1Q3DA

Gsk-3 beta complexed with staurosporine
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
351
structure length
339
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of the Gsk-3Beta Active Site Using Selective and Non-selective ATP-Mimetic Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
total genus 97
structure length 339
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q3dA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q3dA01
4L01A 5CT7A 1OM1A 1PF8A 4OAVB 2R9SA 5HD4A 4QTEA 4JG8A 2YISA 3EKKA 2VWXA 2WTIA 2XIZA 3OD6X 2VTOA 3R21A 3QLFA 4FIFA 3PIXA 3DZOA 5CI6A 1ND4A 3EN6A 5CAQA 4NJDA 2ZV2A 5DT0A 3SRVB 4F63A 4HW7A 3NW7A 3QKLA 3VUIA 3ZUUA 4IM2A 2X9FA 4F7JA 1OUYA 4NW6A 5HIEA 4AE6A 2Q0NA 2PVHA 2OW3A 3O8TA 4BF2A 2FVDA 2ZB1A 4M69B 4MTAA 4A9TA 5J8IA 3PPKA 3R04A 3A7FA 2O63A 3NUPA 1O9UA 4EH6A 4J53A 5M08A 4R5YA 2HZIA 3OWLA 2R3MA 4OW8A 2BHHA 4LOPA 3WILA 1QPJA 1OL7A 3DJ5A 5IQEA 4YPSA 4F0GA 4AT3A 3RWQA 3POZA 2J7TA 2R5TA 3NUAA 2JDOA 5HNGA 2W4JA 1JKLA 1J3HA 3FMDA 3IK3A 4C3PA 4ITJA 3MESA 2RSVA 2W5AA 3NUYA 2QOIA 4M13A 2ACXA 3ZLXA 4EHEA 4J97A 2O2UA 3PXZA 4PPAA 5C9CA 4BCJA 4AS0A 4C8BA 5KMMA 4AZSA 2B9FA 2V62A 4NIFA 4D4SA 3GXLA 5G6VA 4O83A 4ANSA 4X2NA 2WQMA 5AR8A 4YZMA 3BU6A 3QC9A 4O7VA 1NY3A 3ZZWA 1UNGA 2PVKA 3D2KA 4MF1A 3GB2A 4H39A 4D4YA 3R9OA 4G3EA 3C0GA 2WMQA 3DU8A 5AX3A 4U80A 4UY9A 5A4LA 2YJRA 4E5AX 3L9PA 3TV4A 3ZYAA 3F61A 2JKQA 3ORPA 1R3CA 3AC4A 4JXFA 5I0BA 4MAOA 3TUBA 5BVEA 3OP5A 1SMHA 4BDEA 1Y91A 4GUEA 3W2RA 2G01A 3P23A 3EIDA 3NUUA 5KZ0A 3UC4A 4FKGA 4R78A 2ZMDA 4GK3A 3NDMA 2X81A 3PJ1A 5GZAA 3O51A 2QU6A 5E1EA 3C5UA 3PE2A 3DBCA 5LVPA 4O1OA 3TIYA 1QPDA 4EH4A 4KRDA 3P7BA 4MBLA 1ZAOA 3LCSA 3OBGA 3R8ZA 4FIEA 1G8AA 3HP5A 4J96A 4DEAA 2O3PA 4AQCA 4FZAB 3JR1A 4S31A 5H2UA 4PNIA 4CTCA 3E8DA 3NLBA 1SYKA 5DI1A 3C5IA 1GZ8A 1OL1A 5ETFA 1BLXA 4S34A 4WBBB 3EN5A 3VS6A 2X39A 3VS1A 2LGCA 2YIRA 5I9VA 2JDVA 5EDPA 5LARA 2DUVA 2UW3A 3EYHA 1ZZLA 4FKRA 4RJ5A 3W2QA 4FTAA 4LGHA 2UVXA 5CEOA 4M67A 2VTPA 4K18A 4K2RA 4XG3A 3PSDA 2EUFB 2EB2A 2B55A 5HO6A 5JSMA 5HBEA 4IXPA 4JLCA 3NVKI 3GCVA 2C6DA 3Q2MA 1LR4A 3V5JA 5EM8A 4D1ZA 3FLZA 2ITQA 3VUMA 4ANNA 2PE1A 3R71A 4G1WA 4DG0E 4Y46A 4FNXA 3ZLSA 5CSWA 5HNIX 1A06A 5FXRA 2WEVA 5KCVA 1YHWA 4X3FA 1Q4LA 2B9HA 2GTNA 2YA9A 3R00A 4F9BA 1IAJA 2Y6MA 3HMPA 4I0RA 1SNXA 1URWA 5F1ZA 5HG5A 3I81A 4FGRA 2UVYA 4IDTA 3CC6A 3E62A 4RX8A 3PY3A 2BRGA 2O5KA 1KE8A 1GZKA 4HGSA 1A9UA 4C61A 3ZC6A 3QWJA 3U51A 3LLAA 5IUGA 4FIHA 3FMLA 3UP2A 4EONA 2C5VA 2WTVA 3RNYA 4DA5A 4FG9A 3FMMA 4C2VA 1Y8YA 3GU8A 3P1AA 3MVMA 4F64A 1XWSA 4Q5EA 4O82A 4J99A 3H30A 3IQ7A 4K11A 5ANOA 4E4MA 3TKUA 4CEGA 3V01A 3EFWA 4E20A 2BROA 2WXVA 3D0EA 4X2FA 4AU8A 1Y6BA 2I6LA 2YDJA 4ITIA 3RPRA 1Q8TA 3AOXA 4Z7GA 4ZLZA 4RFZA 5IEXA 1LPUA 3P78A 2CKPA 2F57A 2CN5A 2VTTA 3VQUA 4FL1A 2EWAA 4LFIA 2W9ZB 4MNEA 4N6YA 3WZKA 5M53A 2C1BA 4CRLA 4J8NA 4GJ3A 4BGGA 5IU2A 2WMAA 4K8AA 2YIWA 4QP4A 2X9EA 4TRLA 4GFOA 1M2RA 5D41A 5BMMA 3SXRA 3W33A 4AGCA 4CLIA 4PP7A 4NL0A 3ZSIA 2QONA 3GFWA 4CG9A 2R3QA 3BV2A 3LFDA 3NSZA 4PL3A 4FE2A 1STCE 3R28A 3T9IA 1F5QA 1ZYSA 2FH9A 3LW0A 1BKXA 4KKHA 1UU8A 4WRSA 4FKVA 5IA5A 3HV3A 2X8IA 2ZOQA 4JBQA 2QQ7A 4UN0C 4ZP5A 3W2SA 4EK3A 2OJ9A 1E1XA 3PA5A 4FV5A 4B0GA 3LXKA 4EOPA 4BI0A 3E87A 3QL8A 4R7BA 3ANQA 4DEGA 1Y8GA 3ZSHA 4BGQA 5CTPA 4XX9A 4YHTA 2PZPA 3R8PA 1K2PA 2WTCA 4MWIA 4QMOA 5JN2A 4O7RA 4J52A 3P86A 3IW8A 2VTRA 4CRSA 3SG8A 4O0SA 3DJ6A 4ZS0A 2BZHB 3RTPA 3UGCA 1W7HA 3FQHA 2UZLA 1VZOA 3MJ1A 1WFCA 4IAKA 5FBNC 3UZPA 2F7EE 4LQMA 3NYNA 3R8MA 1H07A 2WTDA 4C02A 2QO7A 5CF4A 3SAYA 1XH9A 3CR0A 4HJOA 4IVAA 4GT5A 3FC2A 4K6ZA 3OCSA 3ELJA 2HW7A 4EQUA 3VJOA 5M4IA 3C4XA 4CFXA 2OZAB 3DK7A 2XNMA 3E7VA 4EOSA 2SRCA 3FMKA 3IONA 2G2IA 1NT2A 2PUNA 3FPMA 2YDKA 3DFCB 3PSCA 4KSPA 4JBVA 2WMTA 3SHEA 3GENA 4WT6A 3PFQA 1FPUA 2W96B 3MH1A 4Y95A 4V04A 4R77A 1JKSA 2CDZA 3OUNB 2JFLA 3H0ZA 2Y7JA 2Z7QA 2GS6A 2VO7A 2XYNA 4FVRA 1IRKA 1R78A 4S30A 3TNWA 5DHJA 5AMNA 3WF7A 3BBTB 4FV9A 4CMUA 1KSWA 4IX4A 4P4CA 5A6OA 5IISA 2NNWB 2R0UA 3G33A 1CKJA 4FZ7A 4EC8A 1R1WA 1JAMA 1JKTA 1H08A 5DNRA 3ITZA 4QYFA 3NW5A 4TYEA 1UWJA 3WZDA 3D83A 4CZUA 4FV1A 3IDBA 4G3FA 4J1RA 4FEXA 4JQ8A 2PTKA 3BHTA 3IO7A 3ORTA 3QCSA 4FVQA 4Y5HA 5A4CA 3VHKA 2C3LA 3Q3BA 4AW2A 1TKIA 3REPA 3F88A 2VWYA 3NWWA 3K3JA 3O8PA 4YZDA 2X6DA 2YJSA 3OW3A 3LFSA 2XNPA 2VTQA 2CGXA 3BE9A 3UIUA 1ZY4A 2QCSA 3F6XA 3Q4UA 3N4UA 3I0QA 5K9IA 3BCEA 3KVXA 5AIRA 2ITTA 4FA2A 5M4UA 4O0WA 3DXQA 5HLPA 4BCHA 4GV1A 2XK6A 3JVSA 5KBQA 3GNIB 3EYGA 2OZOA 3N9XA 5KMOA 4BDJA 2EVAA 3TCPA 4IC7A 3A2CA 2R3KA 4TTHB 4A4LA 2PL0A 5CS6A 5FQDC 4IJ9A 2VO0A 2BAJA 3BHHA 4L3LA 3QD4A 4JBOA 4F7SA 4EWQA 4BCNA 4I1ZA 3SLSA 4RIYA 5AUYA 3OCBA 3E92A 3QQUA 2WQEA 4O0UA 4PNKA 4QNAA 5FEEA 3I7BA 1ZXEA 5KKRC 3MPTA 1PXPA 3EZRA 3IOKA 3R83A 1PXOA 4IM3A 4CZYB 3CXWA 2WO6A 5B2LA 1FOTA 3TEIA 3OWPA 3ULIA 4FKLA 4HCVA 4I41A 4YJRA 2OG8A 3MY1A 3OG7A 3UNKA 3C4EA 4O2ZA 5AP4A 4KKGA 4MX9A 1M7QA 3FHIA 4CNHA 5CEQA 4BIBA 5IPJA 4RC4A 1VYZA 4EUUA 4O0TA 4FSRA 4FSWA 4JAIA 2VWUA 4R3RA 5ACKA 1FGIA 3ATSA 5E8VA 2PVRA 4QPAA 4EQMA 4YR8A 5JZJA 2VTSA 5JGDA 4IZYA 3NMUF 4I93A 4I6HA 1OMWA 3PA3A 3U9CA 3QAME 3FV8A 3QHRA 2YITA 3W2PA 3NPCA 2RFDA 3AC3A 4BBMA 4CG8A 3TM0A 3ZFYA 3RBWA 4PL5A 3NEWA 3W8QA 2B53A 3G51A 1YDSE 4XP2A 4YHFA 5HX6A 1J91A 2I0YA 3DLSA 5CYIA 2AYPA 3TUDA 3O7LD 4AWIA 4GEOA 3NNVA 4GH2A 4OLIA 2XNOA 4BCGA 5TOZA 2JIIA 2JLDA 1OZ1A 4DT9A 3EHAA 4BCPA 3NNXA 1J7UA 2J4ZA 2QU5A 4O84A 3TZMA 3AG9A 3WF6A 4N0SA 4YMJA 5FM2A 3Q5IA 5C4KA 1V0OA 5J7BA 4X21A 4YO6A 3BYUA 5L2SA 4K9YA 3CEKA 1H00A 3R9NA 2BIKB 3VBXA 3M1SA 3AMYA 5EYMA 5B0XA 3TG1A 3RM6A 5AADA 4P2KA 2WMVA 2WU7A 3ORLA 3UBDA 1IEPA 5A54A 1UU7A 2I0EA 5I9ZA 4XV2A 5F4NA 2ERKA 3LCTA 4GU6A 1S9JA 3CE3A 3KY2A 4D1XA 3AT4A 4XYFA 4CV8A 3F2AA 4USEA 4JX3A 3OMVA 5LCKA 3HVCA 4FSUA 2F7XE 4K0YA 5A4TA 5IA3A 4FL3A 3R0TA 2R3JA 3K54A 3LOKA 5AUXA 2W1DA 5HLNA 3D5XA 4MBIA 4ITHA 3ZBXA 4UX9A 4O0RA 3KK9A 2W1GA 2OICA 4WOVA 4WSYA 5A14A 4JIKA 2Q0BA 2YAAA 3DNEA 2A4LA 3ZO4A 4CFMA 5I4NA 1OKZA 3KRRA 1OVEA 4LUEA 4PMSA 1ZARA 5ANKA 4BDIA 3VW8A 1FVTA 5EYDA 5E8ZA 3G0FA 4FSYA 4OTDA 4RVTA 4AUAA 4FTRA 4JX7A 4TT7A 5BVFA 5DR9A 2YACA 2G2HA 2BMCA 2QLUA 3L9MA 2JFMA 3Q9YA 3A8WA 4EKKA 4AFJA 4I5CA 2C6OA 3VS2A 1YDRE 4QQJA 4QRCA 5L2IA 4LV5A 2A27A 2XKCA 4PQNA 2WKMA 2XRWA 2X2MA 4QP8A 3F7ZA 4C59A 4W4VA 3C13A 3CY2A 4PDPA 4JR3A 3QFVA 5CQWA 5ETAA 5HESA 5K4IA 1BYGA 5HU3A 5KMIA 2QG7A 1ZMVA 4BDKA 4FI1A 2R4BA 1PMEA 4I24A 4QMMA 4DFBA 2XYUA 4EH9A 3W2OA 4AACA 2RG5A 1RW8A 4BB4A 5BQ0A 2XVDA 4DGLC 3VWAA 4TYIA 3K2LA 1JSVA 5DT4A 4GT3A 5EHLA 3QWKA 4AAAA 4ERKA 1YXSA 3NUSA 2H96A 3QQHA 2BKZA 4FT3A 2KULA 4I4EA 5I9XA 2I40A 4N70A 1Q41A 2WEIA 3R6XA 4RC3A 4ID7A 2DQ7X 4K77A 1PRYA 3ACKA 2V5QA 3DA6A 3Q96A 4IVDA 2UW6A 3RVGA 3QTWA 3R7GA 4Q5HA 4IJPA 4YO4A 2ZM3A 5CF5A 2FA2A 2R3HA 2XBAA 3EL8A 3PJ3A 3RPVA 3TN8A 1ZOHA 4MXOA 3IW7A 2WPAA 3LM5A 3BEGA 3C51A 3NS9A 1GAGA 4A9YA 5E7RA 3KU2A 3HL7A 4J95A 4P5ZA 2C4GA 3ORZA 4RT7A 3PRFA 4XG2A 2UZUE 1V1KA 2YM3A 5TT7A 1RQQA 4GJ2A 4QNYA 3LFAA 3OXZA 3HA8A 4L67A 4U81A 4AA4A 3ZO1A 1U5RA 3F5UA 3PXFA 3ALOA 4HVDA 5KMLA 1HCLA 4G3GA 3KULB 4DLIA 3E8CA 3DY7A 4IQ6A 4TWPA 1T45A 2E9VA 1BUHA 3O2MA 1QMZA 2G9XA 3R7UA 3MPMA 3DKOA 4EBWA 5AV3A 3DQXA 4DFYA 3CS9A 3PPZA 3VUHA 4XG8A 2BFXA 3QBNA 3QKKA 4IANA 4YJOA 3NZ0A 2F2UA 4I22A 2RKUA 4ZSGA 1XQZA 4JR7A 4C37A 3UOLA 2UZVA 3IPHA 4Y8DA 3I5NA 1WBOA 4HYUA 4TWNA 3TJDA 5LQFA 4L42A 2E9OA 3QRTA 2YERA 4USDA 3EQIA 3FL5A 3LJ0A 4O0XA 3W18A 4EBVA 3C7QA 3DQWA 2VUWA 1UNHA 1UU9A 4EWHA 4EZ5A 4E4LA 4L68A 3QA0A 5FXSA 4RC2A 4Y83A 5L3AA 3JVRA 3VBQA 2XKFA 4IB0A 3FUPA 2UW9A 3PUPA 3A8XA 4EEVA 1YKRA 3NUXA 4OTRA 2Z7SA 5DIAA 5LVLA 3R8VA 4XV1A 1L8TA 1U54B 1JNKA 2E9PA 1RDQE 5TO8A 4XG6A 5C8NA 3DOGA 4XJ0A 3ULZA 3HV5A 4IBMA 3ZXTA 3PY1A 4O7TA 5CVHA 3BLHA 5AJQA 3S3IA 5JGAA 1ZYJA 2A2AA 3PG1A 2R3FA 5T68A 5HTCA 2J0KA 4NEUA 3V8SA 5CU3A 5LVMA 5CAPA 2BZKB 4E6QA 2OGVA 4N57A 3L8SA 1PY5A 4EOJA 3AC5A 3A7IA 5TE0A 4QOXA 4D4VA 3DTCA 3C0HA 4FKUA 3SD0A 2JGZA 4EH5A 2BKKA 3LMIA 3D94A 3MIAA 2GQRA 4RJ4A 1MQBA 3NIZA 3B8RA 3E64A 3GQIA 4IDVA 2Z7LA 4J7BA 4JDHA 5FTQA 4LOOA 4YUQA 5KMNA 4X6RA 3WIKA 3MJ2A 3VRYA 4NW5A 3T9TA 2OKRA 4EOLA 2BAQA 4C62A 3KULA 4RWKA 2JBPA 3H9OA 4F7NA 5KBRA 2BRNA 2IJMA 2Y8OA 3I5ZA 3G15A 5M06A 4E3CA 3QX2A 1YI3A 2RG6A 4QYHA 5DRBA 4G2FA 5AWMA 5IQGA 3D15A 4QMLA 2C5YA 2Q83A 3VUTA 4G5PA 1IAHA 2X7OA 3WZJA 3HLLA 4M66A 3Q04A 3OT8A 2XEZA 3QYZA 3C4CA 4IH8A 3I1AA 4MXCA 2GMXA 2VU3A 2ITUA 3KL8A 4YSJA 4F0FA 3DFAA 3JYAA 5C03A 3GC0A 4M12A 5GIPE 5D12A 4B7TA 3FXZA 5IQFA 3OUKA 2VN9A 3BU3A 4ALWA 3OY3A 3PPJA 4QMNA 3LQ8A 2C0IA 3QRJA 2C68A 1IASA 4R1YA 2OZAA 4JI9A 3RAHA 3B8QA 3OS3A 5E8YA 4D5KA 5LVNA 3MPAA 3CGFA 5FDXA 4FV0A 4I5PA 3VHEA 4AFEA 2B4SB 2W5BA 4BTKA 5K5NA 3IG7A 4O86A 1LUFA 3D5UA 3CD3A 3QRIA 3ZU7A 4EZ3A 5FEQA 2R64A 3HA6A 2WQBA 3KF7A 3DPKA 3OTUA 3NAXA 2YWPA 2V55A 4I6BA 5J9YA 5IQIA 3RK7A 3TZ8A 2OFUA 2XBJA 3LFBA 3UPXA 4Z7HA 3C50A 4GS6A 4H3QA 3IW6A 4AT4A 3QQFA 4E5WA 2F4JA 1B39A 2JITA 5J5SA 3N51A 2X6EA 1NVQA 5K4JA 3H4JA 2GNIA 2A1AB 1UA2A 3ANRA 3QQLA 4XLIA 5AP1A 3ZTXA 3G9NA 5ETCA 3QZFA 3U8WA 2PMIA 4RX5A 3MFTA 4XOYA 3EQPA 4FTNA 1QPCA 3FAAA 4YC6A 5GINE 3GP0A 5BVWA 3GU5A 2YCQA 3FLNC 3IECA 2VX3A 3TIZA 3WF8A 3OXTA 4QYEA 5HBJA 2C47A 3DKCA 2OSCA 3OC1A 4I4FA 4BKZA 5M4FA 3TNHA 4HYHA 3UG1A 2PULA 4ZK5A 3AC8A 3Q6UA 3ZRLA 5F9EA 3F66A 4M15A 3D5WA 2YM4A 4F99A 1I09A 1PW2A 5IQBA 5M07A 4QP1A 4B6LA 3T8OA 3KRWA 3F3TA 2JKMA 4O2PA 3W32A 1PMNA 4ZLYA 2XNNA 1WVYA 4WNPA 4WKQA 3VVHA 4A9UA 2R2PA 3BYVA 2GHGA 4CGAA 4FTCA 3QLGA 5AP7A 3EQHA 2ZAZA 3VS0A 3A7JA 4D2PA 4JIAA 3POOA 3KC3A 3ZDUA 4FTMA 5DN3A 3QHWA 4II5A 4B99A 5DLSA 4GFGA 2OJJA 4FNZA 5F94A 3SOCA 4X7QA 3QYWA 4ZTRA 5D9HA 5C27A 2QI8A 3F3UA 4ZY5A 1J1CA 4X2GA 4OTWA 3F2NA 3L9LA 5J1WA 4O7YA 5E4HA 5M4CA 4ZSAA 2XK4A 4UMPA 5AA8A 5C4LA 3RHXA 4ZTLA 4QT1A 4YJQA 4L44A 2IW8A 3VBWA 4E73A 4DCAA 4XCUA 3UIBA 3MFRA 3MN3A 4LG4A 2CHLA 3TT0A 1KV2A 3QCQA 4ZJJA 3VJNA 5I5ZA 5JRQA 5M56A 3H9RA 1OB3A 2C3KA 4FKOA 4PTCA 1ZY5A 2YIYA 4YTIA 2P2IA 5EOLA 4FUXA 4MD8E 4L6QA 4YC3A 3ROYA 5CAOA 4I20A 3AC1A 2X1NA 3MB6A 2PVNA 4W9XA 3SC1A 4KNBA 4ZLOA 4NU1A 4QMZA 3CPBA 5AAFA 1Q3WA 2UW0A 3NVMB 4FSTA 4UMTA 4QQTA 3C4WA 2OBJA 2YZLA 4BHNA 3FWQA 3ZUVA 2ITYA 4EK8A 3O71A 4YC8A 5I9UA 2UZOA 4FEVA 4C4EA 4R1VA 4CTBA 2BTRA 4UWCA 1H0WA 5TF9A 2XNEA 4QP6A 4D55A 4FOBA 4NM5A 2HCKA 3TI1A 4EORA 5C1QB 4LMNA 2GHLA 4O81A 2NRYA 4FT9A 5FG8A 2IZTA 1P4OA 3HX4A 1PHKA 4EK4A 5BPYA 1GY3A 4GIHA 4RFMA 2OH4A 4A9RA 5A9UA 4P7EA 4YLLA 3UOJA 1XH7A 2XIYA 2YEXA 4P5QA 5EKNA 4IX3A 3OCTA 4RLKA 3UO5A 3FPQA 3L9NA 3LJ1A 2CLXA 1GIJA 3PA4A 4KBAA 2I0VA 4FKQA 2QOKA 5EW8A 4ALVA 4TPTA 2DYLA 1LEWA 4E6AA 4W8EA 3NIEA 4FTQA 5EW9A 4EOIA 2XJ0A 4W4XA 4X3JA 5BVNA 3VW6A 3A4OX 3II5A 5CQUA 2GQGA 5JKGA 3DV3A 3E88A 1H25A 3FSKA 4H36A 3OFMA 2WZJA 1H01A 2C69A 2WMWA 3Q9XA 3CPCA 3LFQA 5DEYA 2ZVAA 4FODA 4GCJA 4RSSA 3HAVA 3I6WA 2W1CA 3QTUA 3NR9A 3D5VA 3CKWA 4K33A 4FGBA 4LM5A 1CMKE 2WMBA 5EHYA 3R73A 4DFNA 5ICPA 1PKGA 3R1QA 5DMZA 3B2TA 3SOAA 1WVXA 3UE4A 4F1MA 4RQVA 5EI8A 2ITZA 4I6FA 1GNGA 3EZVA 4EOOA 4XV3A 2P55A 4W4WA 5HG9A 3RAWA 3W2CA 4BTJA 4UMUA 5JQ8A 1UV5A 4DG3E 1NXKA 2VWZA 4BICA 4PX6A 3DDQA 4CCBA 2A0CX 4KUJA 3HMNA 1MP8A 5DOSA 3U6IA 4AG8A 4MYGA 4RIXB 5CENA 5FXQA 4MCVA 4TXCA 3BX5A 4K1BA 2W1EA 2H6DA 1YI4A 3ZSGA 3PDTA 2R3IA 3D7ZA 4IHPA 5EDRA 4ZZMA 3BIZA 3V8WA 1QL6A 4FG7A 4RZWA 5CU2A 2IG7A 4O7SA 2GNGA 3BELA 4WD5A 4FZDB 3S0OA 3GEQA 4DH5A 2UZBA 2GDOA 4QYYA 1WBSA 2BHEA 2XK3A 4LL0A 3DZQA 2HY81 1Q97A 2O64A 2QNJA 4DFLA 5AP0A 4QMTA 2JEDA 4XMOA 3DAKA 4JQEA 1WZYA 3EQBA 4OTIA 3ORKA 1OUKA 4LL5A 3BZ3A 5E8SA 3R7VA 3VS4A 5TR6A 5EM6A 4HZSA 5BUIA 3AMAA 4FKJA 1U5QA 3TZ7A 1JSUA 3EQFA 5AM6A 4L00A 2QR7A 2ZDTA 2OJFE 1OIQA 4WUAA 2WD1A 4RWIA 5A4EA 3BGPA 3F7WA 1EH4A 4MWHA 4X6QC 5M57A 1G8SA 4EHVA 3KXXA 2PSQA 5J7HA 1AD5A 3OBJA 2CKQA 5KMKA 2J90A 3H10A 3QX4A 3KRJA 1GIIA 4L52A 5AR4A 4E1ZA 4RWLA 3OWKA 4ORKA 3F5XA 2R3OA 3D9VA 5BYLA 1YDTE 3FZRA 4AGDA 4LGDA 4DH7A 1R0EA 4BCMA 2JIUA 3I79A 2VRXA 3BLQA 4JAJA 2YAKA 3EFKA 4D58A 1YOMA 4ACHA 4F6WA 5CZHA 3ZRMA 2QC6A 2ZB0A 3P9JA 3HMOA 4QMWA 2VX1A 3DB8A 4MVFA 3MVHA 4USFA 2XCHA 3FI4A 3MFSA 4BDCA 3PXKA 3DK6A 4WBOA 1UKIA 3MB7A 5AIKA 4D9TA 1ZRZA 4HVGA 2HWOA 3PZEA 4LRJA 4R3CA 4YNOA 5F95A 4BR3A 4YZBA 1VR2A 3CP9A 3WYYA 4LI5A 5L2QA 4IMYA 2GNJA 3KA0A 4BFMA 4F65A 2XIKA 2QOBA 4PF4A 5DVRA 3ZO2A 3ZRKA 4BGHA 4DFZE 3V5PA 4WO5A 5IDPA 5HVJA 3C4ZA 3P08A 2CNQA 2IW9A 2QO9A 3UTOA 3FEGA 1Q8YA 5IEYA 2FSOX 4JRVA 4H05A 5HLWA 3VNTA 1OL6A 4FEQA 1KUTA 3DXNA 2VAGA 1OL2A 1REJA 4BDHA 4ZZOA 2FSMX 4DYMA 3RALA 2ZM4A 3C1XA 3VUGA 4L43A 5IQCA 4DGNA 2XUUA 5CXZA 3ZM9A 3UC3A 3RCDA 3HAMA 4YGAA 1R39A 4PMTA 5AP3A 1NVRA 1F3MC 2PY3A 3I0OA 4FZ6A 4RJ7A 4JQ7A 2UZEA 4ONAA 4CFNA 5FGKA 5ITAA 3ZC5A 3KFAA 3QC4A 3U6HA 4XOZA 5BVOA 3LFFA 5FDPA 2WOUA 3FLQA 3HV7A 3CTHA 4HVHA 3S00A 3D7TA 2IW6A 4TKSA 2JBOA 2W1HA 3QCXA 5HICA 5HE2A 4BBEA 3H0YA 5JT2A 4ENXA 3HRCA 1M52A 5AM7A 4YURA 3BYSA 3K3IA 3QTXA 4IWOA 4MHAA 4M7IA 3DJ7A 1R0PA 3NNWA 2OIBA 4KA3A 4BI2A 4WIHA 1DI9A 4IAIA 4C2WA 5KMJA 3CTJA 1K3AA 4XRLA 4BWKA 2G1TA 4LOQA 2OXXA 4XEYA 4KS7A 2O65A 4BCIA 4O1PA 4DH3A 2GNFA 3CQEA 3QUEA 1Q61A 3CGOA 4HYIA 4X0MA 4A4OA 4FUYA 3LPBA 5IDNA 5IA0A 4E5BA 3ATTA 3EWHA 4FKWA 3WIGA 1ZYCA 4TL0A 5A4QA 1CKPA 3SW4A 3R8UA 4PP9A 4AE9A 1UWHA 3HNGA 3L8PA 5J79A 4BDFA 4XLVA 4NKAA 3V6RA 5EYCA 3S2PA 4ZJVA 4F09A 3QU0A 3FC1X 3SV0A 4GFMA 4KRCA 4F6UA 3LXLA 5HIBA 3ET7A 3AT2A 4I5MA 2LAVA 1Q5KA 3G6HA 4EHZA 1XKKA 3GOPA 5JZNA 4J8MA 2Y4IC 1HOWA 3VAPA 2VTNA 4ACDA 4BRXA 3WE8A 2CNVA 4IWDA 2BDFA 1XBAA 4FSZA 2PWLA 3BEAA 5GZ8A 1UU3A 4FTTA 4KIPA 5IH4A 4LYNA 5AP6A 2WAJA 4YLKA 3UVRA 1YXTA 4EL9A 4RJ3A 1UVRA 4CKRA 4WNMA 3U4WA 4IWQA 1Z9XA 3OCGA 4XUFA 2RIOA 1GOLA 4FEWA 4FV4A 3VS5A 2Z02A 2UZTA 4YSMA 2YM5A 3TKIA 4EOMA 3DBDA 1H8FA 4KAOA 4ZSEA 3A60A 3VS3A 4A9SA 3UOKA 5HE1A 4FMQA 3PY0A 4GRBA 3TKHA 5L6WL 3DK3A 4ZMFA 4BDDA 2X8EA 3PYYA 2JD5A 3MVJA 2GFCA 2VTJA 4DG2E 5IH5A 4C57A 1K9AA 3GCPA 3RKBA 1DI8A 1OIYA 1H28A 4BI1A 3JUHA 1WBWA 2QHNA 5HO8A 2QOFA 4A4XA 3SVVA 2VZ6A 5EQPA 1W82A 4NIFB 3WBLA 4UV0A 4RIOA 2PZYA 4IADA 1CTPE 3D4QA 3CIKA 5M44A 5IEVA 1Q99A 3PP1A 4MD7E 4XBRA 4BDBA 4EYJA 5IZFA 4TYGA 4FSNA 2IVUA 5EH0A 4QMXA 4H58A 1P5EA 1WBNA 2ONLC 3QZHA 4DC2A 4IVBA 3LZBA 3QCYA 1TQIA 3P7CA 3LCOA 4GSBA 5E8UA 4DHFA 5CSXA 5IA4A 2YIXA 1B38A 5CF8A 4ANOA 2ITWA 4FNYA 3W10A 4WSQA 5CEKA 1Q8ZA 3F3VA 4XH6A 2JC6A 3QALE 4WNKA 4AZTA 3MW1A 4O21A 3UNZA 4L9IA 3V5QA 4ACGA 4CT2A 3P4KA 4JOAA 4GK4A 5EM7A 5HQ0A 3RK5A 3B2WA 2BTSA 3VBTA 3UQCA 3SRVA 1TQPA 3IS5A 1AQ1A 3EH9A 4FV8A 4Q9SA 4U41A 2XK8A 4UYAA 5AV1A 5AX9A 4BWXA 4JJRA 3KXHA 4ZXTA 5DG5A 4PDYA 1IA8A 2Z8CA 5HO7A 3QA8A 5JFSA 4U7ZA 4EC9A 4OR5A 3DKFA 5CU6A 5BUEA 5AV2A 3GC9A 1G3NA 3GU7A 4GIIA 5E92A 4EJ7A 2OFVA 4D0WA 4XG9A 3LAUA 3Q32A 5HVYA 1W98A 4TWCA 4C0TA 2P0CA 4FV7A 1YOLA 5IF1A 1AGWA 1BL6A 1WMKA 4EH2A 4FKIA 2ITOA 1KE9A 4JDKA 4O38A 4AA0A 5AR2A 3N4TA 2NO3A 4WA9A 5K0KA 2F49A 2BCJA 3GT8A 2UV2A 2UZNA 2CGUA 3PWYA 2WIPA 4FIJA 4FX3A 2C0TA 3LXNA 4IE9A 5E90A 3VBVA 3NNUA 4AA5A 1F0QA 4U79A 4BTFA 2FGIA 4E6CA 2WNTA 2VTIA 2KTYA 4PL4A 2XKEA 3AMBA 3BGQA 3SXSA 5M09A 1IA9A 3DNDA 2WELA 4CCUA 3Q2JA 1JVPP 1HCKA 1YHSA 1XHAA 3EFJA 5EFQA 3FY0A 4E4XA 2XJ1A 3RMFA 3SXFA 5E8WA 1J1BA 4BHZA 1FMKA 4D1SA 1PXNA 2XM8A 4MQ2A 4NKSA 2DS1A 2VGOA 4FC0A 1S9IA 4YJNA 3WYXA 5CEMA 4QMSA 1FINA 2GFSA 2JDRA 2QO2A 3AGLA 3W16A 3KMMA 3UOHA 4BZOA 2GS7A 3JS2A 4E4NA 3HYHA 5FUTA 4RVKA 1OL5A 4MNEB 2WQOA 5HE3A 4AZVA 2BRMA 2ZV7A 1Y6AA 4RJ6A 3FXXA 4V0GB 4CFVA 4U3ZA 4QMQA 4L53A 2ETMA 5AUWA 2C6IA 4DCEA 4TYHA 5KKRB 5HG7A 4U97A 1H24A 2VO3A 4WNOA 4AOTA 2X4ZA 3R30A 5A3XA 4UEUA 3MDYA 1G5SA 1WBPA 4R5SA 1KE6A 5KZIA 4XBUA 2HY0A 4RX9A 4U42A 4HPUE 3UNJA 4BVUA 4RA4A 2QG5A 4QD6A 3H9FA 1PJKA 3S4QA 4G9CA 2NPQA 4IW0A 4EQCA 3FSFA 4EI4A 3COHA 5CU4A 4B4LA 1DAYA 2QURA 3O96A 4BCOA 4F9AA 1KOAA 2CKOA 3FI2A 1SNUA 2BDWA 4IB1A 4GG7A 4RZVA 4TY1A 2CLQA 1PYXA 3MV5A 3NX8A 4O7WA 3DS6A 3QZGA 2B1PA 3AXWA 2VX0A 2ZV8A 3R7OA 2ETKA 5FBOA 5AEPA 5EI2A 4N4SA 3F5PA 3T3VA 4JT3A 4FK6A 5D7VA 4EH8A 4FV2A 4NFNA 2XIRA 3KMUA 1PXJA 2E9UA 3EQDA 4PUZA 5HI2A 5J95A 4RPVA 3R7YA 5AV0A 1OIRA 3NRMA 5AR7A 3COKA 2Y4PA 4YTHA 1CDKA 4D5HA 5CZIA 4CYJA 1LP4A 1YOJA 3PVUA 3CBLA 2Z7RA 3OVVA 5J87A 1OPJA 2H8HA 3DCVA 3FJQE 3ZONA 1O6LA 2HK5A 4OBOA 3GFEA 3K5UA 5LCJA 4I3ZA 3QTSA 5FP6A 3R9DA 2ONLA 3VQHA 2G2FA 3ZFMA 4D4RA 4M3QA 1YWVA 3RK9A 4MKCA 2HZ0A 5H8BA 3TV7A 3CLYA 5K0XA 3ZUTA 5LWNA 1SM2A 4IB5A 4DT8A 4PPCA 4GT4A 4R6VA 4OTQA 2HIWA 2WTKC 1PKDA 2PK9A 2OI4X 2YABA 4YZNA 2R3PA 5HIDA 3RGFA 4BCFA 4DLJA 3TNPC 3UQFA 4A7CA 2RF9A 4QYGA 3GU6A 3KVWA 2YFXA 4CT1A 4EKLA 3FHRA 3O50A 1RE8A 3EMGA 3R9HA 5IH6A 5KX8A 1PMUA 3A7GA 1OKWA 4GMYA 3TJCA 1YQJA 2F2CB 2IZRA 3HDNA 5H3QA 4M68A 3LFNA 1X8BA 3QXOA 4FOCA 4ANQA 2J0MB 4M14A 4O96A 3U55A 4E93A 3EN7A 3FXWA 4IACA 3TTIA 5IMEA 1MRVA 5HCXA 3CD8A 3FYKX 4DITA 4EUTA 3KQ7A 4XG4A 3RP9A 2XZSA 3AD6A 3E7OA 1YRPA 4AN2A 2X4FA 3GQLA 2PMLX 4F08A 2EU9A 4L3JA 2IVVA 4L46A 4D2TA 2HW6A 4D2SA 1H26A 3WF5A 1VJYA 2BALA 2UW7A 2VNWA 1O6KA 2Y6OA 4AXAA 4IX5A 1NVSA 2P2HA 4ZEGA 3UG2A 5FTGA 3LHJA 2C5OA 1H1SA 4Y72A 3MWUA 3BWFA 4C35A 3UMXA 5FP5A 4GVAA 2J6MA 5B2KA 3MGYA 5L8KA 3ORMA 3BHYA 4I0TA 4H3PA 4TNBA 4OUCA 5CU0A 5LWMA 1FQ1B 3BHVA 2XF0A 4UMRA 1GZOA 4FTKA 4R8QA 4UB7A 4GKIA 3V5WA 5B2MA 4L3PA 4QTCA 4FK3A 1CKIA 3BKBA 3BI6A 4EZ7A 5IA2A 4GL9A 4O6EA 5L2WA 2VWIA 4QTDA 4FKPA 1FVVA 4QP9A 1JLUE 3MS9A 5ANJA 5D11A 2YIQA 4ZMEA 2CPKE 2RL5A 1H1WA 1XJDA 4ASXA 2C6MA 3E8NA 4FKSA 3ZH8A 3IKAA 4CFWA 2VTLA 3PXQA 4TN6A 2WTWA 4DINA 5BVDA 3VULA 1ZMWA 1UKHA 4O22A 4DBXA 4GU9A 3G0EA 3QRKA 4MNFA 3FLWA 4AN9A 5I9WA 5GNKA 3VUDA 5EQYA 3HUBA 3T3UA 5C01A 5LMBA 4XS2A 2FB8A 1B6CB 3KF4A 3LCKA 4IAAA 1M14A 1MRUA 5HCYA 5HU9A 2W05A 4EK6A 1ZZ2A 3PXYA 3SGCA 2GCDA 5I9YA 2ITPA 1ZYLA 3BHUA 4A07A 3KN5A 2CKEA 1MRYA 1XH8A 4RGJA 3ZDIA 4IZAA 5JFVA 3F69A 1NA7A 2PE0A 4AZEA 2YWVA 1WAKA 2GQSA 3QKMA 2VO6A 3FBVA 3PSBA 1YWRA 3R22A 4RIYB 4BL1A 3N4VA 3GU4A 2WFYA 4TYHB 1YXVA 1E1VA 4KIKA 4FBXA 1SZMA 2W4OA 4OGRA 4LGGA 2HZ4A 3DTWA 3LIJA 3RHKA 3QZIA 3GGFA 2JAMA 3LMGA 4V0GA 2BIYA 3Q4CA 1Y57A 3W8LA 1YVJA 3PXRA 3OWJA 5FD2A 4I21A 4OT6A 4EHGA 4I23A 5HEZA 1U4DA 4NSTA 2BAKA 4S2ZA 4CKIA 5EG3A 3F82A 4J71A 2PVFA 2W1IA 2PUPA 4CMTA 3RAKA 3UQGA 3GC8A 4KIQA 2XIXA 3DBEA 3BLRA 2X7FA 2BDJA 2PVLA 2X7GA 3QD2B 3VC4A 1RJBA 4HZRA 4RIWA 1ZYDA 4MD9E 4O0VA 4FF8A 5HG8A 4U8ZA 2FSTX 1BX6A 2QR8A 1DS5A 2B9IA 2J51A 2V0DA 1PXLA 3ROCA 2O0UA 2VTHA 5DPVA 4C3FA 4JVGA 4XV9A 3C4FA 4YJSA 2UW5A 1BL7A 2V7AA 4RG0A 5CNOA 3OW4A 1IG1A 2W99B 3CKXA 2J9MA 3G90X 2OJGA 5HHWA 4FSQA 4CFUA 1OBGA 3TL8A 4PWNA 5A6NA 2R3RA 4C4JA 4KSQA 3HRFA 4CYIA 4I5HA 3F5GA 2HWPA 3QD0A 4QP7A 2CGWA 2QOCA 3KGAA 3LM0A 4U40A 3V5LA 4GKHA 5AP5A 3O8UA 1M7NA 3VRZA 2Y0AA 4AOJA 2PZRA 2C3JA 1YHVA 1YXUA 4IAFA 3IW4A 1Q3DA 2GNLA 3LKMA 4JBPA 2B54A 3FDNA 2HXLA 2P4IA 3UIMA 2IVTA 1OITA 5HOAA 5EOBA 2YCFA 1PXKA 2YLEA 3ALNA 3GCSA 3UJGA 4C4HA 2W9FB 4QQ5A 4U9AA 3V3VA 3DB6A 4F9CA 4OTGA 3QQGA 3U6JA 3UO4A 2BRBA 4W9WA 4BDAA 2OO8X 3PWDA 4IAYA 4C58A 4DH8A 3OT3A 5L2TA 5CVGA 2I1MA 5FTOA 4UALA 4DGMA 2QHMA 3F3ZA 4AZFA 3QQJA 5CF6A 2FYSA 3OEFX 4UYNA 3CSVA 3FMEA 4G3DA 3PLSA 4EOKA 3KXGA 4UMQA 4UXQA 4W4YA 4G3CA 4TNDA 5IKWA 4YTFA 1FVRA 4O7NA 5M51A 4XRJA 4EYMA 1KE7A 4O27B 4ZAUA 3FLSA 5ANGA 3UO6A 4RJ8A 4TZRA 1KE5A 2V22A 3JXWA 3TDWA 3PP0A 5F20A 3PJ8A 3WI6A 4C4IA 3E93A 3U87A 5HZNA 3HV6A 4QMYA 3TNIA 1DAWA 2PVMA 1OPKA 5CNNA 3NAYA 4KWPA 5DT3A 4DAWA 3FQSA 2IPXA 3OXIA 4M69A 4YZ9A 3FQEA 3PLAE 3BGZA 3BYMA 4PPBA 3MH3A 2C6EA 3OOMA 1ATPE 4GUBA 2J5EA 4JDIA 5DE2A 4BY9E 2XA4A 5CSPA 3COMA 1ZMUA 2UW8A 2P3GX 4U43A 2C3IB 4X3FC 3LFCA 4D2RA 2Z60A 1WBTA 2FUMA 3ZCLA 1W0XC 4KIKB 4LRKA 4F1OA 3M42A 3TACA 4Z9LA 5JK3A 3PZHA 3LMHA 4DTBA 1JPAA 2G15A 2VTAA 5CANA 5CEIA 2WTKB 3LLTA 3V5TA 4MBJA 2C1AA 2C30A 5JFXA 5KO1A 5FRIA 3CTQA 4FTUA 4G6LA 4WUNA 1WBVA 2V7OA 4LUDA 2RFEA 4QPMA 3ORIA 5D10A 4RMZA 5AP2A 3RI1A 4GG5A 3SX9A 3UVQA 3ZS5A 4M0YA 4B8MA 4DFUA 3QTRA 3C9WA 2YM8A 2HAKA 2OXDA 2WMUA 3S95A 3QTZA 4BIEA 4BYJA 4IB3A 4FT5A 4OBPA 2YM6A 2XK9A 2RGPA 4AZWA 3QQKA 2PYWA 5DEWA 5BX0A 2IVSA 1VEBA 3CQWA 4RX7A 4XNEA 4YJTA 4F7LA 4QMUA 5CVFA 5FWKK 5C8MA 4L8MA 2H9VA 3FY2A 4OT5A 3TV6A 2ETRA 5IQDA 4M0ZA 5HCZA 3Q9ZA 4JL9A 2C6TA 4KB8A 4AGWA 5K5XA 1TQMA 3TUCA 1J7IA 4JS8A 3V6SA 2EXCX 4BZDA 3QUDA 5AR5A 5DGZA 3FMHA 2EXMA 3R2YA 5CX9A 4JRNA 2OF2A 2NP8A 2QKRA 4AOIA 3FZ1A 1H27A 2R3LA 1XBBA 3VF9A 5E91A 3AQVA 1Q8WA 1H1RA 2I0HA 3OOGA 3U4UA 3PG3A 4ACMA 3UPZA 1CM8A 4S33A 3WOWA 2UZDA 4IWPA 3KMWA 4ZOGA 2PZIA 5ANDA 1BI7A 2QKWB 2ZJWA 3DBQA 4DEEA 3BRBA 3MTFA 3FKOA 4KD1A 4U0IA 5AAGA 1H1QA 2BRHA 2XS0A 2XJ2A 3A99A 3ENMA 4FTIA 4MXZA 4RVLA 5I3OA 4C33A 2JIVA 4E26A 3OY1A 2HOGA 3ENHA 3G5DA 2JAVA 1VYWA 4U44A 4G5JA 3ORXA 1YXXA 1MUOA 4JG7A 4KKEA 4RA5A 3ZO3A 4Y5QA 5CLPA 1XBCA 1M2PA 3FMJA 3H3CA 4Y85A 4YJPA 5CY3A 5CSVA 4NYEA 3NW6A 3EOCA 4QPSA 4U3YA 4FICA 1JBPE 2BFYA 1ERKA 3E3PA 1XH6A 3PVGA 2WQNA 1H0VA 4WRGA 5A46A 1PYEA 2W17A 2ZM1A 3HMIA 1Z5MA 4WG5A 4PY1A 5C26A 3TWJA 5IA1A 5HNBA 2QOOA 2YCRA 4PTEA 4HNIA 5FEDA 2RFNA 2GPHA 4R3PA 3KXNA 4I6QA 4IC8A 5HBHA 2B0QA 5EM5A 5BYZA 2IO6A 4QTAA 4PV0A 5CXHA 5LMKC 3I6UA 2H34A 4CV9A 4GW8A 4CKJA 2BPMA 2W1FA 2YHVA 4IFCA 4XG7A 2W1ZA 1APME 4ALUA 1JKKA 1H1PA 4FKTA 2ZYBA 3M2WA 3Q6WA 4M8TA 4RLLA 3UDBA 3COIA 3Q53A 4QQCA 3GBZA 4O7LA 1GJOA 3RAIA 2R3NA 2XRUA 4D0XA 4KBCA 5E1SA 1V0BA 2GNHA 4GYIA 5ANEA 3MI9A 3FZPA 2IZUA 3EFLA 5FLFA 5EKOA 3A62A 2VWBA 3FYJX 3L8XA 4FTOA 3I60A 4ZJIA 4I92A 3UIXA 3ZM4A 4CVAA 3HRBA 4MF0A 4CZTA 4LV8A 5IUIA 3WZUA 4AW1A 3DXPA 4HGEA 4WG3A 3RNIA 4TW9A 3MY5A 4D28A 5E8XA 4L7FA 2QOQA 5CWZA 4ZTNA 3OROA 4QO9A 4CXAA 5CEPA 3HMMA 5BNJA 3R1SA 3VUKA 2VGPA 2CMWA 3R02A 3PVBA 4F6SA 5AV4A 1YI6A 4FEUA 3LCDA 2REIA 4HGLA 5KHXA 2XMYA 4V05A 2PVJA 3R1YA 3HGKA 4BDGA 3EKNA 3FKLA 4ZY6A 2JKKA 3LQ3A 3AGMA 2YZAA 3RPYA 1JQHA 4ZSLA 4JDJA 5AAEA 4D2VA 3AD5A 2PUUA 4ZTSA 4AGUA 3MFUA 2RFSA 3MIYA 4H3BA 4AW5A 2E9NA 2HYYA 1Z57A 1P2AA 5DYJA 3ETAA 2VV9A 2W5HA 1KOBA 2OXYA 1P14A 1ZOEA 3MVLA 5JQ5A 3G6GA 2CCIA 4UXLA 3OF0A 4HGTA 4FSMA 5HTIA 3MSSA 4ZTHA 3MH2A 3FZSA 3ZLYA 3ODYX 2CJMA 2EB3A 3RPSA 3NYXA 2PE2A 4FYNA 4AF3A 1IR3A 4DF3A 3TTJA 3HECA 5KUPA 3UP7A 3NGAA 4U5JA 2J5FA 4FL2A 4XP3A 3ZOSA 1OKYA 4J98A 3VN9A 5JMSA 2J0IA 2QD9A 4QMVA 4Q9ZA 2J0LA 4ENYA 5BYYA 5JGBA 4FIGA 4CD0A 3WARA 3RWPA 5KHWA 3CY3A 4IEBA 4Y73A 4YTCA 5J5TA 2AUHA 2EXEA 2XCKA 4U45A 4UZHA 2CSNA 3RM7A 1J7LA 3IW5A 5EHOA 5AUTA 3EJ1A 3R01A 4P90A 4XHKB 2WMRA 1URCA 1JSTA 2GHMA 3KCFA 4AW0A 4G31A 1LEZA 2WIHA 4NTTA 3PE1A 3W55A 4G6NA 2C6LA 3GCQA 4G9RA 3O0GA 1M17A 2GSFA 5CI7A 5CAUA 4UWBA 4FYOA 3EB0A 4HNFA 4PMMA 4N6ZA 4GVJA 4IZ7A 4NJ3A 2OU7A 4CSVA 4NM0A 4MQ1A 2O8YA 3UMWA 3BU5A 3F3WA 3G2FA 4KABA 4I94A 4NK9A 3ZBFA 4JNWA 3O7LB 4PTGA 4NWMA 4U6RA 4ACCA 4DEBA 3P79A 2PVYA 3MBLA 4UZDA 2XEYA 5LJJA 3KXMA 3QRUA 1KV1A 4IVCA 4JG6A 5KE0A 4NCTC 2OK1A 2OF4A 4KS8A 4FNWA 5AUVA 4M84A 4APCA 3K5VA 3R8LA 3NUNA 1E9HA 3V8TA 4G17A 1ZOGA 3HV4A 1U54A 3ERKA 3R7IA 4CFFA 5GZ9A 5J9ZA 2F9GA 3KB7A 1P4FA 4YU2A 3V04A 4C38A 5H9BA 4DEHA 2CN8A 3VO3A 5GHVA 4APPA 3MY0A 3RJCA 3TZ9A 5IQAA 1PMVA 4FZFB 3HKOA 4PDOA 3U54A 3BWJA 4RFYA 4Z55A 3VS7A 4RIWB 5HX8A 3UYTA 3VBYA 4H1JA 1BI8A 5JRSA 4MXYA 2YLFA 4ERWA 4OTPA 1W84A 4NCTA 4KIOA 5BUJA 3FMNA 4IIRA 3LQ5A 3TNQB 4BCQA 3R2BA 3QGWA 4AX8A 2QODA 1JWHA 5T3QA 4EH3A 1PXIA 2BZIB 1XO2B 4EOQA 1ZLTA 3FLYA 4FV6A 2CCHA 3CCNA 4RQKA 4AN3A 2PMNX 2X2LA 4H1MA 4ZIMA 1CSNA 3CJGA 3RPOA 4DTAA 4LRMA 4RRVA 3KRLA 5K3YA 2W7XA 5CALA 5DR2A 2W0JA 4ANBA 1SVEA 2QOLA 3OTVA 5LOHA 2PPQA 3BQRA 5ACBC 5HORA 1L3RE 5HE0A 3TXOA 5AA9A 3VF8A 2PUIA 3VIDA 2XM9A 4BIDA 2C0OA 3KXZA 4MH7A 5DFPA 4CMOA 5AFVA 2GU8A 3O17A 3WE4A 2R3GA 3LVPA 2CGVA 4YBJA 2ESMA 2XNGA 3QXPA 1FBNA 1XR1A 2AC3A 3NCZA 3Q52A 3SDJA 5G1XA 3Q4TA 4O7ZA 4QMPA 4ZTMA 4FT7A 1MQ4A 3WZEA 4C7TA 2IZSA 4F70A 3KEXA 3P7AA 3O23A 4G6OA 2FO0A 3E3BX 3KRXA 4BKYA 4DBNA 3EQRA 4XP0A 2X8DA 2OLCA 4KBKA 2UZWE 5TKDA 2F7ZE 3U9NA 4F9WA 5J9LA 4X3FB 2VWVA 4EK5A 4C4FA 3Q9WA 4FR4A 4FTLA 1FMOE 5HGIA 4RWJA 1OI9A 4F9YA 3QGYA 5E9EA 3MYGA 4TWOA 2UUEA 4Z3VA 1JOWB 1TVOA 5B7VA 1Q8UA 2PU8A 4IAZA 2E2BA 2W06A 4C34A 4KINA 3ID6C 4CQEA 3E63A 3JPVA 4NFMA 2OWBA 2BILB 2VTMA 5EW3A 4S32A 4E7WA 5AUZA 5CT0A 4OAUC 2NRUA 4HPTE 4D9UA 5LVOA 4W8DA 4F1TA 4BN1A 4HVIA 3I7CA 5BMSA 4O6LA 2WHBA 2XH5A 3SKCA 5EDQA 1PXMA 2PMOX 2ZV9A 2B9JA 3PIZA 1OPLA 2R7IA 5IG1A 3D14A 2B7AA 1U59A 2FSLX 2IN6A 2XNBA 3EN9A 4NTSA 2ZMCA 2HENA 2QOHA 2YDIA 2BUJA 5AR3A 4I0SA 3ZLWA 4PMPA 4YJVA 3MTLA 1T46A 3E5AA 2Y9QA 4PDSA 3FZOA 3HDMA 4OTFA 3EQCA 5HD7A 3UZTA 3DDPA 3FKNA 3PIYA 3R1NA 2QLQA 3EL7A 4R7HA 1OGUA 3PTGA 3UZRA 4ASZA 4ZSJA 5D1JA 2HXQA 3ZEPA 3PJCA 3HUCA 3BBWA 4R7IA 5DWRA 3QD3A 4ASEA 4ASDA 4DEIA 2ITVA 4ZZNA 4X2JA 2P33A 5EYKA 3ZXZA 3F9NA 3A7HA 3EN4A 3LXPA 3RZBA 5BVKA 4DN5A 2YN8A 4NM7A 4NM3A 3OZ6A 3Q60A 2PHKA 3NYOA 3A4PA 3UVPA 3QTIA 4ANMA 1YW2A 3FL4A 3KCKA 4GYGA 2OIDA 5L8JA 4E6DA 5I3RA 3QTQA 4IM0A 5CSHA 4M97A 3GI3A 4UBAA 1A48A 5CASA 3M11A 3SQQA 3R63A 3W1FA 3ZMMA 5JEBA 5L8LA 5DA3A 1V0PA 5LMAA 5C8KA 4ZTQA 3IGOA 4FIIA 2C6KA 5IUHA 4RBLA 2QVSE 3DAJA 5JFWA 3KN6A 3AD4A 2X0GA 1QPEA 3GUBA 1Q62A 2HELA 2ITNA 2Y4IB 3LE6A 2BZJA 1WVWA 3PVWA 2UW4A 3BQCA 4G16A 3ZEWA 4EH7A 5HVKA 1O6YA 3IOPA 4ZY4A 3AT3A 3NYVA 3LFEA 4BYIA 3DLZA 3FZTA 4B8LA 2J50A 4YHJA 3RCJA 3P5KA 4NUSA 4BBFA 2CNUA 4L7SA 1OIUA 1OKVA 2HZNA 3FE3A 2ITXA 3WF9A 5HTBA 2J0JA 3GVUA 3QF9A 4OBQA 1UNLA 3DKGA 3HEGA 3BYOA 3OEZA 4BCKA 3FI3A 3LJ2A 4RIXA 4MEDA 3UYSA 2B52A 3F2RA 3MH0A 3MA6A 4QP3A 4HCUA 4Q2AA 2R0IA 3I4BA 4QP2A 1NW1A 1ZWSA 2JKOA 4DFXE 5KNJA 2VD5A 5L6OA 3D2IA 5EK7A 4V01A 1GIHA 4O0YA 4A06A 4YBKA 5EQEA 5FM3A 4CLJA 4HCTA 3HP2A 4IZ5A 4DE4A 1REKA 1W83A 3KK8A 2OH0E 3A61A 4WHZA 3IDCA 5DH3A 2WGJA 3HZTA 5J1VA 4EJNA 4B9DA 4GK2A 1SVGA 4YNEA 3E8EA 2VWWA 5HKMA 5EI6A 3CQUA 3DT1A 3C0IA 2XB7A 1XH5A 2OJIA 4YZCA 2WTJA 3GCUA 3P0MA 2WOTA 3DAEA 3DBFA 3L1SA 3SG9A 5L4QA 4BZNA 3KREA 2C5XA 3GC7A 3G9LX 2XP2A 3D7TB 4D2WA 3JY9A 4E8AA 5AUUA 2WB8A 1WCCA 4TYJA 5GJFA 4AP7A 4FVPA 1KWPA 3ODZX 4RVMA 2C5NA 3EQGA 3MA3A 2WU6A 4DGGA 4O91A 4MXAA 4X2KA 3QUPA 5LXMA 3IGGA 4IX6A 4YPDA 3ZZEA 2PZ5A 5H8EA 2X2KA 5IQHA 4FTJA 3FI8A 5T6KA 5GJGA 1FGKA 4FG8A 5H8GA 5D7AA 4BTMA 2A19B 3BE2A 3RZFA 3ZHPC 1W8CA 2IWIA 1OBDA 4YJUA 3ACJA 4AT5A 1I44A 2I7QA 4ARKA 3PJ2A 2Z2WA 3ORNA 2WMSA 2ERZE 5DRDA 2JDSA 2J2IB 4ZS4A 2W4KA 5GIOE 4HOKA 4QTBA 1SVHA 3ZFXA 4L45A 4BWPA 3DGKA 4LMUA 3V51A 4WG4A 5DBXA 3BV3A 2YCSA 4C36A 5IMXA 4FV3A 5JH6A 4DTKA 3BPRA 3NCGA 1XH4A 2R7BA 5ETIA 3R7EA 5ANIA 5CAVA 1DM2A 3GOKA 4F4PA 4PRJA 3AC2A 1QCFA 3R9RA 1U46A 4YLJA 2UVZA 4C3RA 4BKJA 4DH1A 4HVSA 5DR6A 2YM7A 3SW7A 2BR1A 2BVAA 3PRIA 4MXXA 4NH1A 2DWBA 2XKDA 4YP8A 2ZDUA 4DGOA 1OECA 2AC5A 1M2QA 3L8VA 1YWNA 2GTMA 4C4GA 5LMKA 3RINA 1H4LA 5L6PA 4IFGA 2VNYA 4ANLA 1GZNA 5E8TA 3UODA 3Q4ZA 2XK7A 4DEDA 3OHTA 2OIQA 4G34A 3THBA 3S1HA 2JDTA 4F0IA 4Z16A 1BMKA 2GS2A 1Q24A 3TDVA 4NT4A 4NZWB 2WMXA 3KKVA 4MK0A 5GJDA 4HYSA 3SA0A 4OTHA 3CJFA 5M55A 4FT0A 4UWYA 4BC6A 3JY0A 4CQGA 3IDPA 3Q5ZA
chains in the Genus database with same CATH superfamily
4L01A 5CT7A 3W0NA 1OM1A 1PF8A 4OAVB 2R9SA 5HD4A 4QTEA 4JG8A 2YISA 3EKKA 2VWXA 2WTIA 2XIZA 3OD6X 2VTOA 3R21A 3QLFA 4FIFA 3PIXA 3DZOA 5CI6A 1ND4A 3EN6A 5CAQA 4NJDA 2ZV2A 5DT0A 3SRVB 4F63A 4HW7A 3NW7A 3QKLA 3VUIA 3ZUUA 4IM2A 2X9FA 4F7JA 1OUYA 4NW6A 5HIEA 4AE6A 2Q0NA 2PVHA 2OW3A 3O8TA 4BF2A 2FVDA 2ZB1A 4M69B 4MTAA 4A9TA 5J8IA 3PPKA 3R04A 3A7FA 2O63A 3NUPA 1O9UA 4EH6A 4J53A 5M08A 4R5YA 2HZIA 3OWLA 2R3MA 4OW8A 2BHHA 4LOPA 3WILA 1QPJA 1OL7A 3DJ5A 5IQEA 4YPSA 4F0GA 4AT3A 3RWQA 2AQXA 3POZA 2J7TA 2R5TA 3O5AA 3NUAA 2JDOA 5HNGA 2W4JA 1JKLA 1J3HA 3FMDA 3IK3A 4C3PA 4ITJA 3MESA 2RSVA 2W5AA 3NUYA 2QOIA 4M13A 2ACXA 3ZLXA 4EHEA 4J97A 2O2UA 3PXZA 4PPAA 5C9CA 4BCJA 4AS0A 4C8BA 5KMMA 4AZSA 2B9FA 2V62A 4NIFA 4D4SA 3GXLA 5G6VA 4O83A 4ANSA 4X2NA 2WQMA 5AR8A 4YZMA 3BU6A 3QC9A 4O7VA 1NY3A 3ZZWA 1UNGA 2PVKA 3D2KA 4MF1A 3GB2A 4H39A 4D4YA 3R9OA 4G3EA 3C0GA 2WMQA 3DU8A 5AX3A 4U80A 4UY9A 5A4LA 2YJRA 4E5AX 3L9PA 3TV4A 3ZYAA 3F61A 2JKQA 3ORPA 1R3CA 3AC4A 4JXFA 5I0BA 4MAOA 3TUBA 5BVEA 3OP5A 1SMHA 4BDEA 1Y91A 4GUEA 3W2RA 2G01A 3P23A 3EIDA 3NUUA 5KZ0A 3UC4A 4FKGA 4R78A 2ZMDA 4GK3A 3NDMA 2X81A 3PJ1A 5GZAA 3O51A 2QU6A 5E1EA 3C5UA 3PE2A 3DBCA 5LVPA 4O1OA 3TIYA 1QPDA 4EH4A 4KRDA 3P7BA 4MBLA 1ZAOA 3LCSA 3OBGA 3R8ZA 4FIEA 1G8AA 3HP5A 4J96A 4DEAA 2O3PA 4AQCA 4FZAB 3JR1A 4S31A 5H2UA 4PNIA 4CTCA 3E8DA 3NLBA 1SYKA 5DI1A 3C5IA 1GZ8A 1OL1A 5ETFA 1BLXA 4S34A 4WBBB 3EN5A 3VS6A 2X39A 3VS1A 2LGCA 2YIRA 5I9VA 2JDVA 5EDPA 4O4EA 5LARA 2DUVA 2UW3A 3EYHA 1ZZLA 4FKRA 4RJ5A 3W2QA 4FTAA 4LGHA 2UVXA 5CEOA 4M67A 2VTPA 4K18A 4K2RA 4XG3A 3PSDA 2EUFB 2EB2A 2B55A 5HO6A 5JSMA 5HBEA 4IXPA 4JLCA 3NVKI 3GCVA 2C6DA 3Q2MA 1LR4A 3V5JA 5EM8A 4D1ZA 3FLZA 2ITQA 3VUMA 4ANNA 2PE1A 3R71A 4G1WA 4DG0E 4Y46A 4FNXA 3ZLSA 5CSWA 5HNIX 1A06A 5FXRA 2WEVA 5KCVA 1YHWA 4X3FA 1Q4LA 2B9HA 2GTNA 2YA9A 3R00A 4F9BA 1IAJA 2Y6MA 3HMPA 4I0RA 1SNXA 1URWA 5F1ZA 5HG5A 3I81A 4FGRA 2UVYA 4IDTA 3CC6A 3E62A 4RX8A 3PY3A 2BRGA 2O5KA 1KE8A 1GZKA 4HGSA 1A9UA 4C61A 3ZC6A 3QWJA 3U51A 3LLAA 5IUGA 4FIHA 3FMLA 3UP2A 4EONA 2C5VA 2WTVA 3RNYA 4DA5A 4FG9A 3FMMA 4C2VA 1Y8YA 3GU8A 3P1AA 3MVMA 4F64A 1XWSA 4Q5EA 4O82A 4J99A 3H30A 3IQ7A 4K11A 5ANOA 4E4MA 3TKUA 4CEGA 3V01A 3EFWA 4E20A 2BROA 2WXVA 3D0EA 4X2FA 4AU8A 1Y6BA 2I6LA 2YDJA 4ITIA 3RPRA 1Q8TA 3AOXA 4Z7GA 4ZLZA 4RFZA 5IEXA 1LPUA 3P78A 2CKPA 2F57A 2CN5A 2VTTA 3VQUA 4FL1A 2EWAA 4LFIA 2W9ZB 4MNEA 4N6YA 3WZKA 5M53A 2A98A 2C1BA 4CRLA 4J8NA 4GJ3A 4BGGA 5IU2A 2WMAA 4K8AA 2YIWA 4QP4A 2X9EA 4TRLA 4GFOA 1M2RA 5D41A 5BMMA 3SXRA 3W33A 4AGCA 4CLIA 4PP7A 4NL0A 3ZSIA 2QONA 3GFWA 4CG9A 2R3QA 3BV2A 3LFDA 3NSZA 4PL3A 4FE2A 1STCE 3R28A 3T9IA 1F5QA 1ZYSA 2FH9A 3LW0A 1BKXA 4KKHA 1UU8A 4WRSA 4FKVA 5IA5A 3HV3A 2X8IA 2ZOQA 4JBQA 2QQ7A 4UN0C 4ZP5A 3W2SA 4EK3A 2OJ9A 1E1XA 3PA5A 4FV5A 4B0GA 3LXKA 4EOPA 4BI0A 3E87A 3QL8A 4R7BA 3ANQA 4DEGA 1Y8GA 3ZSHA 4BGQA 5CTPA 4XX9A 4YHTA 2PZPA 3R8PA 1K2PA 2WTCA 4MWIA 4QMOA 5JN2A 4O7RA 4J52A 3P86A 3IW8A 2VTRA 4CRSA 3SG8A 4O0SA 3DJ6A 4ZS0A 2BZHB 3RTPA 3UGCA 1W7HA 3FQHA 2UZLA 1VZOA 3MJ1A 1WFCA 4IAKA 5FBNC 3UZPA 2F7EE 4LQMA 3NYNA 3R8MA 1H07A 2WTDA 4C02A 2QO7A 5CF4A 3SAYA 1XH9A 3CR0A 4HJOA 4IVAA 4GT5A 3FC2A 4K6ZA 3OCSA 3ELJA 2HW7A 4EQUA 3VJOA 5M4IA 3C4XA 4CFXA 2OZAB 3DK7A 2XNMA 3E7VA 4EOSA 2SRCA 3FMKA 3IONA 2G2IA 1NT2A 2PUNA 3FPMA 2YDKA 3DFCB 3PSCA 4KSPA 4JBVA 2WMTA 3SHEA 3GENA 4WT6A 3PFQA 1FPUA 2W96B 3MH1A 4Y95A 4V04A 4R77A 1JKSA 2CDZA 3OUNB 2XAMA 2JFLA 3H0ZA 2Y7JA 2Z7QA 4DHIB 2GS6A 2VO7A 2XYNA 4FVRA 1IRKA 1R78A 4S30A 3TNWA 5DHJA 5AMNA 3WF7A 3BBTB 4FV9A 4CMUA 1KSWA 4IX4A 4P4CA 5A6OA 5IISA 2NNWB 2R0UA 3G33A 1CKJA 4FZ7A 4EC8A 1R1WA 1JAMA 1JKTA 1H08A 5DNRA 3ITZA 4QYFA 3NW5A 4TYEA 1UWJA 3WZDA 3D83A 4CZUA 4FV1A 3IDBA 4G3FA 4J1RA 1VLRA 4JQ8A 2AEGA 4FEXA 2PTKA 3BHTA 3IO7A 3ORTA 3QCSA 4FVQA 4Y5HA 5A4CA 3VHKA 2C3LA 3Q3BA 4AW2A 1TKIA 3REPA 3F88A 2VWYA 3NWWA 3K3JA 3O8PA 4YZDA 2X6DA 2YJSA 3OW3A 3LFSA 2XNPA 2VTQA 2CGXA 3BE9A 3UIUA 1ZY4A 2QCSA 3F6XA 3Q4UA 3N4UA 3I0QA 5K9IA 3BCEA 3KVXA 5AIRA 2ITTA 4FA2A 5M4UA 4O0WA 3DXQA 5HLPA 4BCHA 4GV1A 2XK6A 3JVSA 5KBQA 3GNIB 3EYGA 2OZOA 3N9XA 5KMOA 4BDJA 2EVAA 3TCPA 4IC7A 3A2CA 2R3KA 4TTHB 4A4LA 2PL0A 5CS6A 5FQDC 4IJ9A 4MUQA 2VO0A 2BAJA 3BHHA 4L3LA 3QD4A 4JBOA 4F7SA 4EWQA 4BCNA 4I1ZA 3SLSA 4RIYA 5AUYA 3OCBA 3E92A 3QQUA 2WQEA 4O0UA 4PNKA 4QNAA 5FEEA 3I7BA 1ZXEA 5KKRC 3MPTA 1PXPA 3EZRA 3IOKA 3R83A 1PXOA 4IM3A 4CZYB 3CXWA 2WO6A 5B2LA 1FOTA 3TEIA 3OWPA 3ULIA 4FKLA 4HCVA 4I41A 4YJRA 2OG8A 3MY1A 3OG7A 3UNKA 3C4EA 4O2ZA 5AP4A 4KKGA 4MX9A 1M7QA 3FHIA 4CNHA 4QDEA 5CEQA 4BIBA 5IPJA 4RC4A 1VYZA 4EUUA 4O0TA 4FSRA 4FSWA 4JAIA 2VWUA 4R3RA 5ACKA 1FGIA 3ATSA 5E8VA 2PVRA 4QPAA 4EQMA 4YR8A 5JZJA 2VTSA 5JGDA 4IZYA 3NMUF 4I93A 4I6HA 1OMWA 3PA3A 3U9CA 3QAME 3FV8A 3QHRA 2YITA 3W2PA 3NPCA 2RFDA 3AC3A 4BBMA 4CG8A 3TM0A 3ZFYA 3RBWA 4PL5A 3NEWA 3W8QA 2B53A 3G51A 1YDSE 4XP2A 4YHFA 3KIOC 5HX6A 1J91A 2I0YA 3DLSA 5CYIA 2AYPA 3TUDA 3O7LD 4AWIA 4GEOA 3NNVA 4GH2A 4OLIA 2XNOA 4BCGA 5TOZA 2JIIA 2JLDA 1OZ1A 4DT9A 3EHAA 4BCPA 3NNXA 1J7UA 2J4ZA 2QU5A 4O84A 3TZMA 3AG9A 3WF6A 4N0SA 4YMJA 5FM2A 3Q5IA 5C4KA 1V0OA 5J7BA 4X21A 4YO6A 3BYUA 5L2SA 4K9YA 3CEKA 1H00A 3R9NA 2BIKB 3VBXA 3M1SA 3AMYA 5EYMA 5B0XA 3TG1A 3RM6A 5AADA 4P2KA 2WMVA 2WU7A 3ORLA 3UBDA 1IEPA 5A54A 1UU7A 2I0EA 5I9ZA 4XV2A 5F4NA 2ERKA 3LCTA 4GU6A 1S9JA 3CE3A 3KY2A 4D1XA 3AT4A 4XYFA 4CV8A 3W0SA 3F2AA 4USEA 4JX3A 3OMVA 5LCKA 3HVCA 4FSUA 2F7XE 4K0YA 5A4TA 5IA3A 4FL3A 3R0TA 3UDTA 2R3JA 3K54A 3LOKA 5AUXA 2W1DA 5HLNA 3D5XA 4MBIA 4ITHA 3ZBXA 4UX9A 4O0RA 3KK9A 2W1GA 2OICA 4WOVA 4WSYA 5A14A 4JIKA 2Q0BA 2YAAA 3DNEA 2A4LA 3ZO4A 4CFMA 5I4NA 1OKZA 3KRRA 1OVEA 4LUEA 4PMSA 1ZARA 5ANKA 4BDIA 3VW8A 1FVTA 5EYDA 5E8ZA 3G0FA 4FSYA 4OTDA 4RVTA 4AUAA 4FTRA 4JX7A 4TT7A 5BVFA 5DR9A 2YACA 2G2HA 2BMCA 2QLUA 3L9MA 2JFMA 3Q9YA 3A8WA 4EKKA 4AFJA 4I5CA 2C6OA 3VS2A 1YDRE 4QQJA 4QRCA 5L2IA 4LV5A 2A27A 2XKCA 4PQNA 2WKMA 2XRWA 2X2MA 4QP8A 3F7ZA 4C59A 4W4VA 3C13A 3CY2A 4PDPA 4JR3A 3QFVA 5CQWA 5ETAA 5HESA 5K4IA 1BYGA 5HU3A 5KMIA 2QG7A 1ZMVA 4BDKA 4FI1A 2R4BA 1PMEA 4I24A 4QMMA 4DFBA 2XYUA 4EH9A 3W2OA 4AACA 2RG5A 1RW8A 4BB4A 5BQ0A 2XVDA 4DGLC 3VWAA 4TYIA 3K2LA 1JSVA 5DT4A 4GT3A 5EHLA 3QWKA 4AAAA 4ERKA 3W0RA 1YXSA 3NUSA 2H96A 3QQHA 2BKZA 4FT3A 2KULA 4I4EA 5I9XA 2I40A 4N70A 1Q41A 2WEIA 3R6XA 4RC3A 4ID7A 2DQ7X 4K77A 1PRYA 3ACKA 2V5QA 3DA6A 3Q96A 4IVDA 2UW6A 3RVGA 3QTWA 3R7GA 4Q5HA 4IJPA 4YO4A 2ZM3A 5CF5A 2FA2A 2R3HA 2XBAA 3EL8A 3PJ3A 3RPVA 3TN8A 1ZOHA 4MXOA 3IW7A 2WPAA 3LM5A 3BEGA 3C51A 3NS9A 1GAGA 4A9YA 5E7RA 3KU2A 3HL7A 4J95A 4P5ZA 2C4GA 3ORZA 4RT7A 3PRFA 4XG2A 2UZUE 1V1KA 2YM3A 5TT7A 1RQQA 4GJ2A 4QNYA 3LFAA 3OXZA 3HA8A 4L67A 4U81A 4AA4A 3ZO1A 1XMMA 1U5RA 3F5UA 3PXFA 3ALOA 4HVDA 5KMLA 1HCLA 4G3GA 3KULB 4DLIA 3E8CA 3DY7A 4IQ6A 4TWPA 1T45A 2E9VA 1BUHA 3O2MA 1QMZA 2G9XA 3R7UA 3MPMA 3DKOA 4EBWA 5AV3A 3DQXA 4DFYA 3CS9A 3PPZA 3VUHA 4XG8A 2BFXA 3QBNA 2X0PA 3QKKA 4IANA 4YJOA 3NZ0A 2F2UA 4I22A 2RKUA 4ZSGA 1XQZA 4JR7A 4C37A 3UOLA 2UZVA 3IPHA 4Y8DA 3I5NA 1WBOA 4HYUA 4TWNA 3TJDA 5LQFA 4L42A 2E9OA 3QRTA 2YERA 4USDA 3EQIA 3FL5A 3LJ0A 4O0XA 3W18A 4EBVA 3C7QA 3DQWA 2VUWA 1UNHA 1UU9A 4EWHA 4FRFA 4EZ5A 4E4LA 4L68A 3QA0A 5FXSA 4RC2A 4Y83A 5L3AA 3JVRA 3VBQA 2XKFA 4IB0A 3FUPA 2UW9A 3PUPA 3A8XA 4EEVA 1YKRA 3NUXA 4OTRA 2Z7SA 5DIAA 5LVLA 3R8VA 5BV3A 4XV1A 1L8TA 1U54B 1JNKA 2E9PA 1RDQE 5TO8A 4XG6A 5C8NA 3DOGA 4XJ0A 3ULZA 3HV5A 4IBMA 3ZXTA 3PY1A 4O7TA 5CVHA 3BLHA 5AJQA 3S3IA 5JGAA 1ZYJA 2A2AA 3PG1A 2R3FA 5T68A 5HTCA 2J0KA 4NEUA 3V8SA 5CU3A 5LVMA 5CAPA 2BZKB 4E6QA 2OGVA 3AKJA 4N57A 3L8SA 1PY5A 4EOJA 3AC5A 3A7IA 5TE0A 4QOXA 4D4VA 3DTCA 3C0HA 4FKUA 3SD0A 2JGZA 4EH5A 2BKKA 3LMIA 3D94A 3MIAA 2GQRA 4RJ4A 1MQBA 3NIZA 3B8RA 3E64A 3GQIA 4IDVA 2Z7LA 4J7BA 4JDHA 5FTQA 4LOOA 4YUQA 5KMNA 4X6RA 3WIKA 3MJ2A 3VRYA 4NW5A 2X0QA 3T9TA 2OKRA 4EOLA 2BAQA 4C62A 3KULA 4RWKA 2JBPA 3H9OA 4F7NA 5KBRA 1TFFA 2BRNA 2IJMA 2Y8OA 3I5ZA 3G15A 5M06A 4E3CA 3QX2A 1YI3A 2RG6A 4QYHA 5DRBA 4G2FA 5AWMA 5IQGA 3D15A 4QMLA 2C5YA 2Q83A 3VUTA 4G5PA 1IAHA 2X7OA 3WZJA 3HLLA 4M66A 3Q04A 3OT8A 2XEZA 3QYZA 3C4CA 4IH8A 3I1AA 4MXCA 2GMXA 2VU3A 2ITUA 3KL8A 4YSJA 4F0FA 3DFAA 3JYAA 5C03A 3GC0A 4M12A 5GIPE 5D12A 4B7TA 3FXZA 5IQFA 3OUKA 2VN9A 3BU3A 4ALWA 3OY3A 3PPJA 4QMNA 3LQ8A 2C0IA 3QRJA 2C68A 1IASA 4R1YA 2OZAA 4JI9A 3RAHA 3B8QA 3OS3A 5E8YA 4D5KA 5LVNA 3MPAA 3CGFA 5FDXA 4FV0A 4I5PA 3VHEA 4AFEA 2B4SB 2W5BA 4BTKA 5K5NA 3IG7A 4O86A 1LUFA 3D5UA 3CD3A 3QRIA 3ZU7A 4EZ3A 5FEQA 2R64A 3HA6A 2WQBA 3KF7A 3DPKA 3OTUA 3NAXA 2YWPA 2V55A 4I6BA 5J9YA 5IQIA 3RK7A 3TZ8A 2OFUA 2XBJA 3LFBA 3UPXA 4Z7HA 3C50A 4GS6A 4H3QA 3IW6A 4AT4A 3QQFA 2XAOA 4E5WA 2F4JA 1B39A 2JITA 5J5SA 3N51A 2X6EA 1NVQA 5K4JA 3H4JA 3ML1A 2GNIA 2A1AB 1UA2A 3ANRA 3QQLA 4XLIA 5AP1A 3ZTXA 3G9NA 5ETCA 3QZFA 3U8WA 2PMIA 4RX5A 3MFTA 4XOYA 3EQPA 4FTNA 1QPCA 3FAAA 4YC6A 5GINE 3GP0A 5BVWA 3GU5A 2YCQA 3FLNC 3IECA 2VX3A 3TIZA 3WF8A 3OXTA 4QYEA 5HBJA 2C47A 3DKCA 2OSCA 2XARA 3OC1A 4I4FA 4BKZA 5M4FA 3TNHA 4HYHA 3UG1A 2PULA 4DDGA 4ZK5A 3AC8A 3Q6UA 3ZRLA 5F9EA 3F66A 4M15A 3D5WA 2YM4A 4F99A 1I09A 1PW2A 5IQBA 5M07A 4QP1A 4B6LA 3T8OA 3KRWA 3F3TA 2JKMA 4O2PA 3W32A 1PMNA 4ZLYA 2XNNA 1WVYA 4WNPA 4WKQA 3VVHA 4A9UA 2R2PA 3BYVA 2GHGA 4CGAA 4FTCA 3QLGA 5AP7A 3EQHA 2ZAZA 3VS0A 3A7JA 4D2PA 4JIAA 3POOA 3KC3A 3ZDUA 4FTMA 5DN3A 3QHWA 4II5A 4B99A 5DLSA 4GFGA 2OJJA 4FNZA 5F94A 3SOCA 4X7QA 3QYWA 4ZTRA 5D9HA 5C27A 2QI8A 3F3UA 4ZY5A 1J1CA 4X2GA 4OTWA 3F2NA 3L9LA 5J1WA 4O7YA 5E4HA 5M4CA 4ZSAA 2XK4A 4UMPA 5AA8A 5C4LA 3RHXA 4ZTLA 3BLAA 4QT1A 4YJQA 4L44A 2IW8A 3VBWA 4E73A 4DCAA 4XCUA 3UIBA 3MFRA 3MN3A 4LG4A 2CHLA 3TT0A 1KV2A 3QCQA 4ZJJA 3VJNA 5I5ZA 5JRQA 5M56A 3H9RA 1OB3A 2C3KA 4FKOA 4PTCA 1ZY5A 2YIYA 4YTIA 2P2IA 5EOLA 4FUXA 4MD8E 4L6QA 4YC3A 3ROYA 5CAOA 4I20A 3AC1A 2X1NA 3UDSA 3MB6A 2PVNA 4W9XA 3SC1A 4KNBA 4ZLOA 4NU1A 4F78A 4QMZA 3CPBA 5AAFA 1Q3WA 2UW0A 3NVMB 4FSTA 4UMTA 4QQTA 3C4WA 2OBJA 2YZLA 4BHNA 3FWQA 3ZUVA 2ITYA 4EK8A 3O71A 4YC8A 5I9UA 2UZOA 4FEVA 4C4EA 4R1VA 4CTBA 2BTRA 4UWCA 1H0WA 5TF9A 2XNEA 4QP6A 4D55A 4FOBA 4NM5A 2HCKA 3TI1A 4EORA 5C1QB 4LMNA 2GHLA 4O81A 2NRYA 4FT9A 5FG8A 2IZTA 1P4OA 3HX4A 1PHKA 4EK4A 5BPYA 1GY3A 4GIHA 4RFMA 2OH4A 4A9RA 5A9UA 4P7EA 4YLLA 3UOJA 1XH7A 2XIYA 2YEXA 4P5QA 5EKNA 4IX3A 3OCTA 4RLKA 3UO5A 3FPQA 3L9NA 3LJ1A 2CLXA 1GIJA 3PA4A 4KBAA 2I0VA 4FKQA 2QOKA 5EW8A 4ALVA 4AXEA 4TPTA 2DYLA 1LEWA 4E6AA 4W8EA 3NIEA 4FTQA 5EW9A 4EOIA 2XJ0A 4W4XA 4X3JA 5BVNA 3VW6A 3A4OX 3II5A 5CQUA 2GQGA 5JKGA 3DV3A 3E88A 1H25A 3FSKA 4H36A 3OFMA 2WZJA 1H01A 2C69A 2WMWA 3Q9XA 3CPCA 3LFQA 5DEYA 2ZVAA 4FODA 4GCJA 4RSSA 3HAVA 3I6WA 2W1CA 3QTUA 3NR9A 3D5VA 3CKWA 4K33A 4FGBA 4LM5A 1CMKE 2WMBA 5EHYA 3R73A 4DFNA 5ICPA 1PKGA 3R1QA 5DMZA 3B2TA 3SOAA 1WVXA 3UE4A 4F1MA 4RQVA 5EI8A 2ITZA 4I6FA 1GNGA 3EZVA 4EOOA 4XV3A 2P55A 4W4WA 5HG9A 3RAWA 3W2CA 4BTJA 4UMUA 5JQ8A 1UV5A 4DG3E 1NXKA 2VWZA 4BICA 4PX6A 3DDQA 4CCBA 2A0CX 4KUJA 3HMNA 1MP8A 5DOSA 3U6IA 4AG8A 4MYGA 4RIXB 5CENA 5FXQA 4MCVA 4TXCA 3BX5A 4K1BA 2W1EA 2H6DA 1YI4A 3ZSGA 3PDTA 2R3IA 3D7ZA 4IHPA 5EDRA 4ZZMA 3BIZA 3V8WA 1QL6A 4FG7A 4RZWA 5CU2A 2IG7A 4O7SA 2GNGA 3BELA 4WD5A 4FZDB 3S0OA 3GEQA 4DH5A 2UZBA 2GDOA 4QYYA 1WBSA 2BHEA 2XK3A 4LL0A 3DZQA 2HY81 1Q97A 2O64A 2QNJA 4DFLA 5AP0A 4QMTA 2JEDA 4XMOA 3DAKA 4JQEA 1WZYA 3EQBA 4OTIA 3ORKA 1OUKA 4LL5A 3BZ3A 5E8SA 3R7VA 3VS4A 5TR6A 5EM6A 4HZSA 5BUIA 3AMAA 4FKJA 1U5QA 3TZ7A 1JSUA 3EQFA 5AM6A 4L00A 2QR7A 2ZDTA 2OJFE 1OIQA 4WUAA 4DDIA 2WD1A 4RWIA 5A4EA 3BGPA 3F7WA 1EH4A 4MWHA 4X6QC 5M57A 1G8SA 4EHVA 3KXXA 2PSQA 5J7HA 1AD5A 3OBJA 2CKQA 5KMKA 2J90A 3H10A 3QX4A 3KRJA 1GIIA 4L52A 5AR4A 4E1ZA 4RWLA 3OWKA 4ORKA 3F5XA 2R3OA 3D9VA 5BYLA 1YDTE 3FZRA 4AGDA 4LGDA 4DH7A 2XANA 1R0EA 4BCMA 2JIUA 3I79A 2VRXA 3BLQA 4JAJA 2YAKA 3EFKA 4D58A 1YOMA 4ACHA 4F6WA 5CZHA 3ZRMA 2QC6A 2ZB0A 3P9JA 3HMOA 4QMWA 2VX1A 3DB8A 4MVFA 3MVHA 4USFA 2XCHA 3FI4A 3MFSA 4BDCA 3PXKA 3DK6A 4WBOA 1UKIA 3MB7A 5AIKA 4D9TA 1ZRZA 4HVGA 2HWOA 3PZEA 4LRJA 4R3CA 4YNOA 5F95A 4BR3A 4YZBA 1VR2A 3CP9A 3WYYA 4LI5A 5L2QA 4IMYA 2GNJA 3KA0A 4BFMA 4F65A 2XIKA 2QOBA 4PF4A 5DVRA 3ZO2A 3ZRKA 4BGHA 4DFZE 3V5PA 4WO5A 5IDPA 5HVJA 3C4ZA 3P08A 2CNQA 2IW9A 2QO9A 3UTOA 3FEGA 1Q8YA 5IEYA 2FSOX 4JRVA 4H05A 5HLWA 3VNTA 1OL6A 4FEQA 1KUTA 3DXNA 3NFGB 2VAGA 1OL2A 1REJA 4BDHA 4ZZOA 2FSMX 4DYMA 3RALA 2ZM4A 3C1XA 3VUGA 4L43A 5IQCA 4DGNA 2XUUA 1W2CA 5CXZA 3ZM9A 3UC3A 3RCDA 3HAMA 4YGAA 1R39A 4PMTA 5AP3A 1NVRA 1F3MC 2PY3A 3I0OA 4FZ6A 4RJ7A 4JQ7A 2UZEA 4ONAA 4CFNA 5FGKA 5ITAA 3ZC5A 3KFAA 3QC4A 3U6HA 4XOZA 5BVOA 3LFFA 5FDPA 2WOUA 3FLQA 3HV7A 3CTHA 4HVHA 3S00A 3D7TA 2IW6A 4TKSA 2JBOA 2W1HA 3QCXA 5HICA 5HE2A 4BBEA 3H0YA 5JT2A 4ENXA 3HRCA 1M52A 5AM7A 4YURA 3BYSA 3K3IA 3QTXA 4IWOA 4MHAA 4M7IA 3DJ7A 1R0PA 3NNWA 2OIBA 4KA3A 4BI2A 4WIHA 1DI9A 4IAIA 4C2WA 5KMJA 3CTJA 1K3AA 4XRLA 4BWKA 2G1TA 4LOQA 2OXXA 4XEYA 4KS7A 2O65A 4BCIA 4O1PA 4DH3A 2GNFA 3CQEA 3QUEA 1Q61A 3CGOA 4HYIA 4X0MA 4A4OA 4FUYA 3LPBA 5IDNA 5IA0A 4E5BA 3ATTA 3EWHA 4FKWA 3WIGA 1ZYCA 4TL0A 5A4QA 1CKPA 3SW4A 3R8UA 4PP9A 4AE9A 1UWHA 3HNGA 3L8PA 5J79A 4BDFA 4XLVA 4NKAA 3V6RA 5EYCA 3S2PA 4ZJVA 4F09A 3QU0A 3FC1X 3SV0A 4GFMA 4KRCA 4F6UA 3LXLA 5HIBA 3ET7A 3AT2A 4I5MA 2LAVA 1Q5KA 3G6HA 4EHZA 1XKKA 3GOPA 5JZNA 4J8MA 2Y4IC 1HOWA 3VAPA 2VTNA 4ACDA 4BRXA 3WE8A 2CNVA 4IWDA 2BDFA 1XBAA 4FSZA 2PWLA 3BEAA 5GZ8A 1UU3A 3AKLA 4FTTA 4KIPA 5IH4A 4LYNA 5AP6A 2WAJA 4YLKA 3UVRA 1YXTA 4EL9A 4RJ3A 1UVRA 4CKRA 4WNMA 3U4WA 4IWQA 1Z9XA 3OCGA 4XUFA 2RIOA 1GOLA 4FEWA 4FV4A 3VS5A 2Z02A 2UZTA 4YSMA 2YM5A 3TKIA 4EOMA 3DBDA 1H8FA 4KAOA 4ZSEA 3A60A 3VS3A 4A9SA 3UOKA 5HE1A 4FMQA 3PY0A 4GRBA 3TKHA 5L6WL 3DK3A 4ZMFA 4BDDA 2X8EA 3PYYA 2JD5A 3MVJA 2GFCA 2VTJA 4DG2E 5IH5A 4C57A 1K9AA 3GCPA 3RKBA 1DI8A 1OIYA 1H28A