYNA 3S6FA 4QB9A 4A33A 1Q7LA 2CF4A 2D4OA 1YVOA 2Q0YA 2NSMA 1HDUA 1XIXA 3HUVA 3NE7A 4GM5A 2NYQA 4Y49B 1V0CA 3GUXA 3R1KA 4X3RA 4BBHA 2IQ6A 3GYAA 3S6GA 4BINA 4MFZA 3EFAA 4MCSA 3VWEA 2JEVA 4R87A 2WPXA 2Z10A 3KR5A 4A30A 1IICA 2OH1A 3JVNA 4QUSA 3SXOA 4KOUA 2ANPA 3R9GA 2J9AA 5KTAA 3FX6A 2Z3OA 2QVPA 3PFEA 4ZY0A 4GS4A 4FUUA 2B4DA 4KVME 2D4PA 4C7HA 4ZY1A 2CNTA 2DPSA 4UCPA 1DTDA 4FD6A 4H89A 3KL9A 4MY0A 4R7MA 5HVFA 1ZG7A 4KZTA 1Z5RA 2WPWA 2VEZA 4YU9A 1QSMA 2J8NA 1ZO0A 4NJQA 6CPAA 5J1QA 3V38A 1S3ZA 4AVAA 4WJBA 3PBEA 3IWEA 2ZEMA 5F48A 4YFJA 2C6PA 4QBJA 1LOKA 1Z8WA 4JYWA 4PXBA 4JWPA 1CBXA 1KUVA 4K30A 4NGTA 3QB8A 4F0YA 3K9TA 3PFOA 5THWA 4KORA 2O53A 2AFSA 1OZPA 2PJ4A 2PRBA 2ZW6A 4JZ0A 2XEJA 3IC1A 4OP4A 2B4BA 2V8GA 1IGBA 3BJ7A 4KVXA 1VHOA 3EY5A 4RS2A 2DPTA 3RBUA 1ON0A 1XMBA 1UFHA 4GXHA 4Q36A 2AE6A 2HUZA 5AG7A 3PB9X 1M1DA 1I1DA 2REFA 4UCMA 1YX0A 4K3NA 3TO9A 2CXAA 3KQXA 2PVVA 5IB0A 1MK4A 3FF3A 4P45A 5HVHA 1FT7A 2IJZA 2PIZA 3C26A 4C2ZA 4PXDA 3H8EA 2VL1A 3SJEA 3VWDA 4UEEA 4KOXA 1A2ZA 2B4DB 3D2MA 4AB7A 3MRUA 4FWUA 5G1ZA 5F46A 2AFMA 3DNSA 2ZOGA 2HV2A 3WC6A 4UIBA 3TT2A 2FXFA 3I9SA 2ZW7A 3GKRA 1AUGA 4XPDC 4KSFA 4W9YA 3B3CA 5LRGA 1PCAA 3E0KA 3IO1A 2ZEPA 2ZEEA 3LACA 2Q43A 3D7DA 4R76A 4ZBGA 1NSLA 2CNMA 3NH5A 1NE9A 3H8GA 4OC5A 3T8WA 2G3TA 2AFOA 1K4JA 2OZGA 2V8VA 4E2AA 1HDQA 3FEEA
chains in the Genus database with same CATH topology
1P4NA 5JPHA 1S7KA 1KUXA 4FD4A 4NXYA 2P0WA 5IV0A 3CXPA 3F8KA 2I00A 5A28A 4PK2A 5H86A 3FBUA 4CAVA 2YNCA 2BUEA 4CAEA 2P6EA 1Z4RA 3TE4A 5F47A 5GCNA 1PU9A 2A4NA 4KS9A 3EO4A 5EBVA 4CGNA 2Z3NA 2Z3MA 4L8AA 4CGLA 4C7IA 4KUAA 4Y49C 5AG5A 3TTHA 2VI7A 4X5KA 3W6SA 3T90A 3R9EA 3I3GA 4LX9A 5IX3A 5AGEA 4MFLA 3KKWA 2GE3A 1IYLA 1PUAA 3QAHA 2ZXVA 4IUSA 3TOBA 2R98A 4CRYB 4ORFA 1M44A 4XNHC 4B13A 2OZUA 4CAWA 4A31A 4MBUA 4B14A 4CGMA 3PZJA 3V8IA 3TCVA 2G3AA 3GY9A 3FB3A 4NCZA 3P2HA 4UFWA 1N71A 2O28A 4LUAA 4ZGYB 4CGPA 1Z9UA 3TO6A 3FRMA 1YK3A 2Z0ZA 2FIWA 5HMNA 1M4IA 2HQYA 1YGHA 4HNWB 3LODA 4KVOE 3B8GA 5G20A 2Q44A 4U5YA 5HH1A 2FT0A 1M4GA 2PC1A 4HKFA 1WK4A 2IL4A 3PGPA 4E8OA 1IIDA 2NMTA 2EVNA 2R7HA 2VQYA 4MHDA 4B10A 5C88A 3IWGA 1M4DA 2WSAA 4YGOA 4MFJA 1TIQA 4NEXA 1CJWA 4KUBA 4KOSA 5DWMA 1CM0A 4OAEA 2AJ6A 3TO7A 3R9FA 5E96A 3WR7A 3FNCA 3EXNA 2PSWA 2FCKA 4UWJA 3CXQA 5C82A 4CYPA 1YLEA 2J8MA 2Z11A 4AVCA 2FE7A 2JDCA 2Z3LA 3H5ZA 4AVBA 2Q04A 4R3KA 2FSRA 2FIAA 1XE4A 2QECA 3DR6A 2FS5A 5ISVA 1Y7RA 3W91A 4B5PB 3D2PA 2PDOA 3IGRA 1R57A 3FIXA 3A9LA 1RXTA 4U9YA 3CXSA 5KTDA 3TFYA 3LD2A 4CYQA 1Q2DA 1SQHA 4XPLA 5G22A 4BMHA 3EC4A 4CAXA 2Q4YA 2WUUA 1MJBA 2ZPAA 4XPKA 3N7ZA 2B5GA 1S60A 3G3SA 5JQ4A 4PV6A 2Z3PA 4H6UA 4FD7A 1QSTA 3IU2A 4MFPA 3DR8A 3F0AA 2G0BA 4MFQA 1I21A 1P0HA 1Y9WA 1MJAA 4A95A 4XPDB 3ZJ0A 2YNCC 4KOVA 4AG9A 1Z4EA 2P6GA 5I0CA 4I49A 4C68A 4E0AA 5F49A 1YVKA 4AG7A 2H5MA 4II9A 2Q7BA 3MGDA 4J3GA 1S5KA 4C2YA 3BLNA 2J8RA 4HNYB 5G21A 4UFVA 4KSAA 3RYOA 1RO5A 4F6AA 3G8WA 2B3VA 2REEA 2Q4VA 4PK3A 3DDDA 4MJ8A 2OU2A 3H4QA 1KUYA 4NF1A 2OB0A 5A27A 3BJ8A 2B5GB 1Q2CA 3W6XA 1IB1E 2PR1A 2X7BA 4UFXA 2EUIA 3UY5A 4EVYA 4A2ZA 2QMLA 5AG6A 4U9ZA 2F5IA 4FD5A 1Y9KA 5CNPA 2ARHA 4B5OA 2B3UA 4B5PA 2VBQA 3FXTA 4JLYA 2K5TA 1WWZA 2BL1A 3P2FA 5J8FA 4XNHB 4PSXA 2VZYA 4JD6A 4IF5A 2JDDA 2YNDA 4NSQA 4CS0B 3D8PA 3PP9A 3S6KA 5J8CA 3ZZIA 2Y0MA 1YREA 1VHSA 1U6MA 4KLVA 2R1IA 4R3LA 2P6FA 2CNSA 3T9YA 1QSRA 2FL4A 4R57A 5H84A 1LRZA 4B11A 3F5BA 4MI4A 4QC6A 4R9MA 4RI1A 4UWIA 5AG4A 4H6ZA 3K9UA 4QVTA 1XMTA 1GHEA 3D3SA 4Q38A 2KCWA 4YRHA 1L0CA 2R8VA 4CRZB 2B58A 1VKCA 3JUWA 2ATRA 4UA3A 4M3SA 3TOAA 1QSNA 4C2XA 2ZW4A 4B12A 4CYNA 2BEIA 1I12A 5EC4A 2GIVA 4A32A 4OLLA 3R96A 2CY2A 2VZZA 2YGWA 1Q2YA 2PR8A 4KOTA 4MFKA 2OZHA 4M85A 1MJ9A 4PSWA 4JXQA 1B87A 3OWCA 4KOYA 1J4JA 2BSWA 3JTKA 5FVJA 4UCNA 1S7LA 2Z3KA 4F0XA 2DXQA 1B6BA 1BO4A 1FY7A 2JLMA 2RC4A 3DSBA 4UBRA 3SHPA 4JXRA 3SXNA 5KTCA 2PQ8A 2VXKA 1S7NA 2C27A 2ZW5A 4KLWA 2I79A 1YR0A 2YNEA 4OADA 2GANA 4CAFA 4CGOA 3S6HA 1IYKA 4HNXB 3R95A 1QSOA 4KOWA 4L89A 1NMTA 2QIRA 1S7FA 1KZFA 4DNCA 1BOBA 4MY3A 4JJXA 5BWAB 3IU1A 4ONUA 1XEBA 4CYOA 1XF8A 5DWNA 3FYNA 3S6FA 4QB9A 4A33A 2D4OA 1YVOA 2Q0YA 1XIXA 3NE7A 4Y49B 1V0CA 3R1KA 4BBHA 3GYAA 3S6GA 4MFZA 3EFAA 3VWEA 2JEVA 4R87A 2WPXA 2Z10A 4A30A 1IICA 2OH1A 3JVNA 4QUSA 3SXOA 4KOUA 3R9GA 5KTAA 2Z3OA 4GS4A 2B4DA 4KVME 2D4PA 4C7HA 2CNTA 2DPSA 4UCPA 4FD6A 4H89A 4MY0A 4KZTA 2WPWA 2VEZA 1QSMA 2J8NA 1ZO0A 1S3ZA 4AVAA 3IWEA 5F48A 4YFJA 4QBJA 4JWPA 1KUVA 4K30A 3QB8A 4F0YA 4KORA 2PRBA 1OZPA 2ZW6A 2B4BA 3BJ7A 4KVXA 3EY5A 4RS2A 2DPTA 1ON0A 1UFHA 4Q36A 2AE6A 2HUZA 5AG7A 1M1DA 1I1DA 2REFA 4UCMA 1YX0A 3TO9A 2CXAA 5IB0A 1MK4A 3C26A 4C2ZA 3VWDA 4KOXA 2B4DB 3D2MA 4AB7A 5G1ZA 5F46A 3DNSA 2HV2A 3TT2A 2FXFA 3I9SA 2ZW7A 3GKRA 4XPDC 4KSFA 3E0KA 1NSLA 4ZBGA 2CNMA 1NE9A 2G3TA 1K4JA 2OZGA 4E2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P4N A;  5JPH A;  1S7K A;  1KUX A;  4FD4 A;  4NXY A;  2P0W A;  5IV0 A;  3CXP A;  3F8K A;  2I00 A;  4PK2 A;  5H86 A;  3FBU A;  4CAV A;  2BUE A;  2P6E A;  1Z4R A;  3TE4 A;  5F47 A;  5GCN A;  1PU9 A;  2A4N A;  3EO4 A;  5EBV A;  4L8A A;  4KUA A;  4Y49 C;  3TTH A;  2VI7 A;  4X5K A;  3W6S A;  3T90 A;  3R9E A;  3I3G A;  4LX9 A;  5IX3 A;  3KKW A;  2GE3 A;  1IYL A;  1PUA A;  3QAH A;  2ZXV A;  4IUS A;  3TOB A;  2R98 A;  4CRY B;  4ORF A;  1M44 A;  4XNH C;  2OZU A;  4CAW A;  4MBU A;  3PZJ A;  3V8I A;  3TCV A;  2G3A A;  3GY9 A;  3FB3 A;  4NCZ A;  3P2H A;  1N71 A;  2O28 A;  4LUA A;  1Z9U A;  3TO6 A;  1YK3 A;  3FRM A;  2Z0Z A;  2FIW A;  5HMN A;  1M4I A;  2HQY A;  1YGH A;  4HNW B;  3LOD A;  4KVO E;  3B8G A;  2Q44 A;  4U5Y A;  5HH1 A;  2FT0 A;  1M4G A;  2PC1 A;  4HKF A;  1WK4 A;  2IL4 A;  3PGP A;  4E8O A;  1IID A;  2NMT A;  2EVN A;  2R7H A;  2VQY A;  4MHD A;  5C88 A;  3IWG A;  1M4D A;  4YGO A;  1TIQ A;  4NEX A;  1CJW A;  4KUB A;  4KOS A;  5DWM A;  1CM0 A;  4OAE A;  2AJ6 A;  3TO7 A;  3R9F A;  5E96 A;  3WR7 A;  3FNC A;  3EXN A;  2PSW A;  2FCK A;  4UWJ A;  3CXQ A;  5C82 A;  1YLE A;  2J8M A;  2Z11 A;  4AVC A;  2FE7 A;  2JDC A;  4AVB A;  2Q04 A;  4R3K A;  2FSR A;  2FIA A;  1XE4 A;  2QEC A;  3DR6 A;  2FS5 A;  5ISV A;  1Y7R A;  3W91 A;  4B5P B;  3D2P A;  2PDO A;  3IGR A;  1R57 A;  3FIX A;  1RXT A;  4U9Y A;  3CXS A;  5KTD A;  3TFY A;  3LD2 A;  1Q2D A;  1SQH A;  4XPL A;  4BMH A;  3EC4 A;  4CAX A;  2Q4Y A;  1MJB A;  2ZPA A;  4XPK A;  3N7Z A;  2B5G A;  1S60 A;  3G3S A;  5JQ4 A;  4PV6 A;  4H6U A;  4FD7 A;  1QST A;  3DR8 A;  3F0A A;  2G0B A;  1I21 A;  1P0H A;  1Y9W A;  1MJA A;  4XPD B;  3ZJ0 A;  4KOV A;  4AG9 A;  1Z4E A;  2P6G A;  5I0C A;  4I49 A;  4E0A A;  5F49 A;  1YVK A;  4AG7 A;  2H5M A;  4II9 A;  2Q7B A;  3MGD A;  4J3G A;  1S5K A;  3BLN A;  2J8R A;  4HNY B;  3RYO A;  1RO5 A;  4F6A A;  3G8W A;  2B3V A;  2REE A;  2Q4V A;  4PK3 A;  3DDD A;  4MJ8 A;  2OU2 A;  3H4Q A;  1KUY A;  4NF1 A;  2OB0 A;  3BJ8 A;  2B5G B;  1Q2C A;  3W6X A;  1IB1 E;  2PR1 A;  2X7B A;  2EUI A;  3UY5 A;  4EVY A;  2QML A;  4U9Z A;  2F5I A;  4FD5 A;  1Y9K A;  5CNP A;  2ARH A;  4B5O A;  2B3U A;  4B5P A;  2VBQ A;  3FXT A;  4JLY A;  2K5T A;  1WWZ A;  2BL1 A;  3P2F A;  5J8F A;  4XNH B;  4PSX A;  2VZY A;  4JD6 A;  4IF5 A;  2JDD A;  4NSQ A;  4CS0 B;  3D8P A;  3PP9 A;  3S6K A;  5J8C A;  3ZZI A;  2Y0M A;  1YRE A;  1VHS A;  1U6M A;  4KLV A;  2R1I A;  4R3L A;  2P6F A;  2CNS A;  3T9Y A;  1QSR A;  2FL4 A;  4R57 A;  5H84 A;  1LRZ A;  3F5B A;  4MI4 A;  4QC6 A;  4R9M A;  4RI1 A;  4UWI A;  4H6Z A;  3K9U A;  4QVT A;  1XMT A;  1GHE A;  3D3S A;  2KCW A;  4YRH A;  1L0C A;  2R8V A;  4CRZ B;  2B58 A;  1VKC A;  3JUW A;  2ATR A;  4UA3 A;  4M3S A;  3TOA A;  1QSN A;  2ZW4 A;  2BEI A;  1I12 A;  5EC4 A;  2GIV A;  4OLL A;  3R96 A;  2CY2 A;  2VZZ A;  1Q2Y A;  2PR8 A;  4KOT A;  2OZH A;  4M85 A;  1MJ9 A;  4PSW A;  4JXQ A;  1B87 A;  3OWC A;  4KOY A;  1J4J A;  2BSW A;  5FVJ A;  1S7L A;  2DXQ A;  1B6B A;  1BO4 A;  1FY7 A;  2JLM A;  2RC4 A;  3DSB A;  4UBR A;  3SHP A;  4JXR A;  3SXN A;  5KTC A;  2PQ8 A;  2VXK A;  1S7N A;  2C27 A;  2ZW5 A;  4KLW A;  2I79 A;  1YR0 A;  4OAD A;  2GAN A;  3S6H A;  1IYK A;  4HNX B;  3R95 A;  1QSO A;  4KOW A;  4L89 A;  1NMT A;  2QIR A;  1S7F A;  1KZF A;  4DNC A;  1BOB A;  4MY3 A;  4JJX A;  4ONU A;  1XEB A;  1XF8 A;  5DWN A;  3FYN A;  3S6F A;  4QB9 A;  2D4O A;  1YVO A;  2Q0Y A;  1XIX A;  3NE7 A;  4Y49 B;  1V0C A;  3R1K A;  3GYA A;  3S6G A;  3EFA A;  3VWE A;  2JEV A;  4R87 A;  2WPX A;  2Z10 A;  1IIC A;  2OH1 A;  3JVN A;  4QUS A;  3SXO A;  4KOU A;  3R9G A;  5KTA A;  4GS4 A;  2B4D A;  4KVM E;  2D4P A;  2CNT A;  4FD6 A;  4H89 A;  4MY0 A;  4KZT A;  2WPW A;  2VEZ A;  1QSM A;  2J8N A;  1S3Z A;  4AVA A;  5F48 A;  4YFJ A;  4QBJ A;  4JWP A;  1KUV A;  4K30 A;  3QB8 A;  4F0Y A;  4KOR A;  2PRB A;  1OZP A;  2ZW6 A;  2B4B A;  3BJ7 A;  4KVX A;  3EY5 A;  4RS2 A;  1ON0 A;  1UFH A;  2AE6 A;  2HUZ A;  1M1D A;  1I1D A;  2REF A;  1YX0 A;  3TO9 A;  5IB0 A;  1MK4 A;  3C26 A;  3VWD A;  4KOX A;  2B4D B;  3D2M A;  4AB7 A;  5F46 A;  3DNS A;  2HV2 A;  3TT2 A;  2FXF A;  3I9S A;  2ZW7 A;  3GKR A;  4XPD C;  3E0K A;  1NSL A;  4ZBG A;  2CNM A;  1NE9 A;  2G3T A;  1K4J A;  2OZG A;  4E2A A; 
#chains in the Genus database with same CATH topology
 3BHX A;  1P4N A;  5JPH A;  1S7K A;  1KUX A;  3KGQ A;  4FD4 A;  4NXY A;  4EME A;  2P0W A;  4MMO A;  3D67 A;  1LAN A;  3CXP A;  5ELY A;  5IV0 A;  3F8K A;  2I00 A;  5A28 A;  3WT4 A;  4PK2 A;  1ELL P;  5H86 A;  3SI2 A;  3FBU A;  4CAV A;  5JM6 A;  2YNC A;  2BUE A;  2OOT A;  3DGV A;  4CAE A;  2P6E A;  1Z4R A;  2C6C A;  3TE4 A;  5F47 A;  5GCN A;  4O23 A;  1ZLI A;  1PU9 A;  2A4N A;  2ZOF A;  4KS9 A;  3EO4 A;  5EBV A;  4M6G A;  4CGN A;  2RB7 A;  2Z3N A;  4P4F A;  2Z3M A;  4L8A A;  4CGL A;  3KZW A;  4C7I A;  3SJG A;  4KUA A;  4Y49 C;  1CG2 A;  5AG5 A;  3TTH A;  2VI7 A;  4X5K A;  2ZED A;  3W6S A;  3T90 A;  3R9E A;  4MHY A;  4A39 A;  3WC7 A;  3LMS A;  1R3N A;  2RFH A;  3I3G A;  4LX9 A;  5IX3 A;  4WWV A;  3H8F A;  4F9V A;  5AGE A;  4MFL A;  2PCU A;  3KKW A;  2GE3 A;  1IYL A;  1PUA A;  3QAH A;  1JWQ A;  2ZXV A;  4IUS A;  3TOB A;  2R98 A;  3N5F A;  4FAI A;  4CRY B;  4ORF A;  1M44 A;  2PJ0 A;  4XNH C;  4B13 A;  2OZU A;  3NH4 A;  4CAW A;  3IIB A;  4A31 A;  4MBU A;  1Z2L A;  2ZEN A;  4B14 A;  4CGM A;  3PZJ A;  3V8I A;  3QAY A;  3TCV A;  2PJ2 A;  2G3A A;  1F57 A;  4LQ6 A;  3GY9 A;  3FB3 A;  4NCZ A;  3NH8 A;  3RZA A;  4NGP A;  1YW4 A;  2PJ1 A;  4NGN A;  3TC8 A;  4NFR A;  3P2H A;  4UFW A;  1TKH A;  1N71 A;  2XEG A;  2GFQ A;  1CX8 A;  2O28 A;  3CT9 A;  4F8Z A;  2GLJ A;  1XRY A;  4LUA A;  4P44 A;  3FED A;  2V77 A;  4ZGY B;  4CGP A;  1Z9U A;  3TO6 A;  1YK3 A;  3FRM A;  2Z0Z A;  2FIW A;  3D4U A;  4OC4 A;  1NSA A;  5JH9 A;  2HB6 A;  1M4I A;  5HMN A;  5I4M A;  2HQY A;  3TX8 A;  1YGH A;  4HNW B;  3LOD A;  4KVO E;  3B8G A;  1XJO A;  1F2P A;  5G20 A;  1DE4 C;  2Q44 A;  4U5Y A;  4MHN A;  5HH1 A;  2FT0 A;  1TKJ A;  1M4G A;  1JQG A;  2PC1 A;  4HKF A;  1LFW A;  1WK4 A;  2IL4 A;  4NGM A;  3PGP A;  4E8O A;  1IID A;  3FMC A;  4EFD A;  4AXV A;  2NMT A;  3CDX A;  2AFU A;  3D7G A;  2EVN A;  2R7H A;  2VQY A;  4MHD A;  1R43 A;  4B10 A;  1TF9 A;  5C88 A;  2HC9 A;  3IWG A;  1M4D A;  2WSA A;  3CPA A;  4YGO A;  1RTQ A;  2EK9 A;  5K8M A;  4KSI A;  4MFJ A;  1TIQ A;  3L2N A;  1CJW A;  4KUB A;  4KOS A;  4NEX A;  4OC0 A;  5DWM A;  4ZX8 A;  1X10 A;  3B7I A;  5HVG A;  2WYR A;  1Z8X A;  2PJC A;  1ZG9 A;  4YWY A;  1CM0 A;  4OAE A;  1CPS A;  2AJ6 A;  3TO7 A;  3R9F A;  2C1C A;  3FEC A;  2I3C A;  4G1P A;  5E96 A;  1UWY A;  5LRK A;  3WR7 A;  2Q51 A;  4OC3 A;  3FNC A;  3IFE A;  3VAT A;  1XBU A;  4IHM A;  3EXN A;  2PSW A;  2FCK A;  4UWJ A;  1ARM A;  3CXQ A;  5C82 A;  2AFX A;  4CYP A;  1YLE A;  1IY7 A;  2GRE A;  2J8M A;  1LAP A;  1PYT B;  2Z11 A;  3S9L A;  2BCO A;  4AVC A;  2FE7 A;  2JDC A;  3V7Z A;  2Z3L A;  1VGY A;  3H5Z A;  4AVB A;  2Q04 A;  4R3K A;  4FBE A;  2FSR A;  5LYL A;  2FIA A;  1XE4 A;  2QEC A;  3DR6 A;  5K8O A;  5K8N A;  3QNV A;  1HEE A;  2ABZ A;  2FS5 A;  4ZI6 A;  5ISV A;  1Y7R A;  3W91 A;  8CPA A;  4B5P B;  1LCP A;  3D2P A;  3FH4 A;  2PDO A;  3IGR A;  1TF8 A;  1R57 A;  3B35 A;  3B3V A;  3FIX A;  3IJ3 A;  2PIY A;  3A9L A;  1RXT A;  3PB8 X;  4PQA A;  3CXS A;  4ONW A;  4U9Y A;  5KTD A;  3TFY A;  1YLO A;  4NJR A;  3LD2 A;  2PRQ A;  4RN7 A;  4X8I A;  1Q2D A;  1SQH A;  4XPL A;  1YW6 A;  5G22 A;  4BMH A;  4CYQ A;  4OC1 A;  3S9M A;  4ZYQ A;  4UEZ A;  2PJ7 A;  2AFZ A;  1Y7E A;  3EC4 A;  2Q4Z A;  3HLP A;  1EE3 P;  4CAX A;  2POK A;  2Q4Y A;  2WUU A;  3PRT A;  4PXC A;  1MJB A;  1OBR A;  2ZPA A;  4XPK A;  2JEW A;  3N7Z A;  2B5G A;  5EMI A;  1S60 A;  2XEI A;  3G3S A;  5JQ4 A;  4PV6 A;  5JGF A;  1TXR A;  3SI0 A;  2Z3P A;  4H6U A;  3SI1 A;  1YSJ A;  1QST A;  4FD7 A;  3IU2 A;  4MFP A;  2ZEF A;  1XFO A;  4A94 A;  2CTC A;  2EWB A;  2V8H A;  3DR8 A;  3F0A A;  3JRU A;  2G0B A;  4DYO A;  4MFQ A;  4H2K A;  4PPZ A;  1I21 A;  1P0H A;  3VAR A;  1Y9W A;  1BPM A;  1MJA A;  5K8P A;  4A95 A;  3LWU A;  4XPD B;  3ZJ0 A;  3PBB A;  4ZY2 A;  2PE3 A;  2YNC C;  4KOV A;  4M6H A;  2ZEO A;  2EK8 A;  2V8D A;  4AG9 A;  1Z4E A;  4P4B A;  2EO8 A;  2FVG A;  2PJ9 A;  5D29 A;  5LRJ A;  2P6G A;  4M6I A;  5I0C A;  2OR4 A;  4I49 A;  4C68 A;  4E0A A;  4X2T A;  4Z65 A;  1CP6 A;  5F49 A;  1YVK A;  3BXM A;  2H5M A;  1CPX A;  4AG7 A;  4II9 A;  2Q7B A;  3MGD A;  4J3G A;  1S5K A;  4C2Y A;  3BLN A;  4IAV A;  2J8R A;  4NGQ A;  2WZN A;  4HNY B;  5G21 A;  4UFV A;  3FJU A;  4KSA A;  3RYO A;  1RO5 A;  4LQG A;  4MXU A;  4F6A A;  3G8W A;  3KI9 A;  2B3V A;  2REE A;  2Q4V A;  4EWT A;  1IU8 A;  4PK3 A;  1ELM P;  3DDD A;  2OU2 A;  4MJ8 A;  3H4Q A;  1KUY A;  5F09 A;  4NF1 A;  2OB0 A;  4R8F A;  5A27 A;  3BJ8 A;  4UF4 A;  2B5G B;  1Q2C A;  3KHZ A;  3NFZ A;  4RUH A;  1Y0Y A;  4MCR A;  1IB1 E;  2PR1 A;  3W6X A;  2X7B A;  3IEH A;  1QMU A;  3GB0 A;  4UFX A;  2EUI A;  2F7V A;  3B2Y A;  5LYD A;  1CP7 A;  3MN8 A;  3UY5 A;  4EVY A;  1BLL E;  4HPS A;  4A2Z A;  2QML A;  5AG6 A;  3B3W A;  1M4L A;  4U9Z A;  2Q7S A;  2F5I A;  4A38 A;  3PB7 X;  4FD5 A;  1Y9K A;  1Z8L A;  5CNP A;  5CBM A;  3SJX A;  2ARH A;  4B5O A;  2B3U A;  4P4E A;  4B5P A;  4P4D A;  2VBQ A;  3FXT A;  4JLY A;  4NGR A;  3WAB A;  2ZEH A;  4P4J A;  2BO9 A;  2PJ3 A;  3CPX A;  2PJ5 A;  1QQ9 A;  2K5T A;  3RNZ A;  1AYE A;  1WWZ A;  2BL1 A;  4UEF A;  3P2F A;  3KR4 A;  4P6Y A;  4OID A;  5J8F A;  4F9U A;  4XNH B;  7CPA A;  3BI0 A;  4OME A;  2JBK A;  3IWW A;  5IB9 A;  4IK2 A;  4PSX A;  2VZY A;  4ZX9 A;  1VHE A;  3RO0 A;  1Z8T A;  3KHX A;  4JD6 A;  2CIJ A;  2QYV A;  1IOF A;  4IF5 A;  2JDD A;  3KAS A;  1ZG8 A;  2YND A;  3CZX A;  4NSQ A;  1BPN A;  3D8P A;  5DS0 A;  4CS0 B;  3PP9 A;  2GU2 A;  3GIU A;  4OIW A;  2DF5 A;  3S6K A;  5J8C A;  3ISZ A;  3ZZI A;  3D7F A;  2Y0M A;  1YRE A;  1VHS A;  3DLJ A;  1U6M A;  4KLV A;  1AMP A;  2R1I A;  2P6F A;  2CNS A;  4R3L A;  4UIA A;  3T9Y A;  2G9D A;  2QJ8 A;  2JBJ A;  1QSR A;  3WC5 A;  3SJF A;  4MCQ A;  2FL4 A;  2ZEG A;  4R57 A;  2EBJ A;  5H84 A;  3VH9 A;  1LRZ A;  2XEF A;  2PJ8 A;  4TNU A;  4B11 A;  3F5B A;  4MI4 A;  4QC6 A;  4R9M A;  4RI1 A;  4UWI A;  4DUK A;  5AG4 A;  3D68 A;  4H6Z A;  3K9U A;  4QVT A;  1GHE A;  1XMT A;  3D3S A;  4Q38 A;  2KCW A;  4YRH A;  1L0C A;  3PEI A;  5D8N A;  2R8V A;  2GLF A;  1GYT A;  4B6Z A;  1YQE A;  2B58 A;  4CRZ B;  1VKC A;  3JUW A;  2ATR A;  4UA3 A;  2PJB A;  4P4I A;  4M3S A;  3TOA A;  1QSN A;  4C2X A;  2ZW4 A;  4B12 A;  4CYN A;  2BEI A;  1I12 A;  5EC4 A;  2GIV A;  4MRI A;  3NA6 A;  4A32 A;  2ZEL A;  2C6G A;  4OLL A;  2CTB A;  5LYF A;  3R96 A;  2CY2 A;  2VZZ A;  1FNO A;  1Q2Y A;  2PR8 A;  2YGW A;  4KOT A;  4MFK A;  4R6T A;  1ZLH A;  2OZH A;  3B3T A;  4M85 A;  4Q7A A;  4A37 A;  1MJ9 A;  3FVL A;  3KQZ A;  4PSW A;  4JXQ A;  3B3S A;  1B87 A;  3OWC A;  5CPA A;  1VIX A;  4KOY A;  5LYI A;  1J4J A;  1F2O A;  2BSW A;  3JTK A;  5FVJ A;  5HXD A;  4NGS A;  4UCN A;  1S7L A;  1LAM A;  2Z3K A;  4CPA A;  1IOI A;  4MHP A;  4F0X A;  2F8H A;  1KWM A;  2DXQ A;  1B6B A;  1BO4 A;  1FY7 A;  1H8L A;  2JLM A;  2ODF A;  2RC4 A;  3BI1 A;  3DSB A;  3ISX A;  2BOA A;  4TWE A;  1TKF A;  1X12 A;  1ARL A;  1Y0R A;  4PXE A;  4BD9 A;  4UBR A;  3NE8 A;  2O4H A;  3SHP A;  4JXR A;  2PVW A;  3SXN A;  5KTC A;  2PQ8 A;  4DJL A;  2DEA A;  2VXK A;  2PJA A;  1S7N A;  2C27 A;  2PJ6 A;  4OKO A;  2ZW5 A;  3GLJ A;  2I79 A;  1YR0 A;  2YNE A;  4KLW A;  4MCP A;  3D7H A;  4OAD A;  2GAN A;  4MHZ A;  4CAF A;  4CGO A;  3K2K A;  3S6H A;  3D66 A;  1IYK A;  4HNX B;  3R95 A;  1QSO A;  4KOW A;  3PB4 X;  4L89 A;  1NMT A;  2QIR A;  2AFW A;  1S7F A;  1YME A;  2IMO A;  3RAM A;  1BAV A;  1KZF A;  4DNC A;  1BOB A;  4MY3 A;  4JJX A;  5BWA B;  3S9N A;  3IU1 A;  3PB6 X;  4ONU A;  1XOV A;  4OC2 A;  4P10 A;  1XEB A;  4CYO A;  3I1U A;  1XF8 A;  5DWN A;  3FYN A;  3S6F A;  4QB9 A;  4A33 A;  1Q7L A;  2CF4 A;  2D4O A;  1YVO A;  2Q0Y A;  2NSM A;  1HDU A;  1XIX A;  3HUV A;  3NE7 A;  4GM5 A;  2NYQ A;  4Y49 B;  1V0C A;  3GUX A;  3R1K A;  4X3R A;  4BBH A;  2IQ6 A;  3GYA A;  3S6G A;  4BIN A;  4MFZ A;  3EFA A;  4MCS A;  3VWE A;  2JEV A;  4R87 A;  2WPX A;  2Z10 A;  3KR5 A;  4A30 A;  1IIC A;  2OH1 A;  3JVN A;  4QUS A;  3SXO A;  4KOU A;  2ANP A;  3R9G A;  2J9A A;  5KTA A;  3FX6 A;  2Z3O A;  2QVP A;  3PFE A;  4ZY0 A;  4GS4 A;  4FUU A;  2B4D A;  4KVM E;  2D4P A;  4C7H A;  4ZY1 A;  2CNT A;  2DPS A;  4UCP A;  1DTD A;  4FD6 A;  4H89 A;  3KL9 A;  4MY0 A;  4R7M A;  5HVF A;  1ZG7 A;  4KZT A;  1Z5R A;  2WPW A;  2VEZ A;  4YU9 A;  1QSM A;  2J8N A;  1ZO0 A;  4NJQ A;  6CPA A;  5J1Q A;  3V38 A;  1S3Z A;  4AVA A;  4WJB A;  3PBE A;  3IWE A;  2ZEM A;  5F48 A;  4YFJ A;  2C6P A;  4QBJ A;  1LOK A;  1Z8W A;  4JYW A;  4PXB A;  4JWP A;  1CBX A;  1KUV A;  4K30 A;  4NGT A;  3QB8 A;  4F0Y A;  3K9T A;  3PFO A;  5THW A;  4KOR A;  2O53 A;  2AFS A;  1OZP A;  2PJ4 A;  2PRB A;  2ZW6 A;  4JZ0 A;  2XEJ A;  3IC1 A;  4OP4 A;  2B4B A;  2V8G A;  1IGB A;  3BJ7 A;  4KVX A;  1VHO A;  3EY5 A;  4RS2 A;  2DPT A;  3RBU A;  1ON0 A;  1XMB A;  1UFH A;  4GXH A;  4Q36 A;  2AE6 A;  2HUZ A;  5AG7 A;  3PB9 X;  1M1D A;  1I1D A;  2REF A;  4UCM A;  1YX0 A;  4K3N A;  3TO9 A;  2CXA A;  3KQX A;  2PVV A;  5IB0 A;  1MK4 A;  3FF3 A;  4P45 A;  5HVH A;  1FT7 A;  2IJZ A;  2PIZ A;  3C26 A;  4C2Z A;  4PXD A;  3H8E A;  2VL1 A;  3SJE A;  3VWD A;  4UEE A;  4KOX A;  1A2Z A;  2B4D B;  3D2M A;  4AB7 A;  3MRU A;  4FWU A;  5G1Z A;  5F46 A;  2AFM A;  3DNS A;  2ZOG A;  2HV2 A;  3WC6 A;  4UIB A;  3TT2 A;  2FXF A;  3I9S A;  2ZW7 A;  3GKR A;  1AUG A;  4XPD C;  4KSF A;  4W9Y A;  3B3C A;  5LRG A;  1PCA A;  3E0K A;  3IO1 A;  2ZEP A;  2ZEE A;  3LAC A;  2Q43 A;  3D7D A;  4R76 A;  4ZBG A;  1NSL A;  2CNM A;  3NH5 A;  1NE9 A;  3H8G A;  4OC5 A;  3T8W A;  2G3T A;  2AFO A;  1K4J A;  2OZG A;  2V8V A;  4E2A A;  1HDQ A;  3FEE A; 
#chains in the Genus database with same CATH homology
 1P4N A;  5JPH A;  1S7K A;  1KUX A;  4FD4 A;  4NXY A;  2P0W A;  5IV0 A;  3CXP A;  3F8K A;  2I00 A;  5A28 A;  4PK2 A;  5H86 A;  3FBU A;  4CAV A;  2YNC A;  2BUE A;  4CAE A;  2P6E A;  1Z4R A;  3TE4 A;  5F47 A;  5GCN A;  1PU9 A;  2A4N A;  4KS9 A;  3EO4 A;  5EBV A;  4CGN A;  2Z3N A;  2Z3M A;  4L8A A;  4CGL A;  4C7I A;  4KUA A;  4Y49 C;  5AG5 A;  3TTH A;  2VI7 A;  4X5K A;  3W6S A;  3T90 A;  3R9E A;  3I3G A;  4LX9 A;  5IX3 A;  5AGE A;  4MFL A;  3KKW A;  2GE3 A;  1IYL A;  1PUA A;  3QAH A;  2ZXV A;  4IUS A;  3TOB A;  2R98 A;  4CRY B;  4ORF A;  1M44 A;  4XNH C;  4B13 A;  2OZU A;  4CAW A;  4A31 A;  4MBU A;  4B14 A;  4CGM A;  3PZJ A;  3V8I A;  3TCV A;  2G3A A;  3GY9 A;  3FB3 A;  4NCZ A;  3P2H A;  4UFW A;  1N71 A;  2O28 A;  4LUA A;  4ZGY B;  4CGP A;  1Z9U A;  3TO6 A;  3FRM A;  1YK3 A;  2Z0Z A;  2FIW A;  5HMN A;  1M4I A;  2HQY A;  1YGH A;  4HNW B;  3LOD A;  4KVO E;  3B8G A;  5G20 A;  2Q44 A;  4U5Y A;  5HH1 A;  2FT0 A;  1M4G A;  2PC1 A;  4HKF A;  1WK4 A;  2IL4 A;  3PGP A;  4E8O A;  1IID A;  2NMT A;  2EVN A;  2R7H A;  2VQY A;  4MHD A;  4B10 A;  5C88 A;  3IWG A;  1M4D A;  2WSA A;  4YGO A;  4MFJ A;  1TIQ A;  4NEX A;  1CJW A;  4KUB A;  4KOS A;  5DWM A;  1CM0 A;  4OAE A;  2AJ6 A;  3TO7 A;  3R9F A;  5E96 A;  3WR7 A;  3FNC A;  3EXN A;  2PSW A;  2FCK A;  4UWJ A;  3CXQ A;  5C82 A;  4CYP A;  1YLE A;  2J8M A;  2Z11 A;  4AVC A;  2FE7 A;  2JDC A;  2Z3L A;  3H5Z A;  4AVB A;  2Q04 A;  4R3K A;  2FSR A;  2FIA A;  1XE4 A;  2QEC A;  3DR6 A;  2FS5 A;  5ISV A;  1Y7R A;  3W91 A;  4B5P B;  3D2P A;  2PDO A;  3IGR A;  1R57 A;  3FIX A;  3A9L A;  1RXT A;  4U9Y A;  3CXS A;  5KTD A;  3TFY A;  3LD2 A;  4CYQ A;  1Q2D A;  1SQH A;  4XPL A;  5G22 A;  4BMH A;  3EC4 A;  4CAX A;  2Q4Y A;  2WUU A;  1MJB A;  2ZPA A;  4XPK A;  3N7Z A;  2B5G A;  1S60 A;  3G3S A;  5JQ4 A;  4PV6 A;  2Z3P A;  4H6U A;  4FD7 A;  1QST A;  3IU2 A;  4MFP A;  3DR8 A;  3F0A A;  2G0B A;  4MFQ A;  1I21 A;  1P0H A;  1Y9W A;  1MJA A;  4A95 A;  4XPD B;  3ZJ0 A;  2YNC C;  4KOV A;  4AG9 A;  1Z4E A;  2P6G A;  5I0C A;  4I49 A;  4C68 A;  4E0A A;  5F49 A;  1YVK A;  4AG7 A;  2H5M A;  4II9 A;  2Q7B A;  3MGD A;  4J3G A;  1S5K A;  4C2Y A;  3BLN A;  2J8R A;  4HNY B;  5G21 A;  4UFV A;  4KSA A;  3RYO A;  1RO5 A;  4F6A A;  3G8W A;  2B3V A;  2REE A;  2Q4V A;  4PK3 A;  3DDD A;  4MJ8 A;  2OU2 A;  3H4Q A;  1KUY A;  4NF1 A;  2OB0 A;  5A27 A;  3BJ8 A;  2B5G B;  1Q2C A;  3W6X A;  1IB1 E;  2PR1 A;  2X7B A;  4UFX A;  2EUI A;  3UY5 A;  4EVY A;  4A2Z A;  2QML A;  5AG6 A;  4U9Z A;  2F5I A;  4FD5 A;  1Y9K A;  5CNP A;  2ARH A;  4B5O A;  2B3U A;  4B5P A;  2VBQ A;  3FXT A;  4JLY A;  2K5T A;  1WWZ A;  2BL1 A;  3P2F A;  5J8F A;  4XNH B;  4PSX A;  2VZY A;  4JD6 A;  4IF5 A;  2JDD A;  2YND A;  4NSQ A;  4CS0 B;  3D8P A;  3PP9 A;  3S6K A;  5J8C A;  3ZZI A;  2Y0M A;  1YRE A;  1VHS A;  1U6M A;  4KLV A;  2R1I A;  4R3L A;  2P6F A;  2CNS A;  3T9Y A;  1QSR A;  2FL4 A;  4R57 A;  5H84 A;  1LRZ A;  4B11 A;  3F5B A;  4MI4 A;  4QC6 A;  4R9M A;  4RI1 A;  4UWI A;  5AG4 A;  4H6Z A;  3K9U A;  4QVT A;  1XMT A;  1GHE A;  3D3S A;  4Q38 A;  2KCW A;  4YRH A;  1L0C A;  2R8V A;  4CRZ B;  2B58 A;  1VKC A;  3JUW A;  2ATR A;  4UA3 A;  4M3S A;  3TOA A;  1QSN A;  4C2X A;  2ZW4 A;  4B12 A;  4CYN A;  2BEI A;  1I12 A;  5EC4 A;  2GIV A;  4A32 A;  4OLL A;  3R96 A;  2CY2 A;  2VZZ A;  2YGW A;  1Q2Y A;  2PR8 A;  4KOT A;  4MFK A;  2OZH A;  4M85 A;  1MJ9 A;  4PSW A;  4JXQ A;  1B87 A;  3OWC A;  4KOY A;  1J4J A;  2BSW A;  3JTK A;  5FVJ A;  4UCN A;  1S7L A;  2Z3K A;  4F0X A;  2DXQ A;  1B6B A;  1BO4 A;  1FY7 A;  2JLM A;  2RC4 A;  3DSB A;  4UBR A;  3SHP A;  4JXR A;  3SXN A;  5KTC A;  2PQ8 A;  2VXK A;  1S7N A;  2C27 A;  2ZW5 A;  4KLW A;  2I79 A;  1YR0 A;  2YNE A;  4OAD A;  2GAN A;  4CAF A;  4CGO A;  3S6H A;  1IYK A;  4HNX B;  3R95 A;  1QSO A;  4KOW A;  4L89 A;  1NMT A;  2QIR A;  1S7F A;  1KZF A;  4DNC A;  1BOB A;  4MY3 A;  4JJX A;  5BWA B;  3IU1 A;  4ONU A;  1XEB A;  4CYO A;  1XF8 A;  5DWN A;  3FYN A;  3S6F A;  4QB9 A;  4A33 A;  2D4O A;  1YVO A;  2Q0Y A;  1XIX A;  3NE7 A;  4Y49 B;  1V0C A;  3R1K A;  4BBH A;  3GYA A;  3S6G A;  4MFZ A;  3EFA A;  3VWE A;  2JEV A;  4R87 A;  2WPX A;  2Z10 A;  4A30 A;  1IIC A;  2OH1 A;  3JVN A;  4QUS A;  3SXO A;  4KOU A;  3R9G A;  5KTA A;  2Z3O A;  4GS4 A;  2B4D A;  4KVM E;  2D4P A;  4C7H A;  2CNT A;  2DPS A;  4UCP A;  4FD6 A;  4H89 A;  4MY0 A;  4KZT A;  2WPW A;  2VEZ A;  1QSM A;  2J8N A;  1ZO0 A;  1S3Z A;  4AVA A;  3IWE A;  5F48 A;  4YFJ A;  4QBJ A;  4JWP A;  1KUV A;  4K30 A;  3QB8 A;  4F0Y A;  4KOR A;  2PRB A;  1OZP A;  2ZW6 A;  2B4B A;  3BJ7 A;  4KVX A;  3EY5 A;  4RS2 A;  2DPT A;  1ON0 A;  1UFH A;  4Q36 A;  2AE6 A;  2HUZ A;  5AG7 A;  1M1D A;  1I1D A;  2REF A;  4UCM A;  1YX0 A;  3TO9 A;  2CXA A;  5IB0 A;  1MK4 A;  3C26 A;  4C2Z A;  3VWD A;  4KOX A;  2B4D B;  3D2M A;  4AB7 A;  5G1Z A;  5F46 A;  3DNS A;  2HV2 A;  3TT2 A;  2FXF A;  3I9S A;  2ZW7 A;  3GKR A;  4XPD C;  4KSF A;  3E0K A;  1NSL A;  4ZBG A;  2CNM A;  1NE9 A;  2G3T A;  1K4J A;  2OZG A;  4E2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...