1Q3BA

Crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli: the r252a mutant at 2.05 resolution.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
262
structure length
259
Chain Sequence
b'PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQVDENKHHGALFRFKVFHRDGEPCERCGSIIEKTTLPFYWCPGCQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endonuclease VIII
publication title Structure of the uncomplexed DNA repair enzyme endonuclease VIII indicates significant interdomain flexibility.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 76
structure length 259
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1q3bA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 1q3bA01
4DV4M 3C58A 4G4OA 4JI0M 4MB7A 3GQ4A 2XZFA 1PJIA 1Q39A 1K3XA 4DV7M 1HNZM 2F5NA 5IWAM 4CISA 4B3RM 4NRVA 4PCZA 4LF5M 1EE8A 3A42A 1XNRM 1MU5A 4X62M 4DV0M 5ITXE 4YHHM 1N34M 1XMOM 2F5QA 1Z59A 4JI8M 4G4NA 1PJJA 2EA0A 3SAWA 3SARA 5LMNM 5LMUM 2Q2EB 2UXDM 3SATA 5ITTA 1N36M 4YY3M 2ZBKB 3T1YM 3U6SA 4PDIA 1IBKM 3GP1A 2E5LM 2OQ4A 1KFVA 1IBMM 4ITQA 3U6EA 1R2YA 4DR4M 4GKJM 3U6MA 5BR8M 1Z5AA 1IBLM 2UU9M 4LFBM 4DV2M 4DV1M 3DOAA 4DR5M 3JR5A 2VQEM 3GPYA 3U6CA 1Z5CA 2F5SA 4B3TM 3U6PA 2XZUA 4DR7M 5ITRA 4DR3M 3SBJA 1XC8A 1L2BA 1HNXM 1N32M 1TDZA 4X66M 4LF8M 4OX9M 4X65M 3TWLA 5ITUA 4K0KM 1TDHA 2UXBM 1R2ZA 3U6DA 4DV5M 5ITQA 3GQ5A 4JV5M 3W0FA 1HNWM 4DUZM 1L1TA 3GQ3A 4JI5M 1MX0A 4LF7M 4LF9M 4X64M 3U6QA 3SASA 3GO8A 2UXCM 5IT9S 1NNJA 1I94M 4NXMM 4GKKM 1XMQM 4G4QA 4PD2A 2OPFA 4B3SM 4B3MM 4DR6M 1FJGM 4AQYM 1K82A 4G4RA 4KHPM 2HKJA 2F5PA 4LF4M 1Q3CA 3J80S 4LF6M 3J7AS 1J5EM 3GPXA 2UUAM 3T1HM 2ZM6M 1Q3BA 1PM5A 1L2CA 5FLXS 5ITXA 3JR4A 2HHHM 4JI7M 3SAUA 1K3WA 3A46A 3JAMS 2VQFM 4JI4M 3U6LA 3A45A 3OTOM 1L2DA 4NXNM 2UUCM 2F4VM 4DR1M 4DV6M 3TWMA 4JI1M 4LFAM 3GPUA 4LFCM 1HR0M 4DR2M 4JI3M 3SAVA 3VK7A 1L1ZA 1N33M 2UUBM 3TWKA 4PDGA 4DV3M 2F5OA 4JYAM 3J81S 4JI2M 4NRWA 5ITYA 3GPPA 1XNQM 4JI6M 1Z5BA 4DUYM 3VK8A 3U6OA 5A2QS
chains in the Genus database with same CATH superfamily
4DV4M 1QAQA 3IG8A 4IBKA 4LGMA 4G4OA 1PJIA 3GLGB 2CFOA 2KRUA 3GLIE 1XB2B 4D81A 2EUCA 5IWAM 4B3RM 1XXHB 3SHFA 1I4WA 4LJ6A 3TQSA 1EE8A 1QANA 4QNRA 3E46A 4FCVA 1QUSA 2ZTCA 3GRRA 2QCUA 1N34M 2YQZA 1NHGC 2JXNA 4IBIA 4HL4A 4LG2A 1SG9A 2EA0A 1G41A 1G59A 4L15A 1NSFA 2Y20A 4DUYM 3AKZA 5JI3E 4GIPA 3B89A 2O5RA 3HZJA 3J7BA 2DENA 3NBXX 4ANRA 2ZTDA 4KO8A 2C99A 4GC5A 3SMPA 5KQDA 1R2YA 3SC3A 1QAMA 1T43A 2KNAA 3CF6E 2UU9M 1PJSA 1OQYA 1S3SA 2JY8A 4BBAA 1VEJA 2P5TA 2R46A 4FD2A 3GRUA 3LW5F 4AG6A 4B3TM 2K47A 4XBOA 4W5WA 1IN4A 4DR7M 3EIHA 5ITRA 3HHXA 2MR9A 3LCUA 4DR3M 2KXEA 2ZAOA 2CP8A 1OJLA 4D80A 1TDZA 1N32M 5JI2E 4LF8M 1OAIA 1IXSA 2LNHC 3B7QA 1TDHA 2G8LA 2UXBM 3SFZA 4DV5M 2C9CA 5ITQA 4JV5M 3CF0A 2YR0A 3U5ZB 2G3QA 5E26A 3GQ3A 1L1TA 4LF7M 1Y8GA 4MGHA 1IN5A 2JUJA 2DHRA 3GLGA 2QBYA 2DWLA 3WHLA 1I94M 1OTRA 1H6UA 1XXHA 3L26A 4L8RC 1GABA 1TGUA 4PD2A 2ZANA 3HJQA 1WHCA 2QNJA 3GLFB 2DHYA 5FTNA 3J80S 4LF6M 3C9PA 3J7AS 3GPXA 2BWBA 1J09A 4LJ7A 1ZAEA 1SXJB 1QDTA 5EP4A 1X37A 2L09A 5FLXS 5ITXA 1SXJC 2RKOA 2WSCF 4MGKE 3B9PA 3AL0C 2KHHA 2DWZB 3WHKA 3A46A 3HGIA 1IN7A 2KNZA 3U6LA 1R6BX 4IBBA 4LJ4A 3KS8A 1T3TA 3HU1A 2L7IA 2JWSA 3KP1E 1ZMWA 4LFAM 3T15A 2Z4SA 4OW0A 2CUZA 2H5XA 4RKUF 3UJNA 4DR2M 1GL7A 3SAVA 1V34A 1L1ZA 1PRBA 4FCTA 3GLHB 2UUBM 5KPZA 3F92A 2L6OA 2ZAMA 2MJ5B 3M6AA 4JN6A 1Z5BA 1JR3A 1HQYE 3DFZA 3I04M 1T6OA 1GL6A 2CE7A 2XGNA 4JI0M 2L7HA 3K9OA 3GQ4A 3FYCA 3KSXA 1Q39A 2DI0A 1K3XA 2D7EA 2CV2A 3I4YA 3U60B 4IJEA 1DO0A 3A42A 3U5ZA 4LF5M 1MU5A 2KEBA 2R62A 4X62M 2OO9A 3KW6A 4JXJA 5ITXE 1IFYA 3KOWE 1QUTA 4GITA 1KSFX 2WSEF 1Z59A 2I7PA 3SYKA 1TR8A 2OOBA 3ZQJA 2EKFA 3KXEC 1JR3D 3SHGB 4I4LA 4S12A 4WP2A 2I7NA 7CATA 2K0BX 2LVPC 2LHCA 1NY5A 4B7HA 3GLFA 4I81A 2JA2A 2LXEA 3DZDA 1QYRA 2JP7A 2DKLA 4YY3M 5ITTA 3PVSA 3H4JA 3K8ZA 3FRHA 4OU7A 4RF0A 4GHLA 3E9SA 4R7GA 2BNKA 1SXJA 1XWIA 4NC6A 4NSRA 2C98A 5FTKA 2C5RA 2OQ4A 4GHAA 1BVSA 3W0LB 1IBMM 4ITQA 1IM2A 1JR3E 3AFHA 4GKJM 4LFBM 3DOAA 2DAKA 3VDPA 1GO5A 2VQEM 1HJPA 1OIZA 2B3TA 3FUXA 1Z5CA 3FYDA 3GPYA 1NNUC 4BLCA 3U6PA 1N77A 3FTDA 4BB9A 3CTWB 2DAIA 3K92A 3KP0E 3UZUA 4FCWA 4IBGA 3FTFA 2O25A 1GJSA 4FWDA 2D7GA 2C9OA 3EIEA 3TWLA 4X65M 1SXJD 3GLHA 1IY2A 3VKHA 1GLNA 4M9SA 1JB0F 3W0FA 2CV0A 4QOZC 1GKIA 3FKEA 1YSYA 2K9DA 3M0EA 4DUZM 3HY5A 3KOZE 4LF9M 1WJ7A 1RU3A 3MMPA 4QOSA 4RF1A 4UN2B 3GLFE 1G3IA 1G8PA 1CUKA 3BXWA 2LVNC 2DWNA 3A98B 3L27A 3HWSA 3I01M 5H37D 3U60A 4NXMM 1NHWC 3LMMA 4GKKM 2RGOA 1ZQ9A 3L25A 4G4QA 5E6JA 2YNMD 1DV0A 3D8LA 1OFHA 5KO3A 2OPFA 2LH0A 5BPVA 4B3MM 1D0MA 4KHPM 1TF0B 2F5PA 1J5EM 4FWGA 2XF3A 2DAGA 3K2LA 1QZMA 2ZM6M 1Q3BA 1PM5A 1GVNA 2MROB 4NOOB 1L2CA 3FTEA 5GKNA 4JI7M 3T38A 3FE3A 2WSFF 1K3WA 2KDLA 1DGGA 2KA6B 3JAMS 2VQFM 4JI4M 3J27B 4KLNA 4IBEA 3GLHE 4I5SA 3OTOM 2CEAA 4R3DA 4P17A 4NXNM 4LRSA 3E4RA 3I4VA 2FH0A 1ZMVA 4QHSA 4RNAA 3QYEA 1R5LA 3TWMA 3GPUA 3GLIB 1PGYA 1UFZA 4WURA 2LVQD 2DAMA 2LWXA 4JI3M 4A3VB 4GH9A 4AKHA 2Y0QA 3ZC7B 4LJ8A 3TWKA 4DV3M 2F5OA 4JYAM 4JI2M 2CHVA 2L4EA 1AIPC 2APLA 2Z7JA 5EXPA 3K9PA 1J7KA 4JI6M 2DZNB 3U6OA 5A2QS 3IHPA 1IQPA 1VDLA 2DZOB 4MB7A 4KT0F 4FWHA 1N78A 2DZLA 3PNVA 4G6ZA 1HNZM 3PNYA 3B7ZA 4CISA 2V1UA 4M0DA 1QZEA 4MH0E 1XNRM 1HQCA 1A5TA 5FTLA 4DV0M 2Y0TA 3QAUA 8CATA 4Z6YA 3I51A 2XH9A 2FE8A 5EQTA 2F5QA 4G4NA 1YLAA 3HJ8A 1MJGM 3SAWA 3RFWA 3SARA 2GQFA 3GRYA 4OVZB 2HL7A 2J5YA 2JZ1A 2C96A 2Q2EB 4QNMA 1NVMA 5FTJA 3GLGE 2UXDM 1XXHE 3SYLA 1N36M 1WGLA 2J7NA 2ZBKB 2QQ8A 4EIWA 3T1YM 3U6SA 3Q8GA 3GP1A 2EKKA 3LCVB 5DYGA 4Q7JA 4HEOA 1ORYB 3LVWA 3THGA 2V6ZM 2XFTA 3ZCBB 4AKIA 3U6MA 1PJQA 4M9XA 4DV1M 1W5TA 4B7FA 3ILKA 3JR5A 1E32A 1N75A 3U6CA 4Y28F 4R71A 2M60A 1VG5A 2R18A 4IBCA 1TH3A 4LCBA 4LZZA 1E9RA 2DWMA 2Z8YM 1XC8A 2FFJA 3E21A 2MH8A 5EXXA 2L2DA 4XK8F 3GLIA 1WIVA 2QPAA 2QHOB 2Y21A 4AKGA 4K0KM 1IN6A 1OKSA 2HAKA 2VF8A 3W67A 1R2ZA 2AHMA 3KOYE 2H1RA 3LQRA 2QZ4A 3GQ5A 3FUTA 4MM3B 2O01F 1D0LA 3R8FA 1IXRC 1HNWM 2XFSA 2QP9X 5KQ8A 2KZUA 3AOEC 2R6FA 1R4GA 3U6QA 3GO8A 2UXCM 4AI6A 2CHGA 2EO2A 4LRTA 1NNJA 3HHWA 3HU2A 1UM8A 5KPTA 4GEWA 3IG5A 4CJ6A 3W68A 3FTCA 4B3SM 3NBIA 2HCBA 4DR6M 1WXQA 2HWJA 4AQYM 1XHBA 3GRVA 1K82A 1PJTA 2G5GX 4LF4M 3BOSA 3FD9A 4L4UA 4WW0A 4I8OA 4OVZA 2UUAM 3TPZA 3V76A 3ZH9B 2EJSA 2YFQA 2HHHM 1TH4A 2QBYB 1NV9A 2JY6B 1WR1B 1DGBA 2L4FA 2ERCA 3TL4X 1AUAA 4LGYA 1NY6A 3FRIA 3MJ5A 4D82A 2UUCM 2F4VM 2LVAA 1MN3A 1R7RA 3HU3A 4GRIA 3L2AA 4CGYB 3M7GA 3L29A 3AJIB 3QWLA 1SXJE 3L28A 4HLQA 2XSZA 2R45A 4MGZE 2JNHA 1FNNA 3VK7A 1N33M 3KDSE 4PDGA 1QVRA 3J81S 2NQ8C 1NV8A 3AOGA 5ITYA 3GPPA 1XNQM 2M5ZA 4F1IA 4JI8M 1LV7A 2X8AA 4IJFA 5IZ7D 2KW0A 2F5NA 4L78A 1IY0A 2X4AA 2LTUA 2R0IA 3C58A 2W82A 4IBFA 4B08A 5DFLA 2CV1A 1W5SA 1P3QQ 2QENA 1VQ1A 2CHQA 2XZFA 1EIJA 3J2PB 4GMQA 4DV7M 4NRVA 1VDDA 2BWEA 1E9SA 1EFUB 5C18A 4PCZA 1TTEA 3AOEA 1F4IA 3T6PA 2MGWA 2XSZD 2D7HA 2LVOC 2DXIA 4YHHM 1XMOM 2RGHA 2GNOA 3RGSA 3RGPA 4IBJA 4AZFA 5IREB 3UGJA 3U61B 1YUBA 2FOIC 2DAEA 3CF2A 3HKPA 1DGHB 1PJJA 3B7NA 3HHYA 2XEPA 3HHZA 4II7A 2JY7A 3D8BA 5LMNM 5LMUM 1IN8A 3KOXE 4M0WA 2Z4RA 3SATA 4FVMA 5L8RF 2LHGA 3CGWA 2CRUA 3VLFB 1NO1A 2FNAA 2VDBB 5FSWA 4PDIA 1G71A 1ZMUA 1ZV1A 1IBKM 2OOAA 2R44A 3LVVA 3NWLA 3PXGA 2E5LM 1LTMA 1V33A 3MK6A 1KFVA 1VEKA 4L6V6 2N35A 4KODA 4F2LA 3U6EA 3BBZA 4DR4M 4MGIE 5DNYA 3LQQA 5BR8M 1Z5AA 1IBLM 2KNVA 2RRUA 3AV0A 1YE9A 3HJSA 4LJ9A 4DV2M 4DR5M 1C1KA 3PFIA 2V1CA 2F5SA 2QSFX 2XZUA 3UMMA 1OAOC 2A5YB 5EJCA 1D2NA 1QAOA 2J7OA 3K1JA 3KVWA 3SBJA 1KYIA 1L2BA 1NJGA 5EXSA 4P16A 1HNXM 2JZ0A 4X66M 3DA1A 4MGYE 4OX9M 5ITUA 3FUWA 1WGNA 3FUVA 3H4MA 4QHTA 1TH2A 3RE8A 3VFDA 3U6DA 1C7YA 1D0KA 1G4AE 3UK6A 4Z8XA 2DVWB 3FUUA 3R9XB 5EP2A 5F3WA 3C3DA 1MX0A 4JI5M 4XGIA 4X64M 3SASA 5IT9S 1L8QA 4CHTB 1GJTA 1Q02A 2JY5A 2K6BA 1HT1E 4L16A 4LZJA 5KPRA 3MHVC 4AG5A 4M9ZA 4NSOB 1XMQM 1HT2E 4G3OA 3QYBA 4DBGB 2LBCA 1FJGM 3KS4A 1DO2A 4G4RA 5DYIA 2KZSA 2HKJA 2XLJA 3U61A 4NL4H 1Q3CA 4LY6A 1DGHA 1QDRA 1OFIA 3VDUA 4TUWA 5FTMA 4PT5A 3Q8XA 2DNAA 3T1HM 2R4JA 4REZA 3KSJA 3JR4A 4FW9A 3SAUA 1VEGA 2X49A 1IXZA 4LJ5A 3C3EA 2R65A 2VF7A 3TE6A 4IIWA 3A45A 1E94E 3B74A 1L2DA 2Z3XA 3VKGA 4LJAA 2BJVA 4DR1M 1OIPA 1QQWA 1Z6TA 4DV6M 4JI1M 1DGFA 3HX3A 4LFCM 2WZJA 1HR0M 4CIZA 3IECA 1IXSB 5EXTA 4GC9A 5EP3A 1V92A 4AW4A 1JQJC 2KRKA 5C1BA 3SMSA 2FS1A 4IBDA 2R4EA 5EP1A 1NJFA 4NRWA 4B7GA 3KFUG 2CWBA 2VIIA 1IY1A 4ZPXA 2BJWA 3VK8A
chains in the Genus database with same CATH topology
4DV4M 1QAQA 3IG8A 4IBKA 4LGMA 4G4OA 1PJIA 3GLGB 2CFOA 2KRUA 4D81A 2EUCA 5IWAM 4B3RM 1XXHB 3SHFA 1I4WA 4LJ6A 3TQSA 1EE8A 1QANA 4QNRA 4FCVA 3GRRA 2QCUA 1N34M 2YQZA 1NHGC 4IBIA 4HL4A 4LG2A 2EA0A 1G41A 1G59A 4L15A 1NSFA 2Y20A 4DUYM 3AKZA 5JI3E 4GIPA 2O5RA 3J7BA 4KO8A 2C99A 4GC5A 3SMPA 5KQDA 1R2YA 3SC3A 1QAMA 3CF6E 2UU9M 1S3SA 4BBAA 2P5TA 2R46A 4FD2A 3GRUA 4AG6A 4B3TM 2K47A 4XBOA 4W5WA 1IN4A 4DR7M 3EIHA 5ITRA 3HHXA 4DR3M 2KXEA 2ZAOA 1N32M 1OJLA 4D80A 1TDZA 5JI2E 4LF8M 2LNHC 1TDHA 2G8LA 2UXBM 3SFZA 4DV5M 2C9CA 5ITQA 4JV5M 3CF0A 2YR0A 3U5ZB 5E26A 3GQ3A 1L1TA 4LF7M 4MGHA 1IN5A 2QBYA 2DHRA 3GLGA 2DWLA 3WHLA 1I94M 1H6UA 1XXHA 3L26A 4L8RC 1TGUA 4PD2A 2ZANA 3HJQA 3GLFB 5FTNA 3J80S 4LF6M 3J7AS 3GPXA 1J09A 4LJ7A 1ZAEA 1SXJB 5EP4A 1X37A 2L09A 5FLXS 5ITXA 1SXJC 2RKOA 4MGKE 3AL0C 3B9PA 2DWZB 3WHKA 3A46A 3HGIA 1IN7A 3U6LA 1R6BX 4IBBA 4LJ4A 3KS8A 1T3TA 3HU1A 2L7IA 3KP1E 4LFAM 3T15A 2Z4SA 4OW0A 2CUZA 3UJNA 4DR2M 3SAVA 1GL7A 1L1ZA 4FCTA 3GLHB 2UUBM 5KPZA 2L6OA 2ZAMA 3M6AA 4JN6A 1Z5BA 1JR3A 3DFZA 1HQYE 1GL6A 2CE7A 2XGNA 4JI0M 2L7HA 3GQ4A 3FYCA 3KSXA 1Q39A 1K3XA 2CV2A 2D7EA 3I4YA 3U60B 4IJEA 1DO0A 3A42A 3U5ZA 4LF5M 1MU5A 2KEBA 2R62A 4X62M 3KW6A 4JXJA 5ITXE 3KOWE 4GITA 1KSFX 1Z59A 2I7PA 3SYKA 3KXEC 1JR3D 3SHGB 4I4LA 4S12A 2I7NA 7CATA 1NY5A 4B7HA 3GLFA 4I81A 2JA2A 2LXEA 3DZDA 1QYRA 5ITTA 4YY3M 3PVSA 3K8ZA 4OU7A 4RF0A 4GHLA 3E9SA 4R7GA 2BNKA 1SXJA 1XWIA 4NSRA 5FTKA 2C98A 2C5RA 2OQ4A 4GHAA 3W0LB 1IBMM 4ITQA 1IM2A 3AFHA 4GKJM 4LFBM 3DOAA 3VDPA 2VQEM 3FUXA 3GPYA 1Z5CA 3FYDA 1NNUC 4BLCA 3U6PA 1N77A 3FTDA 4BB9A 3CTWB 3KP0E 3K92A 3UZUA 4FCWA 4IBGA 3FTFA 4FWDA 2D7GA 2C9OA 3EIEA 3TWLA 4X65M 1SXJD 3GLHA 1IY2A 3VKHA 1GLNA 4M9SA 3W0FA 2CV0A 4QOZC 1GKIA 3FKEA 1YSYA 3M0EA 4DUZM 3KOZE 4LF9M 4QOSA 4RF1A 1G3IA 1G8PA 2DWNA 3A98B 3L27A 3HWSA 5H37D 3U60A 4NXMM 1NHWC 3LMMA 4GKKM 2RGOA 1ZQ9A 4G4QA 5E6JA 2YNMD 3D8LA 1OFHA 5KO3A 2OPFA 2LH0A 5BPVA 4B3MM 4KHPM 2F5PA 1J5EM 4FWGA 2XF3A 3K2LA 1QZMA 2ZM6M 1Q3BA 1PM5A 1GVNA 4NOOB 1L2CA 3FTEA 5GKNA 4JI7M 3T38A 1K3WA 1DGGA 2KA6B 3JAMS 2VQFM 4JI4M 3J27B 4KLNA 4IBEA 4I5SA 3OTOM 2CEAA 4R3DA 4NXNM 4LRSA 3E4RA 3I4VA 4QHSA 4RNAA 3TWMA 3GPUA 3GLIB 4WURA 2LWXA 4JI3M 4A3VB 4GH9A 4AKHA 2Y0QA 3ZC7B 4LJ8A 3TWKA 4DV3M 2F5OA 4JYAM 4JI2M 2CHVA 2Z7JA 5EXPA 4JI6M 1J7KA 2DZNB 3U6OA 5A2QS 1IQPA 2DZOB 4MB7A 1N78A 4FWHA 3PNVA 4G6ZA 1HNZM 3PNYA 4CISA 2V1UA 4M0DA 4MH0E 1XNRM 1HQCA 5FTLA 4DV0M 2Y0TA 3QAUA 8CATA 4Z6YA 3I51A 2XH9A 2FE8A 5EQTA 2F5QA 4G4NA 3HJ8A 3SAWA 3RFWA 3SARA 4OVZB 3GRYA 4QNMA 2HL7A 5FTJA 3L25A 2C96A 2Q2EB 1NVMA 2UXDM 3SYLA 1N36M 2J7NA 2ZBKB 4EIWA 3T1YM 3U6SA 3GP1A 5DYGA 1ORYB 3LVWA 3THGA 2V6ZM 2XFTA 3ZCBB 4AKIA 3U6MA 4M9XA 4DV1M 1W5TA 4B7FA 3ILKA 3JR5A 1E32A 1N75A 3U6CA 2M60A 2R18A 4IBCA 4LCBA 1TH3A 4LZZA 1E9RA 2DWMA 1XC8A 2FFJA 5EXXA 3GLIA 2QPAA 2Y21A 4K0KM 1IN6A 1R2ZA 2AHMA 3KOYE 2H1RA 3LQRA 2QZ4A 3GQ5A 3FUTA 4MM3B 3R8FA 1IXRC 1HNWM 2XFSA 2QP9X 5KQ8A 2KZUA 3AOEC 3U6QA 3GO8A 2UXCM 4AI6A 2CHGA 2EO2A 4LRTA 1NNJA 3HHWA 3HU2A 1UM8A 5KPTA 3IG5A 3FTCA 4B3SM 3NBIA 2HCBA 4DR6M 1WXQA 4AQYM 1XHBA 3GRVA 1K82A 2G5GX 4LF4M 3BOSA 3FD9A 4L4UA 4WW0A 4I8OA 4OVZA 2UUAM 3TPZA 3ZH9B 2YFQA 2HHHM 1TH4A 2QBYB 1DGBA 2ERCA 3TL4X 4LGYA 1NY6A 3MJ5A 4D82A 2UUCM 2F4VM 1R7RA 3HU3A 4GRIA 3L2AA 4CGYB 3M7GA 3L29A 3AJIB 3QWLA 1SXJE 3L28A 4HLQA 2XSZA 2R45A 4MGZE 1FNNA 3VK7A 1N33M 3KDSE 4PDGA 1QVRA 3J81S 2NQ8C 3AOGA 5ITYA 3GPPA 1XNQM 2M5ZA 1LV7A 2X8AA 4IJFA 5IZ7D 2KW0A 2F5NA 4L78A 1IY0A 2X4AA 3C58A 2W82A 4IBFA 4B08A 2CV1A 1W5SA 2QENA 2CHQA 2XZFA 3J2PB 4GMQA 4DV7M 4NRVA 1VDDA 5C18A 1E9SA 4PCZA 3AOEA 2XSZD 2D7HA 2DXIA 4YHHM 1XMOM 2RGHA 3RGSA 3RGPA 4IBJA 4AZFA 5IREB 3UGJA 3U61B 1YUBA 2FOIC 3CF2A 3HKPA 1PJJA 1DGHB 4JI8M 3HHYA 2XEPA 3HHZA 4II7A 3D8BA 5LMNM 5LMUM 1IN8A 3KOXE 4M0WA 2Z4RA 3SATA 4FVMA 3VLFB 2FNAA 5FSWA 4PDIA 1IBKM 3LVVA 3NWLA 3PXGA 2E5LM 3MK6A 1KFVA 4KODA 3U6EA 4DR4M 4MGIE 5DNYA 3LQQA 5BR8M 1Z5AA 1IBLM 4AKGA 3HJSA 3AV0A 1YE9A 4LJ9A 4DV2M 4DR5M 1C1KA 3PFIA 2V1CA 2F5SA 2XZUA 3UMMA 2A5YB 5EJCA 1D2NA 1QAOA 2J7OA 3K1JA 3KVWA 3SBJA 1KYIA 1L2BA 1NJGA 5EXSA 4P16A 1HNXM 4X66M 3DA1A 4MGYE 4OX9M 5ITUA 3FUWA 3FUVA 3H4MA 4QHTA 1TH2A 3RE8A 3VFDA 3U6DA 1G4AE 3UK6A 4Z8XA 2DVWB 3FUUA 3R9XB 5EP2A 5F3WA 4JI5M 1MX0A 4XGIA 4X64M 3SASA 5IT9S 1L8QA 4CHTB 4L16A 4LZJA 1HT1E 1XMQM 5KPRA 3MHVC 4AG5A 4M9ZA 4NSOB 1HT2E 1FJGM 3KS4A 1DO2A 4G4RA 5DYIA 2KZSA 2HKJA 2XLJA 3U61A 4NL4H 1Q3CA 4LY6A 1DGHA 3VDUA 1OFIA 4TUWA 5FTMA 4PT5A 3Q8XA 3T1HM 2R4JA 4REZA 3KSJA 3JR4A 4FW9A 3SAUA 2X49A 1IXZA 4LJ5A 2R65A 3TE6A 4IIWA 3A45A 1E94E 1L2DA 2Z3XA 3VKGA 4LJAA 2BJVA 4DR1M 1QQWA 1Z6TA 4DV6M 4JI1M 1DGFA 4LFCM 1HR0M 1IXSB 5EXTA 4GC9A 5EP3A 4AW4A 1JQJC 2KRKA 5C1BA 3SMSA 4IBDA 2R4EA 5EP1A 1NJFA 4NRWA 4B7GA 3KFUG 2VIIA 1IY1A 4ZPXA 2BJWA 3VK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 M;  3C58 A;  4G4O A;  4JI0 M;  4MB7 A;  3GQ4 A;  2XZF A;  1PJI A;  1Q39 A;  1K3X A;  4DV7 M;  1HNZ M;  2F5N A;  5IWA M;  4CIS A;  4B3R M;  4NRV A;  4PCZ A;  4LF5 M;  1EE8 A;  3A42 A;  1XNR M;  1MU5 A;  4X62 M;  4DV0 M;  5ITX E;  4YHH M;  1N34 M;  1XMO M;  2F5Q A;  1Z59 A;  4JI8 M;  4G4N A;  1PJJ A;  2EA0 A;  3SAW A;  3SAR A;  5LMN M;  5LMU M;  2Q2E B;  2UXD M;  3SAT A;  5ITT A;  1N36 M;  4YY3 M;  2ZBK B;  3T1Y M;  3U6S A;  4PDI A;  1IBK M;  3GP1 A;  2E5L M;  2OQ4 A;  1KFV A;  1IBM M;  4ITQ A;  3U6E A;  1R2Y A;  4DR4 M;  4GKJ M;  3U6M A;  5BR8 M;  1Z5A A;  1IBL M;  2UU9 M;  4LFB M;  4DV2 M;  4DV1 M;  3DOA A;  4DR5 M;  3JR5 A;  2VQE M;  3GPY A;  3U6C A;  1Z5C A;  2F5S A;  4B3T M;  3U6P A;  2XZU A;  4DR7 M;  5ITR A;  4DR3 M;  3SBJ A;  1XC8 A;  1L2B A;  1HNX M;  1N32 M;  1TDZ A;  4X66 M;  4LF8 M;  4OX9 M;  4X65 M;  3TWL A;  5ITU A;  4K0K M;  1TDH A;  2UXB M;  1R2Z A;  3U6D A;  4DV5 M;  5ITQ A;  3GQ5 A;  4JV5 M;  3W0F A;  1HNW M;  4DUZ M;  1L1T A;  3GQ3 A;  4JI5 M;  1MX0 A;  4LF7 M;  4LF9 M;  4X64 M;  3U6Q A;  3SAS A;  3GO8 A;  2UXC M;  5IT9 S;  1NNJ A;  1I94 M;  4NXM M;  4GKK M;  1XMQ M;  4G4Q A;  4PD2 A;  2OPF A;  4B3S M;  4B3M M;  4DR6 M;  1FJG M;  4AQY M;  1K82 A;  4G4R A;  4KHP M;  2HKJ A;  2F5P A;  4LF4 M;  1Q3C A;  3J80 S;  4LF6 M;  3J7A S;  1J5E M;  3GPX A;  2UUA M;  3T1H M;  2ZM6 M;  1Q3B A;  1PM5 A;  1L2C A;  5FLX S;  5ITX A;  3JR4 A;  2HHH M;  4JI7 M;  3SAU A;  1K3W A;  3A46 A;  3JAM S;  2VQF M;  4JI4 M;  3U6L A;  3A45 A;  3OTO M;  1L2D A;  4NXN M;  2UUC M;  2F4V M;  4DR1 M;  4DV6 M;  3TWM A;  4JI1 M;  4LFA M;  3GPU A;  4LFC M;  1HR0 M;  4DR2 M;  4JI3 M;  3SAV A;  3VK7 A;  1L1Z A;  1N33 M;  2UUB M;  3TWK A;  4PDG A;  4DV3 M;  2F5O A;  4JYA M;  3J81 S;  4JI2 M;  4NRW A;  5ITY A;  3GPP A;  1XNQ M;  4JI6 M;  1Z5B A;  4DUY M;  3VK8 A;  3U6O A;  5A2Q S; 
#chains in the Genus database with same CATH topology
 4DV4 M;  1QAQ A;  3IG8 A;  4IBK A;  4LGM A;  4G4O A;  1PJI A;  3GLG B;  2CFO A;  2KRU A;  3GLI E;  1XB2 B;  4D81 A;  2EUC A;  5IWA M;  4B3R M;  1XXH B;  3SHF A;  1I4W A;  4LJ6 A;  3TQS A;  1EE8 A;  1QAN A;  4QNR A;  3E46 A;  4FCV A;  1QUS A;  2ZTC A;  3GRR A;  2QCU A;  1N34 M;  2YQZ A;  1NHG C;  2JXN A;  4IBI A;  4HL4 A;  4LG2 A;  1SG9 A;  2EA0 A;  1G41 A;  1G59 A;  4L15 A;  1NSF A;  2Y20 A;  4DUY M;  3AKZ A;  5JI3 E;  4GIP A;  3B89 A;  2O5R A;  3HZJ A;  3J7B A;  2DEN A;  3NBX X;  4ANR A;  2ZTD A;  4KO8 A;  2C99 A;  4GC5 A;  3SMP A;  5KQD A;  1R2Y A;  3SC3 A;  1QAM A;  1T43 A;  2KNA A;  3CF6 E;  2UU9 M;  1PJS A;  1OQY A;  1S3S A;  2JY8 A;  4BBA A;  1VEJ A;  2P5T A;  2R46 A;  4FD2 A;  3GRU A;  3LW5 F;  4AG6 A;  4B3T M;  2K47 A;  4XBO A;  4W5W A;  1IN4 A;  4DR7 M;  3EIH A;  5ITR A;  3HHX A;  2MR9 A;  3LCU A;  4DR3 M;  2KXE A;  2ZAO A;  2CP8 A;  1OJL A;  4D80 A;  1TDZ A;  1N32 M;  5JI2 E;  4LF8 M;  1OAI A;  1IXS A;  2LNH C;  3B7Q A;  1TDH A;  2G8L A;  2UXB M;  3SFZ A;  4DV5 M;  2C9C A;  5ITQ A;  4JV5 M;  3CF0 A;  2YR0 A;  3U5Z B;  2G3Q A;  5E26 A;  3GQ3 A;  1L1T A;  4LF7 M;  1Y8G A;  4MGH A;  1IN5 A;  2JUJ A;  2DHR A;  3GLG A;  2QBY A;  2DWL A;  3WHL A;  1I94 M;  1OTR A;  1H6U A;  1XXH A;  3L26 A;  4L8R C;  1GAB A;  1TGU A;  4PD2 A;  2ZAN A;  3HJQ A;  1WHC A;  2QNJ A;  3GLF B;  2DHY A;  5FTN A;  3J80 S;  4LF6 M;  3C9P A;  3J7A S;  3GPX A;  2BWB A;  1J09 A;  4LJ7 A;  1ZAE A;  1SXJ B;  1QDT A;  5EP4 A;  1X37 A;  2L09 A;  5FLX S;  5ITX A;  1SXJ C;  2RKO A;  2WSC F;  4MGK E;  3B9P A;  3AL0 C;  2KHH A;  2DWZ B;  3WHK A;  3A46 A;  3HGI A;  1IN7 A;  2KNZ A;  3U6L A;  1R6B X;  4IBB A;  4LJ4 A;  3KS8 A;  1T3T A;  3HU1 A;  2L7I A;  2JWS A;  3KP1 E;  1ZMW A;  4LFA M;  3T15 A;  2Z4S A;  4OW0 A;  2CUZ A;  2H5X A;  4RKU F;  3UJN A;  4DR2 M;  1GL7 A;  3SAV A;  1V34 A;  1L1Z A;  1PRB A;  4FCT A;  3GLH B;  2UUB M;  5KPZ A;  3F92 A;  2L6O A;  2ZAM A;  2MJ5 B;  3M6A A;  4JN6 A;  1Z5B A;  1JR3 A;  1HQY E;  3DFZ A;  3I04 M;  1T6O A;  1GL6 A;  2CE7 A;  2XGN A;  4JI0 M;  2L7H A;  3K9O A;  3GQ4 A;  3FYC A;  3KSX A;  1Q39 A;  2DI0 A;  1K3X A;  2D7E A;  2CV2 A;  3I4Y A;  3U60 B;  4IJE A;  1DO0 A;  3A42 A;  3U5Z A;  4LF5 M;  1MU5 A;  2KEB A;  2R62 A;  4X62 M;  2OO9 A;  3KW6 A;  4JXJ A;  5ITX E;  1IFY A;  3KOW E;  1QUT A;  4GIT A;  1KSF X;  2WSE F;  1Z59 A;  2I7P A;  3SYK A;  1TR8 A;  2OOB A;  3ZQJ A;  2EKF A;  3KXE C;  1JR3 D;  3SHG B;  4I4L A;  4S12 A;  4WP2 A;  2I7N A;  7CAT A;  2K0B X;  2LVP C;  2LHC A;  1NY5 A;  4B7H A;  3GLF A;  4I81 A;  2JA2 A;  2LXE A;  3DZD A;  1QYR A;  2JP7 A;  2DKL A;  4YY3 M;  5ITT A;  3PVS A;  3H4J A;  3K8Z A;  3FRH A;  4OU7 A;  4RF0 A;  4GHL A;  3E9S A;  4R7G A;  2BNK A;  1SXJ A;  1XWI A;  4NC6 A;  4NSR A;  2C98 A;  5FTK A;  2C5R A;  2OQ4 A;  4GHA A;  1BVS A;  3W0L B;  1IBM M;  4ITQ A;  1IM2 A;  1JR3 E;  3AFH A;  4GKJ M;  4LFB M;  3DOA A;  2DAK A;  3VDP A;  1GO5 A;  2VQE M;  1HJP A;  1OIZ A;  2B3T A;  3FUX A;  1Z5C A;  3FYD A;  3GPY A;  1NNU C;  4BLC A;  3U6P A;  1N77 A;  3FTD A;  4BB9 A;  3CTW B;  2DAI A;  3K92 A;  3KP0 E;  3UZU A;  4FCW A;  4IBG A;  3FTF A;  2O25 A;  1GJS A;  4FWD A;  2D7G A;  2C9O A;  3EIE A;  3TWL A;  4X65 M;  1SXJ D;  3GLH A;  1IY2 A;  3VKH A;  1GLN A;  4M9S A;  1JB0 F;  3W0F A;  2CV0 A;  4QOZ C;  1GKI A;  3FKE A;  1YSY A;  2K9D A;  3M0E A;  4DUZ M;  3HY5 A;  3KOZ E;  4LF9 M;  1WJ7 A;  1RU3 A;  3MMP A;  4QOS A;  4RF1 A;  4UN2 B;  3GLF E;  1G3I A;  1G8P A;  1CUK A;  3BXW A;  2LVN C;  2DWN A;  3A98 B;  3L27 A;  3HWS A;  3I01 M;  5H37 D;  3U60 A;  4NXM M;  1NHW C;  3LMM A;  4GKK M;  2RGO A;  1ZQ9 A;  3L25 A;  4G4Q A;  5E6J A;  2YNM D;  1DV0 A;  3D8L A;  1OFH A;  5KO3 A;  2OPF A;  2LH0 A;  5BPV A;  4B3M M;  1D0M A;  4KHP M;  1TF0 B;  2F5P A;  1J5E M;  4FWG A;  2XF3 A;  2DAG A;  3K2L A;  1QZM A;  2ZM6 M;  1Q3B A;  1PM5 A;  1GVN A;  2MRO B;  4NOO B;  1L2C A;  3FTE A;  5GKN A;  4JI7 M;  3T38 A;  3FE3 A;  2WSF F;  1K3W A;  2KDL A;  1DGG A;  2KA6 B;  3JAM S;  2VQF M;  4JI4 M;  3J27 B;  4KLN A;  4IBE A;  3GLH E;  4I5S A;  3OTO M;  2CEA A;  4R3D A;  4P17 A;  4NXN M;  4LRS A;  3E4R A;  3I4V A;  2FH0 A;  1ZMV A;  4QHS A;  4RNA A;  3QYE A;  1R5L A;  3TWM A;  3GPU A;  3GLI B;  1PGY A;  1UFZ A;  4WUR A;  2LVQ D;  2DAM A;  2LWX A;  4JI3 M;  4A3V B;  4GH9 A;  4AKH A;  2Y0Q A;  3ZC7 B;  4LJ8 A;  3TWK A;  4DV3 M;  2F5O A;  4JYA M;  4JI2 M;  2CHV A;  2L4E A;  1AIP C;  2APL A;  2Z7J A;  5EXP A;  3K9P A;  1J7K A;  4JI6 M;  2DZN B;  3U6O A;  5A2Q S;  3IHP A;  1IQP A;  1VDL A;  2DZO B;  4MB7 A;  4KT0 F;  4FWH A;  1N78 A;  2DZL A;  3PNV A;  4G6Z A;  1HNZ M;  3PNY A;  3B7Z A;  4CIS A;  2V1U A;  4M0D A;  1QZE A;  4MH0 E;  1XNR M;  1HQC A;  1A5T A;  5FTL A;  4DV0 M;  2Y0T A;  3QAU A;  8CAT A;  4Z6Y A;  3I51 A;  2XH9 A;  2FE8 A;  5EQT A;  2F5Q A;  4G4N A;  1YLA A;  3HJ8 A;  1MJG M;  3SAW A;  3RFW A;  3SAR A;  2GQF A;  3GRY A;  4OVZ B;  2HL7 A;  2J5Y A;  2JZ1 A;  2C96 A;  2Q2E B;  4QNM A;  1NVM A;  5FTJ A;  3GLG E;  2UXD M;  1XXH E;  3SYL A;  1N36 M;  1WGL A;  2J7N A;  2ZBK B;  2QQ8 A;  4EIW A;  3T1Y M;  3U6S A;  3Q8G A;  3GP1 A;  2EKK A;  3LCV B;  5DYG A;  4Q7J A;  4HEO A;  1ORY B;  3LVW A;  3THG A;  2V6Z M;  2XFT A;  3ZCB B;  4AKI A;  3U6M A;  1PJQ A;  4M9X A;  4DV1 M;  1W5T A;  4B7F A;  3ILK A;  3JR5 A;  1E32 A;  1N75 A;  3U6C A;  4Y28 F;  4R71 A;  2M60 A;  1VG5 A;  2R18 A;  4IBC A;  1TH3 A;  4LCB A;  4LZZ A;  1E9R A;  2DWM A;  2Z8Y M;  1XC8 A;  2FFJ A;  3E21 A;  2MH8 A;  5EXX A;  2L2D A;  4XK8 F;  3GLI A;  1WIV A;  2QPA A;  2QHO B;  2Y21 A;  4AKG A;  4K0K M;  1IN6 A;  1OKS A;  2HAK A;  2VF8 A;  3W67 A;  1R2Z A;  2AHM A;  3KOY E;  2H1R A;  3LQR A;  2QZ4 A;  3GQ5 A;  3FUT A;  4MM3 B;  2O01 F;  1D0L A;  3R8F A;  1IXR C;  1HNW M;  2XFS A;  2QP9 X;  5KQ8 A;  2KZU A;  3AOE C;  2R6F A;  1R4G A;  3U6Q A;  3GO8 A;  2UXC M;  4AI6 A;  2CHG A;  2EO2 A;  4LRT A;  1NNJ A;  3HHW A;  3HU2 A;  1UM8 A;  5KPT A;  4GEW A;  3IG5 A;  4CJ6 A;  3W68 A;  3FTC A;  4B3S M;  3NBI A;  2HCB A;  4DR6 M;  1WXQ A;  2HWJ A;  4AQY M;  1XHB A;  3GRV A;  1K82 A;  1PJT A;  2G5G X;  4LF4 M;  3BOS A;  3FD9 A;  4L4U A;  4WW0 A;  4I8O A;  4OVZ A;  2UUA M;  3TPZ A;  3V76 A;  3ZH9 B;  2EJS A;  2YFQ A;  2HHH M;  1TH4 A;  2QBY B;  1NV9 A;  2JY6 B;  1WR1 B;  1DGB A;  2L4F A;  2ERC A;  3TL4 X;  1AUA A;  4LGY A;  1NY6 A;  3FRI A;  3MJ5 A;  4D82 A;  2UUC M;  2F4V M;  2LVA A;  1MN3 A;  1R7R A;  3HU3 A;  4GRI A;  3L2A A;  4CGY B;  3M7G A;  3L29 A;  3AJI B;  3QWL A;  1SXJ E;  3L28 A;  4HLQ A;  2XSZ A;  2R45 A;  4MGZ E;  2JNH A;  1FNN A;  3VK7 A;  1N33 M;  3KDS E;  4PDG A;  1QVR A;  3J81 S;  2NQ8 C;  1NV8 A;  3AOG A;  5ITY A;  3GPP A;  1XNQ M;  2M5Z A;  4F1I A;  4JI8 M;  1LV7 A;  2X8A A;  4IJF A;  5IZ7 D;  2KW0 A;  2F5N A;  4L78 A;  1IY0 A;  2X4A A;  2LTU A;  2R0I A;  3C58 A;  2W82 A;  4IBF A;  4B08 A;  5DFL A;  2CV1 A;  1W5S A;  1P3Q Q;  2QEN A;  1VQ1 A;  2CHQ A;  2XZF A;  1EIJ A;  3J2P B;  4GMQ A;  4DV7 M;  4NRV A;  1VDD A;  2BWE A;  1E9S A;  1EFU B;  5C18 A;  4PCZ A;  1TTE A;  3AOE A;  1F4I A;  3T6P A;  2MGW A;  2XSZ D;  2D7H A;  2LVO C;  2DXI A;  4YHH M;  1XMO M;  2RGH A;  2GNO A;  3RGS A;  3RGP A;  4IBJ A;  4AZF A;  5IRE B;  3UGJ A;  3U61 B;  1YUB A;  2FOI C;  2DAE A;  3CF2 A;  3HKP A;  1DGH B;  1PJJ A;  3B7N A;  3HHY A;  2XEP A;  3HHZ A;  4II7 A;  2JY7 A;  3D8B A;  5LMN M;  5LMU M;  1IN8 A;  3KOX E;  4M0W A;  2Z4R A;  3SAT A;  4FVM A;  5L8R F;  2LHG A;  3CGW A;  2CRU A;  3VLF B;  1NO1 A;  2FNA A;  2VDB B;  5FSW A;  4PDI A;  1G71 A;  1ZMU A;  1ZV1 A;  1IBK M;  2OOA A;  2R44 A;  3LVV A;  3NWL A;  3PXG A;  2E5L M;  1LTM A;  1V33 A;  3MK6 A;  1KFV A;  1VEK A;  4L6V 6;  2N35 A;  4KOD A;  4F2L A;  3U6E A;  3BBZ A;  4DR4 M;  4MGI E;  5DNY A;  3LQQ A;  5BR8 M;  1Z5A A;  1IBL M;  2KNV A;  2RRU A;  3AV0 A;  1YE9 A;  3HJS A;  4LJ9 A;  4DV2 M;  4DR5 M;  1C1K A;  3PFI A;  2V1C A;  2F5S A;  2QSF X;  2XZU A;  3UMM A;  1OAO C;  2A5Y B;  5EJC A;  1D2N A;  1QAO A;  2J7O A;  3K1J A;  3KVW A;  3SBJ A;  1KYI A;  1L2B A;  1NJG A;  5EXS A;  4P16 A;  1HNX M;  2JZ0 A;  4X66 M;  3DA1 A;  4MGY E;  4OX9 M;  5ITU A;  3FUW A;  1WGN A;  3FUV A;  3H4M A;  4QHT A;  1TH2 A;  3RE8 A;  3VFD A;  3U6D A;  1C7Y A;  1D0K A;  1G4A E;  3UK6 A;  4Z8X A;  2DVW B;  3FUU A;  3R9X B;  5EP2 A;  5F3W A;  3C3D A;  1MX0 A;  4JI5 M;  4XGI A;  4X64 M;  3SAS A;  5IT9 S;  1L8Q A;  4CHT B;  1GJT A;  1Q02 A;  2JY5 A;  2K6B A;  1HT1 E;  4L16 A;  4LZJ A;  5KPR A;  3MHV C;  4AG5 A;  4M9Z A;  4NSO B;  1XMQ M;  1HT2 E;  4G3O A;  3QYB A;  4DBG B;  2LBC A;  1FJG M;  3KS4 A;  1DO2 A;  4G4R A;  5DYI A;  2KZS A;  2HKJ A;  2XLJ A;  3U61 A;  4NL4 H;  1Q3C A;  4LY6 A;  1DGH A;  1QDR A;  1OFI A;  3VDU A;  4TUW A;  5FTM A;  4PT5 A;  3Q8X A;  2DNA A;  3T1H M;  2R4J A;  4REZ A;  3KSJ A;  3JR4 A;  4FW9 A;  3SAU A;  1VEG A;  2X49 A;  1IXZ A;  4LJ5 A;  3C3E A;  2R65 A;  2VF7 A;  3TE6 A;  4IIW A;  3A45 A;  1E94 E;  3B74 A;  1L2D A;  2Z3X A;  3VKG A;  4LJA A;  2BJV A;  4DR1 M;  1OIP A;  1QQW A;  1Z6T A;  4DV6 M;  4JI1 M;  1DGF A;  3HX3 A;  4LFC M;  2WZJ A;  1HR0 M;  4CIZ A;  3IEC A;  1IXS B;  5EXT A;  4GC9 A;  5EP3 A;  1V92 A;  4AW4 A;  1JQJ C;  2KRK A;  5C1B A;  3SMS A;  2FS1 A;  4IBD A;  2R4E A;  5EP1 A;  1NJF A;  4NRW A;  4B7G A;  3KFU G;  2CWB A;  2VII A;  1IY1 A;  4ZPX A;  2BJW A;  3VK8 A; 
#chains in the Genus database with same CATH homology
 4DV4 M;  1QAQ A;  3IG8 A;  4IBK A;  4LGM A;  4G4O A;  1PJI A;  3GLG B;  2CFO A;  2KRU A;  4D81 A;  2EUC A;  5IWA M;  4B3R M;  1XXH B;  3SHF A;  1I4W A;  4LJ6 A;  3TQS A;  1EE8 A;  1QAN A;  4QNR A;  4FCV A;  3GRR A;  2QCU A;  1N34 M;  2YQZ A;  1NHG C;  4IBI A;  4HL4 A;  4LG2 A;  2EA0 A;  1G41 A;  1G59 A;  4L15 A;  1NSF A;  2Y20 A;  4DUY M;  3AKZ A;  5JI3 E;  4GIP A;  2O5R A;  3J7B A;  4KO8 A;  2C99 A;  4GC5 A;  3SMP A;  5KQD A;  1R2Y A;  3SC3 A;  1QAM A;  3CF6 E;  2UU9 M;  1S3S A;  4BBA A;  2P5T A;  2R46 A;  4FD2 A;  3GRU A;  4AG6 A;  4B3T M;  2K47 A;  4XBO A;  4W5W A;  1IN4 A;  4DR7 M;  3EIH A;  5ITR A;  3HHX A;  4DR3 M;  2KXE A;  2ZAO A;  1N32 M;  1OJL A;  4D80 A;  1TDZ A;  5JI2 E;  4LF8 M;  2LNH C;  1TDH A;  2G8L A;  2UXB M;  3SFZ A;  4DV5 M;  2C9C A;  5ITQ A;  4JV5 M;  3CF0 A;  2YR0 A;  3U5Z B;  5E26 A;  3GQ3 A;  1L1T A;  4LF7 M;  4MGH A;  1IN5 A;  2QBY A;  2DHR A;  3GLG A;  2DWL A;  3WHL A;  1I94 M;  1H6U A;  1XXH A;  3L26 A;  4L8R C;  1TGU A;  4PD2 A;  2ZAN A;  3HJQ A;  3GLF B;  5FTN A;  3J80 S;  4LF6 M;  3J7A S;  3GPX A;  1J09 A;  4LJ7 A;  1ZAE A;  1SXJ B;  5EP4 A;  1X37 A;  2L09 A;  5FLX S;  5ITX A;  1SXJ C;  2RKO A;  4MGK E;  3AL0 C;  3B9P A;  2DWZ B;  3WHK A;  3A46 A;  3HGI A;  1IN7 A;  3U6L A;  1R6B X;  4IBB A;  4LJ4 A;  3KS8 A;  1T3T A;  3HU1 A;  2L7I A;  3KP1 E;  4LFA M;  3T15 A;  2Z4S A;  4OW0 A;  2CUZ A;  3UJN A;  4DR2 M;  3SAV A;  1GL7 A;  1L1Z A;  4FCT A;  3GLH B;  2UUB M;  5KPZ A;  2L6O A;  2ZAM A;  3M6A A;  4JN6 A;  1Z5B A;  1JR3 A;  3DFZ A;  1HQY E;  1GL6 A;  2CE7 A;  2XGN A;  4JI0 M;  2L7H A;  3GQ4 A;  3FYC A;  3KSX A;  1Q39 A;  1K3X A;  2CV2 A;  2D7E A;  3I4Y A;  3U60 B;  4IJE A;  1DO0 A;  3A42 A;  3U5Z A;  4LF5 M;  1MU5 A;  2KEB A;  2R62 A;  4X62 M;  3KW6 A;  4JXJ A;  5ITX E;  3KOW E;  4GIT A;  1KSF X;  1Z59 A;  2I7P A;  3SYK A;  3KXE C;  1JR3 D;  3SHG B;  4I4L A;  4S12 A;  2I7N A;  7CAT A;  1NY5 A;  4B7H A;  3GLF A;  4I81 A;  2JA2 A;  2LXE A;  3DZD A;  1QYR A;  5ITT A;  4YY3 M;  3PVS A;  3K8Z A;  4OU7 A;  4RF0 A;  4GHL A;  3E9S A;  4R7G A;  2BNK A;  1SXJ A;  1XWI A;  4NSR A;  5FTK A;  2C98 A;  2C5R A;  2OQ4 A;  4GHA A;  3W0L B;  1IBM M;  4ITQ A;  1IM2 A;  3AFH A;  4GKJ M;  4LFB M;  3DOA A;  3VDP A;  2VQE M;  3FUX A;  3GPY A;  1Z5C A;  3FYD A;  1NNU C;  4BLC A;  3U6P A;  1N77 A;  3FTD A;  4BB9 A;  3CTW B;  3KP0 E;  3K92 A;  3UZU A;  4FCW A;  4IBG A;  3FTF A;  4FWD A;  2D7G A;  2C9O A;  3EIE A;  3TWL A;  4X65 M;  1SXJ D;  3GLH A;  1IY2 A;  3VKH A;  1GLN A;  4M9S A;  3W0F A;  2CV0 A;  4QOZ C;  1GKI A;  3FKE A;  1YSY A;  3M0E A;  4DUZ M;  3KOZ E;  4LF9 M;  4QOS A;  4RF1 A;  1G3I A;  1G8P A;  2DWN A;  3A98 B;  3L27 A;  3HWS A;  5H37 D;  3U60 A;  4NXM M;  1NHW C;  3LMM A;  4GKK M;  2RGO A;  1ZQ9 A;  4G4Q A;  5E6J A;  2YNM D;  3D8L A;  1OFH A;  5KO3 A;  2OPF A;  2LH0 A;  5BPV A;  4B3M M;  4KHP M;  2F5P A;  1J5E M;  4FWG A;  2XF3 A;  3K2L A;  1QZM A;  2ZM6 M;  1Q3B A;  1PM5 A;  1GVN A;  4NOO B;  1L2C A;  3FTE A;  5GKN A;  4JI7 M;  3T38 A;  1K3W A;  1DGG A;  2KA6 B;  3JAM S;  2VQF M;  4JI4 M;  3J27 B;  4KLN A;  4IBE A;  4I5S A;  3OTO M;  2CEA A;  4R3D A;  4NXN M;  4LRS A;  3E4R A;  3I4V A;  4QHS A;  4RNA A;  3TWM A;  3GPU A;  3GLI B;  4WUR A;  2LWX A;  4JI3 M;  4A3V B;  4GH9 A;  4AKH A;  2Y0Q A;  3ZC7 B;  4LJ8 A;  3TWK A;  4DV3 M;  2F5O A;  4JYA M;  4JI2 M;  2CHV A;  2Z7J A;  5EXP A;  4JI6 M;  1J7K A;  2DZN B;  3U6O A;  5A2Q S;  1IQP A;  2DZO B;  4MB7 A;  1N78 A;  4FWH A;  3PNV A;  4G6Z A;  1HNZ M;  3PNY A;  4CIS A;  2V1U A;  4M0D A;  4MH0 E;  1XNR M;  1HQC A;  5FTL A;  4DV0 M;  2Y0T A;  3QAU A;  8CAT A;  4Z6Y A;  3I51 A;  2XH9 A;  2FE8 A;  5EQT A;  2F5Q A;  4G4N A;  3HJ8 A;  3SAW A;  3RFW A;  3SAR A;  4OVZ B;  3GRY A;  4QNM A;  2HL7 A;  5FTJ A;  3L25 A;  2C96 A;  2Q2E B;  1NVM A;  2UXD M;  3SYL A;  1N36 M;  2J7N A;  2ZBK B;  4EIW A;  3T1Y M;  3U6S A;  3GP1 A;  5DYG A;  1ORY B;  3LVW A;  3THG A;  2V6Z M;  2XFT A;  3ZCB B;  4AKI A;  3U6M A;  4M9X A;  4DV1 M;  1W5T A;  4B7F A;  3ILK A;  3JR5 A;  1E32 A;  1N75 A;  3U6C A;  2M60 A;  2R18 A;  4IBC A;  4LCB A;  1TH3 A;  4LZZ A;  1E9R A;  2DWM A;  1XC8 A;  2FFJ A;  5EXX A;  3GLI A;  2QPA A;  2Y21 A;  4K0K M;  1IN6 A;  1R2Z A;  2AHM A;  3KOY E;  2H1R A;  3LQR A;  2QZ4 A;  3GQ5 A;  3FUT A;  4MM3 B;  3R8F A;  1IXR C;  1HNW M;  2XFS A;  2QP9 X;  5KQ8 A;  2KZU A;  3AOE C;  3U6Q A;  3GO8 A;  2UXC M;  4AI6 A;  2CHG A;  2EO2 A;  4LRT A;  1NNJ A;  3HHW A;  3HU2 A;  1UM8 A;  5KPT A;  3IG5 A;  3FTC A;  4B3S M;  3NBI A;  2HCB A;  4DR6 M;  1WXQ A;  4AQY M;  1XHB A;  3GRV A;  1K82 A;  2G5G X;  4LF4 M;  3BOS A;  3FD9 A;  4L4U A;  4WW0 A;  4I8O A;  4OVZ A;  2UUA M;  3TPZ A;  3ZH9 B;  2YFQ A;  2HHH M;  1TH4 A;  2QBY B;  1DGB A;  2ERC A;  3TL4 X;  4LGY A;  1NY6 A;  3MJ5 A;  4D82 A;  2UUC M;  2F4V M;  1R7R A;  3HU3 A;  4GRI A;  3L2A A;  4CGY B;  3M7G A;  3L29 A;  3AJI B;  3QWL A;  1SXJ E;  3L28 A;  4HLQ A;  2XSZ A;  2R45 A;  4MGZ E;  1FNN A;  3VK7 A;  1N33 M;  3KDS E;  4PDG A;  1QVR A;  3J81 S;  2NQ8 C;  3AOG A;  5ITY A;  3GPP A;  1XNQ M;  2M5Z A;  1LV7 A;  2X8A A;  4IJF A;  5IZ7 D;  2KW0 A;  2F5N A;  4L78 A;  1IY0 A;  2X4A A;  3C58 A;  2W82 A;  4IBF A;  4B08 A;  2CV1 A;  1W5S A;  2QEN A;  2CHQ A;  2XZF A;  3J2P B;  4GMQ A;  4DV7 M;  4NRV A;  1VDD A;  5C18 A;  1E9S A;  4PCZ A;  3AOE A;  2XSZ D;  2D7H A;  2DXI A;  4YHH M;  1XMO M;  2RGH A;  3RGS A;  3RGP A;  4IBJ A;  4AZF A;  5IRE B;  3UGJ A;  3U61 B;  1YUB A;  2FOI C;  3CF2 A;  3HKP A;  1PJJ A;  1DGH B;  4JI8 M;  3HHY A;  2XEP A;  3HHZ A;  4II7 A;  3D8B A;  5LMN M;  5LMU M;  1IN8 A;  3KOX E;  4M0W A;  2Z4R A;  3SAT A;  4FVM A;  3VLF B;  2FNA A;  5FSW A;  4PDI A;  1IBK M;  3LVV A;  3NWL A;  3PXG A;  2E5L M;  3MK6 A;  1KFV A;  4KOD A;  3U6E A;  4DR4 M;  4MGI E;  5DNY A;  3LQQ A;  5BR8 M;  1Z5A A;  1IBL M;  4AKG A;  3HJS A;  3AV0 A;  1YE9 A;  4LJ9 A;  4DV2 M;  4DR5 M;  1C1K A;  3PFI A;  2V1C A;  2F5S A;  2XZU A;  3UMM A;  2A5Y B;  5EJC A;  1D2N A;  1QAO A;  2J7O A;  3K1J A;  3KVW A;  3SBJ A;  1KYI A;  1L2B A;  1NJG A;  5EXS A;  4P16 A;  1HNX M;  4X66 M;  3DA1 A;  4MGY E;  4OX9 M;  5ITU A;  3FUW A;  3FUV A;  3H4M A;  4QHT A;  1TH2 A;  3RE8 A;  3VFD A;  3U6D A;  1G4A E;  3UK6 A;  4Z8X A;  2DVW B;  3FUU A;  3R9X B;  5EP2 A;  5F3W A;  4JI5 M;  1MX0 A;  4XGI A;  4X64 M;  3SAS A;  5IT9 S;  1L8Q A;  4CHT B;  4L16 A;  4LZJ A;  1HT1 E;  1XMQ M;  5KPR A;  3MHV C;  4AG5 A;  4M9Z A;  4NSO B;  1HT2 E;  1FJG M;  3KS4 A;  1DO2 A;  4G4R A;  5DYI A;  2KZS A;  2HKJ A;  2XLJ A;  3U61 A;  4NL4 H;  1Q3C A;  4LY6 A;  1DGH A;  3VDU A;  1OFI A;  4TUW A;  5FTM A;  4PT5 A;  3Q8X A;  3T1H M;  2R4J A;  4REZ A;  3KSJ A;  3JR4 A;  4FW9 A;  3SAU A;  2X49 A;  1IXZ A;  4LJ5 A;  2R65 A;  3TE6 A;  4IIW A;  3A45 A;  1E94 E;  1L2D A;  2Z3X A;  3VKG A;  4LJA A;  2BJV A;  4DR1 M;  1QQW A;  1Z6T A;  4DV6 M;  4JI1 M;  1DGF A;  4LFC M;  1HR0 M;  1IXS B;  5EXT A;  4GC9 A;  5EP3 A;  4AW4 A;  1JQJ C;  2KRK A;  5C1B A;  3SMS A;  4IBD A;  2R4E A;  5EP1 A;  1NJF A;  4NRW A;  4B7G A;  3KFU G;  2VII A;  1IY1 A;  4ZPX A;  2BJW A;  3VK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...