1Q3BA

Crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli: the r252a mutant at 2.05 resolution.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
262
structure length
259
Chain Sequence
PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQVDENKHHGALFRFKVFHRDGEPCERCGSIIEKTTLPFYWCPGCQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the uncomplexed DNA repair enzyme endonuclease VIII indicates significant interdomain flexibility.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Endonuclease VIII
total genus 76
structure length 259
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1q3bA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 1q3bA01
3U6MA 4JI4M 4JI0M 2VQFM 3GPYA 4DR1M 1TDZA 1HNZM 4B3RM 1Z59A 1R2ZA 2ZBKB 1K3WA 1L2BA 5ITQA 3U6OA 4LF8M 4DUZM 2UXDM 4G4NA 4JV5M 4DUYM 4JI7M 3C58A 5ITXE 4JI2M 2F5QA 4NRWA 2VQEM 3A45A 1Z5AA 4AQYM 4JI1M 3JR4A 1Q3CA 2UUBM 4X64M 3OTOM 1N34M 4B3MM 4G4RA 3U6SA 1XMOM 4DR3M 1K3XA 4B3SM 4JI5M 4X65M 3TWLA 4NXMM 3DOAA 2EA0A 3T1HM 5BR8M 4NRVA 5ITYA 1IBLM 5IWAM 4DV0M 4LF6M 2F5OA 2UUAM 4LF9M 2UU9M 1MX0A 3GO8A 1EE8A 4PD2A 1HR0M 4X66M 3J81S 4DV2M 2E5LM 2XZFA 3U6LA 4DV5M 3TWKA 4G4OA 2XZUA 5A2QS 3SARA 4B3TM 3W0FA 5LMNM 3VK8A 1XC8A 1PJJA 4JYAM 4LFAM 1XNQM 3J80S 2OQ4A 3J7AS 5ITTA 4GKJM 4DR7M 2UXCM 1Q3BA 5ITXA 4JI3M 3JAMS 1L2CA 2F5NA 4CISA 3GPUA 4DR4M 3U6EA 3GPXA 3U6CA 3SBJA 2OPFA 4DV1M 4LF7M 3GQ4A 4DR2M 1IBMM 3U6QA 4GKKM 4DV7M 3U6DA 4DR6M 2ZM6M 2F5SA 3SAUA 4KHPM 3GQ5A 3SATA 1HNXM 3GPPA 3JR5A 1PM5A 4JI8M 3A42A 3GQ3A 1NNJA 1Z5CA 2Q2EB 4ITQA 4LFBM 1IBKM 3T1YM 1PJIA 4PDIA 5ITRA 1TDHA 2UXBM 2HKJA 4PDGA 1L1ZA 1L2DA 2F4VM 5FLXS 1N33M 4G4QA 2HHHM 5LMUM 4K0KM 4LFCM 3A46A 2UUCM 4DV3M 1XNRM 1J5EM 4DR5M 1I94M 4DV4M 3VK7A 3SASA 4NXNM 3GP1A 1Z5BA 1MU5A 1R2YA 5IT9S 1FJGM 1N36M 1K82A 4PCZA 3SAVA 4DV6M 2F5PA 4OX9M 3U6PA 1N32M 3TWMA 4JI6M 3SAWA 1KFVA 4YHHM 1XMQM 5ITUA 1HNWM 4X62M 1L1TA 1Q39A 4LF4M 4MB7A 4YY3M 4LF5M
chains in the Genus database with same CATH superfamily
2YR0A 3B74A 1I4WA 3HY5A 4JI4M 2FFJA 2JZ0A 3AOGA 2QNJA 4LY6A 1D0MA 2B3TA 1VEJA 1IM2A 2Y21A 1IN8A 1HNZM 3FRIA 1L2BA 1JR3E 2JY7A 5ITQA 4BLCA 4RF1A 4NC6A 2MR9A 2L7HA 4KODA 2R6FA 4Y28F 1AUAA 3M6AA 3L29A 4JI7M 2JWSA 3E21A 1V34A 5ITXE 2OOAA 2X4AA 2V1CA 3GRYA 4QNMA 4ANRA 2LWXA 1UFZA 2Z8YM 4JI1M 4PT5A 2O5RA 1YLAA 1GJSA 2JA2A 2I7NA 1TR8A 1IN5A 1OKSA 1HT2E 2CWBA 3K8ZA 4IBJA 1OAOC 1JR3D 4CIZA 4X64M 1N34M 1ZMUA 4WURA 5KQ8A 1DGHA 5EXPA 1SXJD 2DENA 4IBEA 3SC3A 1IBLM 5BPVA 4IJEA 1W5TA 3CF0A 3K92A 2L6OA 1BVSA 2RGOA 2LVQD 3FTDA 3KSXA 1V92A 4NL4H 3WHKA 3VDUA 3VKHA 1OIPA 2R45A 3CF2A 3LQRA 4M0DA 4DV5M 3U60A 3I4VA 1XC8A 1PJJA 1XHBA 3KOZE 3BBZA 3HU2A 3AFHA 3FUXA 4FD2A 4MH0E 3K2LA 4LJ7A 4UN2B 5EXTA 4AI6A 3GLIB 1D0LA 1DO2A 3EIHA 4F2LA 1KYIA 2LTUA 4JI3M 5EQTA 3GPUA 1Y8GA 2P5TA 1S3SA 1G4AE 3HHWA 4QOSA 2K6BA 2G5GX 1CUKA 4FCTA 1E94E 3AOEA 2XF3A 2ZM6M 1QAOA 4MGKE 3VLFB 3GQ5A 2R18A 3L28A 4KO8A 4Z8XA 3GLFE 2V6ZM 1WIVA 3SHGB 2NQ8C 3HJQA 1Z5CA 3RGPA 3KOWE 3KSJA 1QDRA 1NV8A 4PDIA 1YUBA 2QENA 2HKJA 2D7GA 4PDGA 2F4VM 1N33M 2BWBA 2D7HA 2RKOA 2YNMD 3B7ZA 5LMUM 1E32A 4K0KM 2CUZA 4RNAA 1N78A 4GC5A 3EIEA 5DYGA 2RRUA 3ILKA 1GO5A 4LGYA 4NXNM 2VF7A 1Z5BA 3SHFA 3GLFA 1R2YA 1FJGM 4GIPA 3MHVC 4DV6M 2F5PA 1ZMVA 3U6PA 4AKHA 2CE7A 3B7NA 2BJVA 3GLHA 5E26A 3TWMA 4GHAA 1XXHE 4FW9A 3SMPA 1TH4A 3SAWA 2FE8A 1KFVA 4GC9A 2R0IA 3TE6A 3NWLA 3HJ8A 2KZUA 5FSWA 3LMMA 1N75A 4OVZA 2QZ4A 2C96A 4DBGB 1ZV1A 4MB7A 2FH0A 5C18A 2JY6B 3BXWA 4YY3M 4MGIE 3SAVA 3LW5F 2XSZD 3H4JA 3TPZA 3AOEC 2AHMA 1TF0B 3QYBA 2Y20A 3GPYA 4R3DA 4DR1M 3FTEA 1TTEA 3LVVA 2ZANA 2V1UA 2N35A 4LZJA 1G59A 1NY5A 2ZBKB 2LHGA 1K3WA 2DAIA 1XXHA 1F4IA 4BBAA 4LF8M 5EP2A 4QOZC 2UXDM 4G4NA 3BOSA 3GLFB 2FS1A 2KDLA 3C58A 4RF0A 3PFIA 2R46A 1ORYB 2BWEA 1N77A 3IG5A 1E9SA 4AQYM 5EXSA 3GRRA 4IBBA 3JR4A 2DHYA 1E9RA 4G3OA 4IJFA 4OW0A 2QBYA 1ZMWA 2XH9A 2ZTCA 2UUBM 4I5SA 4AG5A 3OTOM 3U6SA 3CGWA 3K9OA 4DR3M 1XMOM 1K3XA 1IXZA 4NXMM 3TWLA 3DOAA 2EA0A 3PVSA 4QHSA 1H6UA 2DAKA 1HT1E 4NRVA 5ITYA 3UMMA 5BR8M 3E46A 5IWAM 2EUCA 3AV0A 3KXEC 1JB0F 2F5OA 3FUWA 2LVPC 5DNYA 1C7YA 2UU9M 1HR0M 1EE8A 4Z6YA 1J09A 4X66M 1DGGA 3J81S 2OO9A 2R62A 1MJGM 1ZAEA 2RGHA 2QP9X 3I04M 3U6LA 2XZFA 4TUWA 1GABA 4KLNA 2CRUA 2R4EA 5EJCA 5A2QS 5KPRA 4JYAM 4AZFA 3J80S 5C1BA 4IBGA 1Z6TA 1G71A 4QNRA 5ITTA 3UJNA 2UXCM 4IIWA 1QAMA 2D7EA 3VKGA 4LJ9A 4CISA 2DZOB 4QHTA 4GRIA 1XB2B 2X49A 2H1RA 2DAMA 3GLHB 1WGLA 3SYKA 3U6EA 3DZDA 3SBJA 4DV1M 2VF8A 3GQ4A 4DR2M 3D8BA 2L4EA 2O01F 3KVWA 2DI0A 1DGBA 2LXEA 2G3QA 2KNZA 4L4UA 4M9XA 1C1KA 2Z3XA 4LG2A 1IXRC 4F1IA 1Q02A 3QWLA 3K9PA 3E9SA 3JR5A 1PM5A 2HAKA 4IBKA 4JI8M 3L26A 3GRVA 3D8LA 2Q2EB 4ITQA 4LFBM 2R44A 1OFHA 4AKIA 5GKNA 1PJIA 1VG5A 1WR1B 4HLQA 5ITRA 2YFQA 2LHCA 3UGJA 2DXIA 2UXBM 1HQCA 2JUJA 1RU3A 4GITA 1IY0A 1OJLA 1XWIA 2KRKA 2HHHM 4HEOA 3LCUA 2C9OA 1QZEA 4LFCM 3T15A 3AJIB 2UUCM 2JXNA 4DV3M 1XNRM 1J5EM 1R5LA 2BNKA 1IQPA 3KOXE 1HQYE 3SASA 1GL6A 2CV2A 1MU5A 2C99A 5KQDA 5FTMA 1G8PA 2L2DA 4LJ5A 2KNAA 3LVWA 2FNAA 1AIPC 5DYIA 4LZZA 4B7GA 1W5SA 3ZC7B 1JR3A 2L09A 2Y0QA 2DWLA 3U5ZB 3TQSA 1SG9A 1HJPA 4LRSA 1IY1A 4JI6M 2R65A 3F92A 2M60A 1IN4A 2Z4SA 2APLA 2CV1A 1V33A 1WGNA 1XMQM 5ITUA 1NJFA 4L16A 3J27B 3KS4A 3C9PA 3RFWA 2C98A 1NHWC 2K47A 4LF4M 4LF5M 4LJ8A 2WZJA 4JI0M 4L15A 3GLIE 2VDBB 5EP4A 3Q8XA 3FUUA 3HU3A 4REZA 2Z4RA 3HJSA 1LV7A 1R2ZA 2L7IA 2QQ8A 1VDDA 2EKKA 2DWMA 2DZNB 3QYEA 4FWGA 4S12A 1R4GA 5FTNA 2DHRA 4D80A 4JV5M 4DUYM 5JI2E 2ZAOA 4P17A 2CP8A 3SMSA 1QQWA 3NBIA 2BJWA 4NRWA 2K9DA 1JQJC 3GLHE 3A45A 4LJAA 3KFUG 4LJ4A 1X37A 1R6BX 1NV9A 3M0EA 1GJTA 3VDPA 2JNHA 3FUVA 4B3MM 4B3SM 4G4RA 3KDSE 2GNOA 4AW4A 4X65M 3THGA 2KW0A 3W67A 4MGYE 3FE3A 2LVOC 4I4LA 1QUSA 1IFYA 2WSEF 4FCWA 1G3IA 2WSFF 3FTFA 3HZJA 4CGYB 2QCUA 1OQYA 1TH3A 2CHQA 3SFZA 4G4OA 2XZUA 1PJQA 4I81A 3SARA 1QANA 4M0WA 3W0FA 3VK8A 3C3EA 2DKLA 1A5TA 1NO1A 4KT0F 1IY2A 1L8QA 1GVNA 4GKJM 4DR7M 1Q3BA 1IXSB 1VQ1A 3A98B 2C9CA 1L2CA 1PJTA 2L4FA 2H5XA 1GKIA 2QSFX 3U6CA 2OPFA 4LCBA 4CHTB 2A5YB 2CFOA 2MH8A 2XSZA 2GQFA 3B89A 4R71A 2VIIA 1SXJA 5FTLA 3U6QA 4GKKM 2OOBA 3J2PB 4DR6M 3I4YA 3PXGA 1DV0A 3MJ5A 3SAUA 3PNVA 3SATA 4FVMA 4D82A 1HNXM 1T6OA 3RGSA 3FKEA 3GPPA 2G8LA 3KOYE 2ZTDA 1XXHB 3V76A 4XBOA 3T1YM 5EP3A 2KXEA 3J7BA 3CF6E 2XGNA 4LJ6A 2CEAA 4GH9A 1L1ZA 2KRUA 1DGHB 3HHXA 1OIZA 2ERCA 2XFSA 2MGWA 4LRTA 4XGIA 2XEPA 2KNVA 3GRUA 3L25A 3LCVB 2QBYB 4FWDA 1YSYA 5FTKA 4IBDA 4DR5M 1I94M 3GP1A 4M9ZA 5IT9S 3C3DA 3IECA 5L8RF 2JZ1A 1K82A 2DAGA 2LVNC 2DZLA 3HHYA 4PCZA 3U60B 3U5ZA 1ZQ9A 2J5YA 1NJGA 3DFZA 4II7A 1SXJB 1VDLA 3ZH9B 5KO3A 1N32M 4AKGA 5H37D 2LVAA 3HX3A 3RE8A 3IG8A 1QZMA 3U61A 2KHHA 3DA1A 4W5WA 1T43A 5KPTA 3VFDA 1EIJA 2Y0TA 4JXJA 2KZSA 4YHHM 3AL0C 1D0KA 1D2NA 4B08A 3FRHA 4WP2A 4XK8F 2DAEA 2KEBA 3MMPA 3I51A 3QAUA 1L1TA 2MJ5B 1WHCA 5IZ7D 1IN6A 2HWJA 1QUTA 3L27A 1P3QQ 3UK6A 3U6MA 1VEGA 2CHGA 3LQQA 1QDTA 1DO0A 2ZAMA 4NOOB 4P16A 2VQFM 2YQZA 4EIWA 2EO2A 1TDZA 4B3RM 1Z59A 2W82A 3FYCA 4LGMA 4IBIA 3U6OA 1PJSA 4DUZM 4WW0A 3WHLA 2KA6B 2WSCF 2MROB 4OU7A 3KP0E 5EXXA 1NSFA 3B9PA 1NY6A 2M5ZA 4JI2M 3AKZA 2DWNA 2F5QA 2VQEM 1Z5AA 3MK6A 3GLGB 4MGHA 5IREB 1Q3CA 2QHOB 1GL7A 3L2AA 2LBCA 3HKPA 4B7FA 4B7HA 1SXJE 4JI5M 2DVWB 3FYDA 3KW6A 3ZQJA 3UZUA 3H4MA 1TGUA 5E6JA 4L8RC 3T1HM 4NSRA 2I7PA 4IBFA 2FOIC 4D81A 4DV0M 4LF6M 2UUAM 4LF9M 2CV0A 1PGYA 1MX0A 3GO8A 4PD2A 1QYRA 1VEKA 3KS8A 4DV2M 2E5LM 4JN6A 2JY8A 4MGZE 4FCVA 3TWKA 4A3VB 1QVRA 1EFUB 4B3TM 8CATA 5LMNM 4LFAM 1XNQM 3IHPA 4OVZB 2OQ4A 3J7AS 2X8AA 3KP1E 5DFLA 1SXJC 4GEWA 5EP1A 5ITXA 1GLNA 3JAMS 4M9SA 2F5NA 4L6V6 4DR4M 3I01M 3GPXA 1DGFA 1WXQA 3HU1A 3R8FA 2J7NA 3PNYA 3TL4X 4CJ6A 4LF7M 1TH2A 3E4RA 5KPZA 1IBMM 1UM8A 5JI3E 1G41A 2DNAA 2DWZB 4I8OA 1NNUC 1OFIA 4DV7M 3U6DA 2F5SA 3R9XB 4KHPM 1NHGC 3GLGE 3FD9A 5FTJA 3ZCBB 4RKUF 2LH0A 2J7OA 3W0LB 3A42A 3GQ3A 1NNJA 3HWSA 1NVMA 4MM3B 1WJ7A 1IBKM 2HL7A 2QPAA 1IN7A 3K1JA 1TDHA 1OTRA 4L78A 4GHLA 3HGIA 2XFTA 1L2DA 5FLXS 4G4QA 3M7GA 2C5RA 2K0BX 3W68A 1OAIA 3T6PA 1T3TA 2LNHC 4GMQA 1R7RA 1MN3A 2XLJA 1KSFX 3B7QA 3A46A 4Q7JA 3SYLA 3CTWB 4FWHA 4DV4M 1YE9A 3VK7A 4NSOB 3GLGA 1N36M 1PRBA 5F3WA 4HL4A 3GLIA 3U61B 2O25A 4OX9M 3FTCA 2EJSA 2HCBA 4IBCA 4G6ZA 3T38A 3FUTA 2JY5A 1QAQA 2JP7A 4BB9A 4AG6A 7CATA 3HHZA 2CHVA 4R7GA 4ZPXA 1HNWM 1J7KA 2R4JA 2EKFA 2Z7JA 1LTMA 1Q39A 3Q8GA 1FNNA 4X62M 3NBXX 1IXSA
chains in the Genus database with same CATH topology
2YR0A 1I4WA 4JI4M 2FFJA 3AOGA 4LY6A 2Y21A 1IM2A 1IN8A 1HNZM 1L2BA 5ITQA 4BLCA 4RF1A 2L7HA 4KODA 3M6AA 3L29A 4JI7M 5ITXE 2X4AA 2V1CA 3GRYA 4QNMA 2LWXA 4JI1M 4PT5A 2O5RA 2JA2A 2I7NA 1IN5A 1HT2E 3K8ZA 4IBJA 4X64M 1N34M 1JR3D 4WURA 5KQ8A 1DGHA 5EXPA 1SXJD 4IBEA 3SC3A 1IBLM 5BPVA 4IJEA 1W5TA 3CF0A 3K92A 2L6OA 2RGOA 3FTDA 3KSXA 4NL4H 3WHKA 3VDUA 3VKHA 2R45A 3CF2A 4M0DA 4DV5M 3U60A 3I4VA 1XC8A 1PJJA 1XHBA 3KOZE 3HU2A 4FD2A 3AFHA 3FUXA 4MH0E 3K2LA 4LJ7A 5EXTA 4AI6A 3GLIB 1DO2A 3EIHA 1KYIA 4JI3M 5EQTA 3GPUA 2P5TA 1S3SA 1G4AE 3HHWA 4QOSA 2G5GX 4FCTA 1E94E 3AOEA 2XF3A 2ZM6M 1QAOA 4MGKE 3VLFB 3GQ5A 2R18A 3L28A 4KO8A 4Z8XA 2V6ZM 3SHGB 2NQ8C 3HJQA 1Z5CA 3RGPA 3KOWE 3KSJA 4PDIA 1YUBA 2QENA 2HKJA 2D7GA 4PDGA 2F4VM 1N33M 2RKOA 2D7HA 2YNMD 5LMUM 1E32A 4K0KM 2CUZA 4RNAA 1N78A 4GC5A 3EIEA 5DYGA 3ILKA 4LGYA 4NXNM 3SHFA 1Z5BA 3GLFA 1R2YA 1FJGM 4GIPA 3MHVC 4DV6M 2F5PA 3U6PA 4AKHA 2CE7A 2BJVA 3GLHA 5E26A 3TWMA 4GHAA 4FW9A 3SMPA 1TH4A 3SAWA 2FE8A 1KFVA 4GC9A 3TE6A 3NWLA 3HJ8A 2KZUA 5FSWA 3LMMA 1N75A 4OVZA 2QZ4A 2C96A 4MB7A 3SAVA 5C18A 4YY3M 4MGIE 2XSZD 3TPZA 3AOEC 2AHMA 2Y20A 3GPYA 4R3DA 4DR1M 3FTEA 3LVVA 2ZANA 2V1UA 4LZJA 1G59A 1NY5A 2ZBKB 1K3WA 1XXHA 4BBAA 4LF8M 5EP2A 4QOZC 2UXDM 4G4NA 3BOSA 3GLFB 3C58A 4RF0A 3PFIA 2R46A 1ORYB 1N77A 3IG5A 1E9SA 4AQYM 5EXSA 3GRRA 4IBBA 3JR4A 4IJFA 1E9RA 4OW0A 2QBYA 2UUBM 2XH9A 4I5SA 4AG5A 3OTOM 3U6SA 1XMOM 4DR3M 1K3XA 1IXZA 4NXMM 3TWLA 3DOAA 2EA0A 3PVSA 4QHSA 1H6UA 1HT1E 4NRVA 5ITYA 3UMMA 5BR8M 5IWAM 2EUCA 3AV0A 3KXEC 2F5OA 3FUWA 5DNYA 2UU9M 1HR0M 1EE8A 4Z6YA 1J09A 4X66M 1DGGA 3J81S 2R62A 2XZFA 1ZAEA 2RGHA 2QP9X 3U6LA 4TUWA 4KLNA 2R4EA 5EJCA 5A2QS 5KPRA 4JYAM 4AZFA 3J80S 5C1BA 4IBGA 1Z6TA 5ITTA 4QNRA 3UJNA 2UXCM 4IIWA 1QAMA 2D7EA 3VKGA 4LJ9A 4CISA 2DZOB 4QHTA 4GRIA 2X49A 3GLHB 2H1RA 3U6EA 3SYKA 3DZDA 3SBJA 4DV1M 3GQ4A 4DR2M 3D8BA 3KVWA 1DGBA 2LXEA 4M9XA 4L4UA 1C1KA 2Z3XA 4LG2A 1IXRC 3QWLA 3E9SA 3JR5A 1PM5A 4IBKA 4JI8M 3L26A 3GRVA 3D8LA 2Q2EB 4ITQA 4LFBM 1OFHA 4AKIA 5GKNA 1PJIA 4HLQA 5ITRA 2YFQA 3UGJA 2UXBM 2DXIA 1HQCA 4GITA 1IY0A 1OJLA 1XWIA 2KRKA 2HHHM 2C9OA 4LFCM 3T15A 3AJIB 2UUCM 4DV3M 1XNRM 1J5EM 2BNKA 1IQPA 3KOXE 1HQYE 3SASA 1GL6A 2CV2A 1MU5A 2C99A 5KQDA 5FTMA 1G8PA 4LJ5A 3LVWA 2FNAA 5DYIA 4LZZA 4B7GA 1W5SA 3ZC7B 1JR3A 2L09A 2Y0QA 2DWLA 3U5ZB 3TQSA 4LRSA 4JI6M 1IY1A 2R65A 2M60A 1IN4A 2Z4SA 2CV1A 1XMQM 5ITUA 1NJFA 4L16A 3J27B 3KS4A 3RFWA 2C98A 1NHWC 2K47A 4LF4M 4LF5M 4LJ8A 4JI0M 4L15A 5EP4A 3Q8XA 3FUUA 3HU3A 4REZA 2Z4RA 3HJSA 1LV7A 1R2ZA 2L7IA 1VDDA 2DWMA 2DZNB 4FWGA 4S12A 5FTNA 2DHRA 4D80A 4JV5M 4DUYM 5JI2E 2ZAOA 3SMSA 1QQWA 3NBIA 2BJWA 4NRWA 3KFUG 1JQJC 4LJAA 3A45A 4LJ4A 1X37A 1R6BX 3M0EA 3VDPA 3FUVA 4B3MM 4B3SM 4G4RA 3KDSE 4AW4A 4X65M 3THGA 2KW0A 4MGYE 4I4LA 4FCWA 1G3IA 3FTFA 4CGYB 2QCUA 1TH3A 2CHQA 3SFZA 4G4OA 2XZUA 4I81A 3SARA 1QANA 4M0WA 3W0FA 3VK8A 1IY2A 1L8QA 1GVNA 4GKJM 4DR7M 1Q3BA 1IXSB 3A98B 2C9CA 1L2CA 1GKIA 3U6CA 2OPFA 4LCBA 4CHTB 2A5YB 2CFOA 2XSZA 5FTLA 2VIIA 1SXJA 3U6QA 4GKKM 3J2PB 4DR6M 3I4YA 3PXGA 3MJ5A 3SAUA 3PNVA 3SATA 4FVMA 4D82A 1HNXM 3RGSA 3GPPA 3FKEA 2G8LA 3KOYE 1XXHB 4XBOA 3T1YM 5EP3A 2KXEA 3J7BA 3CF6E 2XGNA 4LJ6A 2CEAA 4GH9A 1L1ZA 2KRUA 1DGHB 3HHXA 2ERCA 2XFSA 4LRTA 4XGIA 2XEPA 3GRUA 3L25A 2QBYB 4FWDA 1YSYA 5FTKA 4IBDA 4DR5M 1I94M 3GP1A 4M9ZA 5IT9S 1K82A 4PCZA 3HHYA 3U60B 3U5ZA 1ZQ9A 5KO3A 1NJGA 3DFZA 4II7A 1SXJB 3ZH9B 1N32M 4AKGA 5H37D 3RE8A 3IG8A 1QZMA 3U61A 3DA1A 4W5WA 5KPTA 3VFDA 2Y0TA 4JXJA 2KZSA 4YHHM 3AL0C 4B08A 1D2NA 3QAUA 2KEBA 3I51A 1L1TA 5IZ7D 1IN6A 3L27A 3UK6A 3U6MA 2CHGA 3LQQA 1DO0A 2ZAMA 4NOOB 4P16A 2VQFM 2YQZA 4EIWA 2EO2A 1TDZA 4B3RM 1Z59A 2W82A 3FYCA 4LGMA 4IBIA 3U6OA 4DUZM 4WW0A 3WHLA 2KA6B 4OU7A 3KP0E 5EXXA 1NSFA 3B9PA 1NY6A 2M5ZA 4JI2M 3AKZA 2DWNA 2F5QA 2VQEM 1Z5AA 3MK6A 3GLGB 4MGHA 5IREB 1Q3CA 1GL7A 3L2AA 3HKPA 4B7FA 4B7HA 1SXJE 4JI5M 2DVWB 3FYDA 3KW6A 3UZUA 3H4MA 1TGUA 5E6JA 4L8RC 3T1HM 4NSRA 2I7PA 4IBFA 2FOIC 4D81A 4DV0M 4LF6M 2UUAM 4LF9M 2CV0A 1MX0A 3GO8A 4PD2A 1QYRA 3KS8A 4DV2M 2E5LM 4JN6A 4MGZE 4FCVA 3TWKA 4A3VB 1QVRA 4B3TM 8CATA 5LMNM 4LFAM 1XNQM 4OVZB 2OQ4A 3J7AS 2X8AA 3KP1E 5EP1A 1SXJC 5ITXA 1GLNA 3JAMS 4M9SA 2F5NA 4DR4M 3GPXA 1DGFA 1WXQA 3HU1A 3R8FA 2J7NA 3PNYA 3TL4X 4LF7M 1TH2A 3E4RA 5KPZA 1IBMM 1UM8A 5JI3E 1G41A 2DWZB 4I8OA 1NNUC 1OFIA 4DV7M 3U6DA 2F5SA 3R9XB 4KHPM 1NHGC 3FD9A 5FTJA 3ZCBB 2LH0A 2J7OA 3W0LB 3A42A 3GQ3A 1NNJA 3HWSA 1NVMA 4MM3B 1IBKM 2HL7A 2QPAA 1IN7A 3K1JA 1TDHA 4L78A 4GHLA 3HGIA 2XFTA 1L2DA 5FLXS 4G4QA 3M7GA 2C5RA 1T3TA 2LNHC 4GMQA 1R7RA 2XLJA 1KSFX 3A46A 3SYLA 3CTWB 4FWHA 4DV4M 1YE9A 3VK7A 4NSOB 3GLGA 1N36M 5F3WA 4HL4A 3GLIA 3U61B 4OX9M 3FTCA 2HCBA 4IBCA 4G6ZA 3T38A 3FUTA 1QAQA 4BB9A 4AG6A 7CATA 3HHZA 2CHVA 4R7GA 4ZPXA 1HNWM 1J7KA 2R4JA 2Z7JA 4X62M 1Q39A 1FNNA 3LQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6M A;  4JI4 M;  4JI0 M;  2VQF M;  3GPY A;  4DR1 M;  1TDZ A;  1HNZ M;  4B3R M;  1Z59 A;  1R2Z A;  2ZBK B;  1K3W A;  1L2B A;  5ITQ A;  3U6O A;  4LF8 M;  4DUZ M;  2UXD M;  4G4N A;  4JV5 M;  4DUY M;  4JI7 M;  3C58 A;  5ITX E;  4JI2 M;  2F5Q A;  4NRW A;  2VQE M;  3A45 A;  1Z5A A;  4AQY M;  4JI1 M;  3JR4 A;  1Q3C A;  2UUB M;  4X64 M;  3OTO M;  1N34 M;  4B3M M;  4G4R A;  3U6S A;  1XMO M;  4DR3 M;  1K3X A;  4B3S M;  4JI5 M;  4X65 M;  3TWL A;  4NXM M;  3DOA A;  2EA0 A;  3T1H M;  5BR8 M;  4NRV A;  5ITY A;  1IBL M;  5IWA M;  4DV0 M;  4LF6 M;  2F5O A;  2UUA M;  4LF9 M;  2UU9 M;  1MX0 A;  3GO8 A;  1EE8 A;  4PD2 A;  1HR0 M;  4X66 M;  3J81 S;  4DV2 M;  2E5L M;  2XZF A;  3U6L A;  4DV5 M;  3TWK A;  4G4O A;  2XZU A;  5A2Q S;  3SAR A;  4B3T M;  3W0F A;  5LMN M;  3VK8 A;  1XC8 A;  1PJJ A;  4JYA M;  4LFA M;  1XNQ M;  3J80 S;  2OQ4 A;  3J7A S;  5ITT A;  4GKJ M;  4DR7 M;  2UXC M;  1Q3B A;  5ITX A;  4JI3 M;  3JAM S;  1L2C A;  2F5N A;  4CIS A;  3GPU A;  4DR4 M;  3U6E A;  3GPX A;  3U6C A;  3SBJ A;  2OPF A;  4DV1 M;  4LF7 M;  3GQ4 A;  4DR2 M;  1IBM M;  3U6Q A;  4GKK M;  4DV7 M;  3U6D A;  4DR6 M;  2ZM6 M;  2F5S A;  3SAU A;  4KHP M;  3GQ5 A;  3SAT A;  1HNX M;  3GPP A;  3JR5 A;  1PM5 A;  4JI8 M;  3A42 A;  3GQ3 A;  1NNJ A;  1Z5C A;  2Q2E B;  4ITQ A;  4LFB M;  1IBK M;  3T1Y M;  1PJI A;  4PDI A;  5ITR A;  1TDH A;  2UXB M;  2HKJ A;  4PDG A;  1L1Z A;  1L2D A;  2F4V M;  5FLX S;  1N33 M;  4G4Q A;  2HHH M;  5LMU M;  4K0K M;  4LFC M;  3A46 A;  2UUC M;  4DV3 M;  1XNR M;  1J5E M;  4DR5 M;  1I94 M;  4DV4 M;  3VK7 A;  3SAS A;  4NXN M;  3GP1 A;  1Z5B A;  1MU5 A;  1R2Y A;  5IT9 S;  1FJG M;  1N36 M;  1K82 A;  4PCZ A;  3SAV A;  4DV6 M;  2F5P A;  4OX9 M;  3U6P A;  1N32 M;  3TWM A;  4JI6 M;  3SAW A;  1KFV A;  4YHH M;  1XMQ M;  5ITU A;  1HNW M;  4X62 M;  1L1T A;  1Q39 A;  4LF4 M;  4MB7 A;  4YY3 M;  4LF5 M; 
#chains in the Genus database with same CATH topology
 2YR0 A;  3B74 A;  1I4W A;  3HY5 A;  4JI4 M;  2FFJ A;  2JZ0 A;  3AOG A;  2QNJ A;  4LY6 A;  1D0M A;  2B3T A;  1VEJ A;  1IM2 A;  2Y21 A;  1IN8 A;  1HNZ M;  3FRI A;  1L2B A;  1JR3 E;  2JY7 A;  5ITQ A;  4BLC A;  4RF1 A;  4NC6 A;  2MR9 A;  2L7H A;  4KOD A;  2R6F A;  4Y28 F;  1AUA A;  3M6A A;  3L29 A;  4JI7 M;  2JWS A;  3E21 A;  1V34 A;  5ITX E;  2OOA A;  2X4A A;  2V1C A;  3GRY A;  4QNM A;  4ANR A;  2LWX A;  1UFZ A;  2Z8Y M;  4JI1 M;  4PT5 A;  2O5R A;  1YLA A;  1GJS A;  2JA2 A;  2I7N A;  1TR8 A;  1IN5 A;  1OKS A;  1HT2 E;  2CWB A;  3K8Z A;  4IBJ A;  1OAO C;  1JR3 D;  4CIZ A;  4X64 M;  1N34 M;  1ZMU A;  4WUR A;  5KQ8 A;  1DGH A;  5EXP A;  1SXJ D;  2DEN A;  4IBE A;  3SC3 A;  1IBL M;  5BPV A;  4IJE A;  1W5T A;  3CF0 A;  3K92 A;  2L6O A;  1BVS A;  2RGO A;  2LVQ D;  3FTD A;  3KSX A;  1V92 A;  4NL4 H;  3WHK A;  3VDU A;  3VKH A;  1OIP A;  2R45 A;  3CF2 A;  3LQR A;  4M0D A;  4DV5 M;  3U60 A;  3I4V A;  1XC8 A;  1PJJ A;  1XHB A;  3KOZ E;  3BBZ A;  3HU2 A;  3AFH A;  3FUX A;  4FD2 A;  4MH0 E;  3K2L A;  4LJ7 A;  4UN2 B;  5EXT A;  4AI6 A;  3GLI B;  1D0L A;  1DO2 A;  3EIH A;  4F2L A;  1KYI A;  2LTU A;  4JI3 M;  5EQT A;  3GPU A;  1Y8G A;  2P5T A;  1S3S A;  1G4A E;  3HHW A;  4QOS A;  2K6B A;  2G5G X;  1CUK A;  4FCT A;  1E94 E;  3AOE A;  2XF3 A;  2ZM6 M;  1QAO A;  4MGK E;  3VLF B;  3GQ5 A;  2R18 A;  3L28 A;  4KO8 A;  4Z8X A;  3GLF E;  2V6Z M;  1WIV A;  3SHG B;  2NQ8 C;  3HJQ A;  1Z5C A;  3RGP A;  3KOW E;  3KSJ A;  1QDR A;  1NV8 A;  4PDI A;  1YUB A;  2QEN A;  2HKJ A;  2D7G A;  4PDG A;  2F4V M;  1N33 M;  2BWB A;  2D7H A;  2RKO A;  2YNM D;  3B7Z A;  5LMU M;  1E32 A;  4K0K M;  2CUZ A;  4RNA A;  1N78 A;  4GC5 A;  3EIE A;  5DYG A;  2RRU A;  3ILK A;  1GO5 A;  4LGY A;  4NXN M;  2VF7 A;  1Z5B A;  3SHF A;  3GLF A;  1R2Y A;  1FJG M;  4GIP A;  3MHV C;  4DV6 M;  2F5P A;  1ZMV A;  3U6P A;  4AKH A;  2CE7 A;  3B7N A;  2BJV A;  3GLH A;  5E26 A;  3TWM A;  4GHA A;  1XXH E;  4FW9 A;  3SMP A;  1TH4 A;  3SAW A;  2FE8 A;  1KFV A;  4GC9 A;  2R0I A;  3TE6 A;  3NWL A;  3HJ8 A;  2KZU A;  5FSW A;  3LMM A;  1N75 A;  4OVZ A;  2QZ4 A;  2C96 A;  4DBG B;  1ZV1 A;  4MB7 A;  2FH0 A;  5C18 A;  2JY6 B;  3BXW A;  4YY3 M;  4MGI E;  3SAV A;  3LW5 F;  2XSZ D;  3H4J A;  3TPZ A;  3AOE C;  2AHM A;  1TF0 B;  3QYB A;  2Y20 A;  3GPY A;  4R3D A;  4DR1 M;  3FTE A;  1TTE A;  3LVV A;  2ZAN A;  2V1U A;  2N35 A;  4LZJ A;  1G59 A;  1NY5 A;  2ZBK B;  2LHG A;  1K3W A;  2DAI A;  1XXH A;  1F4I A;  4BBA A;  4LF8 M;  5EP2 A;  4QOZ C;  2UXD M;  4G4N A;  3BOS A;  3GLF B;  2FS1 A;  2KDL A;  3C58 A;  4RF0 A;  3PFI A;  2R46 A;  1ORY B;  2BWE A;  1N77 A;  3IG5 A;  1E9S A;  4AQY M;  5EXS A;  3GRR A;  4IBB A;  3JR4 A;  2DHY A;  1E9R A;  4G3O A;  4IJF A;  4OW0 A;  2QBY A;  1ZMW A;  2XH9 A;  2ZTC A;  2UUB M;  4I5S A;  4AG5 A;  3OTO M;  3U6S A;  3CGW A;  3K9O A;  4DR3 M;  1XMO M;  1K3X A;  1IXZ A;  4NXM M;  3TWL A;  3DOA A;  2EA0 A;  3PVS A;  4QHS A;  1H6U A;  2DAK A;  1HT1 E;  4NRV A;  5ITY A;  3UMM A;  5BR8 M;  3E46 A;  5IWA M;  2EUC A;  3AV0 A;  3KXE C;  1JB0 F;  2F5O A;  3FUW A;  2LVP C;  5DNY A;  1C7Y A;  2UU9 M;  1HR0 M;  1EE8 A;  4Z6Y A;  1J09 A;  4X66 M;  1DGG A;  3J81 S;  2OO9 A;  2R62 A;  1MJG M;  1ZAE A;  2RGH A;  2QP9 X;  3I04 M;  3U6L A;  2XZF A;  4TUW A;  1GAB A;  4KLN A;  2CRU A;  2R4E A;  5EJC A;  5A2Q S;  5KPR A;  4JYA M;  4AZF A;  3J80 S;  5C1B A;  4IBG A;  1Z6T A;  1G71 A;  4QNR A;  5ITT A;  3UJN A;  2UXC M;  4IIW A;  1QAM A;  2D7E A;  3VKG A;  4LJ9 A;  4CIS A;  2DZO B;  4QHT A;  4GRI A;  1XB2 B;  2X49 A;  2H1R A;  2DAM A;  3GLH B;  1WGL A;  3SYK A;  3U6E A;  3DZD A;  3SBJ A;  4DV1 M;  2VF8 A;  3GQ4 A;  4DR2 M;  3D8B A;  2L4E A;  2O01 F;  3KVW A;  2DI0 A;  1DGB A;  2LXE A;  2G3Q A;  2KNZ A;  4L4U A;  4M9X A;  1C1K A;  2Z3X A;  4LG2 A;  1IXR C;  4F1I A;  1Q02 A;  3QWL A;  3K9P A;  3E9S A;  3JR5 A;  1PM5 A;  2HAK A;  4IBK A;  4JI8 M;  3L26 A;  3GRV A;  3D8L A;  2Q2E B;  4ITQ A;  4LFB M;  2R44 A;  1OFH A;  4AKI A;  5GKN A;  1PJI A;  1VG5 A;  1WR1 B;  4HLQ A;  5ITR A;  2YFQ A;  2LHC A;  3UGJ A;  2DXI A;  2UXB M;  1HQC A;  2JUJ A;  1RU3 A;  4GIT A;  1IY0 A;  1OJL A;  1XWI A;  2KRK A;  2HHH M;  4HEO A;  3LCU A;  2C9O A;  1QZE A;  4LFC M;  3T15 A;  3AJI B;  2UUC M;  2JXN A;  4DV3 M;  1XNR M;  1J5E M;  1R5L A;  2BNK A;  1IQP A;  3KOX E;  1HQY E;  3SAS A;  1GL6 A;  2CV2 A;  1MU5 A;  2C99 A;  5KQD A;  5FTM A;  1G8P A;  2L2D A;  4LJ5 A;  2KNA A;  3LVW A;  2FNA A;  1AIP C;  5DYI A;  4LZZ A;  4B7G A;  1W5S A;  3ZC7 B;  1JR3 A;  2L09 A;  2Y0Q A;  2DWL A;  3U5Z B;  3TQS A;  1SG9 A;  1HJP A;  4LRS A;  1IY1 A;  4JI6 M;  2R65 A;  3F92 A;  2M60 A;  1IN4 A;  2Z4S A;  2APL A;  2CV1 A;  1V33 A;  1WGN A;  1XMQ M;  5ITU A;  1NJF A;  4L16 A;  3J27 B;  3KS4 A;  3C9P A;  3RFW A;  2C98 A;  1NHW C;  2K47 A;  4LF4 M;  4LF5 M;  4LJ8 A;  2WZJ A;  4JI0 M;  4L15 A;  3GLI E;  2VDB B;  5EP4 A;  3Q8X A;  3FUU A;  3HU3 A;  4REZ A;  2Z4R A;  3HJS A;  1LV7 A;  1R2Z A;  2L7I A;  2QQ8 A;  1VDD A;  2EKK A;  2DWM A;  2DZN B;  3QYE A;  4FWG A;  4S12 A;  1R4G A;  5FTN A;  2DHR A;  4D80 A;  4JV5 M;  4DUY M;  5JI2 E;  2ZAO A;  4P17 A;  2CP8 A;  3SMS A;  1QQW A;  3NBI A;  2BJW A;  4NRW A;  2K9D A;  1JQJ C;  3GLH E;  3A45 A;  4LJA A;  3KFU G;  4LJ4 A;  1X37 A;  1R6B X;  1NV9 A;  3M0E A;  1GJT A;  3VDP A;  2JNH A;  3FUV A;  4B3M M;  4B3S M;  4G4R A;  3KDS E;  2GNO A;  4AW4 A;  4X65 M;  3THG A;  2KW0 A;  3W67 A;  4MGY E;  3FE3 A;  2LVO C;  4I4L A;  1QUS A;  1IFY A;  2WSE F;  4FCW A;  1G3I A;  2WSF F;  3FTF A;  3HZJ A;  4CGY B;  2QCU A;  1OQY A;  1TH3 A;  2CHQ A;  3SFZ A;  4G4O A;  2XZU A;  1PJQ A;  4I81 A;  3SAR A;  1QAN A;  4M0W A;  3W0F A;  3VK8 A;  3C3E A;  2DKL A;  1A5T A;  1NO1 A;  4KT0 F;  1IY2 A;  1L8Q A;  1GVN A;  4GKJ M;  4DR7 M;  1Q3B A;  1IXS B;  1VQ1 A;  3A98 B;  2C9C A;  1L2C A;  1PJT A;  2L4F A;  2H5X A;  1GKI A;  2QSF X;  3U6C A;  2OPF A;  4LCB A;  4CHT B;  2A5Y B;  2CFO A;  2MH8 A;  2XSZ A;  2GQF A;  3B89 A;  4R71 A;  2VII A;  1SXJ A;  5FTL A;  3U6Q A;  4GKK M;  2OOB A;  3J2P B;  4DR6 M;  3I4Y A;  3PXG A;  1DV0 A;  3MJ5 A;  3SAU A;  3PNV A;  3SAT A;  4FVM A;  4D82 A;  1HNX M;  1T6O A;  3RGS A;  3FKE A;  3GPP A;  2G8L A;  3KOY E;  2ZTD A;  1XXH B;  3V76 A;  4XBO A;  3T1Y M;  5EP3 A;  2KXE A;  3J7B A;  3CF6 E;  2XGN A;  4LJ6 A;  2CEA A;  4GH9 A;  1L1Z A;  2KRU A;  1DGH B;  3HHX A;  1OIZ A;  2ERC A;  2XFS A;  2MGW A;  4LRT A;  4XGI A;  2XEP A;  2KNV A;  3GRU A;  3L25 A;  3LCV B;  2QBY B;  4FWD A;  1YSY A;  5FTK A;  4IBD A;  4DR5 M;  1I94 M;  3GP1 A;  4M9Z A;  5IT9 S;  3C3D A;  3IEC A;  5L8R F;  2JZ1 A;  1K82 A;  2DAG A;  2LVN C;  2DZL A;  3HHY A;  4PCZ A;  3U60 B;  3U5Z A;  1ZQ9 A;  2J5Y A;  1NJG A;  3DFZ A;  4II7 A;  1SXJ B;  1VDL A;  3ZH9 B;  5KO3 A;  1N32 M;  4AKG A;  5H37 D;  2LVA A;  3HX3 A;  3RE8 A;  3IG8 A;  1QZM A;  3U61 A;  2KHH A;  3DA1 A;  4W5W A;  1T43 A;  5KPT A;  3VFD A;  1EIJ A;  2Y0T A;  4JXJ A;  2KZS A;  4YHH M;  3AL0 C;  1D0K A;  1D2N A;  4B08 A;  3FRH A;  4WP2 A;  4XK8 F;  2DAE A;  2KEB A;  3MMP A;  3I51 A;  3QAU A;  1L1T A;  2MJ5 B;  1WHC A;  5IZ7 D;  1IN6 A;  2HWJ A;  1QUT A;  3L27 A;  1P3Q Q;  3UK6 A;  3U6M A;  1VEG A;  2CHG A;  3LQQ A;  1QDT A;  1DO0 A;  2ZAM A;  4NOO B;  4P16 A;  2VQF M;  2YQZ A;  4EIW A;  2EO2 A;  1TDZ A;  4B3R M;  1Z59 A;  2W82 A;  3FYC A;  4LGM A;  4IBI A;  3U6O A;  1PJS A;  4DUZ M;  4WW0 A;  3WHL A;  2KA6 B;  2WSC F;  2MRO B;  4OU7 A;  3KP0 E;  5EXX A;  1NSF A;  3B9P A;  1NY6 A;  2M5Z A;  4JI2 M;  3AKZ A;  2DWN A;  2F5Q A;  2VQE M;  1Z5A A;  3MK6 A;  3GLG B;  4MGH A;  5IRE B;  1Q3C A;  2QHO B;  1GL7 A;  3L2A A;  2LBC A;  3HKP A;  4B7F A;  4B7H A;  1SXJ E;  4JI5 M;  2DVW B;  3FYD A;  3KW6 A;  3ZQJ A;  3UZU A;  3H4M A;  1TGU A;  5E6J A;  4L8R C;  3T1H M;  4NSR A;  2I7P A;  4IBF A;  2FOI C;  4D81 A;  4DV0 M;  4LF6 M;  2UUA M;  4LF9 M;  2CV0 A;  1PGY A;  1MX0 A;  3GO8 A;  4PD2 A;  1QYR A;  1VEK A;  3KS8 A;  4DV2 M;  2E5L M;  4JN6 A;  2JY8 A;  4MGZ E;  4FCV A;  3TWK A;  4A3V B;  1QVR A;  1EFU B;  4B3T M;  8CAT A;  5LMN M;  4LFA M;  1XNQ M;  3IHP A;  4OVZ B;  2OQ4 A;  3J7A S;  2X8A A;  3KP1 E;  5DFL A;  1SXJ C;  4GEW A;  5EP1 A;  5ITX A;  1GLN A;  3JAM S;  4M9S A;  2F5N A;  4L6V 6;  4DR4 M;  3I01 M;  3GPX A;  1DGF A;  1WXQ A;  3HU1 A;  3R8F A;  2J7N A;  3PNY A;  3TL4 X;  4CJ6 A;  4LF7 M;  1TH2 A;  3E4R A;  5KPZ A;  1IBM M;  1UM8 A;  5JI3 E;  1G41 A;  2DNA A;  2DWZ B;  4I8O A;  1NNU C;  1OFI A;  4DV7 M;  3U6D A;  2F5S A;  3R9X B;  4KHP M;  1NHG C;  3GLG E;  3FD9 A;  5FTJ A;  3ZCB B;  4RKU F;  2LH0 A;  2J7O A;  3W0L B;  3A42 A;  3GQ3 A;  1NNJ A;  3HWS A;  1NVM A;  4MM3 B;  1WJ7 A;  1IBK M;  2HL7 A;  2QPA A;  1IN7 A;  3K1J A;  1TDH A;  1OTR A;  4L78 A;  4GHL A;  3HGI A;  2XFT A;  1L2D A;  5FLX S;  4G4Q A;  3M7G A;  2C5R A;  2K0B X;  3W68 A;  1OAI A;  3T6P A;  1T3T A;  2LNH C;  4GMQ A;  1R7R A;  1MN3 A;  2XLJ A;  1KSF X;  3B7Q A;  3A46 A;  4Q7J A;  3SYL A;  3CTW B;  4FWH A;  4DV4 M;  1YE9 A;  3VK7 A;  4NSO B;  3GLG A;  1N36 M;  1PRB A;  5F3W A;  4HL4 A;  3GLI A;  3U61 B;  2O25 A;  4OX9 M;  3FTC A;  2EJS A;  2HCB A;  4IBC A;  4G6Z A;  3T38 A;  3FUT A;  2JY5 A;  1QAQ A;  2JP7 A;  4BB9 A;  4AG6 A;  7CAT A;  3HHZ A;  2CHV A;  4R7G A;  4ZPX A;  1HNW M;  1J7K A;  2R4J A;  2EKF A;  2Z7J A;  1LTM A;  1Q39 A;  3Q8G A;  1FNN A;  4X62 M;  3NBX X;  1IXS A; 
#chains in the Genus database with same CATH homology
 2YR0 A;  1I4W A;  4JI4 M;  2FFJ A;  3AOG A;  4LY6 A;  2Y21 A;  1IM2 A;  1IN8 A;  1HNZ M;  1L2B A;  5ITQ A;  4BLC A;  4RF1 A;  2L7H A;  4KOD A;  3M6A A;  3L29 A;  4JI7 M;  5ITX E;  2X4A A;  2V1C A;  3GRY A;  4QNM A;  2LWX A;  4JI1 M;  4PT5 A;  2O5R A;  2JA2 A;  2I7N A;  1IN5 A;  1HT2 E;  3K8Z A;  4IBJ A;  4X64 M;  1N34 M;  1JR3 D;  4WUR A;  5KQ8 A;  1DGH A;  5EXP A;  1SXJ D;  4IBE A;  3SC3 A;  1IBL M;  5BPV A;  4IJE A;  1W5T A;  3CF0 A;  3K92 A;  2L6O A;  2RGO A;  3FTD A;  3KSX A;  4NL4 H;  3WHK A;  3VDU A;  3VKH A;  2R45 A;  3CF2 A;  4M0D A;  4DV5 M;  3U60 A;  3I4V A;  1XC8 A;  1PJJ A;  1XHB A;  3KOZ E;  3HU2 A;  4FD2 A;  3AFH A;  3FUX A;  4MH0 E;  3K2L A;  4LJ7 A;  5EXT A;  4AI6 A;  3GLI B;  1DO2 A;  3EIH A;  1KYI A;  4JI3 M;  5EQT A;  3GPU A;  2P5T A;  1S3S A;  1G4A E;  3HHW A;  4QOS A;  2G5G X;  4FCT A;  1E94 E;  3AOE A;  2XF3 A;  2ZM6 M;  1QAO A;  4MGK E;  3VLF B;  3GQ5 A;  2R18 A;  3L28 A;  4KO8 A;  4Z8X A;  2V6Z M;  3SHG B;  2NQ8 C;  3HJQ A;  1Z5C A;  3RGP A;  3KOW E;  3KSJ A;  4PDI A;  1YUB A;  2QEN A;  2HKJ A;  2D7G A;  4PDG A;  2F4V M;  1N33 M;  2RKO A;  2D7H A;  2YNM D;  5LMU M;  1E32 A;  4K0K M;  2CUZ A;  4RNA A;  1N78 A;  4GC5 A;  3EIE A;  5DYG A;  3ILK A;  4LGY A;  4NXN M;  3SHF A;  1Z5B A;  3GLF A;  1R2Y A;  1FJG M;  4GIP A;  3MHV C;  4DV6 M;  2F5P A;  3U6P A;  4AKH A;  2CE7 A;  2BJV A;  3GLH A;  5E26 A;  3TWM A;  4GHA A;  4FW9 A;  3SMP A;  1TH4 A;  3SAW A;  2FE8 A;  1KFV A;  4GC9 A;  3TE6 A;  3NWL A;  3HJ8 A;  2KZU A;  5FSW A;  3LMM A;  1N75 A;  4OVZ A;  2QZ4 A;  2C96 A;  4MB7 A;  3SAV A;  5C18 A;  4YY3 M;  4MGI E;  2XSZ D;  3TPZ A;  3AOE C;  2AHM A;  2Y20 A;  3GPY A;  4R3D A;  4DR1 M;  3FTE A;  3LVV A;  2ZAN A;  2V1U A;  4LZJ A;  1G59 A;  1NY5 A;  2ZBK B;  1K3W A;  1XXH A;  4BBA A;  4LF8 M;  5EP2 A;  4QOZ C;  2UXD M;  4G4N A;  3BOS A;  3GLF B;  3C58 A;  4RF0 A;  3PFI A;  2R46 A;  1ORY B;  1N77 A;  3IG5 A;  1E9S A;  4AQY M;  5EXS A;  3GRR A;  4IBB A;  3JR4 A;  4IJF A;  1E9R A;  4OW0 A;  2QBY A;  2UUB M;  2XH9 A;  4I5S A;  4AG5 A;  3OTO M;  3U6S A;  1XMO M;  4DR3 M;  1K3X A;  1IXZ A;  4NXM M;  3TWL A;  3DOA A;  2EA0 A;  3PVS A;  4QHS A;  1H6U A;  1HT1 E;  4NRV A;  5ITY A;  3UMM A;  5BR8 M;  5IWA M;  2EUC A;  3AV0 A;  3KXE C;  2F5O A;  3FUW A;  5DNY A;  2UU9 M;  1HR0 M;  1EE8 A;  4Z6Y A;  1J09 A;  4X66 M;  1DGG A;  3J81 S;  2R62 A;  2XZF A;  1ZAE A;  2RGH A;  2QP9 X;  3U6L A;  4TUW A;  4KLN A;  2R4E A;  5EJC A;  5A2Q S;  5KPR A;  4JYA M;  4AZF A;  3J80 S;  5C1B A;  4IBG A;  1Z6T A;  5ITT A;  4QNR A;  3UJN A;  2UXC M;  4IIW A;  1QAM A;  2D7E A;  3VKG A;  4LJ9 A;  4CIS A;  2DZO B;  4QHT A;  4GRI A;  2X49 A;  3GLH B;  2H1R A;  3U6E A;  3SYK A;  3DZD A;  3SBJ A;  4DV1 M;  3GQ4 A;  4DR2 M;  3D8B A;  3KVW A;  1DGB A;  2LXE A;  4M9X A;  4L4U A;  1C1K A;  2Z3X A;  4LG2 A;  1IXR C;  3QWL A;  3E9S A;  3JR5 A;  1PM5 A;  4IBK A;  4JI8 M;  3L26 A;  3GRV A;  3D8L A;  2Q2E B;  4ITQ A;  4LFB M;  1OFH A;  4AKI A;  5GKN A;  1PJI A;  4HLQ A;  5ITR A;  2YFQ A;  3UGJ A;  2UXB M;  2DXI A;  1HQC A;  4GIT A;  1IY0 A;  1OJL A;  1XWI A;  2KRK A;  2HHH M;  2C9O A;  4LFC M;  3T15 A;  3AJI B;  2UUC M;  4DV3 M;  1XNR M;  1J5E M;  2BNK A;  1IQP A;  3KOX E;  1HQY E;  3SAS A;  1GL6 A;  2CV2 A;  1MU5 A;  2C99 A;  5KQD A;  5FTM A;  1G8P A;  4LJ5 A;  3LVW A;  2FNA A;  5DYI A;  4LZZ A;  4B7G A;  1W5S A;  3ZC7 B;  1JR3 A;  2L09 A;  2Y0Q A;  2DWL A;  3U5Z B;  3TQS A;  4LRS A;  4JI6 M;  1IY1 A;  2R65 A;  2M60 A;  1IN4 A;  2Z4S A;  2CV1 A;  1XMQ M;  5ITU A;  1NJF A;  4L16 A;  3J27 B;  3KS4 A;  3RFW A;  2C98 A;  1NHW C;  2K47 A;  4LF4 M;  4LF5 M;  4LJ8 A;  4JI0 M;  4L15 A;  5EP4 A;  3Q8X A;  3FUU A;  3HU3 A;  4REZ A;  2Z4R A;  3HJS A;  1LV7 A;  1R2Z A;  2L7I A;  1VDD A;  2DWM A;  2DZN B;  4FWG A;  4S12 A;  5FTN A;  2DHR A;  4D80 A;  4JV5 M;  4DUY M;  5JI2 E;  2ZAO A;  3SMS A;  1QQW A;  3NBI A;  2BJW A;  4NRW A;  3KFU G;  1JQJ C;  4LJA A;  3A45 A;  4LJ4 A;  1X37 A;  1R6B X;  3M0E A;  3VDP A;  3FUV A;  4B3M M;  4B3S M;  4G4R A;  3KDS E;  4AW4 A;  4X65 M;  3THG A;  2KW0 A;  4MGY E;  4I4L A;  4FCW A;  1G3I A;  3FTF A;  4CGY B;  2QCU A;  1TH3 A;  2CHQ A;  3SFZ A;  4G4O A;  2XZU A;  4I81 A;  3SAR A;  1QAN A;  4M0W A;  3W0F A;  3VK8 A;  1IY2 A;  1L8Q A;  1GVN A;  4GKJ M;  4DR7 M;  1Q3B A;  1IXS B;  3A98 B;  2C9C A;  1L2C A;  1GKI A;  3U6C A;  2OPF A;  4LCB A;  4CHT B;  2A5Y B;  2CFO A;  2XSZ A;  5FTL A;  2VII A;  1SXJ A;  3U6Q A;  4GKK M;  3J2P B;  4DR6 M;  3I4Y A;  3PXG A;  3MJ5 A;  3SAU A;  3PNV A;  3SAT A;  4FVM A;  4D82 A;  1HNX M;  3RGS A;  3GPP A;  3FKE A;  2G8L A;  3KOY E;  1XXH B;  4XBO A;  3T1Y M;  5EP3 A;  2KXE A;  3J7B A;  3CF6 E;  2XGN A;  4LJ6 A;  2CEA A;  4GH9 A;  1L1Z A;  2KRU A;  1DGH B;  3HHX A;  2ERC A;  2XFS A;  4LRT A;  4XGI A;  2XEP A;  3GRU A;  3L25 A;  2QBY B;  4FWD A;  1YSY A;  5FTK A;  4IBD A;  4DR5 M;  1I94 M;  3GP1 A;  4M9Z A;  5IT9 S;  1K82 A;  4PCZ A;  3HHY A;  3U60 B;  3U5Z A;  1ZQ9 A;  5KO3 A;  1NJG A;  3DFZ A;  4II7 A;  1SXJ B;  3ZH9 B;  1N32 M;  4AKG A;  5H37 D;  3RE8 A;  3IG8 A;  1QZM A;  3U61 A;  3DA1 A;  4W5W A;  5KPT A;  3VFD A;  2Y0T A;  4JXJ A;  2KZS A;  4YHH M;  3AL0 C;  4B08 A;  1D2N A;  3QAU A;  2KEB A;  3I51 A;  1L1T A;  5IZ7 D;  1IN6 A;  3L27 A;  3UK6 A;  3U6M A;  2CHG A;  3LQQ A;  1DO0 A;  2ZAM A;  4NOO B;  4P16 A;  2VQF M;  2YQZ A;  4EIW A;  2EO2 A;  1TDZ A;  4B3R M;  1Z59 A;  2W82 A;  3FYC A;  4LGM A;  4IBI A;  3U6O A;  4DUZ M;  4WW0 A;  3WHL A;  2KA6 B;  4OU7 A;  3KP0 E;  5EXX A;  1NSF A;  3B9P A;  1NY6 A;  2M5Z A;  4JI2 M;  3AKZ A;  2DWN A;  2F5Q A;  2VQE M;  1Z5A A;  3MK6 A;  3GLG B;  4MGH A;  5IRE B;  1Q3C A;  1GL7 A;  3L2A A;  3HKP A;  4B7F A;  4B7H A;  1SXJ E;  4JI5 M;  2DVW B;  3FYD A;  3KW6 A;  3UZU A;  3H4M A;  1TGU A;  5E6J A;  4L8R C;  3T1H M;  4NSR A;  2I7P A;  4IBF A;  2FOI C;  4D81 A;  4DV0 M;  4LF6 M;  2UUA M;  4LF9 M;  2CV0 A;  1MX0 A;  3GO8 A;  4PD2 A;  1QYR A;  3KS8 A;  4DV2 M;  2E5L M;  4JN6 A;  4MGZ E;  4FCV A;  3TWK A;  4A3V B;  1QVR A;  4B3T M;  8CAT A;  5LMN M;  4LFA M;  1XNQ M;  4OVZ B;  2OQ4 A;  3J7A S;  2X8A A;  3KP1 E;  5EP1 A;  1SXJ C;  5ITX A;  1GLN A;  3JAM S;  4M9S A;  2F5N A;  4DR4 M;  3GPX A;  1DGF A;  1WXQ A;  3HU1 A;  3R8F A;  2J7N A;  3PNY A;  3TL4 X;  4LF7 M;  1TH2 A;  3E4R A;  5KPZ A;  1IBM M;  1UM8 A;  5JI3 E;  1G41 A;  2DWZ B;  4I8O A;  1NNU C;  1OFI A;  4DV7 M;  3U6D A;  2F5S A;  3R9X B;  4KHP M;  1NHG C;  3FD9 A;  5FTJ A;  3ZCB B;  2LH0 A;  2J7O A;  3W0L B;  3A42 A;  3GQ3 A;  1NNJ A;  3HWS A;  1NVM A;  4MM3 B;  1IBK M;  2HL7 A;  2QPA A;  1IN7 A;  3K1J A;  1TDH A;  4L78 A;  4GHL A;  3HGI A;  2XFT A;  1L2D A;  5FLX S;  4G4Q A;  3M7G A;  2C5R A;  1T3T A;  2LNH C;  4GMQ A;  1R7R A;  2XLJ A;  1KSF X;  3A46 A;  3SYL A;  3CTW B;  4FWH A;  4DV4 M;  1YE9 A;  3VK7 A;  4NSO B;  3GLG A;  1N36 M;  5F3W A;  4HL4 A;  3GLI A;  3U61 B;  4OX9 M;  3FTC A;  2HCB A;  4IBC A;  4G6Z A;  3T38 A;  3FUT A;  1QAQ A;  4BB9 A;  4AG6 A;  7CAT A;  3HHZ A;  2CHV A;  4R7G A;  4ZPX A;  1HNW M;  1J7K A;  2R4J A;  2Z7J A;  4X62 M;  1Q39 A;  1FNN A;  3LQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...