1Q2YA

Crystal structure of the protein yjcf from bacillus subtilis: a member of the gcn5-related n-acetyltransferase superfamily fold
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
140
structure length
140
Chain Sequence
MKAVIAKNEEQLKDAFYVREEVFVKEQNVPAEEEIDELENESEHIVVYDGEKPVGAGRWRMKDGYGKLERICVLKSHRSAGVGGIIMKALEKAAADGGASGFILNAQTQAVPFYKKHGYRVLSEKEFLDAGIPHLQMMKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords similar to hypothetical proteins
publication title Crystal structure of the protein YJCF from Bacillus subtilis: a member of the GCN5-related N-acetyltransferase superfamily
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 39
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1q2yA00
3I3GA 1GHEA 2ZW6A 1M4DA 2C27A 4QBJA 1Q2CA 4KLWA 4BMHA 1N71A 1CM0A 3W6SA 2I79A 4RS2A 4MI4A 1XF8A 3UY5A 2JDCA 3RYOA 4R57A 4HKFA 2B4DA 4KUAA 1Y9WA 2JEVA 5IX3A 4KOSA 1NE9A 4KORA 1SQHA 5J8CA 1P4NA 2JDDA 4UA3A 3FRMA 4NXYA 2OZUA 2PDOA 1V0CA 4XPDC 3E0KA 4MBUA 5EC4A 2AE6A 2CNMA 2G0BA 2FXFA 3T9YA 4RI1A 5H84A 2X7BA 1YVKA 2D4OA 4UWJA 3BJ8A 3D8PA 3CXSA 3SXNA 5F46A 5KTAA 1Y9KA 2PR8A 2GE3A 4QVTA 2Q7BA 3TE4A 3FXTA 3R9FA 4NCZA 1J4JA 1XEBA 1M1DA 2K5TA 1IIDA 4AG9A 1YK3A 5C82A 5DWMA 1P0HA 4MHDA 2JLMA 3KKWA 3H4QA 4U9YA 2Q4VA 3EXNA 5C88A 2ZXVA 4IF5A 3S6HA 3EO4A 1M4GA 2AJ6A 2O28A 4KOVA 2FCKA 1IICA 2A4NA 2Z11A 3CXPA 2PSWA 2B4DB 4JXQA 3K9UA 4CAWA 4L8AA 2VBQA 4OADA 4QB9A 4JLYA 1BO4A 5JQ4A 1LRZA 4K30A 5EBVA 2Q4YA 3DR8A 3N7ZA 2Z10A 3D3SA 3QAHA 4AG7A 5ISVA 1Z4RA 1M44A 5F47A 1RO5A 2QIRA 2FT0A 4CS0B 1Z4EA 2OB0A 3TT2A 4B5OA 2BSWA 4ZBGA 4GS4A 1KUVA 1S3ZA 3T90A 3SXOA 3TO7A 4CRYB 1S7NA 2GIVA 4I49A 1PUAA 5CNPA 1MJAA 5J8FA 1U6MA 4H6ZA 3FBUA 4XPDB 1UFHA 2HQYA 1B87A 4JD6A 2CNSA 2ZPAA 3ZZIA 3S6FA 5E96A 5F49A 3D2PA 1KUXA 4CRZB 3D2MA 1I21A 4AB7A 1M4IA 1VHSA 4H6UA 3FYNA 3GY9A 4AVAA 1S7KA 1XE4A 2NMTA 2OZHA 4MJ8A 3OWCA 2BEIA 4QUSA 4IUSA 2DXQA 2CY2A 3G8WA 1KUYA 3S6KA 1MJ9A 3DR6A 2FSRA 2J8MA 2VEZA 4CAXA 2B5GA 2FIWA 2FL4A 2WPXA 3BJ7A 4PK2A 4AVCA 2OU2A 3R9EA 1QSOA 3BLNA 5H86A 3I9SA 1YVOA 2HUZA 2R98A 1IB1E 3R9GA 4E2AA 1BOBA 3C26A 4U5YA 2REFA 1WWZA 3B8GA 4R3KA 1CJWA 1ON0A 3S6GA 4QC6A 3QB8A 4M3SA 4II9A 3W91A 4R3LA 4J3GA 3W6XA 1XMTA 3EFAA 2J8RA 3JVNA 4MY3A 1S7FA 1QSTA 3MGDA 1YR0A 2ZW5A 4NF1A 1KZFA 1XIXA 2P6EA 1S7LA 4HNWB 3NE7A 4H89A 2J8NA 4Y49C 4MY0A 4YFJA 2PRBA 4ONUA 4M85A 4B5PA 3TO6A 2KCWA 2P0WA 4XNHC 5KTCA 1NMTA 5IV0A 2VZZA 2ZW7A 2HV2A 1Q2DA 1I1DA 4LX9A 5F48A 1R57A 1I12A 4HNXB 4UWIA 4PK3A 2Y0MA 4JJXA 3R95A 1Q2YA 1QSNA 2BL1A 3LD2A 4PSXA 2REEA 1TIQA 1QSRA 5HH1A 5JPHA 1MK4A 2PC1A 3F5BA 1FY7A 4PSWA 4NSQA 4AVBA 2PQ8A 3FIXA 4CAVA 2B5GB 4KLVA 2EUIA 3F0AA 3CXQA 3EY5A 2WPWA 3SHPA 1QSMA 3WR7A 2Z0ZA 2Q0YA 4XPLA 3GYAA 1PU9A 2F5IA 3PZJA 4YRHA 4HNYB 1VKCA 2I00A 2B4BA 3TO9A 2R7HA 1K4JA 2PR1A 1IYKA 2EVNA 4KUBA 4R87A 4YGOA 3TOAA 2FE7A 1OZPA 5DWNA 3V8IA 4R9MA 2VXKA 4U9ZA 4KOXA 2OZGA 4JXRA 3TTHA 4OLLA 2G3TA 1B6BA 4X5KA 5GCNA 1Y7RA 4E8OA 1MJBA 3EC4A 2RC4A 5IB0A 5KTDA 4XPKA 2G3AA 3VWDA 4NEXA 2BUEA 4L89A 1Z9UA 1S60A 4FD4A 4KVXA 3LODA 4B5PB 2B3VA 3PP9A 4KZTA 2P6GA 2VI7A 1IYLA 2VZYA 5I0CA 2GANA 3TFYA 4KOUA 2D4PA 3IWGA 1YREA 2R1IA 1YGHA 2CNTA 3DSBA 4Y49B 5FVJA 3F8KA 3DNSA 1YLEA 2FS5A 3ZJ0A 3G3SA 3P2HA 2R8VA 4OAEA 2IL4A 4XNHB 3FNCA 2Q44A 2ATRA 4JWPA 3GKRA 3JUWA 4KVME 4KVOE 1YX0A 2QMLA 3PGPA 3DDDA 2FIAA 2B3UA 4UBRA 1L0CA 3TOBA 4DNCA 2ZW4A 4KOWA 4E0AA 4KOYA 4F6AA 3R1KA 4FD5A 4PV6A 1S5KA 1NSLA 2VQYA 4F0YA 2ARHA 3TCVA 4LUAA 5HMNA 4EVYA 2B58A 3VWEA 3P2FA 1WK4A 3R96A 3FB3A 2H5MA 3IGRA 2P6FA 2OH1A 4FD7A 4KOTA 4ORFA 1RXTA 2QECA 4FD6A 2Q04A
chains in the Genus database with same CATH superfamily
3I3GA 1GHEA 5D29A 2C1CA 5K8MA 3BI1A 2ZW6A 2ZELA 2DPSA 1M4DA 2C27A 3B2YA 4P45A 4QBJA 3RBUA 1YQEA 1PYTB 1Q2CA 3D67A 3DGVA 4KLWA 4BMHA 1IOIA 1N71A 4OC0A 1CM0A 4O23A 2I79A 4RS2A 5LYDA 2Q7SA 4MFKA 4MI4A 3W6SA 1XF8A 4EWTA 3N5FA 3UY5A 3B3SA 4M6GA 2JDCA 4UFVA 3LACA 3RYOA 4R57A 1Q7LA 5K8OA 4HKFA 2PVWA 2B4DA 4OC5A 2O4HA 4KUAA 1Y9WA 4MMOA 2XEGA 4P4IA 4BD9A 4ZYQA 3ISXA 2JEVA 3QAYA 4C2YA 5IX3A 4KOSA 1NE9A 4KORA 1SQHA 5D8NA 4CGPA 5J8CA 2AFZA 1P4NA 2JDDA 2PJCA 4R8FA 4UA3A 3FRMA 4NXYA 2PJBA 2OZUA 2PDOA 1V0CA 5AG4A 4XPDC 3E0KA 3KASA 4ZY2A 3FECA 4MBUA 4OC2A 4CYQA 5EC4A 1EE3P 4OC3A 1IGBA 2AE6A 2PJAA 2CNMA 4CPAA 1A2ZA 5LYFA 2G0BA 2FXFA 5THWA 2Q51A 4PPZA 4A30A 1X10A 3T9YA 1BAVA 3BXMA 4G1PA 4TNUA 4RI1A 5H84A 3IC1A 5ELYA 5JPHA 2D4OA 1YVKA 2PJ3A 2X7BA 3B3WA 3FH4A 4UWJA 3BJ8A 2HC9A 4MFZA 3D8PA 2EK9A 1QMUA 3CXSA 3SI2A 3SXNA 1Y9KA 4C7HA 2PR8A 2WUUA 5F46A 2GE3A 4QVTA 2Q7BA 1BPMA 3H8GA 4JZ0A 3TE4A 1LANA 3FXTA 3R9FA 4NCZA 1R3NA 1J4JA 4F9VA 1XEBA 3PB9X 3GLJA 5HXDA 1YW6A 1M1DA 1TF9A 2K5TA 1IIDA 1LFWA 4AG9A 4Q7AA 1YK3A 4OP4A 3KGQA 4R6TA 5C82A 3D7FA 5DWMA 1P0HA 4CGNA 4MHDA 3FMCA 4OMEA 2JLMA 1Z8TA 3MN8A 4NGPA 2Z3NA 3KKWA 4LQ6A 3H4QA 4U9YA 3RNZA 4UFWA 4OIWA 2Q4VA 3EXNA 4MHYA 2ZEEA 3BI0A 5C88A 2ZXVA 5JH9A 4IF5A 1TXRA 3S6HA 3WC7A 3EO4A 4IAVA 1M4GA 2AJ6A 2O28A 2PRQA 2FCKA 4KOVA 3IU2A 4F9UA 2GREA 4NFRA 1IICA 2A4NA 2PJ1A 4UFXA 1Z5RA 2ZENA 3H5ZA 4X8IA 4RUHA 1TKJA 3CXPA 5LYIA 4PXBA 3PFOA 1RTQA 1ELLP 2PSWA 2B4DB 1XOVA 2ZEHA 5K8PA 5LRGA 5K8NA 4JXQA 3K9UA 1F2PA 4CAWA 4CYOA 4L8AA 5JGFA 4CGOA 3RZAA 2VBQA 4OADA 4QB9A 3KHZA 4JLYA 1BO4A 2C6PA 4EFDA 2IMOA 2ZEDA 5JQ4A 4YU9A 2QYVA 1LRZA 2YGWA 4K30A 5EBVA 2Q4YA 3DR8A 3PB7X 3N7ZA 2Z10A 3D3SA 2JEWA 3QAHA 4M6IA 3B3TA 2ABZA 4AG7A 4NGSA 5ISVA 1Z4RA 3TC8A 3NA6A 3TX8A 1LAPA 1M44A 2ZEFA 2J9AA 3ISZA 4BINA 2F7VA 5F47A 1RO5A 2QIRA 1H8LA 2FT0A 4CS0B 4DUKA 1Z8LA 1UWYA 1ARLA 1ZG8A 4MCPA 4P10A 5AGEA 3NH8A 4MCSA 1Z4EA 2OB0A 3A9LA 3NE8A 4P4FA 2HB6A 2V8DA 3TT2A 4B5OA 3V7ZA 5AG7A 3K9TA 2BSWA 4ZBGA 4GS4A 1KUVA 3B7IA 1S3ZA 3T90A 3NH4A 2Z3KA 3SXOA 1HDUA 3TO7A 4CRYB 1XFOA 1S7NA 1CBXA 1F2OA 2PCUA 5EMIA 2RFHA 3KHXA 4TWEA 2GIVA 2CTCA 3D4UA 2JBJA 4I49A 2C6CA 3PBEA 2AFUA 3D7GA 4MFLA 1PUAA 2WYRA 1Z8XA 4DYOA 2PJ9A 5CNPA 1MJAA 4NGNA 4OKOA 5J8FA 1U6MA 4H6ZA 3FBUA 4ONWA 4XPDB 1UFHA 2HQYA 4R76A 1B87A 4JD6A 2CNSA 4C2ZA 2ZPAA 3ZZIA 5HVHA 3S6FA 5E96A 2OOTA 5F49A 1ZO0A 5LYLA 3D2PA 1KUXA 5A28A 4CRZB 2PJ5A 1KWMA 1I21A 3D2MA 4C68A 1X12A 3GUXA 3LMSA 1M4IA 1VHSA 4NGTA 4PQAA 4AB7A 2V8VA 3WT4A 2BO9A 4H6UA 1FNOA 3FYNA 3GY9A 4AVAA 4UEZA 1XMBA 1S7KA 1XE4A 2NMTA 2OZHA 3LWUA 4MJ8A 4NGQA 4F8ZA 3OWCA 2PJ6A 2BEIA 4QUSA 4WWVA 4IUSA 4WJBA 2DXQA 2CY2A 3G8WA 4KSFA 1KUYA 2Z3OA 3RO0A 3S6KA 1MJ9A 3DR6A 3IFEA 2FSRA 4P44A 4CAFA 2J8MA 2V8GA 3DLJA 3NH5A 2BCOA 2VEZA 3CPAA 4GXHA 4CAXA 1LOKA 2B5GA 2FIWA 2FL4A 2WPXA 3BJ7A 4MCQA 4OC1A 1AMPA 2OU2A 4PK2A 3R9EA 4AVCA 1QSOA 3BLNA 5H86A 3QNVA 3I9SA 2PIYA 1YVOA 2HUZA 2R98A 1IB1E 3R9GA 4A31A 3I1UA 1BOBA 3C26A 4U5YA 4E2AA 2ZEGA 2REFA 4H2KA 4MHNA 1CP7A 1WWZA 1FT7A 1ZLIA 3B8GA 4P4DA 4B13A 4R3KA 2GLFA 1CJWA 5AG6A 3WABA 1ON0A 3S6GA 2ZOFA 4QC6A 5KTAA 2NSMA 1XJOA 3SJEA 3QB8A 4M3SA 4MCRA 1ZG7A 4II9A 4MFPA 3W91A 5F09A 4A37A 4R3LA 4J3GA 4ZY1A 4NGRA 3SI0A 3SJXA 1ELMP 4KSAA 3W6XA 4RN7A 1XMTA 4Q36A 2ZEPA 2Q43A 1VHEA 1IU8A 4F0XA 3PB6X 3EFAA 4X3RA 2J8RA 3JVNA 4CGMA 4MY3A 5HVGA 1S7FA 1QSTA 3MGDA 2Z3LA 2Z3PA 3CT9A 1YR0A 2ZW5A 4NF1A 3PB8X 3SJFA 1KZFA 1XIXA 2P6EA 2V8HA 3KQZA 3S9MA 1S7LA 4HNWB 2YNCC 4CGLA 4CYNA 3NE7A 4H89A 4CAEA 2J8NA 3FEDA 4Y49C 3B3VA 4MY0A 4YFJA 2BOAA 2PRBA 1R43A 2OR4A 2FVGA 4ONUA 4M85A 5AG5A 4HPSA 4B5PA 3TO6A 2PJ0A 2KCWA 2WZNA 1CX8A 2P0WA 4XNHC 5KTCA 2PJ8A 1NMTA 5IV0A 2VZZA 2ZW7A 1CPXA 2HV2A 1Q2DA 2XEJA 1I1DA 3VATA 4LX9A 2PVVA 3SJGA 5F48A 4C7IA 3GB0A 5A27A 1R57A 2YNEA 1I12A 2O53A 4B14A 4HNXB 4UWIA 4PK3A 1ARMA 1IY7A 1CP6A 2Y0MA 4JJXA 3KI9A 3R95A 1Q2YA 1QSNA 4UEFA 3KR5A 3T8WA 2EBJA 2BL1A 3SI1A 3LD2A 4PSXA 4EMEA 1M4LA 1Z2LA 2REEA 2IQ6A 1TIQA 1QSRA 4MFQA 5I4MA 4NGMA 4UF4A 5HH1A 1MK4A 1DE4C 2PC1A 1FY7A 3F5BA 4PSWA 3D68A 1TF8A 4NSQA 5JM6A 4AVBA 2GFQA 2JBKA 2PQ8A 3FIXA 6CPAA 4CAVA 4B6ZA 4YWYA 2B5GB 4KLVA 1LCPA 2YNCA 3S9NA 1GYTA 4KS9A 4MXUA 2EUIA 1NSAA 1YLOA 4ZY0A 3F0AA 2Q4ZA 3CXQA 3EY5A 4IK2A 2YNDA 3D7DA 2AFXA 1F57A 2WPWA 3SHPA 1ZG9A 1QSMA 3D7HA 4P4JA 3PB4X 4OC4A 3WR7A 2Z0ZA 4R7MA 5CBMA 2Q0YA 4XPLA 3GYAA 1PU9A 2F5IA 2NYQA 4FUUA 3PZJA 4YRHA 4HNYB 4A2ZA 5DS0A 2CIJA 4A39A 4ZI6A 2AFOA 1VHOA 1VKCA 2I00A 2B4BA 4UCPA 1Z8WA 2R7HA 1K4JA 2PR1A 2RB7A 1IYKA 1TKFA 3TO9A 2G9DA 4Q38A 3IEHA 2EVNA 2VL1A 3L2NA 4KUBA 4R87A 4YGOA 3TOAA 2WSAA 1CPSA 1OZPA 2FE7A 5DWNA 3V8IA 4R9MA 2VXKA 4U9ZA 4A95A 3KR4A 4IHMA 1LAMA 4KOXA 4GM5A 2OZGA 1JWQA 4JXRA 3TTHA 2PJ7A 7CPAA 3PRTA 3IO1A 4OLLA 2G3TA 1B6BA 3D66A 4X5KA 2POKA 1Y0YA 5GCNA 1Y7RA 4E8OA 1MJBA 3EC4A 2RC4A 5IB0A 1HEEA 5KTDA 2PIZA 2G3AA 2ZOGA 4XPKA 3VWDA 3FEEA 4NEXA 2BUEA 4L89A 1TKHA 4NJQA 1Z9UA 2GU2A 3JTKA 3KQXA 1S60A 1DTDA 4FD4A 4KVXA 3LODA 4B5PB 2B3VA 2AFMA 4K3NA 2EWBA 3IIBA 4FD6A 4B12A 1VIXA 3PP9A 4KZTA 4UIAA 2EK8A 4CYPA 2PE3A 2DF5A 2AFWA 1XRYA 2P6GA 1Y0RA 2VI7A 1IYLA 2VZYA 3FF3A 5I0CA 4M6HA 4B10A 2GANA 1AUGA 1JQGA 3K2KA 4UCNA 5G20A 4A38A 2CF4A 3TFYA 3HLPA 4MFJA 5LRKA 3GIUA 4KOUA 2D4PA 5IB9A 4UEEA 4MHZA 4FAIA 1YMEA 2QVPA 3IWGA 1YREA 4OIDA 2R1IA 4FWUA 8CPAA 4UIBA 2CTBA 1YGHA 3VH9A 3H8FA 3KZWA 2CNTA 3DSBA 4Y49B 5FVJA 5G21A 2QJ8A 3DNSA 3F8KA 5G1ZA 1YLEA 2PJ2A 2FS5A 4B11A 4ZX8A 4LQGA 3JRUA 5HVFA 3RAMA 3ZJ0A 3S9LA 3G3SA 1BPNA 1ZLHA 3P2HA 5G22A 3CZXA 2R8VA 4OAEA 4ZX9A 2IL4A 4XNHB 3FNCA 3B3CA 2Q44A 2ATRA 1Y7EA 4JWPA 3GKRA 2C6GA 3JUWA 4ZGYB 1PCAA 4KVME 4KVOE 4NJRA 1OBRA 1IOFA 2DPTA 2ZEMA 3FX6A 3NFZA 1YX0A 2QMLA 3PGPA 1YW4A 5LRJA 3DDDA 4PXCA 2FIAA 3WC6A 4MHPA 4BBHA 3H8EA 2ZEOA 2B3UA 3CDXA 4UBRA 4X2TA 4FBEA 1L0CA 1AYEA 3B35A 3TOBA 4DNCA 2PJ4A 2ZW4A 4KOWA 4W9YA 4E0AA 1CG2A 1QQ9A 4KOYA 4A33A 4F6AA 1HDQA 2V77A 3FVLA 3R1KA 4FD5A 4PV6A 4C2XA 1BLLE 4PXDA 5BWAB 1S5KA 4P4BA 1NSLA 5CPAA 2VQYA 3VARA 4JYWA 4F0YA 4A94A 2ARHA 3TCVA 4LUAA 4A32A 4P4EA 4Z65A 3IWEA 3HUVA 4P6YA 1XBUA 3MRUA 5HMNA 4EVYA 3PBBA 3V38A 4AXVA 2B58A 2ANPA 2EO8A 2IJZA 3CPXA 3FJUA 4PXEA 1YSJA 3KL9A 4DJLA 2DEAA 2ODFA 2XEIA 3IJ3A 4MRIA 3WC5A 3VWEA 3P2FA 1WK4A 3R96A 5J1QA 1VGYA 3PFEA 4KSIA 2I3CA 4UCMA 3FB3A 2AFSA 2H5MA 3IWWA 3IGRA 2CXAA 2P6FA 3BHXA 3PEIA 2OH1A 2GLJA 3IU1A 2F8HA 2XEFA 4FD7A 1RXTA 4KOTA 2QECA 4ORFA 2Z3MA 2Z11A 2Q04A
chains in the Genus database with same CATH topology
3I3GA 1GHEA 2ZW6A 2DPSA 1M4DA 2C27A 4QBJA 1Q2CA 4KLWA 4BMHA 1N71A 1CM0A 3W6SA 2I79A 4RS2A 4MFKA 4MI4A 1XF8A 3UY5A 2JDCA 4UFVA 3RYOA 4R57A 4HKFA 2B4DA 4KUAA 1Y9WA 2JEVA 4C2YA 5IX3A 4KOSA 1NE9A 4KORA 1SQHA 4CGPA 5J8CA 1P4NA 2JDDA 4UA3A 3FRMA 4NXYA 2OZUA 2PDOA 1V0CA 5AG4A 4XPDC 3E0KA 4MBUA 4CYQA 5EC4A 2AE6A 2CNMA 2G0BA 2FXFA 4A30A 3T9YA 4RI1A 5H84A 2X7BA 1YVKA 2D4OA 4UWJA 3BJ8A 4MFZA 3D8PA 3CXSA 3SXNA 4C7HA 5F46A 1Y9KA 5KTAA 2PR8A 2WUUA 2GE3A 4QVTA 2Q7BA 3TE4A 3FXTA 3R9FA 4NCZA 1J4JA 1XEBA 1M1DA 2K5TA 1IIDA 4AG9A 1YK3A 5C82A 5DWMA 1P0HA 4CGNA 4MHDA 2JLMA 2Z3NA 3KKWA 3H4QA 4U9YA 4UFWA 2Q4VA 3EXNA 5C88A 2ZXVA 4IF5A 3S6HA 3EO4A 1M4GA 2AJ6A 2O28A 4KOVA 2FCKA 3IU2A 1IICA 2A4NA 4UFXA 3H5ZA 2Z11A 3CXPA 2PSWA 2B4DB 4JXQA 3K9UA 4CYOA 4CAWA 4L8AA 4CGOA 2VBQA 4OADA 4QB9A 4JLYA 1BO4A 5JQ4A 1LRZA 2YGWA 4K30A 5EBVA 2Q4YA 3DR8A 3N7ZA 2Z10A 3D3SA 3QAHA 4AG7A 5ISVA 1Z4RA 1M44A 5F47A 1RO5A 2QIRA 2FT0A 4CS0B 5AGEA 1Z4EA 2OB0A 3A9LA 3TT2A 4B5OA 5AG7A 2BSWA 4ZBGA 4GS4A 1KUVA 1S3ZA 3T90A 3SXOA 2Z3KA 3TO7A 4CRYB 1S7NA 2GIVA 4I49A 4MFLA 1PUAA 5CNPA 1MJAA 5J8FA 1U6MA 4H6ZA 3FBUA 4XPDB 1UFHA 2HQYA 1B87A 4JD6A 2CNSA 4C2ZA 2ZPAA 3ZZIA 3S6FA 5E96A 5F49A 1ZO0A 3D2PA 1KUXA 5A28A 4CRZB 3D2MA 1I21A 4C68A 4AB7A 1M4IA 1VHSA 4H6UA 3FYNA 3GY9A 4AVAA 1S7KA 1XE4A 2NMTA 2OZHA 4MJ8A 3OWCA 2BEIA 4QUSA 4IUSA 2DXQA 2CY2A 3G8WA 4KSFA 1KUYA 2Z3OA 3S6KA 1MJ9A 3DR6A 2FSRA 4CAFA 2J8MA 2VEZA 4CAXA 2B5GA 2FIWA 2FL4A 2WPXA 3BJ7A 4PK2A 4AVCA 2OU2A 3R9EA 1QSOA 3BLNA 5H86A 3I9SA 1YVOA 2HUZA 2R98A 1IB1E 3R9GA 4A31A 4E2AA 1BOBA 3C26A 4U5YA 2REFA 1WWZA 4B13A 3B8GA 4R3KA 1CJWA 5AG6A 1ON0A 3S6GA 4QC6A 3QB8A 4M3SA 4II9A 4MFPA 3W91A 4R3LA 4J3GA 4KSAA 3W6XA 1XMTA 4Q36A 4F0XA 3EFAA 4CGMA 2J8RA 3JVNA 4MY3A 1S7FA 1QSTA 3MGDA 2Z3LA 2Z3PA 1YR0A 2ZW5A 4NF1A 1KZFA 1XIXA 2P6EA 1S7LA 4HNWB 2YNCC 4CGLA 4CYNA 3NE7A 4H89A 4CAEA 2J8NA 4Y49C 4MY0A 4YFJA 2PRBA 4ONUA 4M85A 5AG5A 4B5PA 3TO6A 2KCWA 2P0WA 4XNHC 5KTCA 1NMTA 5IV0A 2VZZA 2ZW7A 2HV2A 1Q2DA 1I1DA 4LX9A 5F48A 4C7IA 5A27A 1R57A 2YNEA 1I12A 4B14A 4HNXB 4UWIA 4PK3A 2Y0MA 4JJXA 3R95A 1Q2YA 1QSNA 2BL1A 3LD2A 4PSXA 2REEA 4MFQA 1TIQA 1QSRA 5HH1A 5JPHA 1MK4A 2PC1A 3F5BA 1FY7A 4PSWA 4NSQA 4AVBA 2PQ8A 3FIXA 4CAVA 2B5GB 4KLVA 2YNCA 4KS9A 2EUIA 3F0AA 3CXQA 3EY5A 2YNDA 2WPWA 3SHPA 1QSMA 3WR7A 2Z0ZA 2Q0YA 4XPLA 3GYAA 1PU9A 2F5IA 3PZJA 4YRHA 4HNYB 4A2ZA 1VKCA 2I00A 2B4BA 4UCPA 2R7HA 3TO9A 1K4JA 2PR1A 1IYKA 4Q38A 2EVNA 4KUBA 4R87A 4YGOA 3TOAA 2WSAA 2FE7A 1OZPA 5DWNA 3V8IA 4R9MA 2VXKA 4U9ZA 4A95A 4KOXA 2OZGA 4JXRA 3TTHA 4OLLA 2G3TA 1B6BA 4X5KA 5GCNA 1Y7RA 4E8OA 1MJBA 3EC4A 2RC4A 5IB0A 5KTDA 4XPKA 2G3AA 3VWDA 4NEXA 2BUEA 4L89A 1Z9UA 3JTKA 1S60A 4FD4A 4KVXA 3LODA 4B5PB 2B3VA 4B12A 3PP9A 4KZTA 4CYPA 2P6GA 2VI7A 1IYLA 2VZYA 5I0CA 4B10A 2GANA 4UCNA 5G20A 3TFYA 4MFJA 4KOUA 2D4PA 3IWGA 1YREA 2R1IA 1YGHA 2CNTA 3DSBA 4Y49B 5FVJA 5G21A 3F8KA 3DNSA 5G1ZA 1YLEA 2FS5A 4B11A 3ZJ0A 3G3SA 3P2HA 5G22A 2R8VA 4OAEA 2IL4A 4XNHB 3FNCA 2Q44A 2ATRA 4JWPA 3GKRA 3JUWA 4ZGYB 4KVME 4KVOE 2DPTA 1YX0A 2QMLA 3PGPA 3DDDA 2FIAA 4BBHA 2B3UA 4UBRA 1L0CA 3TOBA 4DNCA 2ZW4A 4KOWA 4E0AA 4KOYA 4A33A 4F6AA 3R1KA 4FD5A 4PV6A 4C2XA 5BWAB 1S5KA 1NSLA 2VQYA 4F0YA 2ARHA 3TCVA 4LUAA 4A32A 3IWEA 5HMNA 4EVYA 2B58A 3VWEA 3P2FA 1WK4A 3R96A 4UCMA 3FB3A 2H5MA 3IGRA 2CXAA 2P6FA 2OH1A 4FD7A 3IU1A 4KOTA 4ORFA 1RXTA 2QECA 2Z3MA 4FD6A 2Q04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3G A;  1GHE A;  2ZW6 A;  1M4D A;  2C27 A;  4QBJ A;  1Q2C A;  4KLW A;  4BMH A;  1N71 A;  1CM0 A;  3W6S A;  2I79 A;  4RS2 A;  4MI4 A;  1XF8 A;  3UY5 A;  2JDC A;  3RYO A;  4R57 A;  4HKF A;  2B4D A;  4KUA A;  1Y9W A;  2JEV A;  5IX3 A;  4KOS A;  1NE9 A;  4KOR A;  1SQH A;  5J8C A;  1P4N A;  2JDD A;  4UA3 A;  3FRM A;  4NXY A;  2OZU A;  2PDO A;  1V0C A;  4XPD C;  3E0K A;  4MBU A;  5EC4 A;  2AE6 A;  2CNM A;  2G0B A;  2FXF A;  3T9Y A;  4RI1 A;  5H84 A;  2X7B A;  1YVK A;  2D4O A;  4UWJ A;  3BJ8 A;  3D8P A;  3CXS A;  3SXN A;  5F46 A;  5KTA A;  1Y9K A;  2PR8 A;  2GE3 A;  4QVT A;  2Q7B A;  3TE4 A;  3FXT A;  3R9F A;  4NCZ A;  1J4J A;  1XEB A;  1M1D A;  2K5T A;  1IID A;  4AG9 A;  1YK3 A;  5C82 A;  5DWM A;  1P0H A;  4MHD A;  2JLM A;  3KKW A;  3H4Q A;  4U9Y A;  2Q4V A;  3EXN A;  5C88 A;  2ZXV A;  4IF5 A;  3S6H A;  3EO4 A;  1M4G A;  2AJ6 A;  2O28 A;  4KOV A;  2FCK A;  1IIC A;  2A4N A;  2Z11 A;  3CXP A;  2PSW A;  2B4D B;  4JXQ A;  3K9U A;  4CAW A;  4L8A A;  2VBQ A;  4OAD A;  4QB9 A;  4JLY A;  1BO4 A;  5JQ4 A;  1LRZ A;  4K30 A;  5EBV A;  2Q4Y A;  3DR8 A;  3N7Z A;  2Z10 A;  3D3S A;  3QAH A;  4AG7 A;  5ISV A;  1Z4R A;  1M44 A;  5F47 A;  1RO5 A;  2QIR A;  2FT0 A;  4CS0 B;  1Z4E A;  2OB0 A;  3TT2 A;  4B5O A;  2BSW A;  4ZBG A;  4GS4 A;  1KUV A;  1S3Z A;  3T90 A;  3SXO A;  3TO7 A;  4CRY B;  1S7N A;  2GIV A;  4I49 A;  1PUA A;  5CNP A;  1MJA A;  5J8F A;  1U6M A;  4H6Z A;  3FBU A;  4XPD B;  1UFH A;  2HQY A;  1B87 A;  4JD6 A;  2CNS A;  2ZPA A;  3ZZI A;  3S6F A;  5E96 A;  5F49 A;  3D2P A;  1KUX A;  4CRZ B;  3D2M A;  1I21 A;  4AB7 A;  1M4I A;  1VHS A;  4H6U A;  3FYN A;  3GY9 A;  4AVA A;  1S7K A;  1XE4 A;  2NMT A;  2OZH A;  4MJ8 A;  3OWC A;  2BEI A;  4QUS A;  4IUS A;  2DXQ A;  2CY2 A;  3G8W A;  1KUY A;  3S6K A;  1MJ9 A;  3DR6 A;  2FSR A;  2J8M A;  2VEZ A;  4CAX A;  2B5G A;  2FIW A;  2FL4 A;  2WPX A;  3BJ7 A;  4PK2 A;  4AVC A;  2OU2 A;  3R9E A;  1QSO A;  3BLN A;  5H86 A;  3I9S A;  1YVO A;  2HUZ A;  2R98 A;  1IB1 E;  3R9G A;  4E2A A;  1BOB A;  3C26 A;  4U5Y A;  2REF A;  1WWZ A;  3B8G A;  4R3K A;  1CJW A;  1ON0 A;  3S6G A;  4QC6 A;  3QB8 A;  4M3S A;  4II9 A;  3W91 A;  4R3L A;  4J3G A;  3W6X A;  1XMT A;  3EFA A;  2J8R A;  3JVN A;  4MY3 A;  1S7F A;  1QST A;  3MGD A;  1YR0 A;  2ZW5 A;  4NF1 A;  1KZF A;  1XIX A;  2P6E A;  1S7L A;  4HNW B;  3NE7 A;  4H89 A;  2J8N A;  4Y49 C;  4MY0 A;  4YFJ A;  2PRB A;  4ONU A;  4M85 A;  4B5P A;  3TO6 A;  2KCW A;  2P0W A;  4XNH C;  5KTC A;  1NMT A;  5IV0 A;  2VZZ A;  2ZW7 A;  2HV2 A;  1Q2D A;  1I1D A;  4LX9 A;  5F48 A;  1R57 A;  1I12 A;  4HNX B;  4UWI A;  4PK3 A;  2Y0M A;  4JJX A;  3R95 A;  1Q2Y A;  1QSN A;  2BL1 A;  3LD2 A;  4PSX A;  2REE A;  1TIQ A;  1QSR A;  5HH1 A;  5JPH A;  1MK4 A;  2PC1 A;  3F5B A;  1FY7 A;  4PSW A;  4NSQ A;  4AVB A;  2PQ8 A;  3FIX A;  4CAV A;  2B5G B;  4KLV A;  2EUI A;  3F0A A;  3CXQ A;  3EY5 A;  2WPW A;  3SHP A;  1QSM A;  3WR7 A;  2Z0Z A;  2Q0Y A;  4XPL A;  3GYA A;  1PU9 A;  2F5I A;  3PZJ A;  4YRH A;  4HNY B;  1VKC A;  2I00 A;  2B4B A;  3TO9 A;  2R7H A;  1K4J A;  2PR1 A;  1IYK A;  2EVN A;  4KUB A;  4R87 A;  4YGO A;  3TOA A;  2FE7 A;  1OZP A;  5DWN A;  3V8I A;  4R9M A;  2VXK A;  4U9Z A;  4KOX A;  2OZG A;  4JXR A;  3TTH A;  4OLL A;  2G3T A;  1B6B A;  4X5K A;  5GCN A;  1Y7R A;  4E8O A;  1MJB A;  3EC4 A;  2RC4 A;  5IB0 A;  5KTD A;  4XPK A;  2G3A A;  3VWD A;  4NEX A;  2BUE A;  4L89 A;  1Z9U A;  1S60 A;  4FD4 A;  4KVX A;  3LOD A;  4B5P B;  2B3V A;  3PP9 A;  4KZT A;  2P6G A;  2VI7 A;  1IYL A;  2VZY A;  5I0C A;  2GAN A;  3TFY A;  4KOU A;  2D4P A;  3IWG A;  1YRE A;  2R1I A;  1YGH A;  2CNT A;  3DSB A;  4Y49 B;  5FVJ A;  3F8K A;  3DNS A;  1YLE A;  2FS5 A;  3ZJ0 A;  3G3S A;  3P2H A;  2R8V A;  4OAE A;  2IL4 A;  4XNH B;  3FNC A;  2Q44 A;  2ATR A;  4JWP A;  3GKR A;  3JUW A;  4KVM E;  4KVO E;  1YX0 A;  2QML A;  3PGP A;  3DDD A;  2FIA A;  2B3U A;  4UBR A;  1L0C A;  3TOB A;  4DNC A;  2ZW4 A;  4KOW A;  4E0A A;  4KOY A;  4F6A A;  3R1K A;  4FD5 A;  4PV6 A;  1S5K A;  1NSL A;  2VQY A;  4F0Y A;  2ARH A;  3TCV A;  4LUA A;  5HMN A;  4EVY A;  2B58 A;  3VWE A;  3P2F A;  1WK4 A;  3R96 A;  3FB3 A;  2H5M A;  3IGR A;  2P6F A;  2OH1 A;  4FD7 A;  4KOT A;  4ORF A;  1RXT A;  2QEC A;  4FD6 A;  2Q04 A; 
#chains in the Genus database with same CATH topology
 3I3G A;  1GHE A;  5D29 A;  2C1C A;  5K8M A;  3BI1 A;  2ZW6 A;  2ZEL A;  2DPS A;  1M4D A;  2C27 A;  3B2Y A;  4P45 A;  4QBJ A;  3RBU A;  1YQE A;  1PYT B;  1Q2C A;  3D67 A;  3DGV A;  4KLW A;  4BMH A;  1IOI A;  1N71 A;  4OC0 A;  1CM0 A;  4O23 A;  2I79 A;  4RS2 A;  5LYD A;  2Q7S A;  4MFK A;  4MI4 A;  3W6S A;  1XF8 A;  4EWT A;  3N5F A;  3UY5 A;  3B3S A;  4M6G A;  2JDC A;  4UFV A;  3LAC A;  3RYO A;  4R57 A;  1Q7L A;  5K8O A;  4HKF A;  2PVW A;  2B4D A;  4OC5 A;  2O4H A;  4KUA A;  1Y9W A;  4MMO A;  2XEG A;  4P4I A;  4BD9 A;  4ZYQ A;  3ISX A;  2JEV A;  3QAY A;  4C2Y A;  5IX3 A;  4KOS A;  1NE9 A;  4KOR A;  1SQH A;  5D8N A;  4CGP A;  5J8C A;  2AFZ A;  1P4N A;  2JDD A;  2PJC A;  4R8F A;  4UA3 A;  3FRM A;  4NXY A;  2PJB A;  2OZU A;  2PDO A;  1V0C A;  5AG4 A;  4XPD C;  3E0K A;  3KAS A;  4ZY2 A;  3FEC A;  4MBU A;  4OC2 A;  4CYQ A;  5EC4 A;  1EE3 P;  4OC3 A;  1IGB A;  2AE6 A;  2PJA A;  2CNM A;  4CPA A;  1A2Z A;  5LYF A;  2G0B A;  2FXF A;  5THW A;  2Q51 A;  4PPZ A;  4A30 A;  1X10 A;  3T9Y A;  1BAV A;  3BXM A;  4G1P A;  4TNU A;  4RI1 A;  5H84 A;  3IC1 A;  5ELY A;  5JPH A;  2D4O A;  1YVK A;  2PJ3 A;  2X7B A;  3B3W A;  3FH4 A;  4UWJ A;  3BJ8 A;  2HC9 A;  4MFZ A;  3D8P A;  2EK9 A;  1QMU A;  3CXS A;  3SI2 A;  3SXN A;  1Y9K A;  4C7H A;  2PR8 A;  2WUU A;  5F46 A;  2GE3 A;  4QVT A;  2Q7B A;  1BPM A;  3H8G A;  4JZ0 A;  3TE4 A;  1LAN A;  3FXT A;  3R9F A;  4NCZ A;  1R3N A;  1J4J A;  4F9V A;  1XEB A;  3PB9 X;  3GLJ A;  5HXD A;  1YW6 A;  1M1D A;  1TF9 A;  2K5T A;  1IID A;  1LFW A;  4AG9 A;  4Q7A A;  1YK3 A;  4OP4 A;  3KGQ A;  4R6T A;  5C82 A;  3D7F A;  5DWM A;  1P0H A;  4CGN A;  4MHD A;  3FMC A;  4OME A;  2JLM A;  1Z8T A;  3MN8 A;  4NGP A;  2Z3N A;  3KKW A;  4LQ6 A;  3H4Q A;  4U9Y A;  3RNZ A;  4UFW A;  4OIW A;  2Q4V A;  3EXN A;  4MHY A;  2ZEE A;  3BI0 A;  5C88 A;  2ZXV A;  5JH9 A;  4IF5 A;  1TXR A;  3S6H A;  3WC7 A;  3EO4 A;  4IAV A;  1M4G A;  2AJ6 A;  2O28 A;  2PRQ A;  2FCK A;  4KOV A;  3IU2 A;  4F9U A;  2GRE A;  4NFR A;  1IIC A;  2A4N A;  2PJ1 A;  4UFX A;  1Z5R A;  2ZEN A;  3H5Z A;  4X8I A;  4RUH A;  1TKJ A;  3CXP A;  5LYI A;  4PXB A;  3PFO A;  1RTQ A;  1ELL P;  2PSW A;  2B4D B;  1XOV A;  2ZEH A;  5K8P A;  5LRG A;  5K8N A;  4JXQ A;  3K9U A;  1F2P A;  4CAW A;  4CYO A;  4L8A A;  5JGF A;  4CGO A;  3RZA A;  2VBQ A;  4OAD A;  4QB9 A;  3KHZ A;  4JLY A;  1BO4 A;  2C6P A;  4EFD A;  2IMO A;  2ZED A;  5JQ4 A;  4YU9 A;  2QYV A;  1LRZ A;  2YGW A;  4K30 A;  5EBV A;  2Q4Y A;  3DR8 A;  3PB7 X;  3N7Z A;  2Z10 A;  3D3S A;  2JEW A;  3QAH A;  4M6I A;  3B3T A;  2ABZ A;  4AG7 A;  4NGS A;  5ISV A;  1Z4R A;  3TC8 A;  3NA6 A;  3TX8 A;  1LAP A;  1M44 A;  2ZEF A;  2J9A A;  3ISZ A;  4BIN A;  2F7V A;  5F47 A;  1RO5 A;  2QIR A;  1H8L A;  2FT0 A;  4CS0 B;  4DUK A;  1Z8L A;  1UWY A;  1ARL A;  1ZG8 A;  4MCP A;  4P10 A;  5AGE A;  3NH8 A;  4MCS A;  1Z4E A;  2OB0 A;  3A9L A;  3NE8 A;  4P4F A;  2HB6 A;  2V8D A;  3TT2 A;  4B5O A;  3V7Z A;  5AG7 A;  3K9T A;  2BSW A;  4ZBG A;  4GS4 A;  1KUV A;  3B7I A;  1S3Z A;  3T90 A;  3NH4 A;  2Z3K A;  3SXO A;  1HDU A;  3TO7 A;  4CRY B;  1XFO A;  1S7N A;  1CBX A;  1F2O A;  2PCU A;  5EMI A;  2RFH A;  3KHX A;  4TWE A;  2GIV A;  2CTC A;  3D4U A;  2JBJ A;  4I49 A;  2C6C A;  3PBE A;  2AFU A;  3D7G A;  4MFL A;  1PUA A;  2WYR A;  1Z8X A;  4DYO A;  2PJ9 A;  5CNP A;  1MJA A;  4NGN A;  4OKO A;  5J8F A;  1U6M A;  4H6Z A;  3FBU A;  4ONW A;  4XPD B;  1UFH A;  2HQY A;  4R76 A;  1B87 A;  4JD6 A;  2CNS A;  4C2Z A;  2ZPA A;  3ZZI A;  5HVH A;  3S6F A;  5E96 A;  2OOT A;  5F49 A;  1ZO0 A;  5LYL A;  3D2P A;  1KUX A;  5A28 A;  4CRZ B;  2PJ5 A;  1KWM A;  1I21 A;  3D2M A;  4C68 A;  1X12 A;  3GUX A;  3LMS A;  1M4I A;  1VHS A;  4NGT A;  4PQA A;  4AB7 A;  2V8V A;  3WT4 A;  2BO9 A;  4H6U A;  1FNO A;  3FYN A;  3GY9 A;  4AVA A;  4UEZ A;  1XMB A;  1S7K A;  1XE4 A;  2NMT A;  2OZH A;  3LWU A;  4MJ8 A;  4NGQ A;  4F8Z A;  3OWC A;  2PJ6 A;  2BEI A;  4QUS A;  4WWV A;  4IUS A;  4WJB A;  2DXQ A;  2CY2 A;  3G8W A;  4KSF A;  1KUY A;  2Z3O A;  3RO0 A;  3S6K A;  1MJ9 A;  3DR6 A;  3IFE A;  2FSR A;  4P44 A;  4CAF A;  2J8M A;  2V8G A;  3DLJ A;  3NH5 A;  2BCO A;  2VEZ A;  3CPA A;  4GXH A;  4CAX A;  1LOK A;  2B5G A;  2FIW A;  2FL4 A;  2WPX A;  3BJ7 A;  4MCQ A;  4OC1 A;  1AMP A;  2OU2 A;  4PK2 A;  3R9E A;  4AVC A;  1QSO A;  3BLN A;  5H86 A;  3QNV A;  3I9S A;  2PIY A;  1YVO A;  2HUZ A;  2R98 A;  1IB1 E;  3R9G A;  4A31 A;  3I1U A;  1BOB A;  3C26 A;  4U5Y A;  4E2A A;  2ZEG A;  2REF A;  4H2K A;  4MHN A;  1CP7 A;  1WWZ A;  1FT7 A;  1ZLI A;  3B8G A;  4P4D A;  4B13 A;  4R3K A;  2GLF A;  1CJW A;  5AG6 A;  3WAB A;  1ON0 A;  3S6G A;  2ZOF A;  4QC6 A;  5KTA A;  2NSM A;  1XJO A;  3SJE A;  3QB8 A;  4M3S A;  4MCR A;  1ZG7 A;  4II9 A;  4MFP A;  3W91 A;  5F09 A;  4A37 A;  4R3L A;  4J3G A;  4ZY1 A;  4NGR A;  3SI0 A;  3SJX A;  1ELM P;  4KSA A;  3W6X A;  4RN7 A;  1XMT A;  4Q36 A;  2ZEP A;  2Q43 A;  1VHE A;  1IU8 A;  4F0X A;  3PB6 X;  3EFA A;  4X3R A;  2J8R A;  3JVN A;  4CGM A;  4MY3 A;  5HVG A;  1S7F A;  1QST A;  3MGD A;  2Z3L A;  2Z3P A;  3CT9 A;  1YR0 A;  2ZW5 A;  4NF1 A;  3PB8 X;  3SJF A;  1KZF A;  1XIX A;  2P6E A;  2V8H A;  3KQZ A;  3S9M A;  1S7L A;  4HNW B;  2YNC C;  4CGL A;  4CYN A;  3NE7 A;  4H89 A;  4CAE A;  2J8N A;  3FED A;  4Y49 C;  3B3V A;  4MY0 A;  4YFJ A;  2BOA A;  2PRB A;  1R43 A;  2OR4 A;  2FVG A;  4ONU A;  4M85 A;  5AG5 A;  4HPS A;  4B5P A;  3TO6 A;  2PJ0 A;  2KCW A;  2WZN A;  1CX8 A;  2P0W A;  4XNH C;  5KTC A;  2PJ8 A;  1NMT A;  5IV0 A;  2VZZ A;  2ZW7 A;  1CPX A;  2HV2 A;  1Q2D A;  2XEJ A;  1I1D A;  3VAT A;  4LX9 A;  2PVV A;  3SJG A;  5F48 A;  4C7I A;  3GB0 A;  5A27 A;  1R57 A;  2YNE A;  1I12 A;  2O53 A;  4B14 A;  4HNX B;  4UWI A;  4PK3 A;  1ARM A;  1IY7 A;  1CP6 A;  2Y0M A;  4JJX A;  3KI9 A;  3R95 A;  1Q2Y A;  1QSN A;  4UEF A;  3KR5 A;  3T8W A;  2EBJ A;  2BL1 A;  3SI1 A;  3LD2 A;  4PSX A;  4EME A;  1M4L A;  1Z2L A;  2REE A;  2IQ6 A;  1TIQ A;  1QSR A;  4MFQ A;  5I4M A;  4NGM A;  4UF4 A;  5HH1 A;  1MK4 A;  1DE4 C;  2PC1 A;  1FY7 A;  3F5B A;  4PSW A;  3D68 A;  1TF8 A;  4NSQ A;  5JM6 A;  4AVB A;  2GFQ A;  2JBK A;  2PQ8 A;  3FIX A;  6CPA A;  4CAV A;  4B6Z A;  4YWY A;  2B5G B;  4KLV A;  1LCP A;  2YNC A;  3S9N A;  1GYT A;  4KS9 A;  4MXU A;  2EUI A;  1NSA A;  1YLO A;  4ZY0 A;  3F0A A;  2Q4Z A;  3CXQ A;  3EY5 A;  4IK2 A;  2YND A;  3D7D A;  2AFX A;  1F57 A;  2WPW A;  3SHP A;  1ZG9 A;  1QSM A;  3D7H A;  4P4J A;  3PB4 X;  4OC4 A;  3WR7 A;  2Z0Z A;  4R7M A;  5CBM A;  2Q0Y A;  4XPL A;  3GYA A;  1PU9 A;  2F5I A;  2NYQ A;  4FUU A;  3PZJ A;  4YRH A;  4HNY B;  4A2Z A;  5DS0 A;  2CIJ A;  4A39 A;  4ZI6 A;  2AFO A;  1VHO A;  1VKC A;  2I00 A;  2B4B A;  4UCP A;  1Z8W A;  2R7H A;  1K4J A;  2PR1 A;  2RB7 A;  1IYK A;  1TKF A;  3TO9 A;  2G9D A;  4Q38 A;  3IEH A;  2EVN A;  2VL1 A;  3L2N A;  4KUB A;  4R87 A;  4YGO A;  3TOA A;  2WSA A;  1CPS A;  1OZP A;  2FE7 A;  5DWN A;  3V8I A;  4R9M A;  2VXK A;  4U9Z A;  4A95 A;  3KR4 A;  4IHM A;  1LAM A;  4KOX A;  4GM5 A;  2OZG A;  1JWQ A;  4JXR A;  3TTH A;  2PJ7 A;  7CPA A;  3PRT A;  3IO1 A;  4OLL A;  2G3T A;  1B6B A;  3D66 A;  4X5K A;  2POK A;  1Y0Y A;  5GCN A;  1Y7R A;  4E8O A;  1MJB A;  3EC4 A;  2RC4 A;  5IB0 A;  1HEE A;  5KTD A;  2PIZ A;  2G3A A;  2ZOG A;  4XPK A;  3VWD A;  3FEE A;  4NEX A;  2BUE A;  4L89 A;  1TKH A;  4NJQ A;  1Z9U A;  2GU2 A;  3JTK A;  3KQX A;  1S60 A;  1DTD A;  4FD4 A;  4KVX A;  3LOD A;  4B5P B;  2B3V A;  2AFM A;  4K3N A;  2EWB A;  3IIB A;  4FD6 A;  4B12 A;  1VIX A;  3PP9 A;  4KZT A;  4UIA A;  2EK8 A;  4CYP A;  2PE3 A;  2DF5 A;  2AFW A;  1XRY A;  2P6G A;  1Y0R A;  2VI7 A;  1IYL A;  2VZY A;  3FF3 A;  5I0C A;  4M6H A;  4B10 A;  2GAN A;  1AUG A;  1JQG A;  3K2K A;  4UCN A;  5G20 A;  4A38 A;  2CF4 A;  3TFY A;  3HLP A;  4MFJ A;  5LRK A;  3GIU A;  4KOU A;  2D4P A;  5IB9 A;  4UEE A;  4MHZ A;  4FAI A;  1YME A;  2QVP A;  3IWG A;  1YRE A;  4OID A;  2R1I A;  4FWU A;  8CPA A;  4UIB A;  2CTB A;  1YGH A;  3VH9 A;  3H8F A;  3KZW A;  2CNT A;  3DSB A;  4Y49 B;  5FVJ A;  5G21 A;  2QJ8 A;  3DNS A;  3F8K A;  5G1Z A;  1YLE A;  2PJ2 A;  2FS5 A;  4B11 A;  4ZX8 A;  4LQG A;  3JRU A;  5HVF A;  3RAM A;  3ZJ0 A;  3S9L A;  3G3S A;  1BPN A;  1ZLH A;  3P2H A;  5G22 A;  3CZX A;  2R8V A;  4OAE A;  4ZX9 A;  2IL4 A;  4XNH B;  3FNC A;  3B3C A;  2Q44 A;  2ATR A;  1Y7E A;  4JWP A;  3GKR A;  2C6G A;  3JUW A;  4ZGY B;  1PCA A;  4KVM E;  4KVO E;  4NJR A;  1OBR A;  1IOF A;  2DPT A;  2ZEM A;  3FX6 A;  3NFZ A;  1YX0 A;  2QML A;  3PGP A;  1YW4 A;  5LRJ A;  3DDD A;  4PXC A;  2FIA A;  3WC6 A;  4MHP A;  4BBH A;  3H8E A;  2ZEO A;  2B3U A;  3CDX A;  4UBR A;  4X2T A;  4FBE A;  1L0C A;  1AYE A;  3B35 A;  3TOB A;  4DNC A;  2PJ4 A;  2ZW4 A;  4KOW A;  4W9Y A;  4E0A A;  1CG2 A;  1QQ9 A;  4KOY A;  4A33 A;  4F6A A;  1HDQ A;  2V77 A;  3FVL A;  3R1K A;  4FD5 A;  4PV6 A;  4C2X A;  1BLL E;  4PXD A;  5BWA B;  1S5K A;  4P4B A;  1NSL A;  5CPA A;  2VQY A;  3VAR A;  4JYW A;  4F0Y A;  4A94 A;  2ARH A;  3TCV A;  4LUA A;  4A32 A;  4P4E A;  4Z65 A;  3IWE A;  3HUV A;  4P6Y A;  1XBU A;  3MRU A;  5HMN A;  4EVY A;  3PBB A;  3V38 A;  4AXV A;  2B58 A;  2ANP A;  2EO8 A;  2IJZ A;  3CPX A;  3FJU A;  4PXE A;  1YSJ A;  3KL9 A;  4DJL A;  2DEA A;  2ODF A;  2XEI A;  3IJ3 A;  4MRI A;  3WC5 A;  3VWE A;  3P2F A;  1WK4 A;  3R96 A;  5J1Q A;  1VGY A;  3PFE A;  4KSI A;  2I3C A;  4UCM A;  3FB3 A;  2AFS A;  2H5M A;  3IWW A;  3IGR A;  2CXA A;  2P6F A;  3BHX A;  3PEI A;  2OH1 A;  2GLJ A;  3IU1 A;  2F8H A;  2XEF A;  4FD7 A;  1RXT A;  4KOT A;  2QEC A;  4ORF A;  2Z3M A;  2Z11 A;  2Q04 A; 
#chains in the Genus database with same CATH homology
 3I3G A;  1GHE A;  2ZW6 A;  2DPS A;  1M4D A;  2C27 A;  4QBJ A;  1Q2C A;  4KLW A;  4BMH A;  1N71 A;  1CM0 A;  3W6S A;  2I79 A;  4RS2 A;  4MFK A;  4MI4 A;  1XF8 A;  3UY5 A;  2JDC A;  4UFV A;  3RYO A;  4R57 A;  4HKF A;  2B4D A;  4KUA A;  1Y9W A;  2JEV A;  4C2Y A;  5IX3 A;  4KOS A;  1NE9 A;  4KOR A;  1SQH A;  4CGP A;  5J8C A;  1P4N A;  2JDD A;  4UA3 A;  3FRM A;  4NXY A;  2OZU A;  2PDO A;  1V0C A;  5AG4 A;  4XPD C;  3E0K A;  4MBU A;  4CYQ A;  5EC4 A;  2AE6 A;  2CNM A;  2G0B A;  2FXF A;  4A30 A;  3T9Y A;  4RI1 A;  5H84 A;  2X7B A;  1YVK A;  2D4O A;  4UWJ A;  3BJ8 A;  4MFZ A;  3D8P A;  3CXS A;  3SXN A;  4C7H A;  5F46 A;  1Y9K A;  5KTA A;  2PR8 A;  2WUU A;  2GE3 A;  4QVT A;  2Q7B A;  3TE4 A;  3FXT A;  3R9F A;  4NCZ A;  1J4J A;  1XEB A;  1M1D A;  2K5T A;  1IID A;  4AG9 A;  1YK3 A;  5C82 A;  5DWM A;  1P0H A;  4CGN A;  4MHD A;  2JLM A;  2Z3N A;  3KKW A;  3H4Q A;  4U9Y A;  4UFW A;  2Q4V A;  3EXN A;  5C88 A;  2ZXV A;  4IF5 A;  3S6H A;  3EO4 A;  1M4G A;  2AJ6 A;  2O28 A;  4KOV A;  2FCK A;  3IU2 A;  1IIC A;  2A4N A;  4UFX A;  3H5Z A;  2Z11 A;  3CXP A;  2PSW A;  2B4D B;  4JXQ A;  3K9U A;  4CYO A;  4CAW A;  4L8A A;  4CGO A;  2VBQ A;  4OAD A;  4QB9 A;  4JLY A;  1BO4 A;  5JQ4 A;  1LRZ A;  2YGW A;  4K30 A;  5EBV A;  2Q4Y A;  3DR8 A;  3N7Z A;  2Z10 A;  3D3S A;  3QAH A;  4AG7 A;  5ISV A;  1Z4R A;  1M44 A;  5F47 A;  1RO5 A;  2QIR A;  2FT0 A;  4CS0 B;  5AGE A;  1Z4E A;  2OB0 A;  3A9L A;  3TT2 A;  4B5O A;  5AG7 A;  2BSW A;  4ZBG A;  4GS4 A;  1KUV A;  1S3Z A;  3T90 A;  3SXO A;  2Z3K A;  3TO7 A;  4CRY B;  1S7N A;  2GIV A;  4I49 A;  4MFL A;  1PUA A;  5CNP A;  1MJA A;  5J8F A;  1U6M A;  4H6Z A;  3FBU A;  4XPD B;  1UFH A;  2HQY A;  1B87 A;  4JD6 A;  2CNS A;  4C2Z A;  2ZPA A;  3ZZI A;  3S6F A;  5E96 A;  5F49 A;  1ZO0 A;  3D2P A;  1KUX A;  5A28 A;  4CRZ B;  3D2M A;  1I21 A;  4C68 A;  4AB7 A;  1M4I A;  1VHS A;  4H6U A;  3FYN A;  3GY9 A;  4AVA A;  1S7K A;  1XE4 A;  2NMT A;  2OZH A;  4MJ8 A;  3OWC A;  2BEI A;  4QUS A;  4IUS A;  2DXQ A;  2CY2 A;  3G8W A;  4KSF A;  1KUY A;  2Z3O A;  3S6K A;  1MJ9 A;  3DR6 A;  2FSR A;  4CAF A;  2J8M A;  2VEZ A;  4CAX A;  2B5G A;  2FIW A;  2FL4 A;  2WPX A;  3BJ7 A;  4PK2 A;  4AVC A;  2OU2 A;  3R9E A;  1QSO A;  3BLN A;  5H86 A;  3I9S A;  1YVO A;  2HUZ A;  2R98 A;  1IB1 E;  3R9G A;  4A31 A;  4E2A A;  1BOB A;  3C26 A;  4U5Y A;  2REF A;  1WWZ A;  4B13 A;  3B8G A;  4R3K A;  1CJW A;  5AG6 A;  1ON0 A;  3S6G A;  4QC6 A;  3QB8 A;  4M3S A;  4II9 A;  4MFP A;  3W91 A;  4R3L A;  4J3G A;  4KSA A;  3W6X A;  1XMT A;  4Q36 A;  4F0X A;  3EFA A;  4CGM A;  2J8R A;  3JVN A;  4MY3 A;  1S7F A;  1QST A;  3MGD A;  2Z3L A;  2Z3P A;  1YR0 A;  2ZW5 A;  4NF1 A;  1KZF A;  1XIX A;  2P6E A;  1S7L A;  4HNW B;  2YNC C;  4CGL A;  4CYN A;  3NE7 A;  4H89 A;  4CAE A;  2J8N A;  4Y49 C;  4MY0 A;  4YFJ A;  2PRB A;  4ONU A;  4M85 A;  5AG5 A;  4B5P A;  3TO6 A;  2KCW A;  2P0W A;  4XNH C;  5KTC A;  1NMT A;  5IV0 A;  2VZZ A;  2ZW7 A;  2HV2 A;  1Q2D A;  1I1D A;  4LX9 A;  5F48 A;  4C7I A;  5A27 A;  1R57 A;  2YNE A;  1I12 A;  4B14 A;  4HNX B;  4UWI A;  4PK3 A;  2Y0M A;  4JJX A;  3R95 A;  1Q2Y A;  1QSN A;  2BL1 A;  3LD2 A;  4PSX A;  2REE A;  4MFQ A;  1TIQ A;  1QSR A;  5HH1 A;  5JPH A;  1MK4 A;  2PC1 A;  3F5B A;  1FY7 A;  4PSW A;  4NSQ A;  4AVB A;  2PQ8 A;  3FIX A;  4CAV A;  2B5G B;  4KLV A;  2YNC A;  4KS9 A;  2EUI A;  3F0A A;  3CXQ A;  3EY5 A;  2YND A;  2WPW A;  3SHP A;  1QSM A;  3WR7 A;  2Z0Z A;  2Q0Y A;  4XPL A;  3GYA A;  1PU9 A;  2F5I A;  3PZJ A;  4YRH A;  4HNY B;  4A2Z A;  1VKC A;  2I00 A;  2B4B A;  4UCP A;  2R7H A;  3TO9 A;  1K4J A;  2PR1 A;  1IYK A;  4Q38 A;  2EVN A;  4KUB A;  4R87 A;  4YGO A;  3TOA A;  2WSA A;  2FE7 A;  1OZP A;  5DWN A;  3V8I A;  4R9M A;  2VXK A;  4U9Z A;  4A95 A;  4KOX A;  2OZG A;  4JXR A;  3TTH A;  4OLL A;  2G3T A;  1B6B A;  4X5K A;  5GCN A;  1Y7R A;  4E8O A;  1MJB A;  3EC4 A;  2RC4 A;  5IB0 A;  5KTD A;  4XPK A;  2G3A A;  3VWD A;  4NEX A;  2BUE A;  4L89 A;  1Z9U A;  3JTK A;  1S60 A;  4FD4 A;  4KVX A;  3LOD A;  4B5P B;  2B3V A;  4B12 A;  3PP9 A;  4KZT A;  4CYP A;  2P6G A;  2VI7 A;  1IYL A;  2VZY A;  5I0C A;  4B10 A;  2GAN A;  4UCN A;  5G20 A;  3TFY A;  4MFJ A;  4KOU A;  2D4P A;  3IWG A;  1YRE A;  2R1I A;  1YGH A;  2CNT A;  3DSB A;  4Y49 B;  5FVJ A;  5G21 A;  3F8K A;  3DNS A;  5G1Z A;  1YLE A;  2FS5 A;  4B11 A;  3ZJ0 A;  3G3S A;  3P2H A;  5G22 A;  2R8V A;  4OAE A;  2IL4 A;  4XNH B;  3FNC A;  2Q44 A;  2ATR A;  4JWP A;  3GKR A;  3JUW A;  4ZGY B;  4KVM E;  4KVO E;  2DPT A;  1YX0 A;  2QML A;  3PGP A;  3DDD A;  2FIA A;  4BBH A;  2B3U A;  4UBR A;  1L0C A;  3TOB A;  4DNC A;  2ZW4 A;  4KOW A;  4E0A A;  4KOY A;  4A33 A;  4F6A A;  3R1K A;  4FD5 A;  4PV6 A;  4C2X A;  5BWA B;  1S5K A;  1NSL A;  2VQY A;  4F0Y A;  2ARH A;  3TCV A;  4LUA A;  4A32 A;  3IWE A;  5HMN A;  4EVY A;  2B58 A;  3VWE A;  3P2F A;  1WK4 A;  3R96 A;  4UCM A;  3FB3 A;  2H5M A;  3IGR A;  2CXA A;  2P6F A;  2OH1 A;  4FD7 A;  3IU1 A;  4KOT A;  4ORF A;  1RXT A;  2QEC A;  2Z3M A;  4FD6 A;  2Q04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...