1Q3BA

Crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli: the r252a mutant at 2.05 resolution.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
262
structure length
259
Chain Sequence
PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQVDENKHHGALFRFKVFHRDGEPCERCGSIIEKTTLPFYWCPGCQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endonuclease VIII
publication title Structure of the uncomplexed DNA repair enzyme endonuclease VIII indicates significant interdomain flexibility.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 76
structure length 259
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1q3bA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 1q3bA01
4JI8M 2F5QA 1PJJA 4JI3M 4X65M 2VQEM 3A46A 3U6DA 1N34M 1Z59A 1KFVA 4PDGA 4DR2M 1K3WA 1Q3BA 5BR8M 1N33M 3GPYA 5ITRA 3W0FA 4NRWA 4PDIA 4DV3M 4G4QA 1TDZA 5ITXA 3U6LA 1K3XA 1HNZM 3SATA 4LF8M 2VQFM 4PD2A 1XMQM 2UUAM 1J5EM 3TWKA 1HNWM 2HKJA 4DV0M 3C58A 4GKKM 1FJGM 2ZBKB 4PCZA 2F5OA 2F5SA 1L1ZA 4B3RM 4NXMM 4B3TM 3GQ5A 1NNJA 1R2YA 4GKJM 4DV5M 1K82A 2UU9M 4DR4M 4NRVA 1Z5CA 3A42A 3U6MA 5ITQA 1PJIA 1N32M 1Z5BA 1EE8A 3T1YM 5A2QS 4X66M 3SAVA 1L2CA 4K0KM 2OQ4A 4JI5M 1Z5AA 2UUBM 1L1TA 4DUZM 2UXCM 4DV7M 5ITTA 4CISA 1IBMM 4LF9M 4LF6M 4JI6M 4X64M 2F5PA 3U6PA 4YHHM 4B3SM 3JR5A 4JI0M 4DR5M 4JV5M 2XZUA 1PM5A 4DV2M 2UUCM 1Q39A 3J7AS 4DV1M 3JAMS 2EA0A 3J80S 4LFAM 5FLXS 1IBKM 4JYAM 4JI4M 1XNQM 5ITUA 4DUYM 2UXDM 4LF7M 2UXBM 4X62M 3U6EA 1MU5A 1N36M 1IBLM 5LMNM 3SASA 5ITYA 3J81S 4JI2M 3GP1A 3GPUA 4NXNM 4B3MM 2F5NA 4LFBM 1HR0M 4JI7M 1L2BA 3SBJA 4G4RA 5ITXE 2HHHM 3GO8A 3DOAA 3A45A 4OX9M 4DR1M 1MX0A 4KHPM 2XZFA 4LF5M 3SAWA 2E5LM 2Q2EB 4JI1M 5LMUM 4AQYM 1XMOM 4ITQA 5IT9S 3GPPA 2OPFA 4DV4M 4DV6M 4DR3M 3VK7A 3JR4A 1HNXM 3U6OA 1TDHA 4G4NA 4G4OA 1XNRM 4DR7M 4LF4M 3TWMA 1R2ZA 4DR6M 2ZM6M 3TWLA 4MB7A 1Q3CA 3U6QA 3SAUA 1XC8A 4LFCM 3VK8A 5IWAM 1L2DA 2F4VM 3U6SA 3U6CA 1I94M 4YY3M 3GQ3A 3OTOM 3GPXA 3T1HM 3SARA 3GQ4A
chains in the Genus database with same CATH superfamily
1OFIA 4LJ7A 2V1CA 1V33A 2LNHC 2BNKA 4M0WA 2LXEA 2LVOC 3UJNA 1YLAA 2ERCA 1K3WA 3SFZA 4LGYA 5BR8M 1XWIA 3HJSA 5EP2A 4PT5A 4HEOA 2CE7A 5ITRA 3U60A 3HKPA 2O5RA 2ZTCA 3W0FA 3ZQJA 3K9OA 1GJSA 4IBGA 2OOBA 1VG5A 4LY6A 1QDRA 1FNNA 4LJ4A 2MJ5B 3BOSA 1MJGM 3GRUA 4M9ZA 3VLFB 3FRHA 2QPAA 3SATA 4LF8M 1D0LA 1QAQA 4FVMA 4R3DA 4PD2A 3IG8A 2DAKA 3FRIA 3GRVA 3SYLA 3MJ5A 3TWKA 4AW4A 2C98A 1TR8A 2LBCA 2L4EA 4BB9A 4RNAA 2JY6B 3C58A 1GO5A 4GKKM 1IN8A 2G8LA 3MK6A 3GLGE 4GITA 4RKUF 1SXJA 2MR9A 5FTJA 4B3TM 1JR3A 1R4GA 2R18A 4MGYE 4DV5M 3U5ZB 2DAGA 2L7IA 2C99A 3FUWA 3KS8A 4AG6A 4JXJA 1HQCA 2Z4RA 1NVMA 3C9PA 3NBIA 4K0KM 1Z5AA 3HHWA 4LRTA 4MGIE 4DUZM 4M9XA 4LJ8A 3SHGB 1IBMM 4LF9M 1G3IA 2G5GX 4JI6M 1N77A 4B08A 4YHHM 4RF1A 5JI2E 1R6BX 1EFUB 1IN5A 3U6PA 3EIEA 5EXTA 4B3SM 1RU3A 3KSJA 2K47A 1IXSB 2DZNB 3HJQA 4QNMA 2XZUA 3J7AS 3FTDA 2CHGA 3FE3A 4A3VB 1E9SA 3KFUG 3FUTA 2Z7JA 3GLHA 5FLXS 3LCVB 4JI4M 3RGPA 1BVSA 5ITUA 2DAEA 2FFJA 4DUYM 2UXDM 1HT2E 3KDSE 4II7A 4X62M 2CHVA 1WJ7A 4IBKA 1SXJD 4HLQA 4JI2M 4KO8A 1JR3D 2CHQA 1DO0A 4NXNM 4WP2A 2MH8A 4AKGA 4QOSA 3FD9A 1L2BA 3FTFA 2JXNA 5KO3A 3A45A 4D82A 3KOWE 2QNJA 2H5XA 2E5LM 4FWDA 2Z8YM 1D0MA 2KA6B 4ITQA 4L8RC 2QP9X 1C7YA 3W67A 4DV4M 1OAIA 1LTMA 1T6OA 1TDHA 4B7FA 1WR1B 3KXEC 4DBGB 4TUWA 1SXJE 8CATA 3VKHA 3GLGB 2KNZA 2VF7A 3FKEA 3B7ZA 3SHFA 4CJ6A 3KP1E 2ZAMA 3SMPA 3GLFB 1XC8A 3RFWA 1T43A 1VDLA 4GEWA 1ZV1A 5IWAM 2L6OA 1L2DA 2QBYA 3UMMA 3VKGA 4IBEA 5EXXA 4GMQA 4IBFA 4ZPXA 2XH9A 2XEPA 2DWLA 1TH2A 2XF3A 2L4FA 2ZAOA 2APLA 3GQ4A 3GLIA 3M6AA 4ANRA 1OKSA 1PJJA 2F5QA 4JI3M 1T3TA 3FTEA 1JB0F 2VF8A 3QAUA 4NL4H 2W82A 3T6PA 3U6DA 1Z59A 2EUCA 2HCBA 2XFTA 1IXZA 1Q3BA 2DWNA 3AOEA 1QYRA 1HQYE 2GQFA 1Y8GA 5JI3E 3L29A 1PJSA 3PFIA 3GLHE 4NRWA 2KZUA 2J7NA 2WZJA 1QZEA 1KYIA 2K0BX 1R7RA 4DV3M 4LJ5A 5ITXA 3U6LA 1QANA 3Q8XA 1GABA 2EKFA 4AI6A 1J7KA 1HNZM 2UUAM 1G41A 2ZTDA 4R7GA 5L8RF 2BWEA 4GC5A 3T38A 1LV7A 4MGKE 3ZC7B 1W5TA 1ORYB 3U60B 1FJGM 2ZBKB 2LVPC 4LJ9A 4QHSA 3J27B 4LCBA 4B3RM 2KNAA 4GHAA 1E9RA 2AHMA 1A5TA 3C3EA 3HU1A 3I51A 2UU9M 2DKLA 3K92A 3KVWA 3CGWA 4NRVA 1Z5CA 4BBAA 2WSEF 3A42A 3CF0A 4I8OA 3U6MA 5ITQA 1PJIA 4NSOB 2KRUA 4LGMA 3I4YA 2O25A 3KSXA 5A2QS 2N35A 4WW0A 2CV1A 3FUVA 3HZJA 2OQ4A 1NJGA 1SXJB 5EXSA 5C18A 4LF6M 1WHCA 5KQDA 1OQYA 3DFZA 4X64M 2DAMA 1NY5A 2Z3XA 5FSWA 1WGNA 3HHYA 4JI0M 3A98B 3K8ZA 4IJEA 1QVRA 1SG9A 2B3TA 3HJ8A 2O01F 2D7EA 3H4JA 1WIVA 4XK8F 1GVNA 5EXPA 3I4VA 3IG5A 3J80S 2Y21A 4LFAM 3W68A 3GLFE 3GLIE 4JYAM 2JY5A 1TTEA 3J7BA 2I7NA 2LHGA 4LF7M 4IIWA 4LJ6A 3TPZA 2KEBA 3U6EA 2Y20A 3BXWA 1IM2A 3I01M 2CV0A 5H37D 5ITYA 4FW9A 3GP1A 3GPUA 1TH4A 1IY2A 4B3MM 4LFBM 1Q02A 1HR0M 1HNXM 4FWGA 4G6ZA 3SBJA 2I7PA 3CF2A 3GLHB 5ITXE 2JWSA 4Z8XA 3GO8A 4IBIA 1TH3A 3M7GA 1IFYA 3KOYE 5IZ7D 4Y28F 1QUSA 1OIPA 1NHGC 4DR1M 2FS1A 5DNYA 4L4UA 4JN6A 2XZFA 4G3OA 4NC6A 1IQPA 3SAWA 3CF6E 5LMUM 4L15A 1G59A 3R9XB 3KOXE 1OJLA 2RGOA 1KSFX 2M60A 3B7NA 3JR4A 1GL6A 2CUZA 4DV6M 2EJSA 3WHKA 4DR3M 3U6OA 2QZ4A 5EP4A 1IN6A 3LQQA 4LRSA 3TWMA 2ZM6M 3B74A 3SAUA 1Q3CA 1YE9A 1OTRA 3HGIA 5FTMA 4P16A 2BWBA 2FOIC 3D8LA 2DZOB 1DGHA 2HAKA 4D80A 2F4VM 4OVZA 3U6SA 1D2NA 2VDBB 2QHOB 3GQ3A 1I94M 3AV0A 2JP7A 2X49A 3D8BA 5KPZA 1OAOC 2R0IA 4AZFA 3T1HM 3SARA 3V76A 3MMPA 4NOOB 2DHYA 2KRKA 2G3QA 2EKKA 3AJIB 4UN2B 3A46A 3ZH9B 3DA1A 1V92A 2XLJA 4PDGA 2QBYB 4DR2M 2Y0QA 3KW6A 5KPRA 2M5ZA 3GPYA 1IN7A 4KLNA 4RF0A 4IBBA 3VDPA 2KXEA 2R6FA 1JR3E 4LG2A 1UFZA 4MM3B 1VEKA 1ZMVA 4PDIA 3GLIB 4G4QA 4R71A 1TDZA 2JY7A 2C96A 3FUUA 3HWSA 3B9PA 2VQFM 1J09A 2J5YA 1NV8A 1V34A 3L2AA 4Z6YA 2HKJA 4MGZE 2DWZB 1IY0A 2R62A 2DZLA 1D0KA 1QQWA 2CEAA 5DFLA 2C5RA 2F5SA 1L1ZA 4S12A 1E32A 1PGYA 3GQ5A 1NNJA 2BJWA 4HL4A 4GKJM 3SC3A 4DR4M 1QUTA 3QWLA 4KODA 1XB2B 1G71A 3NBXX 4D81A 5IREB 2D7HA 2JNHA 3KP0E 3K9PA 1PJQA 1DV0A 3U61A 1EE8A 3T1YM 2EO2A 2HL7A 4X66M 4FD2A 3SAVA 2CP8A 1L2CA 4M9SA 4JI5M 2MROB 1WXQA 2C9CA 2UXCM 2KDLA 4DV7M 5ITTA 2BJVA 4NSRA 4Q7JA 2CRUA 3GRYA 3TE6A 3GRRA 5BPVA 2DXIA 4OU7A 3TL4X 2YQZA 4F1IA 4IBDA 3UGJA 3ZCBB 7CATA 2KZSA 1Q39A 2UUCM 4IBJA 1ZAEA 2P5TA 3JAMS 1ZMUA 2EA0A 5DYGA 3UZUA 2K6BA 4QOZC 3L26A 3RGSA 4QHTA 3SASA 1MU5A 1MN3A 4KT0F 3VDUA 2QENA 3FTCA 1IBLM 2LVQD 1NHWC 1UM8A 3HHZA 1VDDA 2X4AA 2YNMD 3FYDA 3NWLA 4AG5A 3SYKA 3LW5F 1IY1A 4JI7M 1NY6A 3THGA 4M0DA 3FYCA 3PNVA 4LZZA 4LZJA 4GRIA 3DOAA 2FNAA 1VQ1A 2LHCA 4OX9M 1MX0A 1PJTA 4KHPM 2R44A 1DGFA 2Q2EB 2FH0A 4IBCA 4MH0E 3E9SA 5IT9S 2R46A 2K9DA 1XXHA 4G4NA 3IHPA 2L2DA 4REZA 3AOGA 1R2ZA 3F92A 1YSYA 2QSFX 5E26A 5KPTA 3CTWB 3L27A 1CUKA 3KOZE 4MB7A 3TWLA 1NJFA 3VK8A 4EIWA 4FCWA 2J7OA 2CWBA 1VEGA 5FTKA 1OFHA 2OOAA 4YY3M 3U6CA 4L78A 3E21A 3HY5A 2JZ1A 1X37A 5E6JA 1OIZA 2FE8A 3B89A 3HU3A 3OTOM 2DAIA 2JUJA 4I4LA 3AFHA 2GNOA 2JZ0A 4JI8M 4W5WA 4IJFA 1HT1E 4LJAA 5KQ8A 2Z4SA 1YUBA 3HHXA 4X65M 2JY8A 2VQEM 1N34M 2WSCF 2R65A 1DGHB 1VEJA 3QYEA 1KFVA 1GLNA 3KS4A 4OVZB 1N33M 3M0EA 2LH0A 1TF0B 3K2LA 4WURA 5EP1A 4L6V6 2NQ8C 2XGNA 3PNYA 1K3XA 4I81A 1L8QA 1SXJC 1NSFA 5EJCA 4CIZA 1XMQM 3U5ZA 1P3QQ 3H4MA 5GKNA 4CGYB 2HWJA 1J5EM 4I5SA 2KHHA 1HNWM 3MHVC 4DV0M 3I04M 3B7QA 2DVWB 1E94E 1G4AE 4MGHA 4PCZA 2F5OA 3BBZA 1G8PA 4NXMM 2L7HA 2RKOA 1R2YA 1DO2A 5EP3A 1QAMA 1K82A 2X8AA 1AIPC 2R4JA 5F3WA 1I4WA 1PRBA 2CFOA 2Y0TA 4FCVA 1XXHE 1IXSA 1WGLA 3EIHA 1Z5BA 3IECA 1N32M 4L16A 4OW0A 5EQTA 2H1RA 2UUBM 4GHLA 4F2LA 4AKIA 1L1TA 2V6ZM 3WHLA 2V1UA 3E4RA 2QCUA 3HX3A 4CISA 5C1BA 3LVVA 4GH9A 2F5PA 5FTNA 2KW0A 1NO1A 1QAOA 2DHRA 4B7HA 3JR5A 3R8FA 1QZMA 2DI0A 3LCUA 4DR5M 4JV5M 2QQ8A 3L25A 2YR0A 1PM5A 4DV2M 1DGBA 1GL7A 4DV1M 3TQSA 3U61B 1IN4A 1C1KA 3LQRA 1JQJC 4P17A 1ZQ9A 3HU2A 1IXRC 1IBKM 3J2PB 2LVAA 3QYBA 3SMSA 1XNQM 1ZMWA 2R45A 2LVNC 4FCTA 2UXBM 2XSZA 2RGHA 2VIIA 2LTUA 4QNRA 1QDTA 2D7GA 1NNUC 5LMNM 1N36M 3PXGA 1GJTA 5FTLA 3J81S 2YFQA 3PVSA 4FWHA 2F5NA 4XBOA 4AKHA 3VFDA 1F4IA 4G4RA 2HHHM 1EIJA 2DNAA 1NV9A 3GLGA 3UK6A 3GLFA 3W0LB 4GC9A 2OO9A 2LWXA 4LF5M 4JI1M 2WSFF 2A5YB 4AQYM 1XMOM 4GIPA 3GPPA 1S3SA 5DYIA 3LMMA 2OPFA 3VK7A 1H6UA 1TGUA 3C3DA 2DENA 2ZANA 4G4OA 1XNRM 3DZDA 4DR7M 3K1JA 3T15A 2DWMA 3AKZA 4LF4M 2XFSA 4CHTB 4DR6M 2JA2A 1AUAA 3FUXA 3ILKA 3LVWA 3U6QA 2CV2A 2R4EA 4LFCM 1Z6TA 1R5LA 2L09A 2C9OA 3L28A 1N78A 1HJPA 2MGWA 2XSZD 1DGGA 1GKIA 2RRUA 3Q8GA 1XXHB 1XHBA 3AOEC 4B7GA 3E46A 4BLCA 1W5SA 1N75A 3GPXA 2KNVA 3RE8A 3AL0C 4XGIA
chains in the Genus database with same CATH topology
1OFIA 4LJ7A 2V1CA 2LNHC 2BNKA 4M0WA 2LXEA 3UJNA 2ERCA 1K3WA 3SFZA 4LGYA 5BR8M 1XWIA 3HJSA 5EP2A 4PT5A 2CE7A 5ITRA 3U60A 3HKPA 2O5RA 3W0FA 4IBGA 4LY6A 1FNNA 4LJ4A 3BOSA 3GRUA 4M9ZA 3VLFB 2QPAA 3SATA 4LF8M 1QAQA 4FVMA 4R3DA 4PD2A 3IG8A 3GRVA 3SYLA 3MJ5A 3TWKA 4AW4A 2C98A 4BB9A 4RNAA 3C58A 4GKKM 1IN8A 2G8LA 3MK6A 4GITA 1SXJA 5FTJA 4B3TM 1JR3A 2R18A 4MGYE 4DV5M 3U5ZB 2L7IA 2C99A 3FUWA 3KS8A 4AG6A 4JXJA 1HQCA 2Z4RA 1NVMA 3NBIA 4K0KM 1Z5AA 3HHWA 4LRTA 4MGIE 4DUZM 4M9XA 4LJ8A 3SHGB 1IBMM 4LF9M 1G3IA 2G5GX 4JI6M 1N77A 4B08A 4YHHM 4RF1A 5JI2E 1R6BX 1IN5A 3U6PA 4B3SM 3EIEA 5EXTA 3KSJA 2K47A 1IXSB 2DZNB 3HJQA 4QNMA 2XZUA 3J7AS 3FTDA 2CHGA 4A3VB 1E9SA 3KFUG 3FUTA 2Z7JA 3GLHA 5FLXS 4JI4M 3RGPA 5ITUA 4DUYM 2FFJA 2UXDM 1HT2E 3KDSE 4II7A 4X62M 2CHVA 4IBKA 1SXJD 4HLQA 4JI2M 4KO8A 1JR3D 2CHQA 1DO0A 4NXNM 4AKGA 4QOSA 3FD9A 1L2BA 3FTFA 5KO3A 3A45A 4D82A 3KOWE 2E5LM 4FWDA 2KA6B 4ITQA 4L8RC 2QP9X 4DV4M 1TDHA 4B7FA 3KXEC 4TUWA 1SXJE 8CATA 3VKHA 3GLGB 3FKEA 3SHFA 3KP1E 2ZAMA 3SMPA 3GLFB 1XC8A 3RFWA 5IWAM 2L6OA 1L2DA 2QBYA 3UMMA 3VKGA 4IBEA 5EXXA 4GMQA 4IBFA 4ZPXA 2XH9A 2XEPA 2DWLA 1TH2A 2XF3A 2ZAOA 3GQ4A 3GLIA 3M6AA 2F5QA 1PJJA 4JI3M 1T3TA 3FTEA 3U6DA 3QAUA 4NL4H 2W82A 1Z59A 2EUCA 2HCBA 2XFTA 1IXZA 1Q3BA 2DWNA 3AOEA 1QYRA 1HQYE 5JI3E 3L29A 3PFIA 4NRWA 2KZUA 2J7NA 1KYIA 4DV3M 1R7RA 4LJ5A 5ITXA 3U6LA 1QANA 3Q8XA 4AI6A 1J7KA 1HNZM 2UUAM 1G41A 4R7GA 4GC5A 3T38A 1LV7A 4MGKE 3ZC7B 1W5TA 1ORYB 3U60B 1FJGM 2ZBKB 4LJ9A 4QHSA 3J27B 4LCBA 4B3RM 4GHAA 1E9RA 2AHMA 3I51A 3HU1A 2UU9M 3K92A 3KVWA 4NRVA 1Z5CA 4BBAA 3A42A 3CF0A 4I8OA 3U6MA 5ITQA 1PJIA 4NSOB 2KRUA 4LGMA 3I4YA 3KSXA 5A2QS 4WW0A 2CV1A 3FUVA 2OQ4A 1NJGA 1SXJB 5EXSA 5C18A 4LF6M 5KQDA 3DFZA 4X64M 1NY5A 2Z3XA 5FSWA 3HHYA 4JI0M 3A98B 3K8ZA 4IJEA 1QVRA 3HJ8A 2D7EA 5EXPA 1GVNA 3I4VA 3IG5A 3J80S 2Y21A 4LFAM 4JYAM 3J7BA 2I7NA 4LF7M 4IIWA 4LJ6A 3TPZA 2KEBA 3U6EA 2Y20A 1IM2A 2CV0A 5H37D 5ITYA 4FW9A 3GP1A 3GPUA 1TH4A 1IY2A 4B3MM 4LFBM 1HR0M 1HNXM 4FWGA 4G6ZA 3SBJA 2I7PA 3CF2A 3GLHB 5ITXE 3GO8A 4Z8XA 4IBIA 1TH3A 3M7GA 3KOYE 5IZ7D 1NHGC 4DR1M 5DNYA 4L4UA 4JN6A 2XZFA 1IQPA 3SAWA 3CF6E 5LMUM 4L15A 1G59A 3R9XB 3KOXE 1OJLA 2RGOA 1KSFX 2M60A 4DV6M 3JR4A 1GL6A 2CUZA 4DR3M 3WHKA 3U6OA 2QZ4A 5EP4A 1IN6A 3LQQA 4LRSA 3TWMA 2ZM6M 3SAUA 1Q3CA 1YE9A 3HGIA 5FTMA 4P16A 2FOIC 3D8LA 4D80A 2DZOB 1DGHA 2F4VM 4OVZA 3U6SA 1D2NA 1I94M 3GQ3A 3AV0A 2X49A 3D8BA 5KPZA 4AZFA 3T1HM 3SARA 4NOOB 2KRKA 3A46A 3AJIB 3ZH9B 3DA1A 2XLJA 4PDGA 2QBYB 4DR2M 2Y0QA 3KW6A 5KPRA 2M5ZA 3GPYA 1IN7A 4KLNA 4RF0A 4IBBA 3VDPA 2KXEA 4LG2A 4MM3B 4PDIA 4G4QA 1TDZA 3GLIB 2C96A 3FUUA 3HWSA 3B9PA 2VQFM 1J09A 3L2AA 4Z6YA 2HKJA 4MGZE 2DWZB 1IY0A 2R62A 2CEAA 1QQWA 2C5RA 2F5SA 1L1ZA 4S12A 1E32A 3GQ5A 1NNJA 2BJWA 4HL4A 4GKJM 3SC3A 4DR4M 3QWLA 4KODA 4D81A 5IREB 2D7HA 3KP0E 3U61A 1EE8A 3T1YM 2EO2A 2HL7A 4X66M 4FD2A 3SAVA 1L2CA 4JI5M 4M9SA 1WXQA 2C9CA 2UXCM 4DV7M 5ITTA 2BJVA 4NSRA 3GRYA 3TE6A 3GRRA 5BPVA 2DXIA 4OU7A 3TL4X 2YQZA 4IBDA 3UGJA 3ZCBB 7CATA 2KZSA 1Q39A 2UUCM 4IBJA 1ZAEA 2P5TA 3JAMS 2EA0A 5DYGA 3UZUA 4QOZC 3L26A 3RGSA 4QHTA 3SASA 1MU5A 3VDUA 1IBLM 2QENA 3FTCA 1NHWC 1UM8A 3HHZA 1VDDA 2X4AA 2YNMD 3FYDA 3NWLA 4AG5A 3SYKA 1IY1A 4JI7M 1NY6A 3THGA 4M0DA 3FYCA 3PNVA 4LZZA 4LZJA 4GRIA 3DOAA 2FNAA 4OX9M 1MX0A 4KHPM 1DGFA 2Q2EB 4IBCA 4MH0E 3E9SA 5IT9S 2R46A 1XXHA 4G4NA 4REZA 3AOGA 1R2ZA 5KPTA 1YSYA 5E26A 3CTWB 3L27A 4MB7A 3KOZE 3TWLA 1NJFA 3VK8A 4EIWA 4FCWA 2J7OA 5FTKA 1OFHA 3U6CA 4YY3M 4L78A 5E6JA 1X37A 2FE8A 3HU3A 3OTOM 4I4LA 3AFHA 4JI8M 4W5WA 4IJFA 1HT1E 4LJAA 5KQ8A 2Z4SA 1YUBA 3HHXA 4X65M 2VQEM 1N34M 2R65A 1DGHB 1KFVA 1GLNA 3KS4A 4OVZB 1N33M 3M0EA 2LH0A 3K2LA 4WURA 5EP1A 2NQ8C 2XGNA 3PNYA 1K3XA 4I81A 1L8QA 1SXJC 1NSFA 5EJCA 1XMQM 3U5ZA 3H4MA 5GKNA 4CGYB 1J5EM 4I5SA 1HNWM 3MHVC 4DV0M 2DVWB 1E94E 1G4AE 4MGHA 4PCZA 2F5OA 1G8PA 4NXMM 2L7HA 2RKOA 1R2YA 1DO2A 5EP3A 1QAMA 1K82A 2X8AA 2R4JA 5F3WA 1I4WA 2CFOA 2Y0TA 4FCVA 3EIHA 1N32M 1Z5BA 4L16A 4OW0A 5EQTA 2H1RA 2UUBM 4GHLA 4AKIA 1L1TA 2V6ZM 3WHLA 2V1UA 3E4RA 2QCUA 4CISA 5C1BA 3LVVA 4GH9A 2F5PA 5FTNA 2KW0A 1QAOA 2DHRA 4B7HA 3R8FA 3JR5A 1QZMA 4DR5M 4JV5M 3L25A 2YR0A 1PM5A 4DV2M 1DGBA 1GL7A 4DV1M 3TQSA 3U61B 1IN4A 1C1KA 3LQRA 1JQJC 1ZQ9A 3HU2A 1IXRC 1IBKM 3J2PB 3SMSA 1XNQM 2R45A 4FCTA 2UXBM 2XSZA 2RGHA 2VIIA 4QNRA 2D7GA 1NNUC 5LMNM 1N36M 3PXGA 5FTLA 3J81S 2YFQA 3PVSA 4FWHA 2F5NA 4XBOA 4AKHA 3VFDA 4G4RA 2HHHM 3GLGA 3UK6A 3GLFA 3W0LB 4GC9A 2LWXA 4LF5M 4JI1M 2A5YB 4AQYM 1XMOM 4GIPA 3GPPA 1S3SA 5DYIA 3LMMA 2OPFA 3VK7A 1H6UA 1TGUA 2ZANA 4G4OA 1XNRM 3DZDA 4DR7M 3K1JA 3T15A 2DWMA 3AKZA 4LF4M 2XFSA 4CHTB 4DR6M 2JA2A 3LVWA 3FUXA 3ILKA 3U6QA 2CV2A 2R4EA 4LFCM 1Z6TA 2L09A 2C9OA 3L28A 1N78A 2XSZD 1DGGA 1GKIA 4B7GA 4BLCA 1XXHB 1XHBA 3AOEC 1W5SA 1N75A 3GPXA 3RE8A 3AL0C 4XGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 M;  2F5Q A;  1PJJ A;  4JI3 M;  4X65 M;  2VQE M;  3A46 A;  3U6D A;  1N34 M;  1Z59 A;  1KFV A;  4PDG A;  4DR2 M;  1K3W A;  1Q3B A;  5BR8 M;  1N33 M;  3GPY A;  5ITR A;  3W0F A;  4NRW A;  4PDI A;  4DV3 M;  4G4Q A;  1TDZ A;  5ITX A;  3U6L A;  1K3X A;  1HNZ M;  3SAT A;  4LF8 M;  2VQF M;  4PD2 A;  1XMQ M;  2UUA M;  1J5E M;  3TWK A;  1HNW M;  2HKJ A;  4DV0 M;  3C58 A;  4GKK M;  1FJG M;  2ZBK B;  4PCZ A;  2F5O A;  2F5S A;  1L1Z A;  4B3R M;  4NXM M;  4B3T M;  3GQ5 A;  1NNJ A;  1R2Y A;  4GKJ M;  4DV5 M;  1K82 A;  2UU9 M;  4DR4 M;  4NRV A;  1Z5C A;  3A42 A;  3U6M A;  5ITQ A;  1PJI A;  1N32 M;  1Z5B A;  1EE8 A;  3T1Y M;  5A2Q S;  4X66 M;  3SAV A;  1L2C A;  4K0K M;  2OQ4 A;  4JI5 M;  1Z5A A;  2UUB M;  1L1T A;  4DUZ M;  2UXC M;  4DV7 M;  5ITT A;  4CIS A;  1IBM M;  4LF9 M;  4LF6 M;  4JI6 M;  4X64 M;  2F5P A;  3U6P A;  4YHH M;  4B3S M;  3JR5 A;  4JI0 M;  4DR5 M;  4JV5 M;  2XZU A;  1PM5 A;  4DV2 M;  2UUC M;  1Q39 A;  3J7A S;  4DV1 M;  3JAM S;  2EA0 A;  3J80 S;  4LFA M;  5FLX S;  1IBK M;  4JYA M;  4JI4 M;  1XNQ M;  5ITU A;  4DUY M;  2UXD M;  4LF7 M;  2UXB M;  4X62 M;  3U6E A;  1MU5 A;  1N36 M;  1IBL M;  5LMN M;  3SAS A;  5ITY A;  3J81 S;  4JI2 M;  3GP1 A;  3GPU A;  4NXN M;  4B3M M;  2F5N A;  4LFB M;  1HR0 M;  4JI7 M;  1L2B A;  3SBJ A;  4G4R A;  5ITX E;  2HHH M;  3GO8 A;  3DOA A;  3A45 A;  4OX9 M;  4DR1 M;  1MX0 A;  4KHP M;  2XZF A;  4LF5 M;  3SAW A;  2E5L M;  2Q2E B;  4JI1 M;  5LMU M;  4AQY M;  1XMO M;  4ITQ A;  5IT9 S;  3GPP A;  2OPF A;  4DV4 M;  4DV6 M;  4DR3 M;  3VK7 A;  3JR4 A;  1HNX M;  3U6O A;  1TDH A;  4G4N A;  4G4O A;  1XNR M;  4DR7 M;  4LF4 M;  3TWM A;  1R2Z A;  4DR6 M;  2ZM6 M;  3TWL A;  4MB7 A;  1Q3C A;  3U6Q A;  3SAU A;  1XC8 A;  4LFC M;  3VK8 A;  5IWA M;  1L2D A;  2F4V M;  3U6S A;  3U6C A;  1I94 M;  4YY3 M;  3GQ3 A;  3OTO M;  3GPX A;  3T1H M;  3SAR A;  3GQ4 A; 
#chains in the Genus database with same CATH topology
 1OFI A;  4LJ7 A;  2V1C A;  1V33 A;  2LNH C;  2BNK A;  4M0W A;  2LXE A;  2LVO C;  3UJN A;  1YLA A;  2ERC A;  1K3W A;  3SFZ A;  4LGY A;  5BR8 M;  1XWI A;  3HJS A;  5EP2 A;  4PT5 A;  4HEO A;  2CE7 A;  5ITR A;  3U60 A;  3HKP A;  2O5R A;  2ZTC A;  3W0F A;  3ZQJ A;  3K9O A;  1GJS A;  4IBG A;  2OOB A;  1VG5 A;  4LY6 A;  1QDR A;  1FNN A;  4LJ4 A;  2MJ5 B;  3BOS A;  1MJG M;  3GRU A;  4M9Z A;  3VLF B;  3FRH A;  2QPA A;  3SAT A;  4LF8 M;  1D0L A;  1QAQ A;  4FVM A;  4R3D A;  4PD2 A;  3IG8 A;  2DAK A;  3FRI A;  3GRV A;  3SYL A;  3MJ5 A;  3TWK A;  4AW4 A;  2C98 A;  1TR8 A;  2LBC A;  2L4E A;  4BB9 A;  4RNA A;  2JY6 B;  3C58 A;  1GO5 A;  4GKK M;  1IN8 A;  2G8L A;  3MK6 A;  3GLG E;  4GIT A;  4RKU F;  1SXJ A;  2MR9 A;  5FTJ A;  4B3T M;  1JR3 A;  1R4G A;  2R18 A;  4MGY E;  4DV5 M;  3U5Z B;  2DAG A;  2L7I A;  2C99 A;  3FUW A;  3KS8 A;  4AG6 A;  4JXJ A;  1HQC A;  2Z4R A;  1NVM A;  3C9P A;  3NBI A;  4K0K M;  1Z5A A;  3HHW A;  4LRT A;  4MGI E;  4DUZ M;  4M9X A;  4LJ8 A;  3SHG B;  1IBM M;  4LF9 M;  1G3I A;  2G5G X;  4JI6 M;  1N77 A;  4B08 A;  4YHH M;  4RF1 A;  5JI2 E;  1R6B X;  1EFU B;  1IN5 A;  3U6P A;  3EIE A;  5EXT A;  4B3S M;  1RU3 A;  3KSJ A;  2K47 A;  1IXS B;  2DZN B;  3HJQ A;  4QNM A;  2XZU A;  3J7A S;  3FTD A;  2CHG A;  3FE3 A;  4A3V B;  1E9S A;  3KFU G;  3FUT A;  2Z7J A;  3GLH A;  5FLX S;  3LCV B;  4JI4 M;  3RGP A;  1BVS A;  5ITU A;  2DAE A;  2FFJ A;  4DUY M;  2UXD M;  1HT2 E;  3KDS E;  4II7 A;  4X62 M;  2CHV A;  1WJ7 A;  4IBK A;  1SXJ D;  4HLQ A;  4JI2 M;  4KO8 A;  1JR3 D;  2CHQ A;  1DO0 A;  4NXN M;  4WP2 A;  2MH8 A;  4AKG A;  4QOS A;  3FD9 A;  1L2B A;  3FTF A;  2JXN A;  5KO3 A;  3A45 A;  4D82 A;  3KOW E;  2QNJ A;  2H5X A;  2E5L M;  4FWD A;  2Z8Y M;  1D0M A;  2KA6 B;  4ITQ A;  4L8R C;  2QP9 X;  1C7Y A;  3W67 A;  4DV4 M;  1OAI A;  1LTM A;  1T6O A;  1TDH A;  4B7F A;  1WR1 B;  3KXE C;  4DBG B;  4TUW A;  1SXJ E;  8CAT A;  3VKH A;  3GLG B;  2KNZ A;  2VF7 A;  3FKE A;  3B7Z A;  3SHF A;  4CJ6 A;  3KP1 E;  2ZAM A;  3SMP A;  3GLF B;  1XC8 A;  3RFW A;  1T43 A;  1VDL A;  4GEW A;  1ZV1 A;  5IWA M;  2L6O A;  1L2D A;  2QBY A;  3UMM A;  3VKG A;  4IBE A;  5EXX A;  4GMQ A;  4IBF A;  4ZPX A;  2XH9 A;  2XEP A;  2DWL A;  1TH2 A;  2XF3 A;  2L4F A;  2ZAO A;  2APL A;  3GQ4 A;  3GLI A;  3M6A A;  4ANR A;  1OKS A;  1PJJ A;  2F5Q A;  4JI3 M;  1T3T A;  3FTE A;  1JB0 F;  2VF8 A;  3QAU A;  4NL4 H;  2W82 A;  3T6P A;  3U6D A;  1Z59 A;  2EUC A;  2HCB A;  2XFT A;  1IXZ A;  1Q3B A;  2DWN A;  3AOE A;  1QYR A;  1HQY E;  2GQF A;  1Y8G A;  5JI3 E;  3L29 A;  1PJS A;  3PFI A;  3GLH E;  4NRW A;  2KZU A;  2J7N A;  2WZJ A;  1QZE A;  1KYI A;  2K0B X;  1R7R A;  4DV3 M;  4LJ5 A;  5ITX A;  3U6L A;  1QAN A;  3Q8X A;  1GAB A;  2EKF A;  4AI6 A;  1J7K A;  1HNZ M;  2UUA M;  1G41 A;  2ZTD A;  4R7G A;  5L8R F;  2BWE A;  4GC5 A;  3T38 A;  1LV7 A;  4MGK E;  3ZC7 B;  1W5T A;  1ORY B;  3U60 B;  1FJG M;  2ZBK B;  2LVP C;  4LJ9 A;  4QHS A;  3J27 B;  4LCB A;  4B3R M;  2KNA A;  4GHA A;  1E9R A;  2AHM A;  1A5T A;  3C3E A;  3HU1 A;  3I51 A;  2UU9 M;  2DKL A;  3K92 A;  3KVW A;  3CGW A;  4NRV A;  1Z5C A;  4BBA A;  2WSE F;  3A42 A;  3CF0 A;  4I8O A;  3U6M A;  5ITQ A;  1PJI A;  4NSO B;  2KRU A;  4LGM A;  3I4Y A;  2O25 A;  3KSX A;  5A2Q S;  2N35 A;  4WW0 A;  2CV1 A;  3FUV A;  3HZJ A;  2OQ4 A;  1NJG A;  1SXJ B;  5EXS A;  5C18 A;  4LF6 M;  1WHC A;  5KQD A;  1OQY A;  3DFZ A;  4X64 M;  2DAM A;  1NY5 A;  2Z3X A;  5FSW A;  1WGN A;  3HHY A;  4JI0 M;  3A98 B;  3K8Z A;  4IJE A;  1QVR A;  1SG9 A;  2B3T A;  3HJ8 A;  2O01 F;  2D7E A;  3H4J A;  1WIV A;  4XK8 F;  1GVN A;  5EXP A;  3I4V A;  3IG5 A;  3J80 S;  2Y21 A;  4LFA M;  3W68 A;  3GLF E;  3GLI E;  4JYA M;  2JY5 A;  1TTE A;  3J7B A;  2I7N A;  2LHG A;  4LF7 M;  4IIW A;  4LJ6 A;  3TPZ A;  2KEB A;  3U6E A;  2Y20 A;  3BXW A;  1IM2 A;  3I01 M;  2CV0 A;  5H37 D;  5ITY A;  4FW9 A;  3GP1 A;  3GPU A;  1TH4 A;  1IY2 A;  4B3M M;  4LFB M;  1Q02 A;  1HR0 M;  1HNX M;  4FWG A;  4G6Z A;  3SBJ A;  2I7P A;  3CF2 A;  3GLH B;  5ITX E;  2JWS A;  4Z8X A;  3GO8 A;  4IBI A;  1TH3 A;  3M7G A;  1IFY A;  3KOY E;  5IZ7 D;  4Y28 F;  1QUS A;  1OIP A;  1NHG C;  4DR1 M;  2FS1 A;  5DNY A;  4L4U A;  4JN6 A;  2XZF A;  4G3O A;  4NC6 A;  1IQP A;  3SAW A;  3CF6 E;  5LMU M;  4L15 A;  1G59 A;  3R9X B;  3KOX E;  1OJL A;  2RGO A;  1KSF X;  2M60 A;  3B7N A;  3JR4 A;  1GL6 A;  2CUZ A;  4DV6 M;  2EJS A;  3WHK A;  4DR3 M;  3U6O A;  2QZ4 A;  5EP4 A;  1IN6 A;  3LQQ A;  4LRS A;  3TWM A;  2ZM6 M;  3B74 A;  3SAU A;  1Q3C A;  1YE9 A;  1OTR A;  3HGI A;  5FTM A;  4P16 A;  2BWB A;  2FOI C;  3D8L A;  2DZO B;  1DGH A;  2HAK A;  4D80 A;  2F4V M;  4OVZ A;  3U6S A;  1D2N A;  2VDB B;  2QHO B;  3GQ3 A;  1I94 M;  3AV0 A;  2JP7 A;  2X49 A;  3D8B A;  5KPZ A;  1OAO C;  2R0I A;  4AZF A;  3T1H M;  3SAR A;  3V76 A;  3MMP A;  4NOO B;  2DHY A;  2KRK A;  2G3Q A;  2EKK A;  3AJI B;  4UN2 B;  3A46 A;  3ZH9 B;  3DA1 A;  1V92 A;  2XLJ A;  4PDG A;  2QBY B;  4DR2 M;  2Y0Q A;  3KW6 A;  5KPR A;  2M5Z A;  3GPY A;  1IN7 A;  4KLN A;  4RF0 A;  4IBB A;  3VDP A;  2KXE A;  2R6F A;  1JR3 E;  4LG2 A;  1UFZ A;  4MM3 B;  1VEK A;  1ZMV A;  4PDI A;  3GLI B;  4G4Q A;  4R71 A;  1TDZ A;  2JY7 A;  2C96 A;  3FUU A;  3HWS A;  3B9P A;  2VQF M;  1J09 A;  2J5Y A;  1NV8 A;  1V34 A;  3L2A A;  4Z6Y A;  2HKJ A;  4MGZ E;  2DWZ B;  1IY0 A;  2R62 A;  2DZL A;  1D0K A;  1QQW A;  2CEA A;  5DFL A;  2C5R A;  2F5S A;  1L1Z A;  4S12 A;  1E32 A;  1PGY A;  3GQ5 A;  1NNJ A;  2BJW A;  4HL4 A;  4GKJ M;  3SC3 A;  4DR4 M;  1QUT A;  3QWL A;  4KOD A;  1XB2 B;  1G71 A;  3NBX X;  4D81 A;  5IRE B;  2D7H A;  2JNH A;  3KP0 E;  3K9P A;  1PJQ A;  1DV0 A;  3U61 A;  1EE8 A;  3T1Y M;  2EO2 A;  2HL7 A;  4X66 M;  4FD2 A;  3SAV A;  2CP8 A;  1L2C A;  4M9S A;  4JI5 M;  2MRO B;  1WXQ A;  2C9C A;  2UXC M;  2KDL A;  4DV7 M;  5ITT A;  2BJV A;  4NSR A;  4Q7J A;  2CRU A;  3GRY A;  3TE6 A;  3GRR A;  5BPV A;  2DXI A;  4OU7 A;  3TL4 X;  2YQZ A;  4F1I A;  4IBD A;  3UGJ A;  3ZCB B;  7CAT A;  2KZS A;  1Q39 A;  2UUC M;  4IBJ A;  1ZAE A;  2P5T A;  3JAM S;  1ZMU A;  2EA0 A;  5DYG A;  3UZU A;  2K6B A;  4QOZ C;  3L26 A;  3RGS A;  4QHT A;  3SAS A;  1MU5 A;  1MN3 A;  4KT0 F;  3VDU A;  2QEN A;  3FTC A;  1IBL M;  2LVQ D;  1NHW C;  1UM8 A;  3HHZ A;  1VDD A;  2X4A A;  2YNM D;  3FYD A;  3NWL A;  4AG5 A;  3SYK A;  3LW5 F;  1IY1 A;  4JI7 M;  1NY6 A;  3THG A;  4M0D A;  3FYC A;  3PNV A;  4LZZ A;  4LZJ A;  4GRI A;  3DOA A;  2FNA A;  1VQ1 A;  2LHC A;  4OX9 M;  1MX0 A;  1PJT A;  4KHP M;  2R44 A;  1DGF A;  2Q2E B;  2FH0 A;  4IBC A;  4MH0 E;  3E9S A;  5IT9 S;  2R46 A;  2K9D A;  1XXH A;  4G4N A;  3IHP A;  2L2D A;  4REZ A;  3AOG A;  1R2Z A;  3F92 A;  1YSY A;  2QSF X;  5E26 A;  5KPT A;  3CTW B;  3L27 A;  1CUK A;  3KOZ E;  4MB7 A;  3TWL A;  1NJF A;  3VK8 A;  4EIW A;  4FCW A;  2J7O A;  2CWB A;  1VEG A;  5FTK A;  1OFH A;  2OOA A;  4YY3 M;  3U6C A;  4L78 A;  3E21 A;  3HY5 A;  2JZ1 A;  1X37 A;  5E6J A;  1OIZ A;  2FE8 A;  3B89 A;  3HU3 A;  3OTO M;  2DAI A;  2JUJ A;  4I4L A;  3AFH A;  2GNO A;  2JZ0 A;  4JI8 M;  4W5W A;  4IJF A;  1HT1 E;  4LJA A;  5KQ8 A;  2Z4S A;  1YUB A;  3HHX A;  4X65 M;  2JY8 A;  2VQE M;  1N34 M;  2WSC F;  2R65 A;  1DGH B;  1VEJ A;  3QYE A;  1KFV A;  1GLN A;  3KS4 A;  4OVZ B;  1N33 M;  3M0E A;  2LH0 A;  1TF0 B;  3K2L A;  4WUR A;  5EP1 A;  4L6V 6;  2NQ8 C;  2XGN A;  3PNY A;  1K3X A;  4I81 A;  1L8Q A;  1SXJ C;  1NSF A;  5EJC A;  4CIZ A;  1XMQ M;  3U5Z A;  1P3Q Q;  3H4M A;  5GKN A;  4CGY B;  2HWJ A;  1J5E M;  4I5S A;  2KHH A;  1HNW M;  3MHV C;  4DV0 M;  3I04 M;  3B7Q A;  2DVW B;  1E94 E;  1G4A E;  4MGH A;  4PCZ A;  2F5O A;  3BBZ A;  1G8P A;  4NXM M;  2L7H A;  2RKO A;  1R2Y A;  1DO2 A;  5EP3 A;  1QAM A;  1K82 A;  2X8A A;  1AIP C;  2R4J A;  5F3W A;  1I4W A;  1PRB A;  2CFO A;  2Y0T A;  4FCV A;  1XXH E;  1IXS A;  1WGL A;  3EIH A;  1Z5B A;  3IEC A;  1N32 M;  4L16 A;  4OW0 A;  5EQT A;  2H1R A;  2UUB M;  4GHL A;  4F2L A;  4AKI A;  1L1T A;  2V6Z M;  3WHL A;  2V1U A;  3E4R A;  2QCU A;  3HX3 A;  4CIS A;  5C1B A;  3LVV A;  4GH9 A;  2F5P A;  5FTN A;  2KW0 A;  1NO1 A;  1QAO A;  2DHR A;  4B7H A;  3JR5 A;  3R8F A;  1QZM A;  2DI0 A;  3LCU A;  4DR5 M;  4JV5 M;  2QQ8 A;  3L25 A;  2YR0 A;  1PM5 A;  4DV2 M;  1DGB A;  1GL7 A;  4DV1 M;  3TQS A;  3U61 B;  1IN4 A;  1C1K A;  3LQR A;  1JQJ C;  4P17 A;  1ZQ9 A;  3HU2 A;  1IXR C;  1IBK M;  3J2P B;  2LVA A;  3QYB A;  3SMS A;  1XNQ M;  1ZMW A;  2R45 A;  2LVN C;  4FCT A;  2UXB M;  2XSZ A;  2RGH A;  2VII A;  2LTU A;  4QNR A;  1QDT A;  2D7G A;  1NNU C;  5LMN M;  1N36 M;  3PXG A;  1GJT A;  5FTL A;  3J81 S;  2YFQ A;  3PVS A;  4FWH A;  2F5N A;  4XBO A;  4AKH A;  3VFD A;  1F4I A;  4G4R A;  2HHH M;  1EIJ A;  2DNA A;  1NV9 A;  3GLG A;  3UK6 A;  3GLF A;  3W0L B;  4GC9 A;  2OO9 A;  2LWX A;  4LF5 M;  4JI1 M;  2WSF F;  2A5Y B;  4AQY M;  1XMO M;  4GIP A;  3GPP A;  1S3S A;  5DYI A;  3LMM A;  2OPF A;  3VK7 A;  1H6U A;  1TGU A;  3C3D A;  2DEN A;  2ZAN A;  4G4O A;  1XNR M;  3DZD A;  4DR7 M;  3K1J A;  3T15 A;  2DWM A;  3AKZ A;  4LF4 M;  2XFS A;  4CHT B;  4DR6 M;  2JA2 A;  1AUA A;  3FUX A;  3ILK A;  3LVW A;  3U6Q A;  2CV2 A;  2R4E A;  4LFC M;  1Z6T A;  1R5L A;  2L09 A;  2C9O A;  3L28 A;  1N78 A;  1HJP A;  2MGW A;  2XSZ D;  1DGG A;  1GKI A;  2RRU A;  3Q8G A;  1XXH B;  1XHB A;  3AOE C;  4B7G A;  3E46 A;  4BLC A;  1W5S A;  1N75 A;  3GPX A;  2KNV A;  3RE8 A;  3AL0 C;  4XGI A; 
#chains in the Genus database with same CATH homology
 1OFI A;  4LJ7 A;  2V1C A;  2LNH C;  2BNK A;  4M0W A;  2LXE A;  3UJN A;  2ERC A;  1K3W A;  3SFZ A;  4LGY A;  5BR8 M;  1XWI A;  3HJS A;  5EP2 A;  4PT5 A;  2CE7 A;  5ITR A;  3U60 A;  3HKP A;  2O5R A;  3W0F A;  4IBG A;  4LY6 A;  1FNN A;  4LJ4 A;  3BOS A;  3GRU A;  4M9Z A;  3VLF B;  2QPA A;  3SAT A;  4LF8 M;  1QAQ A;  4FVM A;  4R3D A;  4PD2 A;  3IG8 A;  3GRV A;  3SYL A;  3MJ5 A;  3TWK A;  4AW4 A;  2C98 A;  4BB9 A;  4RNA A;  3C58 A;  4GKK M;  1IN8 A;  2G8L A;  3MK6 A;  4GIT A;  1SXJ A;  5FTJ A;  4B3T M;  1JR3 A;  2R18 A;  4MGY E;  4DV5 M;  3U5Z B;  2L7I A;  2C99 A;  3FUW A;  3KS8 A;  4AG6 A;  4JXJ A;  1HQC A;  2Z4R A;  1NVM A;  3NBI A;  4K0K M;  1Z5A A;  3HHW A;  4LRT A;  4MGI E;  4DUZ M;  4M9X A;  4LJ8 A;  3SHG B;  1IBM M;  4LF9 M;  1G3I A;  2G5G X;  4JI6 M;  1N77 A;  4B08 A;  4YHH M;  4RF1 A;  5JI2 E;  1R6B X;  1IN5 A;  3U6P A;  4B3S M;  3EIE A;  5EXT A;  3KSJ A;  2K47 A;  1IXS B;  2DZN B;  3HJQ A;  4QNM A;  2XZU A;  3J7A S;  3FTD A;  2CHG A;  4A3V B;  1E9S A;  3KFU G;  3FUT A;  2Z7J A;  3GLH A;  5FLX S;  4JI4 M;  3RGP A;  5ITU A;  4DUY M;  2FFJ A;  2UXD M;  1HT2 E;  3KDS E;  4II7 A;  4X62 M;  2CHV A;  4IBK A;  1SXJ D;  4HLQ A;  4JI2 M;  4KO8 A;  1JR3 D;  2CHQ A;  1DO0 A;  4NXN M;  4AKG A;  4QOS A;  3FD9 A;  1L2B A;  3FTF A;  5KO3 A;  3A45 A;  4D82 A;  3KOW E;  2E5L M;  4FWD A;  2KA6 B;  4ITQ A;  4L8R C;  2QP9 X;  4DV4 M;  1TDH A;  4B7F A;  3KXE C;  4TUW A;  1SXJ E;  8CAT A;  3VKH A;  3GLG B;  3FKE A;  3SHF A;  3KP1 E;  2ZAM A;  3SMP A;  3GLF B;  1XC8 A;  3RFW A;  5IWA M;  2L6O A;  1L2D A;  2QBY A;  3UMM A;  3VKG A;  4IBE A;  5EXX A;  4GMQ A;  4IBF A;  4ZPX A;  2XH9 A;  2XEP A;  2DWL A;  1TH2 A;  2XF3 A;  2ZAO A;  3GQ4 A;  3GLI A;  3M6A A;  2F5Q A;  1PJJ A;  4JI3 M;  1T3T A;  3FTE A;  3U6D A;  3QAU A;  4NL4 H;  2W82 A;  1Z59 A;  2EUC A;  2HCB A;  2XFT A;  1IXZ A;  1Q3B A;  2DWN A;  3AOE A;  1QYR A;  1HQY E;  5JI3 E;  3L29 A;  3PFI A;  4NRW A;  2KZU A;  2J7N A;  1KYI A;  4DV3 M;  1R7R A;  4LJ5 A;  5ITX A;  3U6L A;  1QAN A;  3Q8X A;  4AI6 A;  1J7K A;  1HNZ M;  2UUA M;  1G41 A;  4R7G A;  4GC5 A;  3T38 A;  1LV7 A;  4MGK E;  3ZC7 B;  1W5T A;  1ORY B;  3U60 B;  1FJG M;  2ZBK B;  4LJ9 A;  4QHS A;  3J27 B;  4LCB A;  4B3R M;  4GHA A;  1E9R A;  2AHM A;  3I51 A;  3HU1 A;  2UU9 M;  3K92 A;  3KVW A;  4NRV A;  1Z5C A;  4BBA A;  3A42 A;  3CF0 A;  4I8O A;  3U6M A;  5ITQ A;  1PJI A;  4NSO B;  2KRU A;  4LGM A;  3I4Y A;  3KSX A;  5A2Q S;  4WW0 A;  2CV1 A;  3FUV A;  2OQ4 A;  1NJG A;  1SXJ B;  5EXS A;  5C18 A;  4LF6 M;  5KQD A;  3DFZ A;  4X64 M;  1NY5 A;  2Z3X A;  5FSW A;  3HHY A;  4JI0 M;  3A98 B;  3K8Z A;  4IJE A;  1QVR A;  3HJ8 A;  2D7E A;  5EXP A;  1GVN A;  3I4V A;  3IG5 A;  3J80 S;  2Y21 A;  4LFA M;  4JYA M;  3J7B A;  2I7N A;  4LF7 M;  4IIW A;  4LJ6 A;  3TPZ A;  2KEB A;  3U6E A;  2Y20 A;  1IM2 A;  2CV0 A;  5H37 D;  5ITY A;  4FW9 A;  3GP1 A;  3GPU A;  1TH4 A;  1IY2 A;  4B3M M;  4LFB M;  1HR0 M;  1HNX M;  4FWG A;  4G6Z A;  3SBJ A;  2I7P A;  3CF2 A;  3GLH B;  5ITX E;  3GO8 A;  4Z8X A;  4IBI A;  1TH3 A;  3M7G A;  3KOY E;  5IZ7 D;  1NHG C;  4DR1 M;  5DNY A;  4L4U A;  4JN6 A;  2XZF A;  1IQP A;  3SAW A;  3CF6 E;  5LMU M;  4L15 A;  1G59 A;  3R9X B;  3KOX E;  1OJL A;  2RGO A;  1KSF X;  2M60 A;  4DV6 M;  3JR4 A;  1GL6 A;  2CUZ A;  4DR3 M;  3WHK A;  3U6O A;  2QZ4 A;  5EP4 A;  1IN6 A;  3LQQ A;  4LRS A;  3TWM A;  2ZM6 M;  3SAU A;  1Q3C A;  1YE9 A;  3HGI A;  5FTM A;  4P16 A;  2FOI C;  3D8L A;  4D80 A;  2DZO B;  1DGH A;  2F4V M;  4OVZ A;  3U6S A;  1D2N A;  1I94 M;  3GQ3 A;  3AV0 A;  2X49 A;  3D8B A;  5KPZ A;  4AZF A;  3T1H M;  3SAR A;  4NOO B;  2KRK A;  3A46 A;  3AJI B;  3ZH9 B;  3DA1 A;  2XLJ A;  4PDG A;  2QBY B;  4DR2 M;  2Y0Q A;  3KW6 A;  5KPR A;  2M5Z A;  3GPY A;  1IN7 A;  4KLN A;  4RF0 A;  4IBB A;  3VDP A;  2KXE A;  4LG2 A;  4MM3 B;  4PDI A;  4G4Q A;  1TDZ A;  3GLI B;  2C96 A;  3FUU A;  3HWS A;  3B9P A;  2VQF M;  1J09 A;  3L2A A;  4Z6Y A;  2HKJ A;  4MGZ E;  2DWZ B;  1IY0 A;  2R62 A;  2CEA A;  1QQW A;  2C5R A;  2F5S A;  1L1Z A;  4S12 A;  1E32 A;  3GQ5 A;  1NNJ A;  2BJW A;  4HL4 A;  4GKJ M;  3SC3 A;  4DR4 M;  3QWL A;  4KOD A;  4D81 A;  5IRE B;  2D7H A;  3KP0 E;  3U61 A;  1EE8 A;  3T1Y M;  2EO2 A;  2HL7 A;  4X66 M;  4FD2 A;  3SAV A;  1L2C A;  4JI5 M;  4M9S A;  1WXQ A;  2C9C A;  2UXC M;  4DV7 M;  5ITT A;  2BJV A;  4NSR A;  3GRY A;  3TE6 A;  3GRR A;  5BPV A;  2DXI A;  4OU7 A;  3TL4 X;  2YQZ A;  4IBD A;  3UGJ A;  3ZCB B;  7CAT A;  2KZS A;  1Q39 A;  2UUC M;  4IBJ A;  1ZAE A;  2P5T A;  3JAM S;  2EA0 A;  5DYG A;  3UZU A;  4QOZ C;  3L26 A;  3RGS A;  4QHT A;  3SAS A;  1MU5 A;  3VDU A;  1IBL M;  2QEN A;  3FTC A;  1NHW C;  1UM8 A;  3HHZ A;  1VDD A;  2X4A A;  2YNM D;  3FYD A;  3NWL A;  4AG5 A;  3SYK A;  1IY1 A;  4JI7 M;  1NY6 A;  3THG A;  4M0D A;  3FYC A;  3PNV A;  4LZZ A;  4LZJ A;  4GRI A;  3DOA A;  2FNA A;  4OX9 M;  1MX0 A;  4KHP M;  1DGF A;  2Q2E B;  4IBC A;  4MH0 E;  3E9S A;  5IT9 S;  2R46 A;  1XXH A;  4G4N A;  4REZ A;  3AOG A;  1R2Z A;  5KPT A;  1YSY A;  5E26 A;  3CTW B;  3L27 A;  4MB7 A;  3KOZ E;  3TWL A;  1NJF A;  3VK8 A;  4EIW A;  4FCW A;  2J7O A;  5FTK A;  1OFH A;  3U6C A;  4YY3 M;  4L78 A;  5E6J A;  1X37 A;  2FE8 A;  3HU3 A;  3OTO M;  4I4L A;  3AFH A;  4JI8 M;  4W5W A;  4IJF A;  1HT1 E;  4LJA A;  5KQ8 A;  2Z4S A;  1YUB A;  3HHX A;  4X65 M;  2VQE M;  1N34 M;  2R65 A;  1DGH B;  1KFV A;  1GLN A;  3KS4 A;  4OVZ B;  1N33 M;  3M0E A;  2LH0 A;  3K2L A;  4WUR A;  5EP1 A;  2NQ8 C;  2XGN A;  3PNY A;  1K3X A;  4I81 A;  1L8Q A;  1SXJ C;  1NSF A;  5EJC A;  1XMQ M;  3U5Z A;  3H4M A;  5GKN A;  4CGY B;  1J5E M;  4I5S A;  1HNW M;  3MHV C;  4DV0 M;  2DVW B;  1E94 E;  1G4A E;  4MGH A;  4PCZ A;  2F5O A;  1G8P A;  4NXM M;  2L7H A;  2RKO A;  1R2Y A;  1DO2 A;  5EP3 A;  1QAM A;  1K82 A;  2X8A A;  2R4J A;  5F3W A;  1I4W A;  2CFO A;  2Y0T A;  4FCV A;  3EIH A;  1N32 M;  1Z5B A;  4L16 A;  4OW0 A;  5EQT A;  2H1R A;  2UUB M;  4GHL A;  4AKI A;  1L1T A;  2V6Z M;  3WHL A;  2V1U A;  3E4R A;  2QCU A;  4CIS A;  5C1B A;  3LVV A;  4GH9 A;  2F5P A;  5FTN A;  2KW0 A;  1QAO A;  2DHR A;  4B7H A;  3R8F A;  3JR5 A;  1QZM A;  4DR5 M;  4JV5 M;  3L25 A;  2YR0 A;  1PM5 A;  4DV2 M;  1DGB A;  1GL7 A;  4DV1 M;  3TQS A;  3U61 B;  1IN4 A;  1C1K A;  3LQR A;  1JQJ C;  1ZQ9 A;  3HU2 A;  1IXR C;  1IBK M;  3J2P B;  3SMS A;  1XNQ M;  2R45 A;  4FCT A;  2UXB M;  2XSZ A;  2RGH A;  2VII A;  4QNR A;  2D7G A;  1NNU C;  5LMN M;  1N36 M;  3PXG A;  5FTL A;  3J81 S;  2YFQ A;  3PVS A;  4FWH A;  2F5N A;  4XBO A;  4AKH A;  3VFD A;  4G4R A;  2HHH M;  3GLG A;  3UK6 A;  3GLF A;  3W0L B;  4GC9 A;  2LWX A;  4LF5 M;  4JI1 M;  2A5Y B;  4AQY M;  1XMO M;  4GIP A;  3GPP A;  1S3S A;  5DYI A;  3LMM A;  2OPF A;  3VK7 A;  1H6U A;  1TGU A;  2ZAN A;  4G4O A;  1XNR M;  3DZD A;  4DR7 M;  3K1J A;  3T15 A;  2DWM A;  3AKZ A;  4LF4 M;  2XFS A;  4CHT B;  4DR6 M;  2JA2 A;  3LVW A;  3FUX A;  3ILK A;  3U6Q A;  2CV2 A;  2R4E A;  4LFC M;  1Z6T A;  2L09 A;  2C9O A;  3L28 A;  1N78 A;  2XSZ D;  1DGG A;  1GKI A;  4B7G A;  4BLC A;  1XXH B;  1XHB A;  3AOE C;  1W5S A;  1N75 A;  3GPX A;  3RE8 A;  3AL0 C;  4XGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...