1Q2YA

Crystal structure of the protein yjcf from bacillus subtilis: a member of the gcn5-related n-acetyltransferase superfamily fold
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
140
structure length
140
Chain Sequence
b'MKAVIAKNEEQLKDAFYVREEVFVKEQNVPAEEEIDELENESEHIVVYDGEKPVGAGRWRMKDGYGKLERICVLKSHRSAGVGGIIMKALEKAAADGGASGFILNAQTQAVPFYKKHGYRVLSEKEFLDAGIPHLQMMKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords similar to hypothetical proteins
molecule tags Structural genomics, unknown function
source organism Bacillus subtilis
publication title Crystal structure of the protein YJCF from Bacillus subtilis: a member of the GCN5-related N-acetyltransferase superfamily
rcsb
total genus 39
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1q2yA00
4XPDC 4U9YA 1KUYA 2G3TA 2FL4A 2ZW6A 3FB3A 2WPXA 4Y49B 1M4IA 2GANA 3N7ZA 4PSXA 1IIDA 4AG7A 1PU9A 1QSRA 4QVTA 1NMTA 3R95A 4H89A 4R3LA 2HQYA 4UA3A 2JDCA 2NMTA 2JDDA 4XPKA 1WK4A 4MHDA 4DNCA 4CRYB 3S6GA 3TO7A 2PQ8A 4AVCA 3EC4A 2I00A 3TE4A 2VZZA 3BJ8A 3RYOA 4ZBGA 2CNMA 5DWMA 2O28A 3FYNA 4M85A 3EXNA 4JD6A 1K4JA 5C88A 4ONUA 4PK2A 5JQ4A 4KORA 2VQYA 1V0CA 1IICA 2D4OA 3TFYA 3OWCA 5EC4A 2OZUA 1M44A 4KOXA 4B5PB 2ZPAA 1Q2DA 3FBUA 2FE7A 3VWEA 3IGRA 5JPHA 1SQHA 4JWPA 2VI7A 2K5TA 4KOSA 2I79A 4FD7A 1S7LA 2HV2A 4HNWB 1MJAA 3CXSA 4NSQA 3DDDA 4KVME 1M4GA 3IWGA 2B4DB 4R87A 4RI1A 4KLWA 1MK4A 4H6ZA 4KOYA 3TCVA 4KVOE 5F46A 2RC4A 2Q7BA 1P0HA 4U9ZA 4MY3A 1Y9WA 2QIRA 2P0WA 2Z0ZA 1RO5A 1S5KA 2PC1A 4RS2A 4OAEA 2G3AA 5HH1A 1YREA 4LX9A 2PSWA 5H84A 2ZW7A 3H4QA 2OU2A 2JLMA 3F8KA 4F6AA 3C26A 2J8MA 1B87A 4R9MA 3K9UA 1IB1E 1M4DA 1GHEA 3VWDA 2FIWA 3F0AA 3BLNA 1YGHA 3PP9A 1Q2YA 1S7KA 1VHSA 2J8NA 4L89A 3R9EA 1QSTA 3SHPA 4YGOA 2OZGA 4AVAA 3LODA 3D3SA 2PR1A 4IUSA 2B5GB 4I49A 2FSRA 4KOTA 5GCNA 4HKFA 3FXTA 2VZYA 1FY7A 2P6GA 4PV6A 5KTDA 1P4NA 3WR7A 1XMTA 2Q44A 1BO4A 4Y49C 5F49A 1S60A 4KOUA 2CY2A 1NE9A 2OH1A 4XPDB 3TOAA 4OADA 2VXKA 2WPWA 4AB7A 1Z9UA 3LD2A 2PRBA 3W6SA 2Z10A 2ZXVA 2VBQA 3S6HA 3V8IA 2Q4VA 4XPLA 5FVJA 2CNSA 1I12A 3E0KA 3EO4A 4MJ8A 1QSNA 2B4DA 4JLYA 4FD6A 2X7BA 2GE3A 1WWZA 2Q04A 1XEBA 3R9GA 3FNCA 4F0YA 2REFA 4CAVA 2R7HA 4HNYB 3PZJA 4MI4A 3QAHA 3W6XA 3JUWA 4XNHB 2BEIA 3G8WA 1UFHA 1S7NA 2J8RA 1IYLA 2QMLA 5I0CA 2KCWA 4UWIA 4FD5A 5J8FA 3T9YA 4R3KA 3TO9A 4X5KA 5DWNA 2OB0A 4E0AA 2Y0MA 3FRMA 4E8OA 2B3UA 4XNHC 5F48A 4B5PA 4M3SA 4KUAA 5F47A 3GY9A 2A4NA 3DR8A 2PDOA 1YLEA 4KZTA 1Q2CA 1BOBA 2R8VA 4MY0A 1KUVA 3R1KA 4EVYA 1TIQA 2G0BA 4PSWA 3T90A 3S6KA 3EFAA 1MJ9A 2H5MA 4NXYA 1IYKA 1YK3A 3B8GA 1N71A 3P2HA 4R57A 1M1DA 1I21A 1XIXA 3JVNA 4QUSA 3TOBA 2EVNA 3GYAA 3SXNA 4GS4A 4PK3A 2B5GA 5IB0A 1NSLA 1R57A 4NF1A 4OLLA 4ORFA 2AJ6A 2GIVA 4E2AA 3D8PA 4KUBA 3TO6A 4UBRA 1ON0A 2ZW4A 1U6MA 2Z11A 5H86A 3P2FA 4KLVA 5IV0A 3TT2A 1Y9KA 2R98A 4AVBA 2P6FA 4K30A 2CNTA 5E96A 1Y7RA 1QSMA 3W91A 5KTCA 1VKCA 2FCKA 2BUEA 3FIXA 3I9SA 3KKWA 2FS5A 4U5YA 2B3VA 3NE7A 1YVKA 3ZZIA 1LRZA 2AE6A 3QB8A 4KOVA 3PGPA 1QSOA 3MGDA 2QECA 5IX3A 2BSWA 4KVXA 5J8CA 2P6EA 3I3GA 3TTHA 2B4BA 4YFJA 3BJ7A 2ZW5A 3SXOA 2D4PA 2IL4A 3R9FA 4AG9A 4CAWA 1Z4RA 5ISVA 3UY5A 4UWJA 5CNPA 3D2MA 2Q4YA 5EBVA 5KTAA 3F5BA 4NEXA 4JXQA 1L0CA 4H6UA 1KZFA 2OZHA 4II9A 2ARHA 1S3ZA 2VEZA 2R1IA 4J3GA 1MJBA 3S6FA 5C82A 2FT0A 2FXFA 4JXRA 4BMHA 4L8AA 3EY5A 5HMNA 4HNXB 2JEVA 3G3SA 2HUZA 1YVOA 1YX0A 4JJXA 4CS0B 4YRHA 2C27A 2F5IA 1KUXA 1XF8A 4QB9A 3R96A 4MBUA 1XE4A 3DR6A 1CJWA 4IF5A 2BL1A 2Q0YA 1Z4EA 3ZJ0A 2REEA 2FIAA 4KOWA 3CXPA 3DNSA 1OZPA 4LUAA 4QBJA 1B6BA 4QC6A 2DXQA 1CM0A 2ATRA 1I1DA 3DSBA 4B5OA 4CRZB 1YR0A 4CAXA 1RXTA 3GKRA 3D2PA 4NCZA 1PUAA 4FD4A 2B58A 2EUIA 3CXQA 2PR8A 1S7FA 1J4JA
chains in the Genus database with same CATH superfamily
4XPDC 4U9YA 1KUYA 2AFOA 2BO9A 2G3TA 2FL4A 3H5ZA 2ZW6A 1FT7A 3FB3A 2C1CA 2WPXA 3IU2A 4R76A 4Y49B 1M4IA 2GANA 2V77A 4K3NA 4CGLA 3WC7A 3N7ZA 4PSXA 1HDQA 4R7MA 1IIDA 3CPAA 4X2TA 1PU9A 4AG7A 4CYNA 5LRGA 1QSRA 2NSMA 4QVTA 1NMTA 3KQXA 6CPAA 3R95A 2CF4A 4H89A 4R3LA 2HQYA 4UA3A 2JDCA 2NMTA 2AFUA 1YQEA 2JDDA 3PRTA 2Z3NA 3CZXA 4XPKA 5A28A 1Q7LA 1WK4A 2V8DA 2ZEHA 4IHMA 4YWYA 1LANA 3IC1A 4MHDA 4A30A 1BAVA 2PJ0A 4CRYB 4DNCA 3S6GA 3DGVA 3TO7A 2PQ8A 4NGMA 1XBUA 4AVCA 3IWWA 1AUGA 5G20A 3EC4A 2WUUA 2ZEMA 3RNZA 2I00A 4UFXA 3TE4A 3HUVA 4B10A 2VZZA 4C7HA 4DJLA 4CAEA 4EFDA 3BJ8A 3RYOA 4ZBGA 2CNMA 2Q4ZA 1Z8XA 5DWMA 2AFWA 2PCUA 2O28A 4CAFA 3FYNA 4M85A 1IOFA 3EXNA 1ZG7A 4JD6A 5CBMA 1K4JA 1LFWA 4ONUA 4PK2A 5C88A 5JQ4A 2POKA 3PBEA 1M4LA 4KORA 3IJ3A 4UIBA 4B6ZA 2J9AA 4P4EA 3HLPA 4NGPA 2VQYA 2GLFA 5G1ZA 4C2ZA 3SJGA 2F7VA 1CG2A 3D7HA 1V0CA 3WC6A 5LYLA 4Z65A 2ZEOA 1IICA 5ELYA 2D4OA 3TFYA 1OBRA 3OWCA 3NA6A 4MXUA 5EC4A 2ZOFA 1YMEA 2OZUA 1M44A 4KOXA 2GFQA 3WABA 4B5PB 2ZPAA 1Q2DA 3FBUA 3H8FA 1VHOA 2FE7A 3VWEA 3IGRA 4IAVA 5JPHA 1SQHA 2XEIA 2VI7A 2K5TA 4JWPA 4PXCA 3KASA 2I79A 4KOSA 1TXRA 4UEFA 3TX8A 2ZEPA 3SI0A 4FD7A 1S7LA 2HV2A 4HNWB 1MJAA 3CXSA 4NSQA 4R8FA 3DDDA 1VHEA 4KVME 4OKOA 8CPAA 4BD9A 1M4GA 3IWGA 2B4DB 4MHPA 2HB6A 4R87A 3SJEA 3D7GA 4RI1A 1ZO0A 1XJOA 4KLWA 1MK4A 1XRYA 2F8HA 4H6ZA 1Y7EA 4NGRA 4KOYA 3TCVA 4MFZA 2GLJA 3V7ZA 4KVOE 5F46A 3NH8A 4NGNA 2RC4A 3KR4A 2Q7BA 1P0HA 4U9ZA 2Z3LA 4KSIA 2QIRA 1Y9WA 4MY3A 2P0WA 2Z0ZA 1RO5A 1S5KA 2DF5A 3D7FA 2PC1A 3FJUA 4RS2A 4OAEA 2G3AA 1HEEA 5HH1A 4ZGYB 1YREA 4LX9A 3WC5A 5HVGA 2WSAA 2I3CA 2PSWA 5H84A 4MRIA 1UWYA 2ZW7A 3H4QA 2OU2A 4C2YA 4YU9A 5K8OA 2JLMA 3F8KA 2JBJA 3B3WA 4A95A 2ZEGA 4F6AA 3D4UA 3KQZA 4A37A 2ZOGA 3C26A 2J8MA 1B87A 4R9MA 1RTQA 2CIJA 3K9UA 4A33A 1IB1E 2EK8A 3B3TA 3RAMA 1ZG9A 4UCMA 1M4DA 1GHEA 4P4JA 2PVWA 3JRUA 4MHNA 3CPXA 2FIWA 3VWDA 3F0AA 4OMEA 1IGBA 3BLNA 4M6GA 1F57A 1YGHA 3PB7X 3PP9A 5CPAA 5J1QA 1Q2YA 2PJ1A 1S7KA 2AFSA 1VHSA 3IEHA 4PPZA 1Y0YA 1PYTB 2AFMA 2J8NA 4L89A 3MN8A 3R9EA 4KSAA 1QSTA 3SHPA 1YSJA 2PJBA 1HDUA 4W9YA 4YGOA 3GB0A 1GYTA 2VL1A 2OZGA 4AVAA 3LODA 3D3SA 2PR1A 3KHXA 3LACA 4CYPA 4IUSA 4O23A 2B5GB 5HXDA 3WT4A 2YNCA 4I49A 4MCRA 4F0XA 2EK9A 2FSRA 2PVVA 2Z3MA 4KOTA 4OC4A 5GCNA 4HKFA 4CGMA 3FXTA 2OR4A 5LYIA 1ARMA 1KWMA 2VZYA 1FY7A 2P6GA 4OC3A 2IJZA 4KSFA 4NJRA 4PV6A 4P6YA 5IB9A 5KTDA 2DPTA 4MCQA 4P4IA 1CP7A 5G21A 1R43A 2Q43A 3PB8X 2QJ8A 4ONWA 4WWVA 5JM6A 1CBXA 1P4NA 4EMEA 4MFPA 5LRJA 3WR7A 1XMTA 2Q44A 1BO4A 4Y49C 5F49A 1S60A 3B3CA 4KOUA 4C68A 1DE4C 2CY2A 1NE9A 3ISZA 2OH1A 4XPDB 3TOAA 4OADA 1Z5RA 2VXKA 2WPWA 3KHZA 4AB7A 1FNOA 1Z9UA 3LD2A 2PRBA 4P4DA 4B11A 1DTDA 3S9LA 4MHYA 2Z10A 3W6SA 2ZXVA 4A94A 2VBQA 1QQ9A 3N5FA 3S6HA 4B12A 3V8IA 2AFXA 2Q4VA 2WZNA 4UEEA 4XPLA 5FVJA 1JWQA 4P44A 2CNSA 3VARA 1CX8A 3B3SA 1I12A 2O4HA 3E0KA 4CYQA 3EO4A 4MJ8A 2YGWA 4JYWA 1QSNA 4UIAA 2B4DA 4JLYA 4BBHA 4UFVA 2JEWA 4FD6A 2X7BA 2GE3A 1WWZA 2ZENA 2EBJA 2EO8A 3SJXA 2Q04A 4MMOA 4JZ0A 1XEBA 2WYRA 3R9GA 2C6CA 3FNCA 4F0YA 2REFA 2PRQA 5THWA 3FF3A 2AFZA 4CAVA 4G1PA 1IOIA 1IU8A 4MCPA 4C2XA 2R7HA 4HNYB 4OIWA 4WJBA 3PZJA 4MI4A 2PJCA 4UCNA 3QAHA 3W6XA 1Y0RA 3JUWA 4XNHB 2Q7SA 3NH5A 3KGQA 2BEIA 3G8WA 4X3RA 4OC1A 1UFHA 4IK2A 3V38A 2PJ4A 2FVGA 2XEGA 5HVFA 5D29A 4HPSA 4NGTA 2XEFA 4ZX8A 4H2KA 1S7NA 2J8RA 4ZYQA 1IYLA 2QMLA 2YNEA 2G9DA 2KCWA 3CDXA 1XFOA 4UWIA 4GM5A 3JTKA 4FD5A 5I0CA 5J8FA 3T9YA 4R3KA 4FAIA 3TO9A 1ZG8A 3ISXA 4X5KA 2YNCC 5DWNA 2OB0A 4E0AA 4NJQA 2Y0MA 3FRMA 4E8OA 5BWAB 2B3UA 4XNHC 1F2OA 5AG5A 2PJ8A 5F48A 1NSAA 3RZAA 3TC8A 3GUXA 4B5PA 3B2YA 2CTBA 4KUAA 4M3SA 4X8IA 1CPXA 5F47A 2NYQA 3GY9A 2RFHA 5JGFA 2A4NA 1A2ZA 3DR8A 1YLOA 4P10A 4RUHA 2PDOA 1YLEA 4KZTA 4P4FA 1Q2CA 1BOBA 2R8VA 4FUUA 4OIDA 2PJ2A 4MY0A 1KUVA 2BCOA 3GLJA 4A31A 4F9UA 4OP4A 2IQ6A 3R1KA 1ELLP 3IWEA 4EVYA 2O53A 1TIQA 1QMUA 1TKHA 4FBEA 4UCPA 2G0BA 4PSWA 3T90A 3S6KA 3EFAA 1MJ9A 2H5MA 3BI0A 4NXYA 1IYKA 1VGYA 5F09A 3D68A 3BI1A 1YK3A 3B8GA 1N71A 3P2HA 4CGPA 4B14A 4R57A 1M1DA 1I21A 1XIXA 3JVNA 4QUSA 3TOBA 2EVNA 3GYAA 1ELMP 3BHXA 2Z3PA 3RBUA 2ABZA 3SXNA 4DYOA 3SI2A 3NH4A 4GS4A 4PK3A 4ZY1A 2B5GA 5IB0A 3IFEA 4ZY0A 1NSLA 1R57A 4NF1A 4A39A 4NFRA 1CP6A 1VIXA 4OLLA 2AJ6A 2GIVA 4ORFA 1XMBA 4E2AA 4Q36A 2V8GA 2PJ3A 3B35A 3D8PA 3QNVA 4KUBA 3K9TA 2DEAA 3TO6A 4FWUA 3DLJA 1ON0A 3NE8A 4UBRA 2ZW4A 3D67A 1U6MA 3B7IA 2Z11A 5H86A 3SJFA 3P2FA 4KLVA 5AG6A 5IV0A 3TT2A 1Y9KA 3B3VA 4MHZA 4CGNA 2R98A 4AVBA 4P4BA 2P6FA 2CTCA 4K30A 2CNTA 3IIBA 1LOKA 4NGQA 5E96A 1X12A 1Y7RA 1QSMA 3W91A 2YNDA 5KTCA 1X10A 2Z3OA 1VKCA 2FCKA 2BUEA 3FIXA 3I9SA 3KKWA 1ZLIA 2FS5A 4TNUA 4U5YA 2C6PA 2EWBA 3L2NA 2ZEDA 2B3VA 3NE7A 1YVKA 3LWUA 1TKFA 1LRZA 2QYVA 3ZZIA 2AE6A 3QB8A 2PIZA 1AYEA 4KOVA 3PGPA 4M6HA 3CT9A 2PJ9A 3VATA 1QSOA 4TWEA 3MGDA 5K8NA 2QECA 5IX3A 5LRKA 2BSWA 4KVXA 5J8CA 4PXDA 2P6EA 3PFOA 5JH9A 3I3GA 3TTHA 2B4BA 4YFJA 3S9NA 2ZW5A 3BJ7A 4UF4A 3SXOA 2PIYA 5G22A 5HVHA 2D4PA 2OOTA 3RO0A 2IL4A 2V8VA 3R9FA 1TF8A 4PXEA 5LYDA 3FH4A 1Z4RA 3FEDA 3PFEA 4AG9A 4C7IA 4CAWA 5ISVA 1CPSA 4RN7A 1TF9A 5AGEA 3UY5A 4UWJA 4A38A 3FECA 4CYOA 4CPAA 4F8ZA 5CNPA 3D2MA 2Q4YA 1Z8LA 2PJAA 2PJ6A 5EBVA 2RB7A 1PCAA 5KTAA 4LQGA 4UFWA 3F5BA 4Q7AA 4LQ6A 4NEXA 4JXQA 2ZELA 1L0CA 4P45A 4UEZA 4H6UA 1KZFA 3LMSA 2OZHA 4II9A 2ARHA 1S3ZA 2VEZA 3S9MA 3PB9X 4OC2A 2R1IA 3H8EA 3MRUA 4J3GA 2PJ5A 1F2PA 4MFQA 1MJBA 2QVPA 3FX6A 2V8HA 3S6FA 4R6TA 5C82A 5AG7A 4MFJA 2FT0A 3T8WA 5AG4A 1BLLE 2FXFA 4MCSA 2GU2A 4JXRA 3KI9A 4BMHA 4L8AA 4ZI6A 4A2ZA 3EY5A 5HMNA 4GXHA 3FMCA 1R3NA 2IMOA 4HNXB 4MFKA 2JEVA 3G3SA 2HUZA 1YVOA 4Q38A 3PB4X 1YX0A 2C6GA 1YW6A 2HC9A 3I1UA 4JJXA 4PQAA 1IY7A 3KR5A 4CS0B 4YRHA 4PXBA 2C27A 3PB6X 2F5IA 1KUXA 2Q51A 1Z2LA 1XF8A 2PE3A 3H8GA 4QB9A 1EE3P 5K8PA 3R96A 1LCPA 1LAMA 5I4MA 1LAPA 4M6IA 4MBUA 1ZLHA 4OC5A 3A9LA 2BOAA 5D8NA 1TKJA 4DUKA 2GREA 3FEEA 1XE4A 3FVLA 3DR6A 1CJWA 1AMPA 2ZEEA 2PJ7A 5A27A 3K2KA 3IO1A 2ODFA 3D66A 3KL9A 4ZX9A 3D7DA 3PEIA 4IF5A 1Z8WA 2Q0YA 2BL1A 1Z4EA 3BXMA 5LYFA 3PBBA 3ZJ0A 2REEA 2XEJA 2FIAA 2Z3KA 1BPNA 3CXPA 4KOWA 4MFLA 3VH9A 3DNSA 3GIUA 5K8MA 1OZPA 4LUAA 4QBJA 1B6BA 2DPSA 4QC6A 2DXQA 4F9VA 3IU1A 5DS0A 1CM0A 2ATRA 3SI1A 3KZWA 1I1DA 4NGSA 3DSBA 3QAYA 4ZY2A 4B5OA 1YR0A 4CAXA 4CRZB 1RXTA 1ARLA 3GKRA 7CPAA 3D2PA 1Z8TA 4NCZA 1XOVA 2JBKA 1BPMA 1JQGA 1PUAA 2ZEFA 4A32A 4AXVA 4CGOA 1YW4A 4FD4A 1H8LA 2B58A 2EUIA 3CXQA 2ANPA 2PR8A 4BINA 5EMIA 1S7FA 4OC0A 2CXAA 4EWTA 3NFZA 4KS9A 1J4JA 4B13A
chains in the Genus database with same CATH topology
4XPDC 4U9YA 1KUYA 2G3TA 2FL4A 3H5ZA 2ZW6A 3FB3A 2WPXA 3IU2A 4Y49B 1M4IA 2GANA 4CGLA 3N7ZA 4PSXA 1IIDA 4AG7A 4CYNA 1PU9A 1QSRA 4QVTA 1NMTA 3R95A 4H89A 4R3LA 2HQYA 4UA3A 2JDCA 2NMTA 2JDDA 2Z3NA 4XPKA 5A28A 1WK4A 4MHDA 4A30A 4DNCA 4CRYB 3S6GA 3TO7A 2PQ8A 4AVCA 5G20A 3EC4A 2WUUA 2I00A 4UFXA 3TE4A 4C7HA 4B10A 2VZZA 4CAEA 3BJ8A 3RYOA 4ZBGA 2CNMA 5DWMA 2O28A 4CAFA 3FYNA 4M85A 3EXNA 4JD6A 1K4JA 5C88A 4ONUA 4PK2A 5JQ4A 4KORA 2VQYA 5G1ZA 4C2ZA 1V0CA 1IICA 2D4OA 3TFYA 3OWCA 5EC4A 2OZUA 1M44A 4KOXA 4B5PB 2ZPAA 1Q2DA 3FBUA 2FE7A 3VWEA 3IGRA 5JPHA 1SQHA 4JWPA 2VI7A 2K5TA 4KOSA 2I79A 4FD7A 1S7LA 2HV2A 4HNWB 1MJAA 3CXSA 4NSQA 3DDDA 4KVME 1M4GA 3IWGA 2B4DB 4R87A 4RI1A 1ZO0A 4KLWA 1MK4A 4H6ZA 4KOYA 3TCVA 4MFZA 4KVOE 5F46A 2RC4A 2Q7BA 1P0HA 4U9ZA 2Z3LA 2QIRA 1Y9WA 4MY3A 2P0WA 2Z0ZA 1RO5A 1S5KA 2PC1A 4RS2A 4OAEA 2G3AA 5HH1A 4ZGYB 1YREA 4LX9A 2WSAA 2PSWA 5H84A 2ZW7A 3H4QA 2OU2A 4C2YA 2JLMA 3F8KA 4A95A 4F6AA 3C26A 2J8MA 1B87A 4R9MA 3K9UA 4A33A 1IB1E 4UCMA 1M4DA 1GHEA 3VWDA 2FIWA 3F0AA 3BLNA 1YGHA 3PP9A 1Q2YA 1S7KA 1VHSA 2J8NA 4L89A 3R9EA 4KSAA 1QSTA 3SHPA 4YGOA 2OZGA 4AVAA 3LODA 3D3SA 2PR1A 4CYPA 4IUSA 2B5GB 2YNCA 4I49A 4F0XA 2FSRA 4KOTA 2Z3MA 5GCNA 4HKFA 4CGMA 3FXTA 2VZYA 1FY7A 2P6GA 4KSFA 4PV6A 5KTDA 2DPTA 5G21A 1P4NA 4MFPA 3WR7A 1XMTA 2Q44A 1BO4A 4Y49C 5F49A 1S60A 4KOUA 4C68A 2CY2A 1NE9A 2OH1A 4XPDB 3TOAA 4OADA 2VXKA 2WPWA 4AB7A 1Z9UA 3LD2A 4B11A 2PRBA 3W6SA 2Z10A 2ZXVA 2VBQA 3S6HA 4B12A 3V8IA 2Q4VA 4XPLA 5FVJA 4CYQA 2CNSA 1I12A 3E0KA 3EO4A 4MJ8A 2YGWA 1QSNA 2B4DA 4JLYA 4BBHA 4UFVA 4FD6A 2X7BA 2GE3A 1WWZA 2Q04A 1XEBA 3R9GA 3FNCA 4F0YA 2REFA 4CAVA 4C2XA 2R7HA 4HNYB 3PZJA 4MI4A 4UCNA 3QAHA 3W6XA 3JUWA 4XNHB 2BEIA 3G8WA 1UFHA 1S7NA 2J8RA 1IYLA 2QMLA 2YNEA 5I0CA 2KCWA 4UWIA 3JTKA 4FD5A 5J8FA 3T9YA 4R3KA 3TO9A 4X5KA 2YNCC 5DWNA 2OB0A 4E0AA 2Y0MA 3FRMA 4E8OA 5BWAB 2B3UA 4XNHC 5AG5A 5F48A 4B5PA 4M3SA 4KUAA 5F47A 3GY9A 2A4NA 3DR8A 2PDOA 1YLEA 4KZTA 1Q2CA 1BOBA 2R8VA 4MY0A 1KUVA 4A31A 3R1KA 4EVYA 3IWEA 1TIQA 4UCPA 2G0BA 4PSWA 3T90A 3S6KA 3EFAA 1MJ9A 2H5MA 4NXYA 1IYKA 1YK3A 3B8GA 1N71A 3P2HA 4CGPA 4B14A 4R57A 1M1DA 1I21A 1XIXA 3JVNA 4QUSA 3TOBA 2EVNA 3GYAA 2Z3PA 3SXNA 4GS4A 4PK3A 2B5GA 5IB0A 1NSLA 1R57A 4NF1A 4OLLA 4ORFA 2AJ6A 2GIVA 4E2AA 4Q36A 3D8PA 4KUBA 3TO6A 4UBRA 1ON0A 2ZW4A 1U6MA 2Z11A 5H86A 3P2FA 4KLVA 5AG6A 5IV0A 3TT2A 1Y9KA 4CGNA 2R98A 4AVBA 2P6FA 4K30A 2CNTA 5E96A 1Y7RA 1QSMA 3W91A 2YNDA 5KTCA 2Z3OA 1VKCA 2FCKA 2BUEA 3FIXA 3I9SA 3KKWA 2FS5A 4U5YA 2B3VA 3NE7A 1YVKA 3ZZIA 1LRZA 2AE6A 3QB8A 4KOVA 3PGPA 1QSOA 3MGDA 2QECA 5IX3A 2BSWA 4KVXA 5J8CA 2P6EA 3I3GA 3TTHA 2B4BA 4YFJA 3BJ7A 2ZW5A 3SXOA 5G22A 2D4PA 2IL4A 3R9FA 4AG9A 4C7IA 1Z4RA 4CAWA 5ISVA 3UY5A 5AGEA 4UWJA 4CYOA 5CNPA 3D2MA 2Q4YA 5EBVA 5KTAA 4UFWA 3F5BA 4NEXA 4JXQA 1L0CA 4H6UA 1KZFA 2OZHA 4II9A 2ARHA 1S3ZA 2VEZA 2R1IA 4J3GA 4MFQA 1MJBA 3S6FA 5C82A 5AG7A 4MFJA 2FT0A 5AG4A 2FXFA 4JXRA 4BMHA 4L8AA 4A2ZA 3EY5A 5HMNA 4HNXB 4MFKA 2JEVA 3G3SA 2HUZA 1YVOA 4Q38A 1YX0A 4JJXA 4CS0B 4YRHA 2C27A 2F5IA 1KUXA 1XF8A 4QB9A 3R96A 4MBUA 3A9LA 1XE4A 3DR6A 1CJWA 5A27A 4IF5A 2BL1A 2Q0YA 1Z4EA 3ZJ0A 2REEA 2FIAA 2Z3KA 3CXPA 4KOWA 4MFLA 3DNSA 1OZPA 4LUAA 4QBJA 1B6BA 2DPSA 4QC6A 2DXQA 3IU1A 1CM0A 2ATRA 1I1DA 3DSBA 4B5OA 4CRZB 1YR0A 4CAXA 1RXTA 3GKRA 3D2PA 4NCZA 1PUAA 4A32A 4CGOA 4FD4A 2B58A 2EUIA 3CXQA 2PR8A 1S7FA 2CXAA 4KS9A 1J4JA 4B13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPD C;  4U9Y A;  1KUY A;  2G3T A;  2FL4 A;  2ZW6 A;  3FB3 A;  2WPX A;  4Y49 B;  1M4I A;  2GAN A;  3N7Z A;  4PSX A;  1IID A;  4AG7 A;  1PU9 A;  1QSR A;  4QVT A;  1NMT A;  3R95 A;  4H89 A;  4R3L A;  2HQY A;  4UA3 A;  2JDC A;  2NMT A;  2JDD A;  4XPK A;  1WK4 A;  4MHD A;  4DNC A;  4CRY B;  3S6G A;  3TO7 A;  2PQ8 A;  4AVC A;  3EC4 A;  2I00 A;  3TE4 A;  2VZZ A;  3BJ8 A;  3RYO A;  4ZBG A;  2CNM A;  5DWM A;  2O28 A;  3FYN A;  4M85 A;  3EXN A;  4JD6 A;  1K4J A;  5C88 A;  4ONU A;  4PK2 A;  5JQ4 A;  4KOR A;  2VQY A;  1V0C A;  1IIC A;  2D4O A;  3TFY A;  3OWC A;  5EC4 A;  2OZU A;  1M44 A;  4KOX A;  4B5P B;  2ZPA A;  1Q2D A;  3FBU A;  2FE7 A;  3VWE A;  3IGR A;  5JPH A;  1SQH A;  4JWP A;  2VI7 A;  2K5T A;  4KOS A;  2I79 A;  4FD7 A;  1S7L A;  2HV2 A;  4HNW B;  1MJA A;  3CXS A;  4NSQ A;  3DDD A;  4KVM E;  1M4G A;  3IWG A;  2B4D B;  4R87 A;  4RI1 A;  4KLW A;  1MK4 A;  4H6Z A;  4KOY A;  3TCV A;  4KVO E;  5F46 A;  2RC4 A;  2Q7B A;  1P0H A;  4U9Z A;  4MY3 A;  1Y9W A;  2QIR A;  2P0W A;  2Z0Z A;  1RO5 A;  1S5K A;  2PC1 A;  4RS2 A;  4OAE A;  2G3A A;  5HH1 A;  1YRE A;  4LX9 A;  2PSW A;  5H84 A;  2ZW7 A;  3H4Q A;  2OU2 A;  2JLM A;  3F8K A;  4F6A A;  3C26 A;  2J8M A;  1B87 A;  4R9M A;  3K9U A;  1IB1 E;  1M4D A;  1GHE A;  3VWD A;  2FIW A;  3F0A A;  3BLN A;  1YGH A;  3PP9 A;  1Q2Y A;  1S7K A;  1VHS A;  2J8N A;  4L89 A;  3R9E A;  1QST A;  3SHP A;  4YGO A;  2OZG A;  4AVA A;  3LOD A;  3D3S A;  2PR1 A;  4IUS A;  2B5G B;  4I49 A;  2FSR A;  4KOT A;  5GCN A;  4HKF A;  3FXT A;  2VZY A;  1FY7 A;  2P6G A;  4PV6 A;  5KTD A;  1P4N A;  3WR7 A;  1XMT A;  2Q44 A;  1BO4 A;  4Y49 C;  5F49 A;  1S60 A;  4KOU A;  2CY2 A;  1NE9 A;  2OH1 A;  4XPD B;  3TOA A;  4OAD A;  2VXK A;  2WPW A;  4AB7 A;  1Z9U A;  3LD2 A;  2PRB A;  3W6S A;  2Z10 A;  2ZXV A;  2VBQ A;  3S6H A;  3V8I A;  2Q4V A;  4XPL A;  5FVJ A;  2CNS A;  1I12 A;  3E0K A;  3EO4 A;  4MJ8 A;  1QSN A;  2B4D A;  4JLY A;  4FD6 A;  2X7B A;  2GE3 A;  1WWZ A;  2Q04 A;  1XEB A;  3R9G A;  3FNC A;  4F0Y A;  2REF A;  4CAV A;  2R7H A;  4HNY B;  3PZJ A;  4MI4 A;  3QAH A;  3W6X A;  3JUW A;  4XNH B;  2BEI A;  3G8W A;  1UFH A;  1S7N A;  2J8R A;  1IYL A;  2QML A;  5I0C A;  2KCW A;  4UWI A;  4FD5 A;  5J8F A;  3T9Y A;  4R3K A;  3TO9 A;  4X5K A;  5DWN A;  2OB0 A;  4E0A A;  2Y0M A;  3FRM A;  4E8O A;  2B3U A;  4XNH C;  5F48 A;  4B5P A;  4M3S A;  4KUA A;  5F47 A;  3GY9 A;  2A4N A;  3DR8 A;  2PDO A;  1YLE A;  4KZT A;  1Q2C A;  1BOB A;  2R8V A;  4MY0 A;  1KUV A;  3R1K A;  4EVY A;  1TIQ A;  2G0B A;  4PSW A;  3T90 A;  3S6K A;  3EFA A;  1MJ9 A;  2H5M A;  4NXY A;  1IYK A;  1YK3 A;  3B8G A;  1N71 A;  3P2H A;  4R57 A;  1M1D A;  1I21 A;  1XIX A;  3JVN A;  4QUS A;  3TOB A;  2EVN A;  3GYA A;  3SXN A;  4GS4 A;  4PK3 A;  2B5G A;  5IB0 A;  1NSL A;  1R57 A;  4NF1 A;  4OLL A;  4ORF A;  2AJ6 A;  2GIV A;  4E2A A;  3D8P A;  4KUB A;  3TO6 A;  4UBR A;  1ON0 A;  2ZW4 A;  1U6M A;  2Z11 A;  5H86 A;  3P2F A;  4KLV A;  5IV0 A;  3TT2 A;  1Y9K A;  2R98 A;  4AVB A;  2P6F A;  4K30 A;  2CNT A;  5E96 A;  1Y7R A;  1QSM A;  3W91 A;  5KTC A;  1VKC A;  2FCK A;  2BUE A;  3FIX A;  3I9S A;  3KKW A;  2FS5 A;  4U5Y A;  2B3V A;  3NE7 A;  1YVK A;  3ZZI A;  1LRZ A;  2AE6 A;  3QB8 A;  4KOV A;  3PGP A;  1QSO A;  3MGD A;  2QEC A;  5IX3 A;  2BSW A;  4KVX A;  5J8C A;  2P6E A;  3I3G A;  3TTH A;  2B4B A;  4YFJ A;  3BJ7 A;  2ZW5 A;  3SXO A;  2D4P A;  2IL4 A;  3R9F A;  4AG9 A;  4CAW A;  1Z4R A;  5ISV A;  3UY5 A;  4UWJ A;  5CNP A;  3D2M A;  2Q4Y A;  5EBV A;  5KTA A;  3F5B A;  4NEX A;  4JXQ A;  1L0C A;  4H6U A;  1KZF A;  2OZH A;  4II9 A;  2ARH A;  1S3Z A;  2VEZ A;  2R1I A;  4J3G A;  1MJB A;  3S6F A;  5C82 A;  2FT0 A;  2FXF A;  4JXR A;  4BMH A;  4L8A A;  3EY5 A;  5HMN A;  4HNX B;  2JEV A;  3G3S A;  2HUZ A;  1YVO A;  1YX0 A;  4JJX A;  4CS0 B;  4YRH A;  2C27 A;  2F5I A;  1KUX A;  1XF8 A;  4QB9 A;  3R96 A;  4MBU A;  1XE4 A;  3DR6 A;  1CJW A;  4IF5 A;  2BL1 A;  2Q0Y A;  1Z4E A;  3ZJ0 A;  2REE A;  2FIA A;  4KOW A;  3CXP A;  3DNS A;  1OZP A;  4LUA A;  4QBJ A;  1B6B A;  4QC6 A;  2DXQ A;  1CM0 A;  2ATR A;  1I1D A;  3DSB A;  4B5O A;  4CRZ B;  1YR0 A;  4CAX A;  1RXT A;  3GKR A;  3D2P A;  4NCZ A;  1PUA A;  4FD4 A;  2B58 A;  2EUI A;  3CXQ A;  2PR8 A;  1S7F A;  1J4J A; 
#chains in the Genus database with same CATH topology
 4XPD C;  4U9Y A;  1KUY A;  2AFO A;  2BO9 A;  2G3T A;  2FL4 A;  3H5Z A;  2ZW6 A;  1FT7 A;  3FB3 A;  2C1C A;  2WPX A;  3IU2 A;  4R76 A;  4Y49 B;  1M4I A;  2GAN A;  2V77 A;  4K3N A;  4CGL A;  3WC7 A;  3N7Z A;  4PSX A;  1HDQ A;  4R7M A;  1IID A;  3CPA A;  4X2T A;  1PU9 A;  4AG7 A;  4CYN A;  5LRG A;  1QSR A;  2NSM A;  4QVT A;  1NMT A;  3KQX A;  6CPA A;  3R95 A;  2CF4 A;  4H89 A;  4R3L A;  2HQY A;  4UA3 A;  2JDC A;  2NMT A;  2AFU A;  1YQE A;  2JDD A;  3PRT A;  2Z3N A;  3CZX A;  4XPK A;  5A28 A;  1Q7L A;  1WK4 A;  2V8D A;  2ZEH A;  4IHM A;  4YWY A;  1LAN A;  3IC1 A;  4MHD A;  4A30 A;  1BAV A;  2PJ0 A;  4CRY B;  4DNC A;  3S6G A;  3DGV A;  3TO7 A;  2PQ8 A;  4NGM A;  1XBU A;  4AVC A;  3IWW A;  1AUG A;  5G20 A;  3EC4 A;  2WUU A;  2ZEM A;  3RNZ A;  2I00 A;  4UFX A;  3TE4 A;  3HUV A;  4B10 A;  2VZZ A;  4C7H A;  4DJL A;  4CAE A;  4EFD A;  3BJ8 A;  3RYO A;  4ZBG A;  2CNM A;  2Q4Z A;  1Z8X A;  5DWM A;  2AFW A;  2PCU A;  2O28 A;  4CAF A;  3FYN A;  4M85 A;  1IOF A;  3EXN A;  1ZG7 A;  4JD6 A;  5CBM A;  1K4J A;  1LFW A;  4ONU A;  4PK2 A;  5C88 A;  5JQ4 A;  2POK A;  3PBE A;  1M4L A;  4KOR A;  3IJ3 A;  4UIB A;  4B6Z A;  2J9A A;  4P4E A;  3HLP A;  4NGP A;  2VQY A;  2GLF A;  5G1Z A;  4C2Z A;  3SJG A;  2F7V A;  1CG2 A;  3D7H A;  1V0C A;  3WC6 A;  5LYL A;  4Z65 A;  2ZEO A;  1IIC A;  5ELY A;  2D4O A;  3TFY A;  1OBR A;  3OWC A;  3NA6 A;  4MXU A;  5EC4 A;  2ZOF A;  1YME A;  2OZU A;  1M44 A;  4KOX A;  2GFQ A;  3WAB A;  4B5P B;  2ZPA A;  1Q2D A;  3FBU A;  3H8F A;  1VHO A;  2FE7 A;  3VWE A;  3IGR A;  4IAV A;  5JPH A;  1SQH A;  2XEI A;  2VI7 A;  2K5T A;  4JWP A;  4PXC A;  3KAS A;  2I79 A;  4KOS A;  1TXR A;  4UEF A;  3TX8 A;  2ZEP A;  3SI0 A;  4FD7 A;  1S7L A;  2HV2 A;  4HNW B;  1MJA A;  3CXS A;  4NSQ A;  4R8F A;  3DDD A;  1VHE A;  4KVM E;  4OKO A;  8CPA A;  4BD9 A;  1M4G A;  3IWG A;  2B4D B;  4MHP A;  2HB6 A;  4R87 A;  3SJE A;  3D7G A;  4RI1 A;  1ZO0 A;  1XJO A;  4KLW A;  1MK4 A;  1XRY A;  2F8H A;  4H6Z A;  1Y7E A;  4NGR A;  4KOY A;  3TCV A;  4MFZ A;  2GLJ A;  3V7Z A;  4KVO E;  5F46 A;  3NH8 A;  4NGN A;  2RC4 A;  3KR4 A;  2Q7B A;  1P0H A;  4U9Z A;  2Z3L A;  4KSI A;  2QIR A;  1Y9W A;  4MY3 A;  2P0W A;  2Z0Z A;  1RO5 A;  1S5K A;  2DF5 A;  3D7F A;  2PC1 A;  3FJU A;  4RS2 A;  4OAE A;  2G3A A;  1HEE A;  5HH1 A;  4ZGY B;  1YRE A;  4LX9 A;  3WC5 A;  5HVG A;  2WSA A;  2I3C A;  2PSW A;  5H84 A;  4MRI A;  1UWY A;  2ZW7 A;  3H4Q A;  2OU2 A;  4C2Y A;  4YU9 A;  5K8O A;  2JLM A;  3F8K A;  2JBJ A;  3B3W A;  4A95 A;  2ZEG A;  4F6A A;  3D4U A;  3KQZ A;  4A37 A;  2ZOG A;  3C26 A;  2J8M A;  1B87 A;  4R9M A;  1RTQ A;  2CIJ A;  3K9U A;  4A33 A;  1IB1 E;  2EK8 A;  3B3T A;  3RAM A;  1ZG9 A;  4UCM A;  1M4D A;  1GHE A;  4P4J A;  2PVW A;  3JRU A;  4MHN A;  3CPX A;  2FIW A;  3VWD A;  3F0A A;  4OME A;  1IGB A;  3BLN A;  4M6G A;  1F57 A;  1YGH A;  3PB7 X;  3PP9 A;  5CPA A;  5J1Q A;  1Q2Y A;  2PJ1 A;  1S7K A;  2AFS A;  1VHS A;  3IEH A;  4PPZ A;  1Y0Y A;  1PYT B;  2AFM A;  2J8N A;  4L89 A;  3MN8 A;  3R9E A;  4KSA A;  1QST A;  3SHP A;  1YSJ A;  2PJB A;  1HDU A;  4W9Y A;  4YGO A;  3GB0 A;  1GYT A;  2VL1 A;  2OZG A;  4AVA A;  3LOD A;  3D3S A;  2PR1 A;  3KHX A;  3LAC A;  4CYP A;  4IUS A;  4O23 A;  2B5G B;  5HXD A;  3WT4 A;  2YNC A;  4I49 A;  4MCR A;  4F0X A;  2EK9 A;  2FSR A;  2PVV A;  2Z3M A;  4KOT A;  4OC4 A;  5GCN A;  4HKF A;  4CGM A;  3FXT A;  2OR4 A;  5LYI A;  1ARM A;  1KWM A;  2VZY A;  1FY7 A;  2P6G A;  4OC3 A;  2IJZ A;  4KSF A;  4NJR A;  4PV6 A;  4P6Y A;  5IB9 A;  5KTD A;  2DPT A;  4MCQ A;  4P4I A;  1CP7 A;  5G21 A;  1R43 A;  2Q43 A;  3PB8 X;  2QJ8 A;  4ONW A;  4WWV A;  5JM6 A;  1CBX A;  1P4N A;  4EME A;  4MFP A;  5LRJ A;  3WR7 A;  1XMT A;  2Q44 A;  1BO4 A;  4Y49 C;  5F49 A;  1S60 A;  3B3C A;  4KOU A;  4C68 A;  1DE4 C;  2CY2 A;  1NE9 A;  3ISZ A;  2OH1 A;  4XPD B;  3TOA A;  4OAD A;  1Z5R A;  2VXK A;  2WPW A;  3KHZ A;  4AB7 A;  1FNO A;  1Z9U A;  3LD2 A;  2PRB A;  4P4D A;  4B11 A;  1DTD A;  3S9L A;  4MHY A;  2Z10 A;  3W6S A;  2ZXV A;  4A94 A;  2VBQ A;  1QQ9 A;  3N5F A;  3S6H A;  4B12 A;  3V8I A;  2AFX A;  2Q4V A;  2WZN A;  4UEE A;  4XPL A;  5FVJ A;  1JWQ A;  4P44 A;  2CNS A;  3VAR A;  1CX8 A;  3B3S A;  1I12 A;  2O4H A;  3E0K A;  4CYQ A;  3EO4 A;  4MJ8 A;  2YGW A;  4JYW A;  1QSN A;  4UIA A;  2B4D A;  4JLY A;  4BBH A;  4UFV A;  2JEW A;  4FD6 A;  2X7B A;  2GE3 A;  1WWZ A;  2ZEN A;  2EBJ A;  2EO8 A;  3SJX A;  2Q04 A;  4MMO A;  4JZ0 A;  1XEB A;  2WYR A;  3R9G A;  2C6C A;  3FNC A;  4F0Y A;  2REF A;  2PRQ A;  5THW A;  3FF3 A;  2AFZ A;  4CAV A;  4G1P A;  1IOI A;  1IU8 A;  4MCP A;  4C2X A;  2R7H A;  4HNY B;  4OIW A;  4WJB A;  3PZJ A;  4MI4 A;  2PJC A;  4UCN A;  3QAH A;  3W6X A;  1Y0R A;  3JUW A;  4XNH B;  2Q7S A;  3NH5 A;  3KGQ A;  2BEI A;  3G8W A;  4X3R A;  4OC1 A;  1UFH A;  4IK2 A;  3V38 A;  2PJ4 A;  2FVG A;  2XEG A;  5HVF A;  5D29 A;  4HPS A;  4NGT A;  2XEF A;  4ZX8 A;  4H2K A;  1S7N A;  2J8R A;  4ZYQ A;  1IYL A;  2QML A;  2YNE A;  2G9D A;  2KCW A;  3CDX A;  1XFO A;  4UWI A;  4GM5 A;  3JTK A;  4FD5 A;  5I0C A;  5J8F A;  3T9Y A;  4R3K A;  4FAI A;  3TO9 A;  1ZG8 A;  3ISX A;  4X5K A;  2YNC C;  5DWN A;  2OB0 A;  4E0A A;  4NJQ A;  2Y0M A;  3FRM A;  4E8O A;  5BWA B;  2B3U A;  4XNH C;  1F2O A;  5AG5 A;  2PJ8 A;  5F48 A;  1NSA A;  3RZA A;  3TC8 A;  3GUX A;  4B5P A;  3B2Y A;  2CTB A;  4KUA A;  4M3S A;  4X8I A;  1CPX A;  5F47 A;  2NYQ A;  3GY9 A;  2RFH A;  5JGF A;  2A4N A;  1A2Z A;  3DR8 A;  1YLO A;  4P10 A;  4RUH A;  2PDO A;  1YLE A;  4KZT A;  4P4F A;  1Q2C A;  1BOB A;  2R8V A;  4FUU A;  4OID A;  2PJ2 A;  4MY0 A;  1KUV A;  2BCO A;  3GLJ A;  4A31 A;  4F9U A;  4OP4 A;  2IQ6 A;  3R1K A;  1ELL P;  3IWE A;  4EVY A;  2O53 A;  1TIQ A;  1QMU A;  1TKH A;  4FBE A;  4UCP A;  2G0B A;  4PSW A;  3T90 A;  3S6K A;  3EFA A;  1MJ9 A;  2H5M A;  3BI0 A;  4NXY A;  1IYK A;  1VGY A;  5F09 A;  3D68 A;  3BI1 A;  1YK3 A;  3B8G A;  1N71 A;  3P2H A;  4CGP A;  4B14 A;  4R57 A;  1M1D A;  1I21 A;  1XIX A;  3JVN A;  4QUS A;  3TOB A;  2EVN A;  3GYA A;  1ELM P;  3BHX A;  2Z3P A;  3RBU A;  2ABZ A;  3SXN A;  4DYO A;  3SI2 A;  3NH4 A;  4GS4 A;  4PK3 A;  4ZY1 A;  2B5G A;  5IB0 A;  3IFE A;  4ZY0 A;  1NSL A;  1R57 A;  4NF1 A;  4A39 A;  4NFR A;  1CP6 A;  1VIX A;  4OLL A;  2AJ6 A;  2GIV A;  4ORF A;  1XMB A;  4E2A A;  4Q36 A;  2V8G A;  2PJ3 A;  3B35 A;  3D8P A;  3QNV A;  4KUB A;  3K9T A;  2DEA A;  3TO6 A;  4FWU A;  3DLJ A;  1ON0 A;  3NE8 A;  4UBR A;  2ZW4 A;  3D67 A;  1U6M A;  3B7I A;  2Z11 A;  5H86 A;  3SJF A;  3P2F A;  4KLV A;  5AG6 A;  5IV0 A;  3TT2 A;  1Y9K A;  3B3V A;  4MHZ A;  4CGN A;  2R98 A;  4AVB A;  4P4B A;  2P6F A;  2CTC A;  4K30 A;  2CNT A;  3IIB A;  1LOK A;  4NGQ A;  5E96 A;  1X12 A;  1Y7R A;  1QSM A;  3W91 A;  2YND A;  5KTC A;  1X10 A;  2Z3O A;  1VKC A;  2FCK A;  2BUE A;  3FIX A;  3I9S A;  3KKW A;  1ZLI A;  2FS5 A;  4TNU A;  4U5Y A;  2C6P A;  2EWB A;  3L2N A;  2ZED A;  2B3V A;  3NE7 A;  1YVK A;  3LWU A;  1TKF A;  1LRZ A;  2QYV A;  3ZZI A;  2AE6 A;  3QB8 A;  2PIZ A;  1AYE A;  4KOV A;  3PGP A;  4M6H A;  3CT9 A;  2PJ9 A;  3VAT A;  1QSO A;  4TWE A;  3MGD A;  5K8N A;  2QEC A;  5IX3 A;  5LRK A;  2BSW A;  4KVX A;  5J8C A;  4PXD A;  2P6E A;  3PFO A;  5JH9 A;  3I3G A;  3TTH A;  2B4B A;  4YFJ A;  3S9N A;  2ZW5 A;  3BJ7 A;  4UF4 A;  3SXO A;  2PIY A;  5G22 A;  5HVH A;  2D4P A;  2OOT A;  3RO0 A;  2IL4 A;  2V8V A;  3R9F A;  1TF8 A;  4PXE A;  5LYD A;  3FH4 A;  1Z4R A;  3FED A;  3PFE A;  4AG9 A;  4C7I A;  4CAW A;  5ISV A;  1CPS A;  4RN7 A;  1TF9 A;  5AGE A;  3UY5 A;  4UWJ A;  4A38 A;  3FEC A;  4CYO A;  4CPA A;  4F8Z A;  5CNP A;  3D2M A;  2Q4Y A;  1Z8L A;  2PJA A;  2PJ6 A;  5EBV A;  2RB7 A;  1PCA A;  5KTA A;  4LQG A;  4UFW A;  3F5B A;  4Q7A A;  4LQ6 A;  4NEX A;  4JXQ A;  2ZEL A;  1L0C A;  4P45 A;  4UEZ A;  4H6U A;  1KZF A;  3LMS A;  2OZH A;  4II9 A;  2ARH A;  1S3Z A;  2VEZ A;  3S9M A;  3PB9 X;  4OC2 A;  2R1I A;  3H8E A;  3MRU A;  4J3G A;  2PJ5 A;  1F2P A;  4MFQ A;  1MJB A;  2QVP A;  3FX6 A;  2V8H A;  3S6F A;  4R6T A;  5C82 A;  5AG7 A;  4MFJ A;  2FT0 A;  3T8W A;  5AG4 A;  1BLL E;  2FXF A;  4MCS A;  2GU2 A;  4JXR A;  3KI9 A;  4BMH A;  4L8A A;  4ZI6 A;  4A2Z A;  3EY5 A;  5HMN A;  4GXH A;  3FMC A;  1R3N A;  2IMO A;  4HNX B;  4MFK A;  2JEV A;  3G3S A;  2HUZ A;  1YVO A;  4Q38 A;  3PB4 X;  1YX0 A;  2C6G A;  1YW6 A;  2HC9 A;  3I1U A;  4JJX A;  4PQA A;  1IY7 A;  3KR5 A;  4CS0 B;  4YRH A;  4PXB A;  2C27 A;  3PB6 X;  2F5I A;  1KUX A;  2Q51 A;  1Z2L A;  1XF8 A;  2PE3 A;  3H8G A;  4QB9 A;  1EE3 P;  5K8P A;  3R96 A;  1LCP A;  1LAM A;  5I4M A;  1LAP A;  4M6I A;  4MBU A;  1ZLH A;  4OC5 A;  3A9L A;  2BOA A;  5D8N A;  1TKJ A;  4DUK A;  2GRE A;  3FEE A;  1XE4 A;  3FVL A;  3DR6 A;  1CJW A;  1AMP A;  2ZEE A;  2PJ7 A;  5A27 A;  3K2K A;  3IO1 A;  2ODF A;  3D66 A;  3KL9 A;  4ZX9 A;  3D7D A;  3PEI A;  4IF5 A;  1Z8W A;  2Q0Y A;  2BL1 A;  1Z4E A;  3BXM A;  5LYF A;  3PBB A;  3ZJ0 A;  2REE A;  2XEJ A;  2FIA A;  2Z3K A;  1BPN A;  3CXP A;  4KOW A;  4MFL A;  3VH9 A;  3DNS A;  3GIU A;  5K8M A;  1OZP A;  4LUA A;  4QBJ A;  1B6B A;  2DPS A;  4QC6 A;  2DXQ A;  4F9V A;  3IU1 A;  5DS0 A;  1CM0 A;  2ATR A;  3SI1 A;  3KZW A;  1I1D A;  4NGS A;  3DSB A;  3QAY A;  4ZY2 A;  4B5O A;  1YR0 A;  4CAX A;  4CRZ B;  1RXT A;  1ARL A;  3GKR A;  7CPA A;  3D2P A;  1Z8T A;  4NCZ A;  1XOV A;  2JBK A;  1BPM A;  1JQG A;  1PUA A;  2ZEF A;  4A32 A;  4AXV A;  4CGO A;  1YW4 A;  4FD4 A;  1H8L A;  2B58 A;  2EUI A;  3CXQ A;  2ANP A;  2PR8 A;  4BIN A;  5EMI A;  1S7F A;  4OC0 A;  2CXA A;  4EWT A;  3NFZ A;  4KS9 A;  1J4J A;  4B13 A; 
#chains in the Genus database with same CATH homology
 4XPD C;  4U9Y A;  1KUY A;  2G3T A;  2FL4 A;  3H5Z A;  2ZW6 A;  3FB3 A;  2WPX A;  3IU2 A;  4Y49 B;  1M4I A;  2GAN A;  4CGL A;  3N7Z A;  4PSX A;  1IID A;  4AG7 A;  4CYN A;  1PU9 A;  1QSR A;  4QVT A;  1NMT A;  3R95 A;  4H89 A;  4R3L A;  2HQY A;  4UA3 A;  2JDC A;  2NMT A;  2JDD A;  2Z3N A;  4XPK A;  5A28 A;  1WK4 A;  4MHD A;  4A30 A;  4DNC A;  4CRY B;  3S6G A;  3TO7 A;  2PQ8 A;  4AVC A;  5G20 A;  3EC4 A;  2WUU A;  2I00 A;  4UFX A;  3TE4 A;  4C7H A;  4B10 A;  2VZZ A;  4CAE A;  3BJ8 A;  3RYO A;  4ZBG A;  2CNM A;  5DWM A;  2O28 A;  4CAF A;  3FYN A;  4M85 A;  3EXN A;  4JD6 A;  1K4J A;  5C88 A;  4ONU A;  4PK2 A;  5JQ4 A;  4KOR A;  2VQY A;  5G1Z A;  4C2Z A;  1V0C A;  1IIC A;  2D4O A;  3TFY A;  3OWC A;  5EC4 A;  2OZU A;  1M44 A;  4KOX A;  4B5P B;  2ZPA A;  1Q2D A;  3FBU A;  2FE7 A;  3VWE A;  3IGR A;  5JPH A;  1SQH A;  4JWP A;  2VI7 A;  2K5T A;  4KOS A;  2I79 A;  4FD7 A;  1S7L A;  2HV2 A;  4HNW B;  1MJA A;  3CXS A;  4NSQ A;  3DDD A;  4KVM E;  1M4G A;  3IWG A;  2B4D B;  4R87 A;  4RI1 A;  1ZO0 A;  4KLW A;  1MK4 A;  4H6Z A;  4KOY A;  3TCV A;  4MFZ A;  4KVO E;  5F46 A;  2RC4 A;  2Q7B A;  1P0H A;  4U9Z A;  2Z3L A;  2QIR A;  1Y9W A;  4MY3 A;  2P0W A;  2Z0Z A;  1RO5 A;  1S5K A;  2PC1 A;  4RS2 A;  4OAE A;  2G3A A;  5HH1 A;  4ZGY B;  1YRE A;  4LX9 A;  2WSA A;  2PSW A;  5H84 A;  2ZW7 A;  3H4Q A;  2OU2 A;  4C2Y A;  2JLM A;  3F8K A;  4A95 A;  4F6A A;  3C26 A;  2J8M A;  1B87 A;  4R9M A;  3K9U A;  4A33 A;  1IB1 E;  4UCM A;  1M4D A;  1GHE A;  3VWD A;  2FIW A;  3F0A A;  3BLN A;  1YGH A;  3PP9 A;  1Q2Y A;  1S7K A;  1VHS A;  2J8N A;  4L89 A;  3R9E A;  4KSA A;  1QST A;  3SHP A;  4YGO A;  2OZG A;  4AVA A;  3LOD A;  3D3S A;  2PR1 A;  4CYP A;  4IUS A;  2B5G B;  2YNC A;  4I49 A;  4F0X A;  2FSR A;  4KOT A;  2Z3M A;  5GCN A;  4HKF A;  4CGM A;  3FXT A;  2VZY A;  1FY7 A;  2P6G A;  4KSF A;  4PV6 A;  5KTD A;  2DPT A;  5G21 A;  1P4N A;  4MFP A;  3WR7 A;  1XMT A;  2Q44 A;  1BO4 A;  4Y49 C;  5F49 A;  1S60 A;  4KOU A;  4C68 A;  2CY2 A;  1NE9 A;  2OH1 A;  4XPD B;  3TOA A;  4OAD A;  2VXK A;  2WPW A;  4AB7 A;  1Z9U A;  3LD2 A;  4B11 A;  2PRB A;  3W6S A;  2Z10 A;  2ZXV A;  2VBQ A;  3S6H A;  4B12 A;  3V8I A;  2Q4V A;  4XPL A;  5FVJ A;  4CYQ A;  2CNS A;  1I12 A;  3E0K A;  3EO4 A;  4MJ8 A;  2YGW A;  1QSN A;  2B4D A;  4JLY A;  4BBH A;  4UFV A;  4FD6 A;  2X7B A;  2GE3 A;  1WWZ A;  2Q04 A;  1XEB A;  3R9G A;  3FNC A;  4F0Y A;  2REF A;  4CAV A;  4C2X A;  2R7H A;  4HNY B;  3PZJ A;  4MI4 A;  4UCN A;  3QAH A;  3W6X A;  3JUW A;  4XNH B;  2BEI A;  3G8W A;  1UFH A;  1S7N A;  2J8R A;  1IYL A;  2QML A;  2YNE A;  5I0C A;  2KCW A;  4UWI A;  3JTK A;  4FD5 A;  5J8F A;  3T9Y A;  4R3K A;  3TO9 A;  4X5K A;  2YNC C;  5DWN A;  2OB0 A;  4E0A A;  2Y0M A;  3FRM A;  4E8O A;  5BWA B;  2B3U A;  4XNH C;  5AG5 A;  5F48 A;  4B5P A;  4M3S A;  4KUA A;  5F47 A;  3GY9 A;  2A4N A;  3DR8 A;  2PDO A;  1YLE A;  4KZT A;  1Q2C A;  1BOB A;  2R8V A;  4MY0 A;  1KUV A;  4A31 A;  3R1K A;  4EVY A;  3IWE A;  1TIQ A;  4UCP A;  2G0B A;  4PSW A;  3T90 A;  3S6K A;  3EFA A;  1MJ9 A;  2H5M A;  4NXY A;  1IYK A;  1YK3 A;  3B8G A;  1N71 A;  3P2H A;  4CGP A;  4B14 A;  4R57 A;  1M1D A;  1I21 A;  1XIX A;  3JVN A;  4QUS A;  3TOB A;  2EVN A;  3GYA A;  2Z3P A;  3SXN A;  4GS4 A;  4PK3 A;  2B5G A;  5IB0 A;  1NSL A;  1R57 A;  4NF1 A;  4OLL A;  4ORF A;  2AJ6 A;  2GIV A;  4E2A A;  4Q36 A;  3D8P A;  4KUB A;  3TO6 A;  4UBR A;  1ON0 A;  2ZW4 A;  1U6M A;  2Z11 A;  5H86 A;  3P2F A;  4KLV A;  5AG6 A;  5IV0 A;  3TT2 A;  1Y9K A;  4CGN A;  2R98 A;  4AVB A;  2P6F A;  4K30 A;  2CNT A;  5E96 A;  1Y7R A;  1QSM A;  3W91 A;  2YND A;  5KTC A;  2Z3O A;  1VKC A;  2FCK A;  2BUE A;  3FIX A;  3I9S A;  3KKW A;  2FS5 A;  4U5Y A;  2B3V A;  3NE7 A;  1YVK A;  3ZZI A;  1LRZ A;  2AE6 A;  3QB8 A;  4KOV A;  3PGP A;  1QSO A;  3MGD A;  2QEC A;  5IX3 A;  2BSW A;  4KVX A;  5J8C A;  2P6E A;  3I3G A;  3TTH A;  2B4B A;  4YFJ A;  3BJ7 A;  2ZW5 A;  3SXO A;  5G22 A;  2D4P A;  2IL4 A;  3R9F A;  4AG9 A;  4C7I A;  1Z4R A;  4CAW A;  5ISV A;  3UY5 A;  5AGE A;  4UWJ A;  4CYO A;  5CNP A;  3D2M A;  2Q4Y A;  5EBV A;  5KTA A;  4UFW A;  3F5B A;  4NEX A;  4JXQ A;  1L0C A;  4H6U A;  1KZF A;  2OZH A;  4II9 A;  2ARH A;  1S3Z A;  2VEZ A;  2R1I A;  4J3G A;  4MFQ A;  1MJB A;  3S6F A;  5C82 A;  5AG7 A;  4MFJ A;  2FT0 A;  5AG4 A;  2FXF A;  4JXR A;  4BMH A;  4L8A A;  4A2Z A;  3EY5 A;  5HMN A;  4HNX B;  4MFK A;  2JEV A;  3G3S A;  2HUZ A;  1YVO A;  4Q38 A;  1YX0 A;  4JJX A;  4CS0 B;  4YRH A;  2C27 A;  2F5I A;  1KUX A;  1XF8 A;  4QB9 A;  3R96 A;  4MBU A;  3A9L A;  1XE4 A;  3DR6 A;  1CJW A;  5A27 A;  4IF5 A;  2BL1 A;  2Q0Y A;  1Z4E A;  3ZJ0 A;  2REE A;  2FIA A;  2Z3K A;  3CXP A;  4KOW A;  4MFL A;  3DNS A;  1OZP A;  4LUA A;  4QBJ A;  1B6B A;  2DPS A;  4QC6 A;  2DXQ A;  3IU1 A;  1CM0 A;  2ATR A;  1I1D A;  3DSB A;  4B5O A;  4CRZ B;  1YR0 A;  4CAX A;  1RXT A;  3GKR A;  3D2P A;  4NCZ A;  1PUA A;  4A32 A;  4CGO A;  4FD4 A;  2B58 A;  2EUI A;  3CXQ A;  2PR8 A;  1S7F A;  2CXA A;  4KS9 A;  1J4J A;  4B13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...