1Q3BA

Crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli: the r252a mutant at 2.05 resolution.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
262
structure length
259
Chain Sequence
PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQVDENKHHGALFRFKVFHRDGEPCERCGSIIEKTTLPFYWCPGCQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the uncomplexed DNA repair enzyme endonuclease VIII indicates significant interdomain flexibility.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Endonuclease VIII
total genus 76
structure length 259
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1q3bA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 1q3bA01
4JI4M 1Z5AA 1N33M 1L2CA 4JI8M 2HHHM 3GQ3A 2OQ4A 4PCZA 1Z5CA 4B3MM 2ZM6M 4PDGA 2F5QA 1XNRM 4JI5M 4MB7A 2XZUA 3A42A 4OX9M 1Z5BA 4NRWA 4LF6M 4DR6M 1EE8A 5ITQA 1J5EM 4PD2A 5LMNM 3SBJA 3J81S 4JI7M 3A46A 1HNXM 3SARA 5ITXA 1KFVA 5ITRA 4PDIA 1TDZA 3C58A 4LFAM 3JR5A 4DR5M 4G4NA 5LMUM 3GPXA 3U6EA 3U6QA 2UUAM 2HKJA 2UUCM 4DUYM 1MX0A 3W0FA 2VQFM 4JI6M 4X65M 3GPUA 4LF4M 1XNQM 4B3RM 1HNZM 4GKJM 3T1YM 3GQ5A 5ITUA 1L1TA 4JI3M 4DR4M 4JYAM 3SATA 4DV2M 2VQEM 4DV1M 1XMQM 3TWMA 4CISA 1MU5A 3JAMS 1HR0M 1IBLM 4DR2M 4NXNM 5BR8M 4LF7M 3DOAA 1Z59A 3T1HM 4X62M 3VK8A 1R2ZA 1K82A 4DR7M 2UUBM 2EA0A 4K0KM 2UXBM 3GQ4A 5IT9S 3GPYA 5ITYA 3U6DA 3OTOM 3U6LA 3A45A 4B3SM 1XC8A 3GP1A 5ITTA 3GO8A 1K3XA 5FLXS 1L2DA 4JI2M 1N32M 1K3WA 1Q39A 5A2QS 2E5LM 3TWLA 3U6OA 3U6CA 2UU9M 4LFCM 1L2BA 4G4QA 4DV3M 2F5SA 4JI0M 4KHPM 4LF5M 2F4VM 3U6PA 1HNWM 5IWAM 4NXMM 4DV0M 1I94M 1Q3CA 1PM5A 1XMOM 4DV5M 3U6SA 1PJIA 2F5NA 4DR1M 2UXDM 4AQYM 4LF9M 3SASA 4DV4M 1IBKM 2XZFA 4B3TM 3TWKA 2Q2EB 1Q3BA 4JI1M 3GPPA 4YHHM 2UXCM 4GKKM 4JV5M 4YY3M 1N36M 2OPFA 3VK7A 1R2YA 1L1ZA 4DV7M 1N34M 4G4RA 1TDHA 2F5PA 2ZBKB 4LF8M 3SAVA 3SAUA 1IBMM 4G4OA 3SAWA 3U6MA 4LFBM 1NNJA 5ITXE 4NRVA 4X66M 4X64M 2F5OA 4ITQA 3J7AS 1FJGM 4DV6M 3JR4A 4DUZM 1PJJA 4DR3M 3J80S
chains in the Genus database with same CATH superfamily
4EIWA 3MHVC 3MMPA 4HLQA 2XFTA 5FTLA 1L2CA 2DWZB 4L15A 1GKIA 3AOEC 3GQ3A 4PCZA 2R45A 5DFLA 2ZM6M 4F1IA 3B7NA 4OW0A 2DAIA 5EP4A 3A42A 3M6AA 2XZUA 1GJTA 4CHTB 4NRWA 1EE8A 3CF6E 5ITQA 1MN3A 1TGUA 4OVZB 1V34A 4PD2A 4KLNA 1ZAEA 2L7HA 3VLFB 3E4RA 3KXEC 3I01M 4HL4A 2M60A 4KO8A 7CATA 2LVPC 3FD9A 2XSZA 4JI7M 4IIWA 1IXRC 3U5ZB 4FVMA 3K2LA 1GO5A 3HX3A 4ANRA 4D82A 1V92A 2D7GA 1UM8A 2KDLA 4LFAM 3JR5A 1OFHA 4Z6YA 2XEPA 4L8RC 1MX0A 3T38A 2VQFM 4JI6M 2RKOA 4X65M 2J7OA 4B3RM 2C5RA 2L2DA 1WGNA 3GLHA 2KZSA 3KOZE 3CTWB 3KS4A 3BBZA 4JI3M 5FTMA 1IN5A 3HWSA 2C9CA 3GRYA 1J09A 1E9SA 2VQEM 3HZJA 1XMQM 2DWMA 3TWMA 4QNMA 1MU5A 1HR0M 2CWBA 1JR3A 4LF7M 1NVMA 3B7ZA 2EO2A 2NQ8C 2VIIA 1Z59A 5C1BA 4R3DA 4X62M 3VK8A 4NSOB 2Z3XA 2QBYA 1QYRA 4AG6A 3HY5A 3WHLA 2KNZA 2EA0A 3U60A 3TL4X 2JWSA 3GPYA 5IZ7D 1QUTA 3GLIE 1ZMWA 5FTJA 3THGA 2ZAMA 4LJ4A 1DO0A 1JR3E 2KZUA 4RF1A 3PXGA 2KXEA 3J2PB 2CV1A 1QQWA 3H4MA 5EXPA 4LJ6A 1ZV1A 2L4EA 4AI6A 2R4EA 2VF7A 1NJGA 1ZMUA 3B9PA 1K3XA 1L2DA 2BWEA 2G3QA 2O01F 4MGYE 2EKFA 3IHPA 1YE9A 2CE7A 3FYCA 4G4QA 3RFWA 1BVSA 1D2NA 2F4VM 2X8AA 3LW5F 1PJTA 5IWAM 4NOOB 3TE6A 3U5ZA 3CF2A 4QHSA 2DI0A 4GH9A 1Q3CA 2DHRA 4CJ6A 3SMPA 1QDRA 1XMOM 4GRIA 3VDUA 3HGIA 1XWIA 3LMMA 1AUAA 5EXSA 5EP2A 4BBAA 4DR1M 4XGIA 4M0DA 1IXSA 5KO3A 3FUXA 3Q8GA 1SG9A 2RRUA 3D8LA 3TWKA 2KNAA 2D7HA 1QANA 1VEGA 2YQZA 2DKLA 4RF0A 4JV5M 3AFHA 1N36M 3C3DA 2HCBA 1R2YA 2CHVA 2LVOC 3GRUA 5F3WA 3LVWA 1UFZA 4L4UA 4M9ZA 3ZH9B 2CRUA 1TH2A 2DWNA 2GNOA 3E21A 3KW6A 5IREB 4B7GA 1Y8GA 4F2LA 5ITXE 4X66M 3B7QA 2F5OA 2FH0A 3KVWA 3GLFE 3DZDA 3KOXE 2N35A 4IJFA 1IN4A 2OOBA 3E9SA 2A5YB 3U60B 1PJJA 1WXQA 3QYBA 3J80S 3J7BA 5DNYA 4I4LA 4JI4M 1N33M 4JXJA 1QAQA 3GLHE 2OQ4A 3HU1A 3W0LB 1Z5CA 3HHZA 2ZTCA 1DGHA 1LV7A 1YUBA 2QNJA 3Q8XA 4PDGA 2R65A 2F5QA 2V1UA 2QSFX 3HJ8A 2XLJA 2WSFF 3HHXA 3KS8A 2DZOB 2QHOB 3MK6A 4MGHA 3NWLA 2B3TA 3LQRA 4LJ5A 1HJPA 2V1CA 3A46A 5KPTA 3EIEA 3IG8A 5C18A 4IBCA 1NJFA 2CUZA 2ZANA 3B74A 1KFVA 3KOYE 3SARA 2CEAA 2X4AA 1LTMA 1G71A 1TH3A 1R7RA 3HHYA 3V76A 3GPXA 4G4NA 3U6EA 2UUCM 4LRSA 3DA1A 1OKSA 4LF4M 3GLFA 4IBBA 2L4FA 4QNRA 1HNZM 2YFQA 2XFSA 3T1YM 3GRRA 2K0BX 3GQ5A 1IN8A 3WHKA 1NSFA 2LHGA 4Z8XA 2QPAA 3HU3A 2WSCF 4DR4M 3D8BA 4AG5A 3L26A 1AIPC 3SATA 4DV1M 3HJQA 1Z6TA 3SHFA 1T43A 4RKUF 3AOEA 2DHYA 4DR2M 2C99A 2G8LA 3MJ5A 4IBFA 4P16A 3TQSA 4AW4A 3DOAA 1W5SA 1D0MA 3UGJA 3SYKA 2LXEA 4DR7M 1K82A 1NHWC 2XH9A 3I4YA 2C98A 4K0KM 3GQ4A 2WSEF 3LVVA 3HJSA 4MGZE 3ILKA 4MGKE 3U6DA 2KEBA 5L8RF 1MJGM 1GLNA 1XXHE 1QZEA 3C9PA 2I7NA 3GP1A 3GO8A 3UJNA 2QENA 1TH4A 2JY8A 4XBOA 1K3WA 5DYGA 2Z4SA 1N32M 4Q7JA 1C1KA 5A2QS 5E26A 4BLCA 2FOIC 3FRIA 1N78A 2H5XA 3U6CA 3PNYA 3PFIA 1SXJA 2F5SA 4LG2A 3U6PA 1HNWM 3LCVB 4B7FA 2R46A 3K92A 4FD2A 3AJIB 2LVAA 4DV5M 2MJ5B 2QCUA 1JB0F 2UXDM 4AQYM 3SASA 2Z4RA 5JI3E 2XSZD 1NY5A 2XZFA 2DXIA 4B3TM 1SXJC 3SMSA 2BNKA 2JUJA 2BJWA 1WIVA 2L6OA 4QOZC 2LNHC 4FCWA 3AV0A 4GKKM 1TF0B 4GEWA 2CV0A 2I7PA 2LBCA 1A5TA 1ZMVA 2RGHA 5EXXA 3VK7A 1L1ZA 2JP7A 1TDHA 4LJ7A 2DWLA 3K9OA 3SAVA 2JZ1A 3E46A 3FTEA 3SAUA 1PRBA 4I81A 1WJ7A 1QAMA 1PGYA 4IBEA 1IY2A 1IM2A 2ERCA 3HHWA 2JY7A 2OOAA 4ITQA 2YR0A 1IN7A 4IBJA 1G41A 1RU3A 3U61B 3F92A 3U61A 4LRTA 4DR3M 1XB2B 3KP1E 2J7NA 1Z5AA 2LHCA 4JI8M 3T15A 5BPVA 1XNRM 3CGWA 4LY6A 4P17A 2H1RA 2Z8YM 2QZ4A 4LZJA 3SFZA 4D81A 4NSRA 4JI5M 4DBGB 4OU7A 1Z5BA 4BB9A 1GL7A 3SC3A 5KPZA 4LF6M 4NL4H 1SXJE 2K9DA 1X37A 3GLGE 2RGOA 3SBJA 3IG5A 3C3EA 2KNVA 4ZPXA 2OO9A 4G3OA 1DV0A 3J81S 1J7KA 2J5YA 4GC9A 1OFIA 1N77A 3FTCA 5ITXA 5ITRA 2QQ8A 1YLAA 4PDIA 2C9OA 3W67A 3C58A 4WURA 1G3IA 4AKIA 2WZJA 3U6QA 4NC6A 4REZA 3KSXA 4DUYM 3W0FA 1G4AE 3L27A 3GPUA 1SXJB 4R71A 3GLIB 3AKZA 4GITA 4CIZA 4GKJM 4KODA 2CHQA 1WHCA 1L1TA 1R6BX 2DNAA 4IBKA 3M7GA 1HQYE 2EJSA 3PVSA 3TPZA 4AKGA 2Y0TA 1FNNA 1VDDA 4CISA 3VDPA 2K6BA 4FWDA 1VEJA 2X49A 2CV2A 1IBLM 1GVNA 2Y21A 4IJEA 4LGYA 2JY5A 5EJCA 3LCUA 1R2ZA 2UUBM 4CGYB 5JI2E 4TUWA 2UXBM 4IBIA 5IT9S 1IN6A 2DAGA 2FNAA 4GIPA 1EFUB 1NV8A 3RGSA 3GLIA 3UZUA 3AOGA 2LH0A 2FE8A 4B3SM 2R44A 2Z7JA 2O25A 1XC8A 1IXZA 1G8PA 3K8ZA 1GJSA 2QP9X 1GABA 3B89A 4LZZA 1VEKA 2MROB 1D0KA 4L16A 3KOWE 2VF8A 2M5ZA 1Q39A 3HKPA 2DAEA 1JQJC 3J27B 2HWJA 4KHPM 4LF5M 3NBIA 3GRVA 2LWXA 2R0IA 5E6JA 2Y20A 4FW9A 1NV9A 1GL6A 3I4VA 4JN6A 2XF3A 1OIZA 4I5SA 4L78A 1KSFX 4GMQA 4LJ8A 5EP1A 2BWBA 1KYIA 4MH0E 4LF9M 2R62A 1I4WA 3FUUA 1IBKM 1L8QA 4G6ZA 2Q2EB 2C96A 2KW0A 1IFYA 1OQYA 4JI1M 3GPPA 1NHGC 4YHHM 2HL7A 1OTRA 2DZNB 3AL0C 1VG5A 4A3VB 1E32A 4YY3M 3SHGB 4IBGA 4IBDA 1D0LA 3FTDA 2OPFA 4G4RA 3KP0E 2F5PA 2ZBKB 4LJAA 3L2AA 2AHMA 3L28A 1IBMM 2P5TA 3SAWA 4QHTA 3U6MA 1DGHB 8CATA 4XK8F 1NNJA 1HT1E 4M9XA 3BOSA 4QOSA 3ZQJA 4FCVA 2BJVA 2JZ0A 3M0EA 1FJGM 4DV6M 1W5TA 2DZLA 3QWLA 2D7EA 3QYEA 1ZQ9A 3EIHA 5DYIA 2L7IA 2EUCA 4I8OA 5KQ8A 2R18A 3T6PA 2JNHA 2W82A 3K9PA 2HHHM 4B3MM 1QDTA 1V33A 4PT5A 1NO1A 3FKEA 4MB7A 3FUWA 4B7HA 1WGLA 1IY0A 4UN2B 2R6FA 1DO2A 4OX9M 4DR6M 1QZMA 1J5EM 2XGNA 5LMNM 1HT2E 4S12A 2CHGA 2V6ZM 1DGFA 2L09A 3CF0A 1OIPA 1HNXM 2MH8A 3I04M 5EQTA 3RGPA 4LCBA 1TDZA 2R4JA 1N75A 4AKHA 1CUKA 4DR5M 4FWGA 2O5RA 2VDBB 5LMUM 2UUAM 2HKJA 1DGGA 2KA6B 4FWHA 3VFDA 1XNQM 3I51A 2KRKA 1IQPA 5ITUA 4WW0A 4AZFA 2KHHA 4JYAM 1QUSA 4DV2M 3VKHA 1IY1A 1T6OA 1PJSA 3K1JA 4GC5A 1TTEA 1IXSB 3JAMS 3L25A 1Q02A 4NXNM 3LQQA 4KT0F 4D80A 1E94E 2DENA 5BR8M 3KDSE 1H6UA 1HQCA 2JXNA 3T1HM 2K47A 3FE3A 4M9SA 4R7GA 3L29A 4MGIE 2LTUA 1R4GA 2HAKA 3FUVA 1WR1B 4M0WA 5EXTA 3ZC7B 5FSWA 5H37D 3UMMA 2LVQD 5ITYA 1OAOC 3R9XB 2DAKA 4HEOA 3OTOM 1T3TA 3U6LA 3A45A 1XXHA 2Y0QA 3RE8A 4Y28F 1XHBA 4FCTA 5ITTA 3A98B 1E9RA 1QAOA 1VDLA 5KQDA 5FLXS 4JI2M 3SYLA 2KRUA 2MR9A 3NBXX 2YNMD 3FRHA 2E5LM 3GLFB 2DVWB 3TWLA 3U6OA 2DAMA 2UU9M 1C7YA 4LFCM 1L2BA 2MGWA 1NY6A 3IECA 4DV3M 4JI0M 2LVNC 1OJLA 4GHLA 4W5WA 2JY6B 4NXMM 4DV0M 2FS1A 2CP8A 1ORYB 1I94M 2QBYB 1EIJA 5FTNA 4LJ9A 3VKGA 4B08A 3DFZA 1PM5A 1F4IA 2ZTDA 3U6SA 3KSJA 4RNAA 1PJIA 2CFOA 2F5NA 1S3SA 3ZCBB 3FUTA 4DV4M 1SXJD 4GHAA 4II7A 1JR3D 5GKNA 1XXHB 2EKKA 1Q3BA 1YSYA 3FTFA 4LGMA 2UXCM 1G59A 3GLGA 1DGBA 3GLGB 1PJQA 3UK6A 4DV7M 3QAUA 4OVZA 1N34M 3BXWA 2GQFA 4L6V6 1P3QQ 4LF8M 4MM3B 3KFUG 1QVRA 3W68A 4G4OA 3R8FA 3H4JA 2FFJA 3GLHB 4LFBM 1OAIA 3FYDA 5EP3A 2ZAOA 2JA2A 3HU2A 2APLA 4NRVA 3PNVA 1NNUC 4X64M 3J7AS 1TR8A 3JR4A 4WP2A 1VQ1A 5KPRA 4DUZM 5FTKA 2G5GX 1R5LA
chains in the Genus database with same CATH topology
4EIWA 3MHVC 4HLQA 2XFTA 5FTLA 1L2CA 2DWZB 4L15A 1GKIA 3AOEC 3GQ3A 4PCZA 2R45A 2ZM6M 4OW0A 5EP4A 2XZUA 3A42A 3M6AA 4CHTB 4NRWA 1EE8A 3CF6E 5ITQA 1TGUA 4OVZB 4PD2A 4KLNA 1ZAEA 2L7HA 3VLFB 3E4RA 3KXEC 4HL4A 2M60A 4KO8A 7CATA 3FD9A 2XSZA 4JI7M 4IIWA 1IXRC 3U5ZB 4FVMA 3K2LA 4D82A 2D7GA 1UM8A 4LFAM 3JR5A 1OFHA 4Z6YA 2XEPA 4L8RC 1MX0A 3T38A 2VQFM 4JI6M 2RKOA 4X65M 2J7OA 4B3RM 2C5RA 3GLHA 2KZSA 3KOZE 3CTWB 3KS4A 4JI3M 5FTMA 1IN5A 3HWSA 2C9CA 3GRYA 1J09A 1E9SA 2VQEM 1XMQM 2DWMA 3TWMA 4QNMA 1MU5A 1HR0M 1JR3A 4LF7M 1NVMA 2EO2A 2NQ8C 2VIIA 1Z59A 5C1BA 4R3DA 4X62M 3VK8A 4NSOB 2Z3XA 2QBYA 1QYRA 4AG6A 3WHLA 2EA0A 3U60A 3TL4X 3GPYA 5IZ7D 5FTJA 3THGA 2ZAMA 4LJ4A 1DO0A 2KZUA 4RF1A 3PXGA 2KXEA 3J2PB 2CV1A 1QQWA 3H4MA 5EXPA 4LJ6A 4AI6A 2R4EA 1K3XA 1NJGA 3B9PA 1L2DA 4MGYE 1YE9A 2CE7A 3FYCA 4G4QA 3RFWA 2F4VM 1D2NA 2X8AA 5IWAM 4NOOB 3TE6A 3U5ZA 3CF2A 4QHSA 4GH9A 1Q3CA 2DHRA 3SMPA 1XMOM 4GRIA 3VDUA 3HGIA 1XWIA 3LMMA 5EXSA 4BBAA 5EP2A 4DR1M 4XGIA 4M0DA 5KO3A 3FUXA 3D8LA 3TWKA 2D7HA 1QANA 2YQZA 4RF0A 4JV5M 3AFHA 1N36M 2HCBA 1R2YA 2CHVA 3GRUA 5F3WA 3LVWA 4L4UA 4M9ZA 3ZH9B 1TH2A 2DWNA 3KW6A 5IREB 5ITXE 4B7GA 4X66M 2F5OA 3KVWA 3DZDA 3KOXE 4IJFA 1IN4A 3E9SA 2A5YB 3U60B 1PJJA 1WXQA 3J80S 3J7BA 5DNYA 4I4LA 4JI4M 1N33M 4JXJA 1QAQA 2OQ4A 3HU1A 3W0LB 1Z5CA 3HHZA 4PDGA 1DGHA 1LV7A 1YUBA 2F5QA 3Q8XA 2R65A 2V1UA 3HJ8A 2XLJA 3HHXA 3KS8A 2DZOB 3MK6A 4MGHA 3NWLA 3LQRA 4LJ5A 2V1CA 3A46A 5KPTA 3EIEA 3IG8A 5C18A 4IBCA 1NJFA 2CUZA 2ZANA 1KFVA 3SARA 3KOYE 2CEAA 2X4AA 1TH3A 1R7RA 3HHYA 4G4NA 3GPXA 3U6EA 2UUCM 4LRSA 3DA1A 4LF4M 3GLFA 4IBBA 4QNRA 1HNZM 2YFQA 2XFSA 3T1YM 3GRRA 3GQ5A 1IN8A 3WHKA 1NSFA 4Z8XA 2QPAA 3HU3A 4DR4M 3D8BA 4AG5A 3L26A 3SATA 4DV1M 3HJQA 1Z6TA 3SHFA 3AOEA 4DR2M 2C99A 2G8LA 3MJ5A 4IBFA 4P16A 3TQSA 4AW4A 3DOAA 1W5SA 3UGJA 3SYKA 2LXEA 4DR7M 1K82A 1NHWC 2XH9A 3I4YA 2C98A 4K0KM 3GQ4A 3LVVA 4MGZE 3HJSA 3U6DA 3ILKA 4MGKE 2KEBA 1GLNA 2I7NA 3GP1A 3GO8A 3UJNA 2QENA 1TH4A 1N32M 4XBOA 1K3WA 5DYGA 2Z4SA 1C1KA 5A2QS 5E26A 4BLCA 2FOIC 1N78A 3U6CA 3PNYA 3PFIA 1SXJA 2F5SA 4LG2A 3U6PA 1HNWM 4B7FA 2R46A 3K92A 4FD2A 3AJIB 4DV5M 2QCUA 2UXDM 4AQYM 3SASA 2Z4RA 5JI3E 2XSZD 1NY5A 2XZFA 2DXIA 4B3TM 1SXJC 3SMSA 2BNKA 2BJWA 2L6OA 4QOZC 2LNHC 4FCWA 3AV0A 4GKKM 2CV0A 2I7PA 3VK7A 2RGHA 5EXXA 1L1ZA 1TDHA 4LJ7A 2DWLA 3SAVA 3FTEA 3SAUA 4I81A 1QAMA 4IBEA 1IY2A 1IM2A 2ERCA 3HHWA 4ITQA 2YR0A 1IN7A 4IBJA 1G41A 3U61B 3U61A 4LRTA 4DR3M 3KP1E 2J7NA 1Z5AA 4JI8M 3T15A 5BPVA 1XNRM 4AKGA 4LY6A 2H1RA 4LZJA 2QZ4A 3SFZA 4D81A 4JI5M 4NSRA 4OU7A 1Z5BA 4BB9A 1GL7A 3SC3A 5KPZA 4LF6M 4NL4H 1SXJE 1X37A 2RGOA 3SBJA 3IG5A 4ZPXA 3J81S 1J7KA 4GC9A 1OFIA 1N77A 3FTCA 5ITXA 5ITRA 4PDIA 2C9OA 3C58A 4WURA 1G3IA 4AKIA 3U6QA 4REZA 3KSXA 4DUYM 3W0FA 1G4AE 3L27A 3GPUA 1SXJB 3GLIB 4GKJM 3AKZA 4GITA 4KODA 2CHQA 1L1TA 1R6BX 4IBKA 3M7GA 1HQYE 3PVSA 3TPZA 2Y0TA 1FNNA 1VDDA 4CISA 3VDPA 4FWDA 2X49A 2CV2A 1IBLM 1GVNA 2Y21A 4IJEA 4LGYA 5EJCA 1R2ZA 2UUBM 4CGYB 5JI2E 4TUWA 2UXBM 4IBIA 5IT9S 1IN6A 4GIPA 2FNAA 3GLIA 3RGSA 3UZUA 3AOGA 2LH0A 2FE8A 4B3SM 2Z7JA 1XC8A 1IXZA 1G8PA 3K8ZA 2QP9X 4LZZA 4L16A 3KOWE 2M5ZA 1Q39A 3HKPA 1JQJC 3J27B 4KHPM 4LF5M 3NBIA 3GRVA 2LWXA 5E6JA 2Y20A 4FW9A 3I4VA 1GL6A 4JN6A 2XF3A 4I5SA 4L78A 1KSFX 4GMQA 4LJ8A 5EP1A 4LF9M 1KYIA 4MH0E 2R62A 1I4WA 3FUUA 1IBKM 4G6ZA 1L8QA 2Q2EB 2C96A 2KW0A 4JI1M 3GPPA 1NHGC 4YHHM 2HL7A 2DZNB 3AL0C 4A3VB 1E32A 4YY3M 3SHGB 4IBGA 4IBDA 2OPFA 3FTDA 4G4RA 3KP0E 2F5PA 2ZBKB 4LJAA 3L2AA 2AHMA 3L28A 1IBMM 2P5TA 3SAWA 4QHTA 3U6MA 1DGHB 8CATA 1NNJA 1HT1E 4M9XA 3BOSA 4QOSA 4FCVA 2BJVA 3M0EA 1FJGM 4DV6M 1W5TA 3QWLA 2D7EA 1ZQ9A 3EIHA 5DYIA 2L7IA 2EUCA 4I8OA 5KQ8A 2R18A 2W82A 2HHHM 4B3MM 4PT5A 3FKEA 4MB7A 3FUWA 4B7HA 4OX9M 1IY0A 1DO2A 4DR6M 1QZMA 1J5EM 2XGNA 5LMNM 1HT2E 4S12A 2CHGA 2V6ZM 1DGFA 2L09A 3CF0A 1HNXM 5EQTA 3RGPA 4LCBA 1TDZA 2R4JA 1N75A 4AKHA 4DR5M 4FWGA 2O5RA 5LMUM 2UUAM 2HKJA 1DGGA 2KA6B 4FWHA 3VFDA 1XNQM 3I51A 2KRKA 1IQPA 5ITUA 4WW0A 4AZFA 4JYAM 4DV2M 3VKHA 1IY1A 3K1JA 4GC5A 3JAMS 1IXSB 3L25A 4NXNM 3LQQA 4D80A 5BR8M 1E94E 3KDSE 1H6UA 1HQCA 3T1HM 2K47A 4M9SA 4R7GA 3L29A 4MGIE 5EXTA 3FUVA 4M0WA 3ZC7B 5FSWA 5H37D 3UMMA 5ITYA 3R9XB 3OTOM 1T3TA 3U6LA 3A45A 1XXHA 2Y0QA 3RE8A 1XHBA 4FCTA 5ITTA 3A98B 1E9RA 1QAOA 5KQDA 5FLXS 4JI2M 3SYLA 2KRUA 2YNMD 2E5LM 3GLFB 2DVWB 3TWLA 3U6OA 2UU9M 4LFCM 1L2BA 1NY6A 4DV3M 4JI0M 1OJLA 4GHLA 4W5WA 4NXMM 4DV0M 1I94M 1ORYB 2QBYB 5FTNA 4LJ9A 3VKGA 4B08A 3DFZA 1PM5A 3U6SA 3KSJA 4RNAA 1PJIA 2CFOA 2F5NA 1S3SA 3ZCBB 3FUTA 4DV4M 1SXJD 4GHAA 4II7A 1JR3D 5GKNA 1XXHB 1Q3BA 1YSYA 3FTFA 4LGMA 2UXCM 1G59A 3GLGA 1DGBA 3GLGB 3UK6A 4DV7M 3QAUA 4OVZA 1N34M 4LF8M 4MM3B 3KFUG 1QVRA 4G4OA 3R8FA 2FFJA 3GLHB 4LFBM 3FYDA 5EP3A 2ZAOA 2JA2A 3HU2A 4NRVA 4X64M 3PNVA 1NNUC 3J7AS 3JR4A 5KPRA 4DUZM 5FTKA 2G5GX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 M;  1Z5A A;  1N33 M;  1L2C A;  4JI8 M;  2HHH M;  3GQ3 A;  2OQ4 A;  4PCZ A;  1Z5C A;  4B3M M;  2ZM6 M;  4PDG A;  2F5Q A;  1XNR M;  4JI5 M;  4MB7 A;  2XZU A;  3A42 A;  4OX9 M;  1Z5B A;  4NRW A;  4LF6 M;  4DR6 M;  1EE8 A;  5ITQ A;  1J5E M;  4PD2 A;  5LMN M;  3SBJ A;  3J81 S;  4JI7 M;  3A46 A;  1HNX M;  3SAR A;  5ITX A;  1KFV A;  5ITR A;  4PDI A;  1TDZ A;  3C58 A;  4LFA M;  3JR5 A;  4DR5 M;  4G4N A;  5LMU M;  3GPX A;  3U6E A;  3U6Q A;  2UUA M;  2HKJ A;  2UUC M;  4DUY M;  1MX0 A;  3W0F A;  2VQF M;  4JI6 M;  4X65 M;  3GPU A;  4LF4 M;  1XNQ M;  4B3R M;  1HNZ M;  4GKJ M;  3T1Y M;  3GQ5 A;  5ITU A;  1L1T A;  4JI3 M;  4DR4 M;  4JYA M;  3SAT A;  4DV2 M;  2VQE M;  4DV1 M;  1XMQ M;  3TWM A;  4CIS A;  1MU5 A;  3JAM S;  1HR0 M;  1IBL M;  4DR2 M;  4NXN M;  5BR8 M;  4LF7 M;  3DOA A;  1Z59 A;  3T1H M;  4X62 M;  3VK8 A;  1R2Z A;  1K82 A;  4DR7 M;  2UUB M;  2EA0 A;  4K0K M;  2UXB M;  3GQ4 A;  5IT9 S;  3GPY A;  5ITY A;  3U6D A;  3OTO M;  3U6L A;  3A45 A;  4B3S M;  1XC8 A;  3GP1 A;  5ITT A;  3GO8 A;  1K3X A;  5FLX S;  1L2D A;  4JI2 M;  1N32 M;  1K3W A;  1Q39 A;  5A2Q S;  2E5L M;  3TWL A;  3U6O A;  3U6C A;  2UU9 M;  4LFC M;  1L2B A;  4G4Q A;  4DV3 M;  2F5S A;  4JI0 M;  4KHP M;  4LF5 M;  2F4V M;  3U6P A;  1HNW M;  5IWA M;  4NXM M;  4DV0 M;  1I94 M;  1Q3C A;  1PM5 A;  1XMO M;  4DV5 M;  3U6S A;  1PJI A;  2F5N A;  4DR1 M;  2UXD M;  4AQY M;  4LF9 M;  3SAS A;  4DV4 M;  1IBK M;  2XZF A;  4B3T M;  3TWK A;  2Q2E B;  1Q3B A;  4JI1 M;  3GPP A;  4YHH M;  2UXC M;  4GKK M;  4JV5 M;  4YY3 M;  1N36 M;  2OPF A;  3VK7 A;  1R2Y A;  1L1Z A;  4DV7 M;  1N34 M;  4G4R A;  1TDH A;  2F5P A;  2ZBK B;  4LF8 M;  3SAV A;  3SAU A;  1IBM M;  4G4O A;  3SAW A;  3U6M A;  4LFB M;  1NNJ A;  5ITX E;  4NRV A;  4X66 M;  4X64 M;  2F5O A;  4ITQ A;  3J7A S;  1FJG M;  4DV6 M;  3JR4 A;  4DUZ M;  1PJJ A;  4DR3 M;  3J80 S; 
#chains in the Genus database with same CATH topology
 4EIW A;  3MHV C;  3MMP A;  4HLQ A;  2XFT A;  5FTL A;  1L2C A;  2DWZ B;  4L15 A;  1GKI A;  3AOE C;  3GQ3 A;  4PCZ A;  2R45 A;  5DFL A;  2ZM6 M;  4F1I A;  3B7N A;  4OW0 A;  2DAI A;  5EP4 A;  3A42 A;  3M6A A;  2XZU A;  1GJT A;  4CHT B;  4NRW A;  1EE8 A;  3CF6 E;  5ITQ A;  1MN3 A;  1TGU A;  4OVZ B;  1V34 A;  4PD2 A;  4KLN A;  1ZAE A;  2L7H A;  3VLF B;  3E4R A;  3KXE C;  3I01 M;  4HL4 A;  2M60 A;  4KO8 A;  7CAT A;  2LVP C;  3FD9 A;  2XSZ A;  4JI7 M;  4IIW A;  1IXR C;  3U5Z B;  4FVM A;  3K2L A;  1GO5 A;  3HX3 A;  4ANR A;  4D82 A;  1V92 A;  2D7G A;  1UM8 A;  2KDL A;  4LFA M;  3JR5 A;  1OFH A;  4Z6Y A;  2XEP A;  4L8R C;  1MX0 A;  3T38 A;  2VQF M;  4JI6 M;  2RKO A;  4X65 M;  2J7O A;  4B3R M;  2C5R A;  2L2D A;  1WGN A;  3GLH A;  2KZS A;  3KOZ E;  3CTW B;  3KS4 A;  3BBZ A;  4JI3 M;  5FTM A;  1IN5 A;  3HWS A;  2C9C A;  3GRY A;  1J09 A;  1E9S A;  2VQE M;  3HZJ A;  1XMQ M;  2DWM A;  3TWM A;  4QNM A;  1MU5 A;  1HR0 M;  2CWB A;  1JR3 A;  4LF7 M;  1NVM A;  3B7Z A;  2EO2 A;  2NQ8 C;  2VII A;  1Z59 A;  5C1B A;  4R3D A;  4X62 M;  3VK8 A;  4NSO B;  2Z3X A;  2QBY A;  1QYR A;  4AG6 A;  3HY5 A;  3WHL A;  2KNZ A;  2EA0 A;  3U60 A;  3TL4 X;  2JWS A;  3GPY A;  5IZ7 D;  1QUT A;  3GLI E;  1ZMW A;  5FTJ A;  3THG A;  2ZAM A;  4LJ4 A;  1DO0 A;  1JR3 E;  2KZU A;  4RF1 A;  3PXG A;  2KXE A;  3J2P B;  2CV1 A;  1QQW A;  3H4M A;  5EXP A;  4LJ6 A;  1ZV1 A;  2L4E A;  4AI6 A;  2R4E A;  2VF7 A;  1NJG A;  1ZMU A;  3B9P A;  1K3X A;  1L2D A;  2BWE A;  2G3Q A;  2O01 F;  4MGY E;  2EKF A;  3IHP A;  1YE9 A;  2CE7 A;  3FYC A;  4G4Q A;  3RFW A;  1BVS A;  1D2N A;  2F4V M;  2X8A A;  3LW5 F;  1PJT A;  5IWA M;  4NOO B;  3TE6 A;  3U5Z A;  3CF2 A;  4QHS A;  2DI0 A;  4GH9 A;  1Q3C A;  2DHR A;  4CJ6 A;  3SMP A;  1QDR A;  1XMO M;  4GRI A;  3VDU A;  3HGI A;  1XWI A;  3LMM A;  1AUA A;  5EXS A;  5EP2 A;  4BBA A;  4DR1 M;  4XGI A;  4M0D A;  1IXS A;  5KO3 A;  3FUX A;  3Q8G A;  1SG9 A;  2RRU A;  3D8L A;  3TWK A;  2KNA A;  2D7H A;  1QAN A;  1VEG A;  2YQZ A;  2DKL A;  4RF0 A;  4JV5 M;  3AFH A;  1N36 M;  3C3D A;  2HCB A;  1R2Y A;  2CHV A;  2LVO C;  3GRU A;  5F3W A;  3LVW A;  1UFZ A;  4L4U A;  4M9Z A;  3ZH9 B;  2CRU A;  1TH2 A;  2DWN A;  2GNO A;  3E21 A;  3KW6 A;  5IRE B;  4B7G A;  1Y8G A;  4F2L A;  5ITX E;  4X66 M;  3B7Q A;  2F5O A;  2FH0 A;  3KVW A;  3GLF E;  3DZD A;  3KOX E;  2N35 A;  4IJF A;  1IN4 A;  2OOB A;  3E9S A;  2A5Y B;  3U60 B;  1PJJ A;  1WXQ A;  3QYB A;  3J80 S;  3J7B A;  5DNY A;  4I4L A;  4JI4 M;  1N33 M;  4JXJ A;  1QAQ A;  3GLH E;  2OQ4 A;  3HU1 A;  3W0L B;  1Z5C A;  3HHZ A;  2ZTC A;  1DGH A;  1LV7 A;  1YUB A;  2QNJ A;  3Q8X A;  4PDG A;  2R65 A;  2F5Q A;  2V1U A;  2QSF X;  3HJ8 A;  2XLJ A;  2WSF F;  3HHX A;  3KS8 A;  2DZO B;  2QHO B;  3MK6 A;  4MGH A;  3NWL A;  2B3T A;  3LQR A;  4LJ5 A;  1HJP A;  2V1C A;  3A46 A;  5KPT A;  3EIE A;  3IG8 A;  5C18 A;  4IBC A;  1NJF A;  2CUZ A;  2ZAN A;  3B74 A;  1KFV A;  3KOY E;  3SAR A;  2CEA A;  2X4A A;  1LTM A;  1G71 A;  1TH3 A;  1R7R A;  3HHY A;  3V76 A;  3GPX A;  4G4N A;  3U6E A;  2UUC M;  4LRS A;  3DA1 A;  1OKS A;  4LF4 M;  3GLF A;  4IBB A;  2L4F A;  4QNR A;  1HNZ M;  2YFQ A;  2XFS A;  3T1Y M;  3GRR A;  2K0B X;  3GQ5 A;  1IN8 A;  3WHK A;  1NSF A;  2LHG A;  4Z8X A;  2QPA A;  3HU3 A;  2WSC F;  4DR4 M;  3D8B A;  4AG5 A;  3L26 A;  1AIP C;  3SAT A;  4DV1 M;  3HJQ A;  1Z6T A;  3SHF A;  1T43 A;  4RKU F;  3AOE A;  2DHY A;  4DR2 M;  2C99 A;  2G8L A;  3MJ5 A;  4IBF A;  4P16 A;  3TQS A;  4AW4 A;  3DOA A;  1W5S A;  1D0M A;  3UGJ A;  3SYK A;  2LXE A;  4DR7 M;  1K82 A;  1NHW C;  2XH9 A;  3I4Y A;  2C98 A;  4K0K M;  3GQ4 A;  2WSE F;  3LVV A;  3HJS A;  4MGZ E;  3ILK A;  4MGK E;  3U6D A;  2KEB A;  5L8R F;  1MJG M;  1GLN A;  1XXH E;  1QZE A;  3C9P A;  2I7N A;  3GP1 A;  3GO8 A;  3UJN A;  2QEN A;  1TH4 A;  2JY8 A;  4XBO A;  1K3W A;  5DYG A;  2Z4S A;  1N32 M;  4Q7J A;  1C1K A;  5A2Q S;  5E26 A;  4BLC A;  2FOI C;  3FRI A;  1N78 A;  2H5X A;  3U6C A;  3PNY A;  3PFI A;  1SXJ A;  2F5S A;  4LG2 A;  3U6P A;  1HNW M;  3LCV B;  4B7F A;  2R46 A;  3K92 A;  4FD2 A;  3AJI B;  2LVA A;  4DV5 M;  2MJ5 B;  2QCU A;  1JB0 F;  2UXD M;  4AQY M;  3SAS A;  2Z4R A;  5JI3 E;  2XSZ D;  1NY5 A;  2XZF A;  2DXI A;  4B3T M;  1SXJ C;  3SMS A;  2BNK A;  2JUJ A;  2BJW A;  1WIV A;  2L6O A;  4QOZ C;  2LNH C;  4FCW A;  3AV0 A;  4GKK M;  1TF0 B;  4GEW A;  2CV0 A;  2I7P A;  2LBC A;  1A5T A;  1ZMV A;  2RGH A;  5EXX A;  3VK7 A;  1L1Z A;  2JP7 A;  1TDH A;  4LJ7 A;  2DWL A;  3K9O A;  3SAV A;  2JZ1 A;  3E46 A;  3FTE A;  3SAU A;  1PRB A;  4I81 A;  1WJ7 A;  1QAM A;  1PGY A;  4IBE A;  1IY2 A;  1IM2 A;  2ERC A;  3HHW A;  2JY7 A;  2OOA A;  4ITQ A;  2YR0 A;  1IN7 A;  4IBJ A;  1G41 A;  1RU3 A;  3U61 B;  3F92 A;  3U61 A;  4LRT A;  4DR3 M;  1XB2 B;  3KP1 E;  2J7N A;  1Z5A A;  2LHC A;  4JI8 M;  3T15 A;  5BPV A;  1XNR M;  3CGW A;  4LY6 A;  4P17 A;  2H1R A;  2Z8Y M;  2QZ4 A;  4LZJ A;  3SFZ A;  4D81 A;  4NSR A;  4JI5 M;  4DBG B;  4OU7 A;  1Z5B A;  4BB9 A;  1GL7 A;  3SC3 A;  5KPZ A;  4LF6 M;  4NL4 H;  1SXJ E;  2K9D A;  1X37 A;  3GLG E;  2RGO A;  3SBJ A;  3IG5 A;  3C3E A;  2KNV A;  4ZPX A;  2OO9 A;  4G3O A;  1DV0 A;  3J81 S;  1J7K A;  2J5Y A;  4GC9 A;  1OFI A;  1N77 A;  3FTC A;  5ITX A;  5ITR A;  2QQ8 A;  1YLA A;  4PDI A;  2C9O A;  3W67 A;  3C58 A;  4WUR A;  1G3I A;  4AKI A;  2WZJ A;  3U6Q A;  4NC6 A;  4REZ A;  3KSX A;  4DUY M;  3W0F A;  1G4A E;  3L27 A;  3GPU A;  1SXJ B;  4R71 A;  3GLI B;  3AKZ A;  4GIT A;  4CIZ A;  4GKJ M;  4KOD A;  2CHQ A;  1WHC A;  1L1T A;  1R6B X;  2DNA A;  4IBK A;  3M7G A;  1HQY E;  2EJS A;  3PVS A;  3TPZ A;  4AKG A;  2Y0T A;  1FNN A;  1VDD A;  4CIS A;  3VDP A;  2K6B A;  4FWD A;  1VEJ A;  2X49 A;  2CV2 A;  1IBL M;  1GVN A;  2Y21 A;  4IJE A;  4LGY A;  2JY5 A;  5EJC A;  3LCU A;  1R2Z A;  2UUB M;  4CGY B;  5JI2 E;  4TUW A;  2UXB M;  4IBI A;  5IT9 S;  1IN6 A;  2DAG A;  2FNA A;  4GIP A;  1EFU B;  1NV8 A;  3RGS A;  3GLI A;  3UZU A;  3AOG A;  2LH0 A;  2FE8 A;  4B3S M;  2R44 A;  2Z7J A;  2O25 A;  1XC8 A;  1IXZ A;  1G8P A;  3K8Z A;  1GJS A;  2QP9 X;  1GAB A;  3B89 A;  4LZZ A;  1VEK A;  2MRO B;  1D0K A;  4L16 A;  3KOW E;  2VF8 A;  2M5Z A;  1Q39 A;  3HKP A;  2DAE A;  1JQJ C;  3J27 B;  2HWJ A;  4KHP M;  4LF5 M;  3NBI A;  3GRV A;  2LWX A;  2R0I A;  5E6J A;  2Y20 A;  4FW9 A;  1NV9 A;  1GL6 A;  3I4V A;  4JN6 A;  2XF3 A;  1OIZ A;  4I5S A;  4L78 A;  1KSF X;  4GMQ A;  4LJ8 A;  5EP1 A;  2BWB A;  1KYI A;  4MH0 E;  4LF9 M;  2R62 A;  1I4W A;  3FUU A;  1IBK M;  1L8Q A;  4G6Z A;  2Q2E B;  2C96 A;  2KW0 A;  1IFY A;  1OQY A;  4JI1 M;  3GPP A;  1NHG C;  4YHH M;  2HL7 A;  1OTR A;  2DZN B;  3AL0 C;  1VG5 A;  4A3V B;  1E32 A;  4YY3 M;  3SHG B;  4IBG A;  4IBD A;  1D0L A;  3FTD A;  2OPF A;  4G4R A;  3KP0 E;  2F5P A;  2ZBK B;  4LJA A;  3L2A A;  2AHM A;  3L28 A;  1IBM M;  2P5T A;  3SAW A;  4QHT A;  3U6M A;  1DGH B;  8CAT A;  4XK8 F;  1NNJ A;  1HT1 E;  4M9X A;  3BOS A;  4QOS A;  3ZQJ A;  4FCV A;  2BJV A;  2JZ0 A;  3M0E A;  1FJG M;  4DV6 M;  1W5T A;  2DZL A;  3QWL A;  2D7E A;  3QYE A;  1ZQ9 A;  3EIH A;  5DYI A;  2L7I A;  2EUC A;  4I8O A;  5KQ8 A;  2R18 A;  3T6P A;  2JNH A;  2W82 A;  3K9P A;  2HHH M;  4B3M M;  1QDT A;  1V33 A;  4PT5 A;  1NO1 A;  3FKE A;  4MB7 A;  3FUW A;  4B7H A;  1WGL A;  1IY0 A;  4UN2 B;  2R6F A;  1DO2 A;  4OX9 M;  4DR6 M;  1QZM A;  1J5E M;  2XGN A;  5LMN M;  1HT2 E;  4S12 A;  2CHG A;  2V6Z M;  1DGF A;  2L09 A;  3CF0 A;  1OIP A;  1HNX M;  2MH8 A;  3I04 M;  5EQT A;  3RGP A;  4LCB A;  1TDZ A;  2R4J A;  1N75 A;  4AKH A;  1CUK A;  4DR5 M;  4FWG A;  2O5R A;  2VDB B;  5LMU M;  2UUA M;  2HKJ A;  1DGG A;  2KA6 B;  4FWH A;  3VFD A;  1XNQ M;  3I51 A;  2KRK A;  1IQP A;  5ITU A;  4WW0 A;  4AZF A;  2KHH A;  4JYA M;  1QUS A;  4DV2 M;  3VKH A;  1IY1 A;  1T6O A;  1PJS A;  3K1J A;  4GC5 A;  1TTE A;  1IXS B;  3JAM S;  3L25 A;  1Q02 A;  4NXN M;  3LQQ A;  4KT0 F;  4D80 A;  1E94 E;  2DEN A;  5BR8 M;  3KDS E;  1H6U A;  1HQC A;  2JXN A;  3T1H M;  2K47 A;  3FE3 A;  4M9S A;  4R7G A;  3L29 A;  4MGI E;  2LTU A;  1R4G A;  2HAK A;  3FUV A;  1WR1 B;  4M0W A;  5EXT A;  3ZC7 B;  5FSW A;  5H37 D;  3UMM A;  2LVQ D;  5ITY A;  1OAO C;  3R9X B;  2DAK A;  4HEO A;  3OTO M;  1T3T A;  3U6L A;  3A45 A;  1XXH A;  2Y0Q A;  3RE8 A;  4Y28 F;  1XHB A;  4FCT A;  5ITT A;  3A98 B;  1E9R A;  1QAO A;  1VDL A;  5KQD A;  5FLX S;  4JI2 M;  3SYL A;  2KRU A;  2MR9 A;  3NBX X;  2YNM D;  3FRH A;  2E5L M;  3GLF B;  2DVW B;  3TWL A;  3U6O A;  2DAM A;  2UU9 M;  1C7Y A;  4LFC M;  1L2B A;  2MGW A;  1NY6 A;  3IEC A;  4DV3 M;  4JI0 M;  2LVN C;  1OJL A;  4GHL A;  4W5W A;  2JY6 B;  4NXM M;  4DV0 M;  2FS1 A;  2CP8 A;  1ORY B;  1I94 M;  2QBY B;  1EIJ A;  5FTN A;  4LJ9 A;  3VKG A;  4B08 A;  3DFZ A;  1PM5 A;  1F4I A;  2ZTD A;  3U6S A;  3KSJ A;  4RNA A;  1PJI A;  2CFO A;  2F5N A;  1S3S A;  3ZCB B;  3FUT A;  4DV4 M;  1SXJ D;  4GHA A;  4II7 A;  1JR3 D;  5GKN A;  1XXH B;  2EKK A;  1Q3B A;  1YSY A;  3FTF A;  4LGM A;  2UXC M;  1G59 A;  3GLG A;  1DGB A;  3GLG B;  1PJQ A;  3UK6 A;  4DV7 M;  3QAU A;  4OVZ A;  1N34 M;  3BXW A;  2GQF A;  4L6V 6;  1P3Q Q;  4LF8 M;  4MM3 B;  3KFU G;  1QVR A;  3W68 A;  4G4O A;  3R8F A;  3H4J A;  2FFJ A;  3GLH B;  4LFB M;  1OAI A;  3FYD A;  5EP3 A;  2ZAO A;  2JA2 A;  3HU2 A;  2APL A;  4NRV A;  3PNV A;  1NNU C;  4X64 M;  3J7A S;  1TR8 A;  3JR4 A;  4WP2 A;  1VQ1 A;  5KPR A;  4DUZ M;  5FTK A;  2G5G X;  1R5L A; 
#chains in the Genus database with same CATH homology
 4EIW A;  3MHV C;  4HLQ A;  2XFT A;  5FTL A;  1L2C A;  2DWZ B;  4L15 A;  1GKI A;  3AOE C;  3GQ3 A;  4PCZ A;  2R45 A;  2ZM6 M;  4OW0 A;  5EP4 A;  2XZU A;  3A42 A;  3M6A A;  4CHT B;  4NRW A;  1EE8 A;  3CF6 E;  5ITQ A;  1TGU A;  4OVZ B;  4PD2 A;  4KLN A;  1ZAE A;  2L7H A;  3VLF B;  3E4R A;  3KXE C;  4HL4 A;  2M60 A;  4KO8 A;  7CAT A;  3FD9 A;  2XSZ A;  4JI7 M;  4IIW A;  1IXR C;  3U5Z B;  4FVM A;  3K2L A;  4D82 A;  2D7G A;  1UM8 A;  4LFA M;  3JR5 A;  1OFH A;  4Z6Y A;  2XEP A;  4L8R C;  1MX0 A;  3T38 A;  2VQF M;  4JI6 M;  2RKO A;  4X65 M;  2J7O A;  4B3R M;  2C5R A;  3GLH A;  2KZS A;  3KOZ E;  3CTW B;  3KS4 A;  4JI3 M;  5FTM A;  1IN5 A;  3HWS A;  2C9C A;  3GRY A;  1J09 A;  1E9S A;  2VQE M;  1XMQ M;  2DWM A;  3TWM A;  4QNM A;  1MU5 A;  1HR0 M;  1JR3 A;  4LF7 M;  1NVM A;  2EO2 A;  2NQ8 C;  2VII A;  1Z59 A;  5C1B A;  4R3D A;  4X62 M;  3VK8 A;  4NSO B;  2Z3X A;  2QBY A;  1QYR A;  4AG6 A;  3WHL A;  2EA0 A;  3U60 A;  3TL4 X;  3GPY A;  5IZ7 D;  5FTJ A;  3THG A;  2ZAM A;  4LJ4 A;  1DO0 A;  2KZU A;  4RF1 A;  3PXG A;  2KXE A;  3J2P B;  2CV1 A;  1QQW A;  3H4M A;  5EXP A;  4LJ6 A;  4AI6 A;  2R4E A;  1K3X A;  1NJG A;  3B9P A;  1L2D A;  4MGY E;  1YE9 A;  2CE7 A;  3FYC A;  4G4Q A;  3RFW A;  2F4V M;  1D2N A;  2X8A A;  5IWA M;  4NOO B;  3TE6 A;  3U5Z A;  3CF2 A;  4QHS A;  4GH9 A;  1Q3C A;  2DHR A;  3SMP A;  1XMO M;  4GRI A;  3VDU A;  3HGI A;  1XWI A;  3LMM A;  5EXS A;  4BBA A;  5EP2 A;  4DR1 M;  4XGI A;  4M0D A;  5KO3 A;  3FUX A;  3D8L A;  3TWK A;  2D7H A;  1QAN A;  2YQZ A;  4RF0 A;  4JV5 M;  3AFH A;  1N36 M;  2HCB A;  1R2Y A;  2CHV A;  3GRU A;  5F3W A;  3LVW A;  4L4U A;  4M9Z A;  3ZH9 B;  1TH2 A;  2DWN A;  3KW6 A;  5IRE B;  5ITX E;  4B7G A;  4X66 M;  2F5O A;  3KVW A;  3DZD A;  3KOX E;  4IJF A;  1IN4 A;  3E9S A;  2A5Y B;  3U60 B;  1PJJ A;  1WXQ A;  3J80 S;  3J7B A;  5DNY A;  4I4L A;  4JI4 M;  1N33 M;  4JXJ A;  1QAQ A;  2OQ4 A;  3HU1 A;  3W0L B;  1Z5C A;  3HHZ A;  4PDG A;  1DGH A;  1LV7 A;  1YUB A;  2F5Q A;  3Q8X A;  2R65 A;  2V1U A;  3HJ8 A;  2XLJ A;  3HHX A;  3KS8 A;  2DZO B;  3MK6 A;  4MGH A;  3NWL A;  3LQR A;  4LJ5 A;  2V1C A;  3A46 A;  5KPT A;  3EIE A;  3IG8 A;  5C18 A;  4IBC A;  1NJF A;  2CUZ A;  2ZAN A;  1KFV A;  3SAR A;  3KOY E;  2CEA A;  2X4A A;  1TH3 A;  1R7R A;  3HHY A;  4G4N A;  3GPX A;  3U6E A;  2UUC M;  4LRS A;  3DA1 A;  4LF4 M;  3GLF A;  4IBB A;  4QNR A;  1HNZ M;  2YFQ A;  2XFS A;  3T1Y M;  3GRR A;  3GQ5 A;  1IN8 A;  3WHK A;  1NSF A;  4Z8X A;  2QPA A;  3HU3 A;  4DR4 M;  3D8B A;  4AG5 A;  3L26 A;  3SAT A;  4DV1 M;  3HJQ A;  1Z6T A;  3SHF A;  3AOE A;  4DR2 M;  2C99 A;  2G8L A;  3MJ5 A;  4IBF A;  4P16 A;  3TQS A;  4AW4 A;  3DOA A;  1W5S A;  3UGJ A;  3SYK A;  2LXE A;  4DR7 M;  1K82 A;  1NHW C;  2XH9 A;  3I4Y A;  2C98 A;  4K0K M;  3GQ4 A;  3LVV A;  4MGZ E;  3HJS A;  3U6D A;  3ILK A;  4MGK E;  2KEB A;  1GLN A;  2I7N A;  3GP1 A;  3GO8 A;  3UJN A;  2QEN A;  1TH4 A;  1N32 M;  4XBO A;  1K3W A;  5DYG A;  2Z4S A;  1C1K A;  5A2Q S;  5E26 A;  4BLC A;  2FOI C;  1N78 A;  3U6C A;  3PNY A;  3PFI A;  1SXJ A;  2F5S A;  4LG2 A;  3U6P A;  1HNW M;  4B7F A;  2R46 A;  3K92 A;  4FD2 A;  3AJI B;  4DV5 M;  2QCU A;  2UXD M;  4AQY M;  3SAS A;  2Z4R A;  5JI3 E;  2XSZ D;  1NY5 A;  2XZF A;  2DXI A;  4B3T M;  1SXJ C;  3SMS A;  2BNK A;  2BJW A;  2L6O A;  4QOZ C;  2LNH C;  4FCW A;  3AV0 A;  4GKK M;  2CV0 A;  2I7P A;  3VK7 A;  2RGH A;  5EXX A;  1L1Z A;  1TDH A;  4LJ7 A;  2DWL A;  3SAV A;  3FTE A;  3SAU A;  4I81 A;  1QAM A;  4IBE A;  1IY2 A;  1IM2 A;  2ERC A;  3HHW A;  4ITQ A;  2YR0 A;  1IN7 A;  4IBJ A;  1G41 A;  3U61 B;  3U61 A;  4LRT A;  4DR3 M;  3KP1 E;  2J7N A;  1Z5A A;  4JI8 M;  3T15 A;  5BPV A;  1XNR M;  4AKG A;  4LY6 A;  2H1R A;  4LZJ A;  2QZ4 A;  3SFZ A;  4D81 A;  4JI5 M;  4NSR A;  4OU7 A;  1Z5B A;  4BB9 A;  1GL7 A;  3SC3 A;  5KPZ A;  4LF6 M;  4NL4 H;  1SXJ E;  1X37 A;  2RGO A;  3SBJ A;  3IG5 A;  4ZPX A;  3J81 S;  1J7K A;  4GC9 A;  1OFI A;  1N77 A;  3FTC A;  5ITX A;  5ITR A;  4PDI A;  2C9O A;  3C58 A;  4WUR A;  1G3I A;  4AKI A;  3U6Q A;  4REZ A;  3KSX A;  4DUY M;  3W0F A;  1G4A E;  3L27 A;  3GPU A;  1SXJ B;  3GLI B;  4GKJ M;  3AKZ A;  4GIT A;  4KOD A;  2CHQ A;  1L1T A;  1R6B X;  4IBK A;  3M7G A;  1HQY E;  3PVS A;  3TPZ A;  2Y0T A;  1FNN A;  1VDD A;  4CIS A;  3VDP A;  4FWD A;  2X49 A;  2CV2 A;  1IBL M;  1GVN A;  2Y21 A;  4IJE A;  4LGY A;  5EJC A;  1R2Z A;  2UUB M;  4CGY B;  5JI2 E;  4TUW A;  2UXB M;  4IBI A;  5IT9 S;  1IN6 A;  4GIP A;  2FNA A;  3GLI A;  3RGS A;  3UZU A;  3AOG A;  2LH0 A;  2FE8 A;  4B3S M;  2Z7J A;  1XC8 A;  1IXZ A;  1G8P A;  3K8Z A;  2QP9 X;  4LZZ A;  4L16 A;  3KOW E;  2M5Z A;  1Q39 A;  3HKP A;  1JQJ C;  3J27 B;  4KHP M;  4LF5 M;  3NBI A;  3GRV A;  2LWX A;  5E6J A;  2Y20 A;  4FW9 A;  3I4V A;  1GL6 A;  4JN6 A;  2XF3 A;  4I5S A;  4L78 A;  1KSF X;  4GMQ A;  4LJ8 A;  5EP1 A;  4LF9 M;  1KYI A;  4MH0 E;  2R62 A;  1I4W A;  3FUU A;  1IBK M;  4G6Z A;  1L8Q A;  2Q2E B;  2C96 A;  2KW0 A;  4JI1 M;  3GPP A;  1NHG C;  4YHH M;  2HL7 A;  2DZN B;  3AL0 C;  4A3V B;  1E32 A;  4YY3 M;  3SHG B;  4IBG A;  4IBD A;  2OPF A;  3FTD A;  4G4R A;  3KP0 E;  2F5P A;  2ZBK B;  4LJA A;  3L2A A;  2AHM A;  3L28 A;  1IBM M;  2P5T A;  3SAW A;  4QHT A;  3U6M A;  1DGH B;  8CAT A;  1NNJ A;  1HT1 E;  4M9X A;  3BOS A;  4QOS A;  4FCV A;  2BJV A;  3M0E A;  1FJG M;  4DV6 M;  1W5T A;  3QWL A;  2D7E A;  1ZQ9 A;  3EIH A;  5DYI A;  2L7I A;  2EUC A;  4I8O A;  5KQ8 A;  2R18 A;  2W82 A;  2HHH M;  4B3M M;  4PT5 A;  3FKE A;  4MB7 A;  3FUW A;  4B7H A;  4OX9 M;  1IY0 A;  1DO2 A;  4DR6 M;  1QZM A;  1J5E M;  2XGN A;  5LMN M;  1HT2 E;  4S12 A;  2CHG A;  2V6Z M;  1DGF A;  2L09 A;  3CF0 A;  1HNX M;  5EQT A;  3RGP A;  4LCB A;  1TDZ A;  2R4J A;  1N75 A;  4AKH A;  4DR5 M;  4FWG A;  2O5R A;  5LMU M;  2UUA M;  2HKJ A;  1DGG A;  2KA6 B;  4FWH A;  3VFD A;  1XNQ M;  3I51 A;  2KRK A;  1IQP A;  5ITU A;  4WW0 A;  4AZF A;  4JYA M;  4DV2 M;  3VKH A;  1IY1 A;  3K1J A;  4GC5 A;  3JAM S;  1IXS B;  3L25 A;  4NXN M;  3LQQ A;  4D80 A;  5BR8 M;  1E94 E;  3KDS E;  1H6U A;  1HQC A;  3T1H M;  2K47 A;  4M9S A;  4R7G A;  3L29 A;  4MGI E;  5EXT A;  3FUV A;  4M0W A;  3ZC7 B;  5FSW A;  5H37 D;  3UMM A;  5ITY A;  3R9X B;  3OTO M;  1T3T A;  3U6L A;  3A45 A;  1XXH A;  2Y0Q A;  3RE8 A;  1XHB A;  4FCT A;  5ITT A;  3A98 B;  1E9R A;  1QAO A;  5KQD A;  5FLX S;  4JI2 M;  3SYL A;  2KRU A;  2YNM D;  2E5L M;  3GLF B;  2DVW B;  3TWL A;  3U6O A;  2UU9 M;  4LFC M;  1L2B A;  1NY6 A;  4DV3 M;  4JI0 M;  1OJL A;  4GHL A;  4W5W A;  4NXM M;  4DV0 M;  1I94 M;  1ORY B;  2QBY B;  5FTN A;  4LJ9 A;  3VKG A;  4B08 A;  3DFZ A;  1PM5 A;  3U6S A;  3KSJ A;  4RNA A;  1PJI A;  2CFO A;  2F5N A;  1S3S A;  3ZCB B;  3FUT A;  4DV4 M;  1SXJ D;  4GHA A;  4II7 A;  1JR3 D;  5GKN A;  1XXH B;  1Q3B A;  1YSY A;  3FTF A;  4LGM A;  2UXC M;  1G59 A;  3GLG A;  1DGB A;  3GLG B;  3UK6 A;  4DV7 M;  3QAU A;  4OVZ A;  1N34 M;  4LF8 M;  4MM3 B;  3KFU G;  1QVR A;  4G4O A;  3R8F A;  2FFJ A;  3GLH B;  4LFB M;  3FYD A;  5EP3 A;  2ZAO A;  2JA2 A;  3HU2 A;  4NRV A;  4X64 M;  3PNV A;  1NNU C;  3J7A S;  3JR4 A;  5KPR A;  4DUZ M;  5FTK A;  2G5G X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...