1Q3BA

Crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli: the r252a mutant at 2.05 resolution.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
262
structure length
259
Chain Sequence
b'PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQVDENKHHGALFRFKVFHRDGEPCERCGSIIEKTTLPFYWCPGCQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endonuclease VIII
publication title Structure of the uncomplexed DNA repair enzyme endonuclease VIII indicates significant interdomain flexibility.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 76
structure length 259
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1q3bA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 1q3bA01
4LF7M 5ITRA 4LF9M 5ITQA 1N32M 1IBMM 2UXDM 3JR4A 4JYAM 3GO8A 3U6SA 4GKKM 3W0FA 3U6LA 3GQ5A 3U6EA 4B3SM 4B3RM 4GKJM 4PDGA 4DR2M 4JI0M 4YY3M 4LFAM 2OPFA 5ITUA 3U6QA 2ZBKB 4LF8M 4X65M 4DV4M 4DR4M 2F5PA 1HR0M 2VQFM 1XMQM 2F5QA 3J80S 4DR1M 2XZUA 1XC8A 4JI6M 4NXNM 4X64M 3U6DA 1Q3BA 1Z5AA 2HKJA 2VQEM 1R2ZA 4K0KM 4LF5M 3SAUA 2UU9M 4DR3M 1TDHA 3GQ3A 1MU5A 4B3MM 3SARA 4LFCM 4AQYM 1EE8A 1L2BA 1L2CA 1PM5A 1HNZM 4B3TM 2E5LM 2UXCM 5ITXE 3OTOM 3SBJA 1NNJA 4DUZM 1IBKM 3TWMA 4G4QA 1K3WA 3GPUA 1XNRM 1Q3CA 4KHPM 4LF4M 3A45A 2UUCM 4DV7M 1XNQM 1K82A 2HHHM 4JI4M 1IBLM 2F5NA 1Z5CA 1L2DA 4MB7A 3SAVA 2F4VM 1N33M 2UUAM 1PJIA 1PJJA 4JI7M 3U6PA 4ITQA 4YHHM 4DUYM 4OX9M 3GPYA 1L1TA 2Q2EB 5FLXS 3A46A 3JR5A 4JI1M 5IT9S 4X66M 5ITYA 3GP1A 4LF6M 4LFBM 3U6CA 1I94M 1R2YA 4DR7M 1FJGM 5ITXA 3J7AS 1L1ZA 1K3XA 4NRVA 1MX0A 3C58A 2ZM6M 3GPPA 1XMOM 3DOAA 2OQ4A 4PCZA 4DV5M 1TDZA 5A2QS 1Z59A 3T1HM 3SASA 3JAMS 5BR8M 4DV6M 4DV1M 4DR5M 2UUBM 4PD2A 5LMNM 3GQ4A 3SATA 5IWAM 3SAWA 2F5OA 3T1YM 3TWLA 4DR6M 1Z5BA 2F5SA 4NXMM 1HNWM 4JI5M 4JI8M 3GPXA 4X62M 3A42A 4G4NA 4G4RA 4JI2M 3TWKA 4CISA 5ITTA 4G4OA 4PDIA 3VK7A 2XZFA 4JI3M 3J81S 3U6MA 4DV2M 4DV3M 4NRWA 3VK8A 1Q39A 1KFVA 4JV5M 2UXBM 3U6OA 5LMUM 1N34M 1N36M 1J5EM 4DV0M 1HNXM 2EA0A
chains in the Genus database with same CATH superfamily
4LF9M 4MH0E 3LCUA 4P16A 5JI3E 3C9PA 1LV7A 4IBIA 1ZMUA 3U6SA 4MGYE 1NV8A 3THGA 4D82A 1XXHA 3U6LA 4FCTA 2ZANA 3FRHA 4II7A 4B3RM 1R6BX 2M5ZA 2GQFA 5EJCA 2JUJA 2KZUA 2CFOA 3J7BA 5EXSA 2XFSA 5KQ8A 1TH3A 3GLGA 3FUTA 3QYEA 4CGYB 3HJSA 2DXIA 4KODA 3KFUG 3U5ZA 1NJGA 2MGWA 1HR0M 3SHGB 2VQFM 1C1KA 4X64M 2C9OA 2MH8A 3AOEC 5IZ7D 4AKIA 2VQEM 2EUCA 3BOSA 2UU9M 2YR0A 3HHYA 4OU7A 1MU5A 3IG8A 3UGJA 1WJ7A 2OOBA 3MJ5A 4Z8XA 3VDUA 3T38A 3K2LA 4AKGA 2QCUA 1NNUC 3GRRA 2GNOA 2DKLA 1GO5A 2VDBB 1S3SA 3Q8GA 3SBJA 2ZTCA 2G8LA 4DUZM 3PXGA 3KOZE 1IBKM 2RGOA 1K3WA 4BB9A 3AKZA 4CHTB 2BNKA 4M0WA 4AZFA 2KZSA 5EP2A 2LXEA 1SXJC 2UUCM 3I4VA 1X37A 2KDLA 4DV7M 2FOIC 4D80A 3KSXA 3RGSA 2KNZA 3W0LB 4IBDA 1DO2A 3BXWA 5EXTA 5GKNA 2KXEA 3NBIA 3F92A 1NVMA 3SAVA 2F4VM 1QDTA 4LRTA 1IN5A 1C7YA 3HZJA 3VLFB 1R4GA 2MR9A 3CF0A 3HY5A 1PJJA 2QNJA 1IXZA 1QAOA 1L1TA 2Q2EB 2BJWA 2ZTDA 4EIWA 5FLXS 3M7GA 1NY6A 1G59A 2DAKA 3B7NA 3HHZA 2CHVA 4LFBM 1VG5A 2Z8YM 4CJ6A 4FWGA 1I94M 3WHLA 1SXJB 1SG9A 1FJGM 4M9SA 1QQWA 5E26A 1OKSA 4HEOA 4B7HA 1I4WA 1OJLA 4MM3B 1R7RA 4GIPA 5KQDA 1QDRA 1MX0A 3C58A 2O01F 4M0DA 1XMOM 2KA6B 5EP1A 2HL7A 2OQ4A 1Y8GA 2KW0A 1TDZA 3ZCBB 2R4JA 1H6UA 2YNMD 4IBKA 1VDDA 1D2NA 2LHGA 2X8AA 1G3IA 3FKEA 2Z4SA 3GLHE 3GLFB 5LMNM 2R65A 2UUBM 3R9XB 5L8RF 3T1YM 3K8ZA 1OFIA 3SYKA 5FTMA 3UJNA 2F5SA 4JI5M 2CP8A 3GPXA 1IM2A 2QQ8A 1IY0A 3I51A 4AI6A 1N75A 3I01M 3FE3A 4GMQA 3TWKA 4CISA 1DV0A 3E21A 2CWBA 1G41A 3U61A 2FS1A 4Q7JA 3L26A 4DBGB 3J81S 1GKIA 3U6MA 4DV3M 3WHKA 3FUXA 4B7GA 1KFVA 4JV5M 1E94E 2CE7A 1N34M 2LBCA 1J5EM 2EKFA 3MK6A 4XBOA 1QAQA 4OVZA 4DV0M 1T43A 3FUWA 1TR8A 5ITRA 4L8RC 2BJVA 1IBMM 2J7NA 4JN6A 3B7ZA 2UXDM 1HQCA 2L7IA 3L2AA 3CF2A 3GQ5A 2DWMA 1R5LA 2ERCA 2CHQA 3GLHA 3U6EA 1XXHB 4PDGA 1E9RA 4JI0M 4RF0A 4I4LA 1XHBA 3FTDA 2OPFA 1AUAA 1E9SA 1GL7A 4LJAA 2G3QA 2EJSA 1DGGA 5EQTA 5ITUA 3LVWA 2LHCA 4DV4M 1ZV1A 2F5PA 1NV9A 2LVQD 2HWJA 1ZMWA 2P5TA 1XC8A 3PFIA 4NXNM 3U6DA 3KOYE 1Z5AA 1LTMA 5KPZA 3TPZA 3HHWA 4K0KM 4LF5M 3FYCA 3HU3A 4DR3M 4LJ6A 2QENA 1V33A 2QZ4A 4GHAA 3SARA 2JNHA 2R18A 4I5SA 4MGZE 1D0LA 2DENA 3NWLA 4LRSA 4B3TM 1T6OA 2LVPC 3T6PA 4AG5A 2E5LM 1VDLA 2UXCM 3EIHA 4F2LA 2Z7JA 4LF4M 1D0KA 3A45A 3KP1E 4L4UA 4IBCA 1NO1A 3ILKA 1L8QA 1D0MA 2VF8A 1NHWC 4JI4M 1IN7A 2XGNA 2Y0TA 2JY5A 4MB7A 1F4IA 3KVWA 5H37D 1JQJC 3KOXE 2JY6B 4Z6YA 5KO3A 4L16A 1GABA 1MJGM 1PJIA 2O25A 2QBYA 4JI7M 4IJEA 3W67A 2MROB 1NJFA 4IBBA 3IECA 5DFLA 5EP3A 4DUYM 4ITQA 3VKHA 3GPYA 5JI2E 1QZEA 3A46A 2FE8A 3JR5A 3M6AA 4XGIA 1QYRA 4IBEA 2FFJA 3ZQJA 3SHFA 3GP1A 1DGBA 4FVMA 2CV2A 1R2YA 2YQZA 4WP2A 1OIZA 4QOSA 2C5RA 2D7EA 1GJSA 3FUVA 3W68A 2X49A 1UFZA 3B74A 3B9PA 1IN6A 1Z6TA 4NRVA 3GRUA 3L25A 1CUKA 1TH4A 1WHCA 1GLNA 3SMPA 5DNYA 3V76A 5E6JA 4LGYA 2APLA 2XLJA 3HU1A 5BR8M 4IJFA 4MGHA 2V6ZM 3I4YA 1IXSA 4PD2A 5IWAM 3GQ4A 2H1RA 4DR6M 1HNWM 1PJQA 2JZ1A 2XH9A 3FD9A 3T15A 1AIPC 1KYIA 3RE8A 1IQPA 1BVSA 4JI2M 2L4FA 4LJ8A 1WIVA 4AW4A 4G4OA 2DAGA 2QPAA 4LG2A 4B08A 2LVOC 2MJ5B 2N35A 3HHXA 4BBAA 4D81A 4DV2M 4QHTA 3SYLA 1TF0B 2I7NA 8CATA 3U6OA 5IREB 5LMUM 2JY7A 2LWXA 1QUTA 1HNXM 4QNRA 4Y28F 4OVZB 2JA2A 3FTCA 3ZH9B 4LF7M 4QOZC 1ZMVA 4JXJA 1JR3D 3JR4A 3LVVA 3FUUA 4GKKM 2RGHA 4HLQA 3TE6A 2O5RA 2KNVA 4KO8A 4NOOB 4L78A 3LQRA 4GRIA 3GLIE 4LZZA 2DHRA 1E32A 4DR4M 2C99A 4IBGA 2DAIA 5EP4A 4L6V6 1KSFX 2F5QA 4DR1M 2XZUA 2BWEA 2C98A 1Q3BA 4I8OA 2KEBA 1IN8A 1G71A 3VDPA 1TDHA 1WXQA 2QSFX 3GQ3A 3VKGA 3GRYA 2DNAA 4LCBA 2DI0A 4LFCM 1DO0A 2A5YB 1IXRC 1EE8A 2L09A 1WGNA 4XK8F 1PM5A 1OFHA 2JXNA 2QHOB 1L2BA 1HNZM 2DVWB 4RF1A 4RKUF 5EXXA 4GC5A 2R62A 3OTOM 3AV0A 2DWNA 1NNJA 3CF6E 2L4EA 3PNYA 1DGFA 3U60A 3CTWB 1Q3CA 2JY8A 4REZA 3KS4A 1XWIA 4GHLA 5FSWA 3GLGB 3AOGA 1QZMA 2C96A 1ORYB 2D7HA 2HHHM 2K0BX 4LJ4A 2DZLA 3GLIA 3U5ZB 1JR3E 1IBLM 1Z5CA 1L2DA 2ZAOA 4MGIE 3M0EA 2UUAM 1YE9A 2CRUA 2QBYB 3U6PA 1MN3A 4YHHM 4OX9M 2R0IA 1HT1E 3HU2A 1QANA 4JI1M 4QHSA 1OAIA 5C1BA 5KPRA 5IT9S 3HJ8A 4OW0A 2FNAA 4PT5A 4P17A 1VQ1A 2LNHC 1V92A 2HAKA 4LF6M 2V1CA 2RRUA 2J5YA 4DR7M 3AFHA 1WGLA 1T3TA 2DWLA 3J7AS 2CEAA 2D7GA 2K6BA 1N77A 3RFWA 3TQSA 3FYDA 3DFZA 3UZUA 3KSJA 4B7FA 2CV0A 1QAMA 1V34A 2ZM6M 3GPPA 4ANRA 3H4MA 1NHGC 4IBFA 1QUSA 3MMPA 1JR3A 1Q02A 1Z59A 3HKPA 4FW9A 4L15A 5A2QS 3JAMS 4DV6M 3SASA 1DGHA 4DV1M 3KP0E 4DR5M 1TH2A 3SATA 3SAWA 5BPVA 1IXSB 4AG6A 3TWLA 1IN4A 2L7HA 4M9ZA 5FTJA 4JI8M 4X62M 2DAEA 1VEKA 3PNVA 3D8LA 3LMMA 3ZC7B 1TTEA 5KPTA 3KW6A 4G4NA 1JB0F 2EKKA 2L6OA 1J7KA 2LH0A 2LVAA 4G4RA 3B89A 4LY6A 1IFYA 2OO9A 2XSZD 4RNAA 4IIWA 4PDIA 4NC6A 3VK7A 1SXJD 2XZFA 2RKOA 5C18A 4JI3M 4KLNA 4WURA 2JP7A 4NRWA 2Y0QA 1Q39A 4S12A 2XF3A 3H4JA 4FWDA 1W5TA 3HWSA 2LVNC 3J2PB 4LJ9A 1NSFA 5EXPA 3K9PA 4AKHA 1YSYA 4G6ZA 5ITQA 3E9SA 2J7OA 5DYIA 1N32M 3I04M 3B7QA 1ZAEA 4JYAM 3GO8A 4R71A 3W0FA 1ZQ9A 5F3WA 4B3SM 4GKJM 4MGKE 4DR2M 1OTRA 4LJ5A 4R3DA 3SC3A 4YY3M 1GVNA 1OQYA 4LFAM 1VEJA 3R8FA 5FTNA 3K92A 3U6QA 1EIJA 2ZBKB 4FD2A 4CIZA 4LF8M 4X65M 3EIEA 4FCWA 4KT0F 3U61B 3DA1A 1XMQM 2OOAA 2K9DA 5DYGA 3J80S 4BLCA 2CV1A 7CATA 2V1UA 4JI6M 2HKJA 4F1IA 1R2ZA 1N78A 3K1JA 4GITA 3SAUA 1GJTA 1P3QQ 2CUZA 4LJ7A 4UN2B 3SFZA 4B3MM 4FCVA 3CGWA 4NSOB 4AQYM 1QVRA 1L2CA 3AJIB 1SXJE 2KNAA 4IBJA 3L28A 1PJTA 1XB2B 2HCBA 4LZJA 4NL4H 4WW0A 2G5GX 3HJQA 5ITXE 2KRUA 2NQ8C 3GLHB 3TWMA 4G4QA 1OIPA 2JWSA 3GPUA 1XNRM 3QAUA 3U60B 1OAOC 2H5XA 4KHPM 2WSFF 3D8BA 2R44A 3AOEA 1IY2A 2C9CA 2K47A 1GL6A 2DAMA 2R6FA 3K9OA 1K82A 1XNQM 3IHPA 1NY5A 4GH9A 3RGPA 3AL0C 3KXEC 1FNNA 2F5NA 2VF7A 3GLIB 1WR1B 3SMSA 2BWBA 2CHGA 3GLFE 3MHVC 3QWLA 1N33M 3HX3A 3QYBA 2KRKA 2YFQA 3FRIA 1J09A 4FWHA 4G3OA 3L27A 3PVSA 1A5TA 1IY1A 1TGUA 2XFTA 3TL4X 3FTFA 3KDSE 2M60A 4GC9A 2Y21A 3KS8A 2DZOB 1YUBA 5ITYA 4X66M 1PJSA 4I81A 2AHMA 4QNMA 2XSZA 4TUWA 3U6CA 3L29A 3BBZA 1SXJA 4A3VB 1PGYA 3A98B 3C3DA 3LQQA 3Q8XA 2VIIA 2WSCF 2ZAMA 5ITXA 3NBXX 1G8PA 2L2DA 3VFDA 1L1ZA 2W82A 1K3XA 1G4AE 2Z4RA 3LCVB 2WZJA 3DZDA 3DOAA 3GRVA 4PCZA 4DV5M 2FH0A 3UK6A 3T1HM 2Z3XA 4M9XA 1XXHE 4LGMA 2XEPA 3GLFA 1DGHB 2EO2A 2I7PA 3C3EA 5FTLA 2F5OA 4GEWA 5FTKA 2R45A 1Z5BA 4NXMM 2X4AA 1PRBA 3E4RA 3GLGE 3A42A 1W5SA 3KOWE 3HGIA 4HL4A 5ITTA 2R46A 1EFUB 2LTUA 3FTEA 1VEGA 2KHHA 1HT2E 1YLAA 3J27B 3LW5F 2B3TA 4NSRA 2QP9X 3VK8A 2R4EA 1HQYE 2DHYA 3E46A 4W5WA 2UXBM 1HJPA 2DWZB 1RU3A 2WSEF 1UM8A 2JZ0A 3UMMA 2DZNB 1N36M 3IG5A 2Y20A 4R7GA 2EA0A 4ZPXA
chains in the Genus database with same CATH topology
4LF9M 4MH0E 4P16A 5JI3E 1LV7A 4IBIA 3U6SA 4MGYE 3THGA 4D82A 3U6LA 1XXHA 4FCTA 2ZANA 4II7A 4B3RM 1R6BX 2M5ZA 5EJCA 2KZUA 2CFOA 3J7BA 5EXSA 2XFSA 5KQ8A 1TH3A 3GLGA 3FUTA 4CGYB 3HJSA 2DXIA 4KODA 3KFUG 3U5ZA 1NJGA 1HR0M 3SHGB 2VQFM 1C1KA 4X64M 2C9OA 3AOEC 5IZ7D 4AKIA 2VQEM 2EUCA 3BOSA 2UU9M 2YR0A 3HHYA 4OU7A 1MU5A 3IG8A 3UGJA 4Z8XA 3MJ5A 3VDUA 3T38A 3K2LA 4AKGA 2QCUA 1NNUC 3GRRA 1S3SA 3SBJA 2G8LA 4DUZM 3PXGA 3KOZE 1IBKM 2RGOA 1K3WA 4BB9A 3AKZA 4CHTB 2BNKA 4M0WA 4AZFA 2KZSA 5EP2A 2LXEA 1SXJC 2UUCM 3I4VA 1X37A 4DV7M 2FOIC 4D80A 3KSXA 3RGSA 3W0LB 4IBDA 1DO2A 5EXTA 5GKNA 2KXEA 3NBIA 1NVMA 3SAVA 2F4VM 4LRTA 1IN5A 3VLFB 1PJJA 3CF0A 1IXZA 1QAOA 1L1TA 2Q2EB 2BJWA 4EIWA 5FLXS 3M7GA 1NY6A 1G59A 3HHZA 2CHVA 4LFBM 4FWGA 1I94M 3WHLA 1SXJB 1FJGM 4M9SA 1QQWA 5E26A 4B7HA 1I4WA 1OJLA 4MM3B 1R7RA 4GIPA 5KQDA 1MX0A 3C58A 4M0DA 1XMOM 2KA6B 5EP1A 2HL7A 2OQ4A 2KW0A 1TDZA 3ZCBB 2R4JA 1H6UA 2YNMD 4IBKA 1VDDA 1D2NA 2UUBM 3FKEA 2X8AA 1G3IA 2Z4SA 5LMNM 3GLFB 2R65A 3R9XB 3T1YM 3K8ZA 1OFIA 3SYKA 5FTMA 3UJNA 2F5SA 4JI5M 3GPXA 1IM2A 3I51A 1IY0A 4AI6A 1N75A 4GMQA 3TWKA 4CISA 1G41A 3U61A 3L26A 3J81S 1GKIA 3U6MA 4DV3M 3WHKA 3FUXA 4B7GA 1KFVA 4JV5M 1E94E 2CE7A 1N34M 1J5EM 3MK6A 4XBOA 1QAQA 4OVZA 4DV0M 3FUWA 5ITRA 4L8RC 2BJVA 1IBMM 2J7NA 4JN6A 2UXDM 1HQCA 2L7IA 3L2AA 3CF2A 3GQ5A 2DWMA 2ERCA 2CHQA 3GLHA 3U6EA 1XXHB 4PDGA 1E9RA 4JI0M 4RF0A 4I4LA 1XHBA 3FTDA 2OPFA 1E9SA 1GL7A 4LJAA 5EQTA 5ITUA 1DGGA 3LVWA 4DV4M 2F5PA 2P5TA 1XC8A 3PFIA 4NXNM 3U6DA 3KOYE 1Z5AA 5KPZA 3TPZA 3HHWA 4K0KM 4LF5M 3FYCA 3HU3A 4DR3M 4LJ6A 2QENA 2QZ4A 4GHAA 3SARA 2R18A 4I5SA 4MGZE 3NWLA 4LRSA 4B3TM 2E5LM 4AG5A 2UXCM 3EIHA 2Z7JA 4LF4M 3A45A 3KP1E 4L4UA 4IBCA 3ILKA 1L8QA 1NHWC 4JI4M 1IN7A 2XGNA 2Y0TA 4MB7A 3KVWA 5H37D 1JQJC 3KOXE 4Z6YA 5KO3A 4L16A 1PJIA 2QBYA 4JI7M 4IJEA 4IBBA 1NJFA 5EP3A 4ITQA 4DUYM 3VKHA 3GPYA 5JI2E 3A46A 2FE8A 3JR5A 3M6AA 4XGIA 1QYRA 4IBEA 2FFJA 3GP1A 3SHFA 1DGBA 4FVMA 2CV2A 1R2YA 2YQZA 4QOSA 2C5RA 2D7EA 3FUVA 2X49A 3B9PA 1IN6A 1Z6TA 4NRVA 3GRUA 3L25A 5DNYA 1TH4A 1GLNA 3SMPA 5E6JA 4LGYA 2XLJA 3HU1A 5BR8M 4IJFA 4MGHA 2V6ZM 3I4YA 4PD2A 3GQ4A 5IWAM 2H1RA 4DR6M 1HNWM 2XH9A 3FD9A 3T15A 1KYIA 3RE8A 1IQPA 4JI2M 4LJ8A 4AW4A 4G4OA 2QPAA 4LG2A 4B08A 4D81A 3HHXA 4BBAA 4DV2M 4QHTA 3SYLA 2I7NA 8CATA 3U6OA 5IREB 5LMUM 2LWXA 1HNXM 4QNRA 4OVZB 2JA2A 3FTCA 3ZH9B 4LF7M 4QOZC 4JXJA 1JR3D 3JR4A 3LVVA 3FUUA 4GKKM 2RGHA 4HLQA 3TE6A 2O5RA 4KO8A 4NOOB 4L78A 3LQRA 4GRIA 4LZZA 2DHRA 1E32A 4DR4M 2C99A 4IBGA 5EP4A 1KSFX 2F5QA 4DR1M 2XZUA 2C98A 1Q3BA 4I8OA 2KEBA 1IN8A 3VDPA 1TDHA 1WXQA 3GQ3A 3VKGA 3GRYA 4LCBA 4LFCM 1DO0A 2A5YB 1IXRC 1EE8A 2L09A 1L2BA 1PM5A 1OFHA 1HNZM 2DVWB 4RF1A 5EXXA 4GC5A 2R62A 3OTOM 3AV0A 2DWNA 1NNJA 3CF6E 3PNYA 1DGFA 3U60A 3CTWB 1Q3CA 4REZA 3KS4A 1XWIA 4GHLA 5FSWA 3GLGB 3AOGA 1QZMA 2C96A 1ORYB 2D7HA 2HHHM 3GLIA 4LJ4A 3U5ZB 1IBLM 1Z5CA 1L2DA 2ZAOA 4MGIE 3M0EA 2UUAM 1YE9A 2QBYB 3U6PA 4YHHM 4OX9M 1HT1E 3HU2A 1QANA 4JI1M 4QHSA 5KPRA 5C1BA 5IT9S 3HJ8A 4OW0A 2FNAA 4PT5A 4LF6M 2LNHC 2V1CA 4DR7M 3AFHA 2DWLA 1T3TA 3J7AS 2CEAA 2D7GA 1N77A 3RFWA 3TQSA 3FYDA 3DFZA 3UZUA 3KSJA 4B7FA 2CV0A 1QAMA 2ZM6M 3GPPA 3H4MA 1NHGC 4IBFA 1JR3A 1Z59A 3HKPA 4L15A 4FW9A 5A2QS 3SASA 3JAMS 4DV6M 1DGHA 4DV1M 3KP0E 4DR5M 1TH2A 3SATA 3SAWA 5BPVA 1IXSB 4AG6A 3TWLA 1IN4A 2L7HA 4M9ZA 5FTJA 4JI8M 4X62M 3PNVA 3ZC7B 3D8LA 3LMMA 5KPTA 3KW6A 4G4NA 2L6OA 4G4RA 2LH0A 1J7KA 4LY6A 2XSZD 4RNAA 4PDIA 4IIWA 3VK7A 1SXJD 2XZFA 2RKOA 5C18A 4JI3M 4KLNA 4WURA 4NRWA 2Y0QA 1Q39A 4S12A 2XF3A 4FWDA 1W5TA 3HWSA 3J2PB 4LJ9A 1NSFA 5EXPA 4AKHA 1YSYA 4G6ZA 5ITQA 3E9SA 2J7OA 5DYIA 1N32M 1ZAEA 4JYAM 3GO8A 3W0FA 1ZQ9A 5F3WA 4B3SM 4GKJM 4MGKE 4DR2M 4LJ5A 4R3DA 3SC3A 4YY3M 1GVNA 4LFAM 3R8FA 5FTNA 3K92A 3U6QA 2ZBKB 4FD2A 4LF8M 4X65M 3EIEA 4FCWA 3U61B 3DA1A 1XMQM 2CV1A 5DYGA 3J80S 4BLCA 2V1UA 4JI6M 7CATA 2HKJA 1N78A 1R2ZA 3K1JA 4GITA 3SAUA 2CUZA 4LJ7A 3SFZA 4B3MM 4FCVA 4NSOB 4AQYM 1QVRA 1L2CA 3AJIB 1SXJE 4IBJA 3L28A 2HCBA 4LZJA 4WW0A 4NL4H 5ITXE 2G5GX 3HJQA 2KRUA 2NQ8C 3GLHB 3TWMA 4G4QA 3GPUA 1XNRM 3QAUA 3U60B 4KHPM 3D8BA 3AOEA 2K47A 1IY2A 2C9CA 1GL6A 1K82A 1XNQM 4GH9A 1NY5A 3RGPA 3AL0C 3KXEC 1FNNA 2F5NA 3GLIB 3SMSA 2CHGA 3MHVC 3QWLA 1N33M 2KRKA 2YFQA 1J09A 4FWHA 3L27A 3PVSA 1IY1A 1TGUA 2XFTA 3TL4X 3FTFA 3KDSE 2M60A 4GC9A 2Y21A 3KS8A 2DZOB 1YUBA 5ITYA 4X66M 4I81A 2AHMA 4QNMA 2XSZA 4TUWA 3U6CA 3L29A 1SXJA 4A3VB 3A98B 3LQQA 3Q8XA 5ITXA 2VIIA 2ZAMA 1G8PA 3VFDA 1L1ZA 2W82A 1K3XA 1G4AE 2Z4RA 3DZDA 3DOAA 3GRVA 4PCZA 4DV5M 3UK6A 3T1HM 2Z3XA 4M9XA 3GLFA 4LGMA 2XEPA 1DGHB 2EO2A 2I7PA 5FTLA 2F5OA 5FTKA 2R45A 1Z5BA 4NXMM 2X4AA 3E4RA 3A42A 1W5SA 3KOWE 3HGIA 4HL4A 5ITTA 2R46A 3FTEA 3J27B 1HT2E 4NSRA 2QP9X 3VK8A 2R4EA 1HQYE 4W5WA 2UXBM 2DWZB 1UM8A 3UMMA 1N36M 2DZNB 3IG5A 2Y20A 4R7GA 2EA0A 4ZPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 M;  5ITR A;  4LF9 M;  5ITQ A;  1N32 M;  1IBM M;  2UXD M;  3JR4 A;  4JYA M;  3GO8 A;  3U6S A;  4GKK M;  3W0F A;  3U6L A;  3GQ5 A;  3U6E A;  4B3S M;  4B3R M;  4GKJ M;  4PDG A;  4DR2 M;  4JI0 M;  4YY3 M;  4LFA M;  2OPF A;  5ITU A;  3U6Q A;  2ZBK B;  4LF8 M;  4X65 M;  4DV4 M;  4DR4 M;  2F5P A;  1HR0 M;  2VQF M;  1XMQ M;  2F5Q A;  3J80 S;  4DR1 M;  2XZU A;  1XC8 A;  4JI6 M;  4NXN M;  4X64 M;  3U6D A;  1Q3B A;  1Z5A A;  2HKJ A;  2VQE M;  1R2Z A;  4K0K M;  4LF5 M;  3SAU A;  2UU9 M;  4DR3 M;  1TDH A;  3GQ3 A;  1MU5 A;  4B3M M;  3SAR A;  4LFC M;  4AQY M;  1EE8 A;  1L2B A;  1L2C A;  1PM5 A;  1HNZ M;  4B3T M;  2E5L M;  2UXC M;  5ITX E;  3OTO M;  3SBJ A;  1NNJ A;  4DUZ M;  1IBK M;  3TWM A;  4G4Q A;  1K3W A;  3GPU A;  1XNR M;  1Q3C A;  4KHP M;  4LF4 M;  3A45 A;  2UUC M;  4DV7 M;  1XNQ M;  1K82 A;  2HHH M;  4JI4 M;  1IBL M;  2F5N A;  1Z5C A;  1L2D A;  4MB7 A;  3SAV A;  2F4V M;  1N33 M;  2UUA M;  1PJI A;  1PJJ A;  4JI7 M;  3U6P A;  4ITQ A;  4YHH M;  4DUY M;  4OX9 M;  3GPY A;  1L1T A;  2Q2E B;  5FLX S;  3A46 A;  3JR5 A;  4JI1 M;  5IT9 S;  4X66 M;  5ITY A;  3GP1 A;  4LF6 M;  4LFB M;  3U6C A;  1I94 M;  1R2Y A;  4DR7 M;  1FJG M;  5ITX A;  3J7A S;  1L1Z A;  1K3X A;  4NRV A;  1MX0 A;  3C58 A;  2ZM6 M;  3GPP A;  1XMO M;  3DOA A;  2OQ4 A;  4PCZ A;  4DV5 M;  1TDZ A;  5A2Q S;  1Z59 A;  3T1H M;  3SAS A;  3JAM S;  5BR8 M;  4DV6 M;  4DV1 M;  4DR5 M;  2UUB M;  4PD2 A;  5LMN M;  3GQ4 A;  3SAT A;  5IWA M;  3SAW A;  2F5O A;  3T1Y M;  3TWL A;  4DR6 M;  1Z5B A;  2F5S A;  4NXM M;  1HNW M;  4JI5 M;  4JI8 M;  3GPX A;  4X62 M;  3A42 A;  4G4N A;  4G4R A;  4JI2 M;  3TWK A;  4CIS A;  5ITT A;  4G4O A;  4PDI A;  3VK7 A;  2XZF A;  4JI3 M;  3J81 S;  3U6M A;  4DV2 M;  4DV3 M;  4NRW A;  3VK8 A;  1Q39 A;  1KFV A;  4JV5 M;  2UXB M;  3U6O A;  5LMU M;  1N34 M;  1N36 M;  1J5E M;  4DV0 M;  1HNX M;  2EA0 A; 
#chains in the Genus database with same CATH topology
 4LF9 M;  4MH0 E;  3LCU A;  4P16 A;  5JI3 E;  3C9P A;  1LV7 A;  4IBI A;  1ZMU A;  3U6S A;  4MGY E;  1NV8 A;  3THG A;  4D82 A;  1XXH A;  3U6L A;  4FCT A;  2ZAN A;  3FRH A;  4II7 A;  4B3R M;  1R6B X;  2M5Z A;  2GQF A;  5EJC A;  2JUJ A;  2KZU A;  2CFO A;  3J7B A;  5EXS A;  2XFS A;  5KQ8 A;  1TH3 A;  3GLG A;  3FUT A;  3QYE A;  4CGY B;  3HJS A;  2DXI A;  4KOD A;  3KFU G;  3U5Z A;  1NJG A;  2MGW A;  1HR0 M;  3SHG B;  2VQF M;  1C1K A;  4X64 M;  2C9O A;  2MH8 A;  3AOE C;  5IZ7 D;  4AKI A;  2VQE M;  2EUC A;  3BOS A;  2UU9 M;  2YR0 A;  3HHY A;  4OU7 A;  1MU5 A;  3IG8 A;  3UGJ A;  1WJ7 A;  2OOB A;  3MJ5 A;  4Z8X A;  3VDU A;  3T38 A;  3K2L A;  4AKG A;  2QCU A;  1NNU C;  3GRR A;  2GNO A;  2DKL A;  1GO5 A;  2VDB B;  1S3S A;  3Q8G A;  3SBJ A;  2ZTC A;  2G8L A;  4DUZ M;  3PXG A;  3KOZ E;  1IBK M;  2RGO A;  1K3W A;  4BB9 A;  3AKZ A;  4CHT B;  2BNK A;  4M0W A;  4AZF A;  2KZS A;  5EP2 A;  2LXE A;  1SXJ C;  2UUC M;  3I4V A;  1X37 A;  2KDL A;  4DV7 M;  2FOI C;  4D80 A;  3KSX A;  3RGS A;  2KNZ A;  3W0L B;  4IBD A;  1DO2 A;  3BXW A;  5EXT A;  5GKN A;  2KXE A;  3NBI A;  3F92 A;  1NVM A;  3SAV A;  2F4V M;  1QDT A;  4LRT A;  1IN5 A;  1C7Y A;  3HZJ A;  3VLF B;  1R4G A;  2MR9 A;  3CF0 A;  3HY5 A;  1PJJ A;  2QNJ A;  1IXZ A;  1QAO A;  1L1T A;  2Q2E B;  2BJW A;  2ZTD A;  4EIW A;  5FLX S;  3M7G A;  1NY6 A;  1G59 A;  2DAK A;  3B7N A;  3HHZ A;  2CHV A;  4LFB M;  1VG5 A;  2Z8Y M;  4CJ6 A;  4FWG A;  1I94 M;  3WHL A;  1SXJ B;  1SG9 A;  1FJG M;  4M9S A;  1QQW A;  5E26 A;  1OKS A;  4HEO A;  4B7H A;  1I4W A;  1OJL A;  4MM3 B;  1R7R A;  4GIP A;  5KQD A;  1QDR A;  1MX0 A;  3C58 A;  2O01 F;  4M0D A;  1XMO M;  2KA6 B;  5EP1 A;  2HL7 A;  2OQ4 A;  1Y8G A;  2KW0 A;  1TDZ A;  3ZCB B;  2R4J A;  1H6U A;  2YNM D;  4IBK A;  1VDD A;  1D2N A;  2LHG A;  2X8A A;  1G3I A;  3FKE A;  2Z4S A;  3GLH E;  3GLF B;  5LMN M;  2R65 A;  2UUB M;  3R9X B;  5L8R F;  3T1Y M;  3K8Z A;  1OFI A;  3SYK A;  5FTM A;  3UJN A;  2F5S A;  4JI5 M;  2CP8 A;  3GPX A;  1IM2 A;  2QQ8 A;  1IY0 A;  3I51 A;  4AI6 A;  1N75 A;  3I01 M;  3FE3 A;  4GMQ A;  3TWK A;  4CIS A;  1DV0 A;  3E21 A;  2CWB A;  1G41 A;  3U61 A;  2FS1 A;  4Q7J A;  3L26 A;  4DBG B;  3J81 S;  1GKI A;  3U6M A;  4DV3 M;  3WHK A;  3FUX A;  4B7G A;  1KFV A;  4JV5 M;  1E94 E;  2CE7 A;  1N34 M;  2LBC A;  1J5E M;  2EKF A;  3MK6 A;  4XBO A;  1QAQ A;  4OVZ A;  4DV0 M;  1T43 A;  3FUW A;  1TR8 A;  5ITR A;  4L8R C;  2BJV A;  1IBM M;  2J7N A;  4JN6 A;  3B7Z A;  2UXD M;  1HQC A;  2L7I A;  3L2A A;  3CF2 A;  3GQ5 A;  2DWM A;  1R5L A;  2ERC A;  2CHQ A;  3GLH A;  3U6E A;  1XXH B;  4PDG A;  1E9R A;  4JI0 M;  4RF0 A;  4I4L A;  1XHB A;  3FTD A;  2OPF A;  1AUA A;  1E9S A;  1GL7 A;  4LJA A;  2G3Q A;  2EJS A;  1DGG A;  5EQT A;  5ITU A;  3LVW A;  2LHC A;  4DV4 M;  1ZV1 A;  2F5P A;  1NV9 A;  2LVQ D;  2HWJ A;  1ZMW A;  2P5T A;  1XC8 A;  3PFI A;  4NXN M;  3U6D A;  3KOY E;  1Z5A A;  1LTM A;  5KPZ A;  3TPZ A;  3HHW A;  4K0K M;  4LF5 M;  3FYC A;  3HU3 A;  4DR3 M;  4LJ6 A;  2QEN A;  1V33 A;  2QZ4 A;  4GHA A;  3SAR A;  2JNH A;  2R18 A;  4I5S A;  4MGZ E;  1D0L A;  2DEN A;  3NWL A;  4LRS A;  4B3T M;  1T6O A;  2LVP C;  3T6P A;  4AG5 A;  2E5L M;  1VDL A;  2UXC M;  3EIH A;  4F2L A;  2Z7J A;  4LF4 M;  1D0K A;  3A45 A;  3KP1 E;  4L4U A;  4IBC A;  1NO1 A;  3ILK A;  1L8Q A;  1D0M A;  2VF8 A;  1NHW C;  4JI4 M;  1IN7 A;  2XGN A;  2Y0T A;  2JY5 A;  4MB7 A;  1F4I A;  3KVW A;  5H37 D;  1JQJ C;  3KOX E;  2JY6 B;  4Z6Y A;  5KO3 A;  4L16 A;  1GAB A;  1MJG M;  1PJI A;  2O25 A;  2QBY A;  4JI7 M;  4IJE A;  3W67 A;  2MRO B;  1NJF A;  4IBB A;  3IEC A;  5DFL A;  5EP3 A;  4DUY M;  4ITQ A;  3VKH A;  3GPY A;  5JI2 E;  1QZE A;  3A46 A;  2FE8 A;  3JR5 A;  3M6A A;  4XGI A;  1QYR A;  4IBE A;  2FFJ A;  3ZQJ A;  3SHF A;  3GP1 A;  1DGB A;  4FVM A;  2CV2 A;  1R2Y A;  2YQZ A;  4WP2 A;  1OIZ A;  4QOS A;  2C5R A;  2D7E A;  1GJS A;  3FUV A;  3W68 A;  2X49 A;  1UFZ A;  3B74 A;  3B9P A;  1IN6 A;  1Z6T A;  4NRV A;  3GRU A;  3L25 A;  1CUK A;  1TH4 A;  1WHC A;  1GLN A;  3SMP A;  5DNY A;  3V76 A;  5E6J A;  4LGY A;  2APL A;  2XLJ A;  3HU1 A;  5BR8 M;  4IJF A;  4MGH A;  2V6Z M;  3I4Y A;  1IXS A;  4PD2 A;  5IWA M;  3GQ4 A;  2H1R A;  4DR6 M;  1HNW M;  1PJQ A;  2JZ1 A;  2XH9 A;  3FD9 A;  3T15 A;  1AIP C;  1KYI A;  3RE8 A;  1IQP A;  1BVS A;  4JI2 M;  2L4F A;  4LJ8 A;  1WIV A;  4AW4 A;  4G4O A;  2DAG A;  2QPA A;  4LG2 A;  4B08 A;  2LVO C;  2MJ5 B;  2N35 A;  3HHX A;  4BBA A;  4D81 A;  4DV2 M;  4QHT A;  3SYL A;  1TF0 B;  2I7N A;  8CAT A;  3U6O A;  5IRE B;  5LMU M;  2JY7 A;  2LWX A;  1QUT A;  1HNX M;  4QNR A;  4Y28 F;  4OVZ B;  2JA2 A;  3FTC A;  3ZH9 B;  4LF7 M;  4QOZ C;  1ZMV A;  4JXJ A;  1JR3 D;  3JR4 A;  3LVV A;  3FUU A;  4GKK M;  2RGH A;  4HLQ A;  3TE6 A;  2O5R A;  2KNV A;  4KO8 A;  4NOO B;  4L78 A;  3LQR A;  4GRI A;  3GLI E;  4LZZ A;  2DHR A;  1E32 A;  4DR4 M;  2C99 A;  4IBG A;  2DAI A;  5EP4 A;  4L6V 6;  1KSF X;  2F5Q A;  4DR1 M;  2XZU A;  2BWE A;  2C98 A;  1Q3B A;  4I8O A;  2KEB A;  1IN8 A;  1G71 A;  3VDP A;  1TDH A;  1WXQ A;  2QSF X;  3GQ3 A;  3VKG A;  3GRY A;  2DNA A;  4LCB A;  2DI0 A;  4LFC M;  1DO0 A;  2A5Y B;  1IXR C;  1EE8 A;  2L09 A;  1WGN A;  4XK8 F;  1PM5 A;  1OFH A;  2JXN A;  2QHO B;  1L2B A;  1HNZ M;  2DVW B;  4RF1 A;  4RKU F;  5EXX A;  4GC5 A;  2R62 A;  3OTO M;  3AV0 A;  2DWN A;  1NNJ A;  3CF6 E;  2L4E A;  3PNY A;  1DGF A;  3U60 A;  3CTW B;  1Q3C A;  2JY8 A;  4REZ A;  3KS4 A;  1XWI A;  4GHL A;  5FSW A;  3GLG B;  3AOG A;  1QZM A;  2C96 A;  1ORY B;  2D7H A;  2HHH M;  2K0B X;  4LJ4 A;  2DZL A;  3GLI A;  3U5Z B;  1JR3 E;  1IBL M;  1Z5C A;  1L2D A;  2ZAO A;  4MGI E;  3M0E A;  2UUA M;  1YE9 A;  2CRU A;  2QBY B;  3U6P A;  1MN3 A;  4YHH M;  4OX9 M;  2R0I A;  1HT1 E;  3HU2 A;  1QAN A;  4JI1 M;  4QHS A;  1OAI A;  5C1B A;  5KPR A;  5IT9 S;  3HJ8 A;  4OW0 A;  2FNA A;  4PT5 A;  4P17 A;  1VQ1 A;  2LNH C;  1V92 A;  2HAK A;  4LF6 M;  2V1C A;  2RRU A;  2J5Y A;  4DR7 M;  3AFH A;  1WGL A;  1T3T A;  2DWL A;  3J7A S;  2CEA A;  2D7G A;  2K6B A;  1N77 A;  3RFW A;  3TQS A;  3FYD A;  3DFZ A;  3UZU A;  3KSJ A;  4B7F A;  2CV0 A;  1QAM A;  1V34 A;  2ZM6 M;  3GPP A;  4ANR A;  3H4M A;  1NHG C;  4IBF A;  1QUS A;  3MMP A;  1JR3 A;  1Q02 A;  1Z59 A;  3HKP A;  4FW9 A;  4L15 A;  5A2Q S;  3JAM S;  4DV6 M;  3SAS A;  1DGH A;  4DV1 M;  3KP0 E;  4DR5 M;  1TH2 A;  3SAT A;  3SAW A;  5BPV A;  1IXS B;  4AG6 A;  3TWL A;  1IN4 A;  2L7H A;  4M9Z A;  5FTJ A;  4JI8 M;  4X62 M;  2DAE A;  1VEK A;  3PNV A;  3D8L A;  3LMM A;  3ZC7 B;  1TTE A;  5KPT A;  3KW6 A;  4G4N A;  1JB0 F;  2EKK A;  2L6O A;  1J7K A;  2LH0 A;  2LVA A;  4G4R A;  3B89 A;  4LY6 A;  1IFY A;  2OO9 A;  2XSZ D;  4RNA A;  4IIW A;  4PDI A;  4NC6 A;  3VK7 A;  1SXJ D;  2XZF A;  2RKO A;  5C18 A;  4JI3 M;  4KLN A;  4WUR A;  2JP7 A;  4NRW A;  2Y0Q A;  1Q39 A;  4S12 A;  2XF3 A;  3H4J A;  4FWD A;  1W5T A;  3HWS A;  2LVN C;  3J2P B;  4LJ9 A;  1NSF A;  5EXP A;  3K9P A;  4AKH A;  1YSY A;  4G6Z A;  5ITQ A;  3E9S A;  2J7O A;  5DYI A;  1N32 M;  3I04 M;  3B7Q A;  1ZAE A;  4JYA M;  3GO8 A;  4R71 A;  3W0F A;  1ZQ9 A;  5F3W A;  4B3S M;  4GKJ M;  4MGK E;  4DR2 M;  1OTR A;  4LJ5 A;  4R3D A;  3SC3 A;  4YY3 M;  1GVN A;  1OQY A;  4LFA M;  1VEJ A;  3R8F A;  5FTN A;  3K92 A;  3U6Q A;  1EIJ A;  2ZBK B;  4FD2 A;  4CIZ A;  4LF8 M;  4X65 M;  3EIE A;  4FCW A;  4KT0 F;  3U61 B;  3DA1 A;  1XMQ M;  2OOA A;  2K9D A;  5DYG A;  3J80 S;  4BLC A;  2CV1 A;  7CAT A;  2V1U A;  4JI6 M;  2HKJ A;  4F1I A;  1R2Z A;  1N78 A;  3K1J A;  4GIT A;  3SAU A;  1GJT A;  1P3Q Q;  2CUZ A;  4LJ7 A;  4UN2 B;  3SFZ A;  4B3M M;  4FCV A;  3CGW A;  4NSO B;  4AQY M;  1QVR A;  1L2C A;  3AJI B;  1SXJ E;  2KNA A;  4IBJ A;  3L28 A;  1PJT A;  1XB2 B;  2HCB A;  4LZJ A;  4NL4 H;  4WW0 A;  2G5G X;  3HJQ A;  5ITX E;  2KRU A;  2NQ8 C;  3GLH B;  3TWM A;  4G4Q A;  1OIP A;  2JWS A;  3GPU A;  1XNR M;  3QAU A;  3U60 B;  1OAO C;  2H5X A;  4KHP M;  2WSF F;  3D8B A;  2R44 A;  3AOE A;  1IY2 A;  2C9C A;  2K47 A;  1GL6 A;  2DAM A;  2R6F A;  3K9O A;  1K82 A;  1XNQ M;  3IHP A;  1NY5 A;  4GH9 A;  3RGP A;  3AL0 C;  3KXE C;  1FNN A;  2F5N A;  2VF7 A;  3GLI B;  1WR1 B;  3SMS A;  2BWB A;  2CHG A;  3GLF E;  3MHV C;  3QWL A;  1N33 M;  3HX3 A;  3QYB A;  2KRK A;  2YFQ A;  3FRI A;  1J09 A;  4FWH A;  4G3O A;  3L27 A;  3PVS A;  1A5T A;  1IY1 A;  1TGU A;  2XFT A;  3TL4 X;  3FTF A;  3KDS E;  2M60 A;  4GC9 A;  2Y21 A;  3KS8 A;  2DZO B;  1YUB A;  5ITY A;  4X66 M;  1PJS A;  4I81 A;  2AHM A;  4QNM A;  2XSZ A;  4TUW A;  3U6C A;  3L29 A;  3BBZ A;  1SXJ A;  4A3V B;  1PGY A;  3A98 B;  3C3D A;  3LQQ A;  3Q8X A;  2VII A;  2WSC F;  2ZAM A;  5ITX A;  3NBX X;  1G8P A;  2L2D A;  3VFD A;  1L1Z A;  2W82 A;  1K3X A;  1G4A E;  2Z4R A;  3LCV B;  2WZJ A;  3DZD A;  3DOA A;  3GRV A;  4PCZ A;  4DV5 M;  2FH0 A;  3UK6 A;  3T1H M;  2Z3X A;  4M9X A;  1XXH E;  4LGM A;  2XEP A;  3GLF A;  1DGH B;  2EO2 A;  2I7P A;  3C3E A;  5FTL A;  2F5O A;  4GEW A;  5FTK A;  2R45 A;  1Z5B A;  4NXM M;  2X4A A;  1PRB A;  3E4R A;  3GLG E;  3A42 A;  1W5S A;  3KOW E;  3HGI A;  4HL4 A;  5ITT A;  2R46 A;  1EFU B;  2LTU A;  3FTE A;  1VEG A;  2KHH A;  1HT2 E;  1YLA A;  3J27 B;  3LW5 F;  2B3T A;  4NSR A;  2QP9 X;  3VK8 A;  2R4E A;  1HQY E;  2DHY A;  3E46 A;  4W5W A;  2UXB M;  1HJP A;  2DWZ B;  1RU3 A;  2WSE F;  1UM8 A;  2JZ0 A;  3UMM A;  2DZN B;  1N36 M;  3IG5 A;  2Y20 A;  4R7G A;  2EA0 A;  4ZPX A; 
#chains in the Genus database with same CATH homology
 4LF9 M;  4MH0 E;  4P16 A;  5JI3 E;  1LV7 A;  4IBI A;  3U6S A;  4MGY E;  3THG A;  4D82 A;  3U6L A;  1XXH A;  4FCT A;  2ZAN A;  4II7 A;  4B3R M;  1R6B X;  2M5Z A;  5EJC A;  2KZU A;  2CFO A;  3J7B A;  5EXS A;  2XFS A;  5KQ8 A;  1TH3 A;  3GLG A;  3FUT A;  4CGY B;  3HJS A;  2DXI A;  4KOD A;  3KFU G;  3U5Z A;  1NJG A;  1HR0 M;  3SHG B;  2VQF M;  1C1K A;  4X64 M;  2C9O A;  3AOE C;  5IZ7 D;  4AKI A;  2VQE M;  2EUC A;  3BOS A;  2UU9 M;  2YR0 A;  3HHY A;  4OU7 A;  1MU5 A;  3IG8 A;  3UGJ A;  4Z8X A;  3MJ5 A;  3VDU A;  3T38 A;  3K2L A;  4AKG A;  2QCU A;  1NNU C;  3GRR A;  1S3S A;  3SBJ A;  2G8L A;  4DUZ M;  3PXG A;  3KOZ E;  1IBK M;  2RGO A;  1K3W A;  4BB9 A;  3AKZ A;  4CHT B;  2BNK A;  4M0W A;  4AZF A;  2KZS A;  5EP2 A;  2LXE A;  1SXJ C;  2UUC M;  3I4V A;  1X37 A;  4DV7 M;  2FOI C;  4D80 A;  3KSX A;  3RGS A;  3W0L B;  4IBD A;  1DO2 A;  5EXT A;  5GKN A;  2KXE A;  3NBI A;  1NVM A;  3SAV A;  2F4V M;  4LRT A;  1IN5 A;  3VLF B;  1PJJ A;  3CF0 A;  1IXZ A;  1QAO A;  1L1T A;  2Q2E B;  2BJW A;  4EIW A;  5FLX S;  3M7G A;  1NY6 A;  1G59 A;  3HHZ A;  2CHV A;  4LFB M;  4FWG A;  1I94 M;  3WHL A;  1SXJ B;  1FJG M;  4M9S A;  1QQW A;  5E26 A;  4B7H A;  1I4W A;  1OJL A;  4MM3 B;  1R7R A;  4GIP A;  5KQD A;  1MX0 A;  3C58 A;  4M0D A;  1XMO M;  2KA6 B;  5EP1 A;  2HL7 A;  2OQ4 A;  2KW0 A;  1TDZ A;  3ZCB B;  2R4J A;  1H6U A;  2YNM D;  4IBK A;  1VDD A;  1D2N A;  2UUB M;  3FKE A;  2X8A A;  1G3I A;  2Z4S A;  5LMN M;  3GLF B;  2R65 A;  3R9X B;  3T1Y M;  3K8Z A;  1OFI A;  3SYK A;  5FTM A;  3UJN A;  2F5S A;  4JI5 M;  3GPX A;  1IM2 A;  3I51 A;  1IY0 A;  4AI6 A;  1N75 A;  4GMQ A;  3TWK A;  4CIS A;  1G41 A;  3U61 A;  3L26 A;  3J81 S;  1GKI A;  3U6M A;  4DV3 M;  3WHK A;  3FUX A;  4B7G A;  1KFV A;  4JV5 M;  1E94 E;  2CE7 A;  1N34 M;  1J5E M;  3MK6 A;  4XBO A;  1QAQ A;  4OVZ A;  4DV0 M;  3FUW A;  5ITR A;  4L8R C;  2BJV A;  1IBM M;  2J7N A;  4JN6 A;  2UXD M;  1HQC A;  2L7I A;  3L2A A;  3CF2 A;  3GQ5 A;  2DWM A;  2ERC A;  2CHQ A;  3GLH A;  3U6E A;  1XXH B;  4PDG A;  1E9R A;  4JI0 M;  4RF0 A;  4I4L A;  1XHB A;  3FTD A;  2OPF A;  1E9S A;  1GL7 A;  4LJA A;  5EQT A;  5ITU A;  1DGG A;  3LVW A;  4DV4 M;  2F5P A;  2P5T A;  1XC8 A;  3PFI A;  4NXN M;  3U6D A;  3KOY E;  1Z5A A;  5KPZ A;  3TPZ A;  3HHW A;  4K0K M;  4LF5 M;  3FYC A;  3HU3 A;  4DR3 M;  4LJ6 A;  2QEN A;  2QZ4 A;  4GHA A;  3SAR A;  2R18 A;  4I5S A;  4MGZ E;  3NWL A;  4LRS A;  4B3T M;  2E5L M;  4AG5 A;  2UXC M;  3EIH A;  2Z7J A;  4LF4 M;  3A45 A;  3KP1 E;  4L4U A;  4IBC A;  3ILK A;  1L8Q A;  1NHW C;  4JI4 M;  1IN7 A;  2XGN A;  2Y0T A;  4MB7 A;  3KVW A;  5H37 D;  1JQJ C;  3KOX E;  4Z6Y A;  5KO3 A;  4L16 A;  1PJI A;  2QBY A;  4JI7 M;  4IJE A;  4IBB A;  1NJF A;  5EP3 A;  4ITQ A;  4DUY M;  3VKH A;  3GPY A;  5JI2 E;  3A46 A;  2FE8 A;  3JR5 A;  3M6A A;  4XGI A;  1QYR A;  4IBE A;  2FFJ A;  3GP1 A;  3SHF A;  1DGB A;  4FVM A;  2CV2 A;  1R2Y A;  2YQZ A;  4QOS A;  2C5R A;  2D7E A;  3FUV A;  2X49 A;  3B9P A;  1IN6 A;  1Z6T A;  4NRV A;  3GRU A;  3L25 A;  5DNY A;  1TH4 A;  1GLN A;  3SMP A;  5E6J A;  4LGY A;  2XLJ A;  3HU1 A;  5BR8 M;  4IJF A;  4MGH A;  2V6Z M;  3I4Y A;  4PD2 A;  3GQ4 A;  5IWA M;  2H1R A;  4DR6 M;  1HNW M;  2XH9 A;  3FD9 A;  3T15 A;  1KYI A;  3RE8 A;  1IQP A;  4JI2 M;  4LJ8 A;  4AW4 A;  4G4O A;  2QPA A;  4LG2 A;  4B08 A;  4D81 A;  3HHX A;  4BBA A;  4DV2 M;  4QHT A;  3SYL A;  2I7N A;  8CAT A;  3U6O A;  5IRE B;  5LMU M;  2LWX A;  1HNX M;  4QNR A;  4OVZ B;  2JA2 A;  3FTC A;  3ZH9 B;  4LF7 M;  4QOZ C;  4JXJ A;  1JR3 D;  3JR4 A;  3LVV A;  3FUU A;  4GKK M;  2RGH A;  4HLQ A;  3TE6 A;  2O5R A;  4KO8 A;  4NOO B;  4L78 A;  3LQR A;  4GRI A;  4LZZ A;  2DHR A;  1E32 A;  4DR4 M;  2C99 A;  4IBG A;  5EP4 A;  1KSF X;  2F5Q A;  4DR1 M;  2XZU A;  2C98 A;  1Q3B A;  4I8O A;  2KEB A;  1IN8 A;  3VDP A;  1TDH A;  1WXQ A;  3GQ3 A;  3VKG A;  3GRY A;  4LCB A;  4LFC M;  1DO0 A;  2A5Y B;  1IXR C;  1EE8 A;  2L09 A;  1L2B A;  1PM5 A;  1OFH A;  1HNZ M;  2DVW B;  4RF1 A;  5EXX A;  4GC5 A;  2R62 A;  3OTO M;  3AV0 A;  2DWN A;  1NNJ A;  3CF6 E;  3PNY A;  1DGF A;  3U60 A;  3CTW B;  1Q3C A;  4REZ A;  3KS4 A;  1XWI A;  4GHL A;  5FSW A;  3GLG B;  3AOG A;  1QZM A;  2C96 A;  1ORY B;  2D7H A;  2HHH M;  3GLI A;  4LJ4 A;  3U5Z B;  1IBL M;  1Z5C A;  1L2D A;  2ZAO A;  4MGI E;  3M0E A;  2UUA M;  1YE9 A;  2QBY B;  3U6P A;  4YHH M;  4OX9 M;  1HT1 E;  3HU2 A;  1QAN A;  4JI1 M;  4QHS A;  5KPR A;  5C1B A;  5IT9 S;  3HJ8 A;  4OW0 A;  2FNA A;  4PT5 A;  4LF6 M;  2LNH C;  2V1C A;  4DR7 M;  3AFH A;  2DWL A;  1T3T A;  3J7A S;  2CEA A;  2D7G A;  1N77 A;  3RFW A;  3TQS A;  3FYD A;  3DFZ A;  3UZU A;  3KSJ A;  4B7F A;  2CV0 A;  1QAM A;  2ZM6 M;  3GPP A;  3H4M A;  1NHG C;  4IBF A;  1JR3 A;  1Z59 A;  3HKP A;  4L15 A;  4FW9 A;  5A2Q S;  3SAS A;  3JAM S;  4DV6 M;  1DGH A;  4DV1 M;  3KP0 E;  4DR5 M;  1TH2 A;  3SAT A;  3SAW A;  5BPV A;  1IXS B;  4AG6 A;  3TWL A;  1IN4 A;  2L7H A;  4M9Z A;  5FTJ A;  4JI8 M;  4X62 M;  3PNV A;  3ZC7 B;  3D8L A;  3LMM A;  5KPT A;  3KW6 A;  4G4N A;  2L6O A;  4G4R A;  2LH0 A;  1J7K A;  4LY6 A;  2XSZ D;  4RNA A;  4PDI A;  4IIW A;  3VK7 A;  1SXJ D;  2XZF A;  2RKO A;  5C18 A;  4JI3 M;  4KLN A;  4WUR A;  4NRW A;  2Y0Q A;  1Q39 A;  4S12 A;  2XF3 A;  4FWD A;  1W5T A;  3HWS A;  3J2P B;  4LJ9 A;  1NSF A;  5EXP A;  4AKH A;  1YSY A;  4G6Z A;  5ITQ A;  3E9S A;  2J7O A;  5DYI A;  1N32 M;  1ZAE A;  4JYA M;  3GO8 A;  3W0F A;  1ZQ9 A;  5F3W A;  4B3S M;  4GKJ M;  4MGK E;  4DR2 M;  4LJ5 A;  4R3D A;  3SC3 A;  4YY3 M;  1GVN A;  4LFA M;  3R8F A;  5FTN A;  3K92 A;  3U6Q A;  2ZBK B;  4FD2 A;  4LF8 M;  4X65 M;  3EIE A;  4FCW A;  3U61 B;  3DA1 A;  1XMQ M;  2CV1 A;  5DYG A;  3J80 S;  4BLC A;  2V1U A;  4JI6 M;  7CAT A;  2HKJ A;  1N78 A;  1R2Z A;  3K1J A;  4GIT A;  3SAU A;  2CUZ A;  4LJ7 A;  3SFZ A;  4B3M M;  4FCV A;  4NSO B;  4AQY M;  1QVR A;  1L2C A;  3AJI B;  1SXJ E;  4IBJ A;  3L28 A;  2HCB A;  4LZJ A;  4WW0 A;  4NL4 H;  5ITX E;  2G5G X;  3HJQ A;  2KRU A;  2NQ8 C;  3GLH B;  3TWM A;  4G4Q A;  3GPU A;  1XNR M;  3QAU A;  3U60 B;  4KHP M;  3D8B A;  3AOE A;  2K47 A;  1IY2 A;  2C9C A;  1GL6 A;  1K82 A;  1XNQ M;  4GH9 A;  1NY5 A;  3RGP A;  3AL0 C;  3KXE C;  1FNN A;  2F5N A;  3GLI B;  3SMS A;  2CHG A;  3MHV C;  3QWL A;  1N33 M;  2KRK A;  2YFQ A;  1J09 A;  4FWH A;  3L27 A;  3PVS A;  1IY1 A;  1TGU A;  2XFT A;  3TL4 X;  3FTF A;  3KDS E;  2M60 A;  4GC9 A;  2Y21 A;  3KS8 A;  2DZO B;  1YUB A;  5ITY A;  4X66 M;  4I81 A;  2AHM A;  4QNM A;  2XSZ A;  4TUW A;  3U6C A;  3L29 A;  1SXJ A;  4A3V B;  3A98 B;  3LQQ A;  3Q8X A;  5ITX A;  2VII A;  2ZAM A;  1G8P A;  3VFD A;  1L1Z A;  2W82 A;  1K3X A;  1G4A E;  2Z4R A;  3DZD A;  3DOA A;  3GRV A;  4PCZ A;  4DV5 M;  3UK6 A;  3T1H M;  2Z3X A;  4M9X A;  3GLF A;  4LGM A;  2XEP A;  1DGH B;  2EO2 A;  2I7P A;  5FTL A;  2F5O A;  5FTK A;  2R45 A;  1Z5B A;  4NXM M;  2X4A A;  3E4R A;  3A42 A;  1W5S A;  3KOW E;  3HGI A;  4HL4 A;  5ITT A;  2R46 A;  3FTE A;  3J27 B;  1HT2 E;  4NSR A;  2QP9 X;  3VK8 A;  2R4E A;  1HQY E;  4W5W A;  2UXB M;  2DWZ B;  1UM8 A;  3UMM A;  1N36 M;  2DZN B;  3IG5 A;  2Y20 A;  4R7G A;  2EA0 A;  4ZPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...