1Q3DA

Gsk-3 beta complexed with staurosporine
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
351
structure length
339
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of the Gsk-3Beta Active Site Using Selective and Non-selective ATP-Mimetic Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
total genus 97
structure length 339
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q3dA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q3dA01
1PXPA 2HOGA 3TNPC 4G9CA 4ZTQA 1QCFA 2B55A 3QX2A 2YM7A 5HO6A 3QUPA 4CRLA 4I92A 3FEGA 2UW7A 3ZC6A 3QRIA 5M55A 3WILA 3P7BA 4YC6A 3MFUA 3P9JA 4X21A 3ZRLA 3H3CA 4RJ5A 1PXOA 1U5RA 3ELJA 3EQBA 3ZSGA 4KKHA 1CKIA 2GS2A 3JR1A 4FUXA 5IF1A 3HAMA 2WEIA 2W1GA 1WFCA 5IMEA 2R3NA 4O6EA 3NUYA 1ND4A 4BF2A 2YIRA 3MPAA 4BYIA 1UWJA 2YZLA 2XIKA 5TE0A 5HX6A 5HEZA 2I1MA 4USEA 3PVGA 5E8ZA 5AFVA 4ASXA 5HG9A 4HVGA 5BVFA 3R30A 3QXOA 4BWKA 3LFSA 3GU4A 5BVDA 4YZ9A 2XK4A 3ZBFA 3TJDA 4FGRA 1Q24A 4C4JA 4HCTA 2ETMA 3UOHA 3LOKA 3JPVA 4FV4A 4A4LA 3DFCB 4BCMA 3S1HA 1H24A 1PJKA 4R7HA 5AWMA 4RFYA 3MH3A 3UOKA 4Z55A 4CFUA 5EW8A 4BBFA 1H25A 2PVRA 5DG5A 4PPAA 5HO8A 5L8JA 4DGOA 5IQDA 3CXWA 3DBDA 3MW1A 4F9BA 5IPJA 1FINA 2YACA 4I4FA 4PF4A 1OKVA 5AJQA 2PWLA 5CY3A 5HG7A 5FWKK 4E6CA 4F9AA 2B52A 4W9WA 5JMSA 4EORA 5BPYA 5L2IA 4G34A 3RALA 3MESA 3LPBA 4N6YA 1VR2A 1FVTA 4DG0E 3COKA 3FMMA 5CSWA 2VUWA 1AGWA 5M56A 3WF6A 1RE8A 4M12A 4BVUA 3ZXZA 4NM0A 3WARA 4F63A 3CTQA 4XHKB 3LXLA 4XLVA 5GIPE 4KWPA 5IA4A 4H58A 4UMUA 2E2BA 3WF7A 4RX9A 4I41A 4IVCA 3RAKA 5BQ0A 1JSUA 2OZAB 4DAWA 5F94A 5M08A 5DLSA 1NA7A 4UXLA 3R9DA 5FTOA 4NH1A 4ZZOA 2PL0A 4GK2A 2JKKA 4RQVA 4TTHB 3MH2A 4XS2A 5CVHA 5LCJA 3CTHA 2GHGA 3Q9XA 3ZLWA 4DFUA 2ZDTA 4YJUA 4H05A 4HGLA 2OLCA 2EVAA 1OITA 1YVJA 2XZSA 3UYTA 4HVIA 2NRYA 5CVGA 4BDBA 4DH3A 4TWCA 4CD0A 2B9HA 3LFQA 4OTGA 4EKLA 2PVFA 3OEFX 2E9PA 1J7UA 4IC8A 2B7AA 4MD7E 3NW7A 4CZTA 5LMAA 4DEGA 2HAKA 3A7FA 1HCKA 4IXPA 1OGUA 2X0GA 4EOJA 4NCTC 5EDPA 4EHZA 4H36A 5KBRA 2BROA 5AIRA 3SRVB 5AM6A 5E9EA 2GSFA 1BKXA 1WBNA 3GXLA 3LMHA 4CQGA 3V3VA 4NM3A 4BKZA 2BTSA 2GNJA 3I5NA 3ZO2A 5DGZA 4I5MA 3LXKA 1JWHA 4E4LA 3HMOA 1SNUA 3LM0A 4TYHA 1H27A 5IISA 1X8BA 2VTIA 4KKEA 4EJNA 3C4FA 4I20A 4G6LA 4IB3A 2XRWA 4IADA 4F7NA 3PE1A 2BZIB 1R1WA 4AGWA 3DNDA 3V5QA 2VTMA 3C1XA 2KULA 3RTPA 2WU6A 2CPKE 2UVYA 3QUEA 4C3PA 4IX6A 1VEBA 3VS2A 4A9SA 2OGVA 3CS9A 1GZOA 2IO6A 3A60A 5DFPA 3GU7A 2KTYA 1YOJA 2E9NA 3MBLA 4UXQA 3UE4A 1V0BA 4EH6A 4ZTLA 5HE3A 3R7OA 2BVAA 3LLTA 3E63A 4OTFA 4MXCA 4GCJA 5CX9A 5EHYA 4FEXA 2XNPA 3I7CA 3KXGA 4JL9A 5KMLA 1IR3A 2JDSA 4HCVA 3BBWA 4ORKA 4I5PA 3ZZWA 4YHJA 4E6DA 4IH8A 5HO7A 2VTNA 4J97A 2XEYA 4I93A 4ZJIA 3QLFA 3C13A 2C6LA 4Y5QA 5EM8A 5AV1A 3IECA 5TR6A 4QYEA 4AZFA 3DAJA 4AZWA 1WBOA 3VHKA 4R5SA 4FTQA 5AR3A 3GEQA 1PXJA 4FKIA 3GFEA 3FJQE 5L2QA 2IW8A 4BC6A 3ODYX 2XK7A 3FZ1A 5HOAA 4ACMA 5I9YA 3DJ7A 4R7BA 2F57A 5KKRB 5ANEA 4M15A 1Q61A 4IWQA 4PRJA 4H1JA 3F61A 1FGIA 1XHAA 4DGNA 2B1PA 1BI8A 2YM4A 4YLJA 5F4NA 2E9VA 4GT5A 2VNYA 1U54A 3GGFA 1GY3A 4ZEGA 4NKSA 4XV2A 5HE1A 1M14A 3F2AA 2VTQA 4MBJA 4OT6A 4W4WA 4O0SA 4EH9A 3FMEA 3RPRA 3RM6A 4IZAA 4QMZA 4M97A 4V0GB 3LCTA 4MF1A 1BLXA 4UMPA 3NUUA 5A4EA 5CLPA 2ZDUA 4OUCA 4RA5A 3DKCA 3GNIB 4I3ZA 5HNBA 5KKRC 2X9EA 3G6GA 3QWKA 5CU3A 2GS6A 5CT0A 3UC3A 4FSRA 4JNWA 3P7AA 2F2CB 4P2KA 3ID6C 5IDNA 4IQ6A 4MTAA 3LQ3A 2CCIA 4L52A 5B7VA 4NTSA 4MD8E 2ITQA 4QMVA 4FEVA 5IUHA 3WF9A 3DCVA 3ORKA 2R3LA 4BCJA 1S9IA 3DK7A 5FXRA 4F1OA 4U40A 4C35A 2XIXA 2Z8CA 3BYMA 3O2MA 3VF9A 4L6QA 4BWXA 3B8QA 4CFXA 5JZJA 3CY3A 5HICA 2PVNA 1KOAA 5BYZA 2PULA 3FUPA 1H1WA 2JKMA 2G15A 2VWIA 3IDPA 3CQUA 4LGDA 4AF3A 4AGUA 2I0HA 3TV7A 4D9UA 3QRTA 3IGOA 2EWAA 3QTRA 4MBLA 2G2FA 4NJ3A 3A7JA 3OEZA 2XF0A 3PP1A 4YC8A 5I9XA 4NZWB 5JFVA 3RI1A 2FVDA 3GI3A 5EH0A 3D7TA 4C34A 4CFFA 4QMNA 4YPSA 1FMOE 4J52A 4A9YA 1ZARA 2GU8A 2OBJA 4GVJA 4O6LA 2C6TA 2HY81 2JC6A 2CNVA 2HXLA 3RBWA 3FZTA 4FC0A 4QD6A 2JFMA 4AT3A 1PXKA 3OXTA 3PSDA 3NW5A 3QKKA 5M51A 4BTJA 4RIYB 2BDJA 5BUEA 1RW8A 2HIWA 2BIKB 4EQCA 2GFCA 3R7GA 2QO2A 1WBWA 3I6UA 2VTOA 3OP5A 3G33A 4ITIA 5CXZA 2PVMA 2A1AB 2QR7A 2GQGA 3FQSA 2PTKA 3AXWA 4HOKA 5HD7A 4FF8A 1YDRE 5A4LA 5DH3A 4F0IA 3SVVA 4AZSA 5CU6A 3IS5A 3K5VA 5T68A 3FYJX 2R3IA 4ZSGA 4MK0A 4DCEA 3QGYA 4OBOA 3FPQA 4UMTA 4WKQA 1UNGA 4FG7A 2JGZA 4XP0A 4D2TA 1H0WA 4R6VA 3C4ZA 3DXPA 1ZYCA 2VTLA 5IQHA 3QL8A 2QOFA 2X1NA 4AACA 4NW5A 2C6EA 4D2RA 3KXMA 2YWPA 2V7OA 2XYUA 4O7TA 4YLKA 3MVMA 1SMHA 4FA2A 4Q9ZA 3AGMA 4ACCA 4G9RA 4BDEA 3QZGA 2C5OA 3LFFA 5ETFA 4BDIA 5AV4A 1XBAA 4TWOA 5ETCA 3HECA 3QQHA 2R2PA 4WG3A 3EYGA 4FNYA 1YXSA 3WIKA 5IQEA 2WMVA 3HV3A 3OUNB 2C5VA 1DS5A 3TNQB 4E73A 2XUUA 3ZC5A 2CLXA 4QNYA 5E90A 2FB8A 1MRYA 2VAGA 1Q3DA 3RAIA 3UNKA 1XBCA 3NIEA 3PG1A 2JIVA 5K0XA 4GT4A 2CGWA 5BVKA 3BV3A 3R9NA 5KHWA 4NCTA 4BHNA 3VRYA 3UOJA 5M4UA 5A9UA 3WI6A 4E5WA 3ORMA 4AG8A 3UZRA 5A4QA 4IAZA 4EOMA 3E3BX 2WMAA 2VTJA 4FMQA 5E7RA 1JKLA 5L2SA 1GZKA 1H08A 2JIUA 3F5UA 5CI6A 2HZ4A 3VUGA 4GRBA 4YBKA 4DA5A 3FZRA 3DTWA 4H1MA 4EQMA 4YJQA 4O2PA 4YR8A 4BR3A 1Q62A 4CFWA 1IAJA 3MPTA 4ZS0A 1OM1A 2VO0A 1ATPE 3R22A 2RGPA 5FXSA 2CN8A 2VO6A 4MD9E 4RVKA 4ANSA 4ITJA 5AR7A 4BWPA 1QMZA 4ZTRA 5L2WA 3U6JA 4BY9E 2JD5A 3HGKA 4ZJVA 4CSVA 4DGLC 3QTQA 3P1AA 3C4EA 5J95A 3Q9ZA 4WD5A 3JUHA 4EK8A 3SQQA 2ZV7A 4XOYA 3VVHA 5IKWA 1VJYA 2VO3A 4KBAA 5GZ8A 4MHAA 3NYXA 1YDTE 2JAMA 3JVSA 3QU0A 3T9IA 4YPDA 4APCA 4M3QA 1P4FA 4IZ5A 3W1FA 3W2SA 4YU2A 4PP7A 2I0YA 3QCXA 4HPTE 1JPAA 3P79A 3UQFA 5HCYA 4EZ7A 4RMZA 3D0EA 4FKJA 5HE2A 4U3YA 2JDTA 3FMJA 1K3AA 3MVHA 3Q4CA 1OECA 3E8CA 3VUTA 3HLLA 3C5UA 2Y6MA 2XNEA 1UU7A 4NSTA 3C9WA 3C4XA 5CTPA 5D7AA 3L9LA 4FV6A 2W1DA 4G5JA 5KMNA 3COMA 4H3QA 5BMMA 3PLSA 2J51A 3GVUA 5M09A 1OIRA 5KZIA 2YAAA 4WA9A 3CKWA 4GH2A 1B6CB 4L3LA 4N0SA 5C4KA 1W8CA 4HGEA 4E4NA 4R8QA 4LFIA 3D2KA 3DZOA 4TXCA 2ZB1A 4E3CA 2OW3A 4B0GA 1GJOA 2WOTA 4QMUA 3OWJA 2B53A 3H10A 2WQEA 4IM2A 4UX9A 5FGKA 1R0PA 2X7OA 4L7FA 2VWWA 4GFGA 4NYEA 3G15A 2FUMA 4DFBA 1H28A 2YCSA 4R3PA 4U45A 4KAOA 2QHMA 3EN7A 4EBWA 3HUCA 3QQLA 3TACA 3MFSA 3QD3A 4WUNA 2VX0A 5DRDA 4O7RA 4O38A 1CTPE 3UIUA 4BIEA 1OL6A 3D2IA 2Y6OA 2CKEA 2XJ1A 2UW8A 2XK6A 2BTRA 3QRUA 2QOQA 4V04A 5TKDA 4B8MA 4CMUA 2ETRA 3PJ2A 4G5PA 2DS1A 3OWPA 2WQNA 4AA0A 4F0FA 1DAWA 4O0YA 3ZFYA 1PMEA 1YWRA 5HHWA 4ZSEA 2WIHA 4U9AA 4RC2A 3HMMA 3JY0A 4MAOA 5DA3A 4GG7A 4ASDA 4S34A 2EU9A 3RK7A 4PL3A 4BCFA 2NP8A 3DNEA 3MYGA 1BUHA 2XA4A 5AR2A 3KREA 3E7OA 2QU6A 5KBQA 2WZJA 5G1XA 5LVOA 2J7TA 4WNMA 5D41A 5GZAA 4FTKA 2F9GA 4HVHA 2FA2A 5HX8A 4F99A 4APPA 3DGKA 4PY1A 4JX7A 5H8EA 4QYGA 2XKEA 2WTCA 5DVRA 2HWPA 4PMTA 3MFTA 1REKA 3GC9A 3MVLA 4L7SA 5EDQA 1JLUE 3TEIA 4ZIMA 2WMQA 4D0WA 4QYFA 4A7CA 5ANJA 1MRUA 3KXXA 2CNUA 5LWNA 4RC3A 2ACXA 4Q2AA 4FKGA 4QMXA 3NYVA 4QMPA 4YTHA 3R7EA 4TYHB 4M69A 5HVYA 4IWPA 4D5HA 2F7EE 5KE0A 2XM8A 3KXHA 3ORNA 5TT7A 1VZOA 3EL8A 3GP0A 5CEOA 3QD4A 3EKKA 4FTOA 4ZSJA 3R83A 2W9FB 2X2MA 4NU1A 2VV9A 4FTJA 2R3RA 4FKPA 5DE2A 3LJ0A 2QOHA 2PUUA 4Y5HA 3VAPA 5CAPA 3HA6A 4L8MA 4L67A 1XH4A 2R3GA 3M1SA 4HZSA 5CEIA 4F0GA 4DYMA 3RWPA 1Q3WA 3BBTB 2J5EA 3ETAA 4X0MA 1E1VA 4FKQA 3FMDA 3PA5A 5FTGA 3CY2A 1UU8A 2HZNA 4FZDB 3BHHA 5CNNA 5K3YA 3IDBA 2YCQA 1OL7A 2C1BA 1UVRA 2XK8A 4IFGA 4I4EA 4QRCA 2WKMA 3HP5A 3PVUA 4FZFB 5E92A 3VS7A 4MWHA 4YJVA 1IEPA 4BCHA 1Y6BA 4IANA 4EONA 3QCQA 3R1YA 5EM7A 5LQFA 3H0ZA 1V0OA 3N4TA 3POOA 3VS3A 5EM6A 3T3VA 4EZ3A 2R3KA 4UZHA 3H4JA 3E93A 3ZO4A 4YTCA 4DEIA 4UY9A 5H9BA 3GUBA 3C0IA 3ROYA 5IQBA 2RFEA 3O8UA 4D1ZA 1PYEA 3DA6A 1J7IA 3WE4A 3BE9A 1LEWA 5AA8A 5FUTA 4RFMA 3DT1A 3R8MA 4DFZE 5HTIA 2OKRA 3PJ1A 3QQGA 2I0VA 4K9YA 2C0IA 3PJ8A 3A7GA 4EHGA 3W32A 3U87A 2DWBA 2QODA 3OZ6A 4AOIA 1OL1A 1RJBA 3PP0A 4J96A 2G2HA 5ACBC 2V5QA 3R1SA 1SVEA 1WCCA 5M4CA 1P5EA 2OXXA 4BCKA 4PTCA 4KRDA 5JH6A 4XLIA 2W1ZA 1PXNA 1XO2B 2YDJA 2X8IA 5ITAA 4LI5A 3RNYA 4AP7A 4Q5EA 4AW1A 3ZBXA 4QNAA 4HYIA 2WD1A 2X6EA 4Z9LA 2ITWA 4UYAA 4RX7A 3R8UA 3UP2A 3FZPA 2QOCA 4QYHA 5GJFA 2X39A 2OZAA 3R1NA 4LOOA 4CMOA 5IU2A 2PZYA 1Z9XA 3ALOA 4AZTA 1YI4A 5IMXA 5HU9A 3EQCA 3A2CA 3HRFA 3UP7A 3L9MA 5AEPA 4FKVA 3VBXA 1GNGA 4E6QA 1ZOEA 4UZDA 2CGXA 5CU4A 3QALE 3P23A 3PRFA 4FUYA 3FWQA 1CKJA 5C26A 2PSQA 2UZDA 2RG5A 4DFXE 3BHYA 3GENA 3VUIA 1XR1A 1DM2A 2VGPA 4X2NA 2IVVA 3RM7A 1DI8A 4DG2E 3VQUA 4AOTA 5IH5A 2OIBA 3REPA 3KEXA 4QP4A 2WPAA 4J95A 3CPBA 4U42A 3FSKA 3SGCA 2X9FA 5AUXA 4O0UA 4I22A 4KUJA 4XH6A 3ULZA 3JYAA 2IN6A 3EWHA 4BB4A 3ATSA 2UZUE 5E8YA 4QP6A 3EHAA 5KMOA 3RAWA 1XWSA 4C4FA 4HW7A 2XEZA 4FKOA 4FVQA 3EQGA 2QD9A 2WGJA 5CAOA 3TNHA 5LMBA 2W4KA 3I0OA 4IM0A 1H1RA 2IVTA 4MVFA 4CEGA 4O7WA 2QOOA 3QGWA 4Z16A 2YN8A 3A7HA 3WZJA 2WMTA 4XV3A 3NSZA 5HG5A 4EI4A 1KE5A 2ZV9A 4EK5A 2J0IA 5AV3A 3AC8A 2QG5A 4Z7HA 3G51A 2OFUA 4O22A 2V62A 3QKMA 4XG6A 1O6KA 2ITYA 3GCVA 3OVVA 2C5NA 4FEUA 5C01A 4EUTA 2ITUA 4C4GA 4AT4A 5CF8A 2YWVA 4DBNA 1H4LA 1YI3A 4RT7A 2WMUA 3EQRA 4DTAA 1ZYDA 4GS6A 5HCZA 3BLQA 2C47A 1BL6A 3DAKA 3ORIA 3NR9A 3AT2A 4JI9A 3S0OA 4TWNA 5HIEA 3W2QA 2X6DA 3SOAA 3I60A 5FQDC 1YWVA 4DEAA 5DBXA 4AE6A 4D1SA 4ZMEA 2ITTA 5K5XA 1KE6A 4EK3A 3Q3BA 4YJTA 3CR0A 3F2NA 3LXNA 3R8LA 2PMOX 3PZHA 3VHEA 2PZIA 4FNXA 5IDPA 1ZY4A 5I9WA 2BDFA 4E26A 5KMIA 1PMUA 3DLSA 5EI8A 1FVRA 2BRMA 3O8TA 4FKLA 2YABA 3R04A 2RF9A 4M0ZA 1YXVA 4WG4A 4GVAA 5AA9A 5AV0A 4KIPA 4FVRA 1E1XA 4GYGA 2BFXA 2VX3A 3DBEA 2Q0NA 3FQEA 4ERKA 4O7VA 3GQLA 3DJ6A 4LUDA 2A4LA 4CYIA 1PF8A 4PV0A 1K2PA 3VS4A 1URWA 3OG7A 3QTXA 1CMKE 3AMAA 3PY0A 5GIOE 1OIYA 1LEZA 3LFNA 2C69A 1OKZA 4FOBA 5K5NA 2B0QA 2P33A 5CWZA 3UMWA 3O96A 4ZZMA 3LCOA 1A48A 3QD0A 3TI1A 4E1ZA 5HG8A 4U80A 4YJOA 1TKIA 4U6RA 3S2PA 4Q5HA 4JIKA 4NM5A 4HYUA 5HESA 2XIYA 2OK1A 3UGCA 2YJSA 5LCKA 3LFCA 4AW2A 3NUSA 2CSNA 2VZ6A 2BZKB 3I0QA 3GFWA 4FV7A 1Y91A 1QPJA 2HZIA 4YNEA 2NO3A 3VQHA 1NVSA 3PRIA 4MXAA 4PDOA 5E91A 3F2RA 2A0CX 4HJOA 3PXKA 3D5WA 2VWVA 3MJ1A 3ZLYA 2GQRA 4FSYA 3AD5A 5FEEA 1BYGA 1HOWA 3ET7A 4IM3A 3CQWA 3SW7A 4L43A 1YWNA 3BHVA 3DPKA 4K33A 4KIQA 4KS7A 2ITNA 2PMIA 2JDVA 4WNKA 5M07A 4EZ5A 5BUJA 3PDTA 4C57A 3AC3A 1OVEA 4PDPA 3UZPA 2JBOA 4CXAA 4DH1A 2CN5A 1A9UA 1OPLA 4I6QA 4ITHA 3E7VA 2ZM4A 1W84A 4L46A 4LMUA 4Y46A 4YURA 3V8TA 4RQKA 4BN1A 1IG1A 3VUHA 5CEQA 5J79A 4EHVA 2HXQA 3OTUA 4FTIA 5AUUA 4O27B 3G5DA 1UNLA 4TNDA 3UVPA 5IQCA 4F9CA 4FSMA 4MX9A 4G17A 3FC2A 3BRBA 5B0XA 2BKZA 5BYYA 5F20A 2W17A 4YZMA 4IX5A 2C6DA 2QURA 3ZEWA 4CCUA 3VUDA 2XRUA 2XKFA 4C0TA 3IGGA 4X3JA 1OMWA 3F3VA 2X4ZA 3PG3A 2GNIA 5AP7A 4CYJA 3EH9A 2BRBA 3E64A 4O86A 4LYNA 3D4QA 4M68A 5IA2A 3QCSA 2W96B 3MVJA 3BYVA 1SM2A 3PZEA 3PJCA 2PVYA 2R3MA 3HA8A 4RX5A 4FG9A 3F69A 3IW4A 3LW0A 3F3ZA 1DI9A 1QPCA 2PMLX 1XQZA 4WHZA 5A46A 5AAEA 4DCAA 3OMVA 2CGVA 4WNOA 5J5TA 5AR4A 2W06A 1U5QA 3G0EA 4K0YA 4O1OA 2J2IB 4RFZA 2I7QA 1GIHA 1FVVA 2IVSA 3FI3A 3KXZA 5BVNA 5HTCA 3DK3A 3OBJA 3D5VA 3P5KA 5AIKA 4BDKA 2WTWA 3R71A 4IB1A 2R7IA 4G6OA 4GSBA 3PIXA 4PTEA 2UW0A 3FSFA 3IOPA 5EHOA 4CV9A 4C8BA 2E9OA 2JEDA 3PJ3A 5A6NA 3DBCA 2CKPA 4XMOA 3NVMB 1VYZA 3CEKA 2QR8A 3PLAE 4PUZA 4G3EA 5H8GA 3R2YA 5E1EA 3FXZA 4FK3A 3UIMA 3KVWA 3BYUA 4WSYA 4QMSA 3N4UA 3MV5A 4JQEA 3DBFA 2C6KA 3MY1A 2GNFA 1P4OA 4C02A 4HYSA 3QQJA 3E5AA 3EFJA 4FK6A 4WSQA 4XOZA 3UO5A 1YRPA 1SVGA 3AC1A 3DZQA 3GQIA 4M7IA 4RPVA 3K5UA 3PUPA 2BMCA 3PXFA 3F3UA 5TF9A 3V8SA 4NL0A 1SVHA 3NRMA 1ZOHA 4FIJA 4U41A 3WF8A 4YUQA 3NDMA 2YEXA 4L3JA 1J91A 4MF0A 3HMPA 3POZA 4LRMA 4CFNA 5ANKA 4FKRA 5HLNA 1P14A 3FLZA 2Z7RA 4W4VA 3KF4A 3ZFMA 5HQ0A 1WVXA 5CEMA 2YHVA 2J6MA 3C4CA 4FT3A 5CNOA 4ZXTA 4D4VA 4FZ6A 1F0QA 4C38A 4Q9SA 5KMMA 3FLSA 2W1FA 5AR8A 2P4IA 4C4HA 3D5UA 2NRUA 4XBRA 2J0LA 3CPCA 2QONA 3HYHA 5JQ5A 4ZZNA 5CAVA 3FZOA 2F2UA 1J1BA 3IKAA 5AAGA 5EK7A 3RVGA 4IX4A 1ZYLA 1ERKA 2GQSA 4UB7A 2RFNA 1SZMA 4AW5A 2WMXA 1ZOGA 3FMNA 2Z7SA 3IO7A 4KD1A 4OW8A 4XRLA 2OIDA 4C61A 2XJ0A 4GYIA 4V0GA 3KRRA 5IQGA 4DEEA 3LHJA 2H34A 4CVAA 4MNFA 4W8EA 2PVKA 4ZTHA 4AA5A 4AOJA 4ZLYA 5KX8A 3COIA 2OXDA 4GJ3A 5EOLA 4BIDA 4U44A 2GMXA 3OUKA 2YIWA 1JBPE 1RQQA 4I6FA 4IVDA 3EYHA 3OCTA 1JNKA 1FMKA 4LL5A 4Y85A 5AUYA 5FTQA 5I9UA 3OC1A 4U5JA 5AP3A 4C58A 4JAIA 3ZUTA 3AD4A 3P0MA 3UJGA 4IFCA 3PWDA 1SYKA 4FIGA 4LRKA 4EOSA 4LQMA 4BDGA 2XNBA 3KMUA 3PXQA 3Q96A 4XX9A 3E8NA 3L8SA 3E3PA 3LFDA 3OW4A 4PP9A 5CSPA 3ZU7A 4WT6A 4FTRA 4L00A 3U4UA 2JAVA 4TYGA 4S2ZA 1CM8A 4YHTA 2OO8X 5JT2A 4QT1A 1O9UA 1MP8A 5KMJA 3H9FA 3PVWA 3HMNA 3R21A 4U79A 4WO5A 4S31A 4KIKB 4TYIA 4AWIA 4BCNA 4BIBA 4W4XA 4BI1A 4FIHA 2B9JA 4B7TA 3GC8A 4C7TA 3RPSA 3LJ1A 1OL2A 3NGAA 3NZ0A 3BWJA 3BQRA 4IWOA 3EFLA 3RPVA 4BHZA 3EKNA 3NAXA 2JFLA 2R3PA 5JFSA 4LRJA 5FXQA 3TWJA 3LZBA 4MH7A 3BI6A 4QQCA 3UPZA 1MQBA 3AOXA 2OU7A 4TYJA 5IA5A 2PY3A 4MBIA 5GJGA 1YOLA 3P08A 2EXEA 3RCJA 2X7FA 1JKTA 4TWPA 5CEKA 2JDOA 4GUEA 1UA2A 2IVUA 2XYNA 2X4FA 3H9OA 4IAIA 4IAAA 3TNIA 4GIHA 3FL4A 4EBVA 1M17A 4EOLA 1Q8ZA 1ZY5A 4ZSAA 4S30A 3R7VA 2YZAA 5T6KA 3GU8A 3ZONA 4ZTSA 4F6SA 2V0DA 3M42A 3KY2A 2IZRA 3V5WA 3W55A 4DC2A 4F1MA 2GHMA 1TVOA 2WMBA 4O7YA 3TKUA 4JLCA 3ORXA 4FKUA 4D4RA 4HGTA 3U4WA 2WTVA 4QPAA 4RJ6A 2VO7A 3BU3A 4CV8A 4PL4A 5J9ZA 3OCBA 3VBTA 2O3PA 1MQ4A 5LARA 5J1WA 3G9LX 4DEBA 1XH5A 2YCRA 4E20A 5CS6A 2R5TA 4O81A 3VW6A 3R73A 4MCVA 5CT7A 3VS0A 4EH7A 2UVZA 3WZEA 4AT5A 4FNZA 4D4YA 3CTJA 3DY7A 5IA3A 4QQJA 5LVMA 2O0UA 2WU7A 5IQIA 2EXCX 1W0XC 5DN3A 3UBDA 4PMSA 3ZFXA 5DMZA 1LP4A 2RKUA 4YTFA 3G6HA 3NCZA 2G1TA 3MJ2A 3A7IA 3FPMA 2H9VA 2Z2WA 4BTFA 5D11A 2JKQA 4XG4A 4FL2A 4M69B 1ZMWA 1ZYJA 5FRIA 5HGIA 2AUHA 3JVRA 4CRSA 3IQ7A 4AE9A 2C3KA 3TZMA 4D4SA 4R3RA 5H3QA 4D2VA 3LFEA 4E4MA 4EWQA 3RK5A 3OS3A 1REJA 4YC3A 4RZVA 1Q8UA 3OY1A 5LVLA 3BU6A 2ITVA 1NY3A 3A99A 3GC7A 3MS9A 4FKSA 5HBJA 5AR5A 5L4QA 1I44A 3D94A 4R1YA 4PNKA 5DEYA 3ZTXA 1LUFA 4IWDA 2UZOA 3V5PA 4YJNA 5L8LA 1WZYA 3RMFA 3JS2A 2VWBA 1JQHA 1IA8A 2QQ7A 3PXYA 3TZ8A 4RVTA 2O64A 2WMRA 5C4LA 3CIKA 5DRBA 1PYXA 4X2KA 3E8EA 3FV8A 3WZDA 2YM6A 4QP1A 3PSBA 5IUIA 4JQ8A 5CAQA 4JDJA 3U6HA 3QCYA 2ZB0A 1M7NA 4JG8A 5ANGA 5L3AA 4TRLA 2P0CA 4B6LA 4RRVA 2BALA 2WIPA 3F5GA 3Q04A 1FQ1B 3KVXA 5EYMA 3ZEPA 3F5XA 4BFMA 4Y73A 3O71A 3K2LA 4HVDA 3VN9A 3G90X 3RAHA 3II5A 4RVMA 4IAKA 5I9VA 1MUOA 1O6YA 3D7ZA 1OBDA 2BZJA 1OKWA 4O0RA 4AUAA 2OIQA 4ASZA 3ANRA 3IW6A 3LE6A 1PMVA 3QAME 3TDWA 2W99B 3QTSA 3W2CA 4PMMA 2CLQA 3UQCA 4FV9A 5C27A 4UWCA 2C1AA 3TG1A 2OICA 2VTAA 5K0KA 3B8RA 3QUDA 1H1QA 3L9NA 5CQWA 3R9OA 2ZOQA 4J98A 1NT2A 4GW8A 3AC5A 3ORZA 4E4XA 5CF4A 3I81A 4NIFB 2VTRA 4MYGA 2WOUA 3DKGA 5CXHA 5CEPA 2FO0A 3NW6A 4P4CA 2UUEA 2PVHA 4NUSA 4I24A 2OI4X 3VIDA 4KBCA 4YZBA 4BTKA 3MY0A 4EK6A 4C33A 3LCSA 2R4BA 5B2MA 3QD2B 3PA3A 4FT5A 3ZUUA 5HU3A 4IDVA 4QQ5A 4JQ7A 3S95A 3EQHA 5HLWA 4G1WA 5BVWA 2F4JA 4DT9A 1Z57A 4I23A 3F3TA 5KUPA 4EJ7A 2WNTA 4AN9A 2PE0A 3PIYA 4G2FA 4BGHA 4C4IA 1WVYA 5DT4A 5IA0A 2PZ5A 3OT8A 1S9JA 5ACKA 4BKJA 4E93A 3U6IA 2R3OA 4EH2A 4XBUA 2C5YA 3FLYA 5CU2A 3MB6A 2NNWB 4FTMA 4AZEA 4FE2A 4BICA 3R01A 5JEBA 3QXPA 3GCUA 3H30A 5ANIA 2QOBA 4D2PA 3P86A 1PHKA 2R0IA 3UG1A 4A07A 5C8MA 3QF9A 5A4CA 3T3UA 5HORA 3BGQA 3NYOA 4O0WA 2R9SA 3KK8A 3UC4A 4O83A 4G3GA 1Q5KA 4NJDA 4DTBA 4I0TA 5D1JA 4GMYA 1JVPP 4AGCA 4X2JA 3QTZA 5DYJA 5DWRA 1UU3A 4GIIA 4PX6A 5JFWA 4RIWB 2VWYA 3SOCA 3FY2A 4NFNA 1ZLTA 3U9NA 2X7GA 5LMKC 5AAFA 3FHIA 2RSVA 4C4EA 5HCXA 5B2LA 3V5TA 3LFAA 2J5FA 1Q8YA 4U81A 4K2RA 4OGRA 4CLJA 2BCJA 3LCKA 4IMYA 4IVBA 4U0IA 5FEQA 5AMNA 2W0JA 3FLWA 4FV8A 3UZTA 1YW2A 4YNOA 4JDHA 4PTGA 3HRCA 5HI2A 4DTKA 5F9EA 4GJ2A 1Q41A 4M0YA 4GKHA 3PIZA 5D12A 4LL0A 5CZIA 3LLAA 1APME 2ZMDA 1Y8GA 3FDNA 5EDRA 3IG7A 3L8VA 2QC6A 3PVBA 4OTDA 3ZHPC 3CLYA 2OFVA 4AFEA 2AC3A 4DFYA 4F1TA 3DDPA 3N9XA 2R3JA 5DT3A 5E8VA 3W2PA 3RINA 3UIXA 3A62A 5EFQA 3TKIA 5CASA 3BEGA 4MXOA 3FC1X 4F6WA 1M7QA 3PA4A 3U8WA 4J99A 2GFSA 1YDSE 4BGQA 3D5XA 3TUCA 2VX1A 5HNIX 1Y6AA 4A4XA 2YM3A 1YOMA 3A61A 5HLPA 3ZO1A 3FXXA 4FEQA 4EOQA 5AP2A 4ID7A 4FKWA 5AV2A 2UW4A 1H01A 4KNBA 4O82A 4CNHA 4IVAA 5GHVA 4IIRA 1YKRA 2WTKC 5HTBA 4DBXA 4XV9A 3R0TA 4TPTA 5EHLA 4JG6A 2JIIA 4A4OA 3V6RA 2QKWB 4JBOA 4HGSA 3ENMA 3O23A 3BLRA 3GU5A 4PMPA 3HRBA 1EH4A 4ANOA 2W7XA 4ZSLA 5HVJA 1H0VA 2ESMA 3CD8A 2VTTA 3IW5A 1Q97A 4MXZA 4D0XA 4F7LA 4KABA 4O96A 4F08A 1TQIA 3R6XA 4WNPA 3R9RA 4ZLZA 4CG9A 1XBBA 3R8ZA 2XNOA 3EZVA 4RWLA 5HVKA 4ZS4A 1WBSA 2I6LA 3WE8A 4O7SA 3FI4A 1KWPA 1XH7A 2WTKB 3C51A 3PWYA 4FV5A 4RWKA 5EI6A 3QA0A 3SXFA 3R28A 4RJ8A 2VD5A 3VS6A 4X7QA 4E7WA 4FT9A 3IONA 3RWQA 4EYJA 3QKLA 4UEUA 2HWOA 5E8SA 3NUAA 4A9RA 4EOOA 3DJ5A 4EWHA 4MQ2A 3ZOSA 3CKXA 2B9IA 4PWNA 3MDYA 4RZWA 2PZRA 4F9WA 3QTUA 2GNHA 2QNJA 2YIQA 3OY3A 4WIHA 3U9CA 3VO3A 5JGAA 4CZUA 4JXFA 4DFLA 4J8MA 3HEGA 4FIEA 3I79A 3PY1A 4CQEA 2XMYA 3HZTA 2PUPA 4I94A 1QL6A 2ZMCA 2W5AA 4JX3A 1NVRA 2JLDA 4QMQA 4NWMA 2C6OA 4L45A 3QWJA 3O8PA 3UO4A 3HL7A 5M57A 5JN2A 4Y83A 3LQ8A 5EW9A 3BU5A 5HBHA 4D5KA 3DV3A 3OOGA 3ZSIA 4BL1A 4DGMA 4RWJA 3D15A 2R0UA 3UVQA 3U55A 2VGOA 4RG0A 3W2RA 3TTIA 2JDRA 4D9TA 5L2TA 3KU2A 1RDQE 4FZ7A 3ZSHA 4CCBA 3VULA 2PMNX 2YIYA 3ORTA 4XJ0A 1G5SA 2WQBA 1GOLA 3EZRA 2UZNA 4KSQA 5CYIA 2ZVAA 3UODA 4FX3A 4KBKA 2I0EA 4CTBA 5A14A 5HZNA 4QMLA 4ACHA 4IB0A 2HZ0A 5D7VA 3TNWA 2IZTA 3R7UA 3RGFA 5J9LA 2Y4IC 4K11A 2WTIA 3S4QA 3MB7A 4R1VA 2XS0A 4O7NA 2P2HA 4AAAA 4C3FA 4EOKA 4AS0A 3VRZA 4ACGA 3SRVA 3UVRA 4B4LA 1ZMVA 4C37A 2EXMA 3OD6X 3KULB 1JAMA 2YERA 2IZUA 2R7BA 3AMYA 3GT8A 2XVDA 4USDA 5FD2A 2OF4A 3SC1A 2BILB 4CZYB 2G2IA 3D14A 3FKNA 2BAQA 4KIOA 3UOLA 4AQCA 2G9XA 2CGUA 2GCDA 1L8TA 2PVJA 5E8WA 3JY9A 3MN3A 1PW2A 3LXPA 4KSPA 5F1ZA 3UIBA 5IA1A 2WMSA 1W83A 1XJDA 3SHEA 4BCIA 4DT8A 4L01A 3C0HA 4GV1A 1SNXA 4KKGA 2Y4IB 3MTFA 2QKRA 4RJ4A 4JJRA 3KL8A 4BCQA 2GS7A 4B8LA 4IW0A 2YA9A 5CF5A 1H1SA 5EYDA 3JXWA 5EQEA 5A4TA 2W1EA 4RSSA 1STCE 3RP9A 2V22A 5CVFA 5M44A 5BUIA 3F7WA 2H6DA 5DPVA 2IPXA 3WIGA 2HW7A 3IDCA 3TKHA 4FR4A 4CTCA 5JGBA 3KCFA 4RIXB 2XCKA 4ACDA 1H00A 4BRXA 3UO6A 4QP7A 3F5PA 3F66A 3DK6A 4R7IA 3GU6A 5IQAA 3CC6A 2Z02A 3VNTA 3QFVA 4IE9A 4PPBA 4EL9A 4U3ZA 3TM0A 2UZVA 3HX4A 3GCSA 4QP2A 4XG9A 4IHPA 1FBNA 4U7ZA 3AC4A 3CQEA 2DUVA 4C62A 2QOIA 2IWIA 4FL3A 4P90A 2WMWA 1IA9A 1BMKA 5I4NA 4LV5A 3ZS5A 4CKJA 3FI2A 4JBVA 1CSNA 4BZOA 1FPUA 2UZBA 4C3RA 3FLQA 4B9DA 3FXWA 3ORPA 4EOPA 5KNJA 1PXIA 1Q4LA 4DHFA 3KC3A 1M2PA 3CGOA 3N4VA 5KO1A 4EH5A 4W9XA 4BCOA 4FKTA 2C6IA 4D2SA 4O2ZA 4FSUA 4FTNA 5JGDA 3K3IA 5ETIA 3BV2A 1ZZLA 2BHEA 2W1IA 2DYLA 3T9TA 4O0TA 4JR7A 4QP8A 3DS6A 4UBAA 5AP6A 2ERZE 3HMIA 2ETKA 4EOIA 3DXQA 3LCDA 3VBVA 3UQGA 2C4GA 1URCA 4R5YA 3KULA 3DB6A 1BL7A 4UV0A 2HENA 3GBZA 2BPMA 4WBBB 1VYWA 3CCNA 1KSWA 3AG9A 5EQPA 3DU8A 3EQFA 2IZSA 3DAEA 4YJSA 3M11A 4JBQA 2RFDA 4BDFA 4K6ZA 2P3GX 5AM7A 5JK3A 5L6PA 1YHSA 3EQIA 3W33A 5FBNC 2QOKA 3BGZA 2XH5A 1Y8YA 2OSCA 2X2LA 4E5BA 5CU0A 3OHTA 2Y7JA 4UN0C 2YAKA 2UW6A 5J8IA 2ERKA 3QLGA 5IUGA 5EKOA 2F7ZE 4I5CA 4M66A 5GINE 3BWFA 3ZMMA 3HDMA 2WAJA 3QC4A 4YZNA 1V1KA 2AC5A 1YQJA 4QQTA 2QU5A 4FV2A 3VS1A 2QCSA 2Z60A 4IX3A 4AX8A 2GTNA 1JSVA 3N51A 3QZIA 4JR3A 3ATTA 3FYKX 4QMYA 4DH8A 4QOXA 2OXYA 3NUNA 3SG8A 4FG8A 2E9UA 4X2GA 1ZZ2A 4I1ZA 3O7LD 3L8XA 3S00A 5CZHA 2CMWA 4I6HA 4JG7A 3TJCA 4MXYA 3UNZA 1OPKA 4TN6A 4JDKA 1M2QA 2C0OA 3ZM9A 4NTTA 5H2UA 3I4BA 3OXZA 2XKCA 3CJGA 1OB3A 2B4SB 3SW4A 1KOBA 5AUVA 2WB8A 5K4IA 3ZLSA 5GJDA 3TCPA 3LQ5A 5CANA 3EN9A 4UWYA 4CKIA 5I5ZA 5DEWA 4PDYA 3WZUA 3ZXTA 2AYPA 4FI1A 3WZKA 4FSZA 3OT3A 3QA8A 2XCHA 2X8DA 3KRXA 2A27A 2YLFA 4MKCA 3F7ZA 2IW9A 3W18A 5FDXA 5FLFA 3QHWA 4TW9A 3VC4A 3Q32A 1Z5MA 2OJ9A 3Q5IA 5M4FA 4OT5A 4GL9A 5E1SA 1YXUA 1WBTA 4O1PA 5LVPA 4AN3A 2O2UA 1NXKA 4W4YA 3ERKA 1H1PA 2V7AA 3C0GA 4OTHA 4XCUA 4C59A 3PPJA 3HDNA 4G3DA 1T46A 3KA0A 3MIYA 3U51A 1YI6A 4FTLA 4OR5A 3HV7A 1A06A 3NWWA 2ZYBA 5AADA 3D83A 3MFRA 4AN2A 2Z7QA 1QPEA 3DTCA 1PKGA 4CMTA 2C3JA 4IJ9A 4ENXA 4R78A 2HK5A 3EJ1A 2YCFA 3BYOA 3TTJA 4USFA 3LJ2A 4NKAA 1U59A 2PK9A 2VWUA 4X2FA 5J87A 4UMRA 4C2WA 4MQ1A 3TL8A 3FL5A 4IAYA 3SDJA 3KMMA 1UNHA 1YHWA 4YO6A 3ROCA 4BDCA 4DEDA 3QBNA 4UMQA 4BZNA 5IEXA 4OBPA 4YSJA 3UDBA 2XIRA 1WAKA 4O7ZA 2YFXA 4YHFA 3RZBA 1W7HA 5J1VA 2XBAA 3EN5A 3FMLA 4IAFA 4KB8A 2YISA 4CKRA 3PXZA 3RPYA 3C50A 2OJIA 4FV1A 5CSXA 3SXSA 2HY0A 3Q2JA 1H26A 2CJMA 3NUXA 3UG2A 4F6UA 3ZDUA 2WXVA 1V0PA 3B2WA 2OH0E 1KV1A 3TT0A 1OKYA 1JOWB 2R3FA 4EC8A 4XP3A 4F7SA 4QTEA 2CKQA 4F70A 4G3FA 5BNJA 5JKGA 2OG8A 2W5BA 3DQXA 3F88A 3QQFA 4S33A 3R8PA 2JKOA 5FM3A 3TZ9A 3ENHA 1Q8TA 3EMGA 3V5JA 3P7CA 4GK3A 4R77A 5M53A 2VWZA 2W1HA 4FSQA 4RVLA 2J0JA 2WQOA 4D58A 3OCGA 3HNGA 2PUNA 3OBGA 2J90A 4XNEA 2DQ7X 1XH9A 3EN4A 2YDKA 1U46A 4FYNA 3BQCA 4NEUA 5D10A 3SX9A 4U43A 5K9IA 2Y4PA 3SG9A 4RJ7A 4ARKA 1ZWSA 4F65A 4TZRA 5CI7A 3V8WA 4BI0A 4ZTMA 3QTWA 2BR1A 4RX8A 3Q2MA 4QMMA 5HNGA 5EKNA 4OTIA 4M67A 1T45A 2VWXA 2Q83A 3R7YA 5GZ9A 2OF2A 1XKKA 3DLZA 3RPOA 3NS9A 3SXRA 2QOLA 2WO6A 3BELA 3KMWA 5IZFA 5LMKA 1XH6A 3CBLA 3PPZA 2YM8A 1IRKA 5E8UA 4JS8A 5CQUA 1ZXEA 5FDPA 4AFJA 2FYSA 3NNWA 3TZ7A 3ZO3A 4RLKA 2YJRA 3A4PA 5AUWA 4IJPA 4YGAA 3AGLA 3ANQA 5C9CA 2QG7A 2V55A 4CG8A 4ENYA 5HD4A 4TNBA 4NW6A 3VJNA 4K8AA 4OBQA 1B38A 4PQNA 2WTDA 2PHKA 3GCQA 2FSMX 3EB0A 3V01A 2OWBA 4EYMA 4ZMFA 3WYYA 5J7BA 2BRHA 4A9UA 3VBWA 2J0KA 5BMSA 3OWKA 4MNEA 3SD0A 2OJFE 3V51A 3MIAA 4JRNA 3Q52A 1ZYSA 4V05A 4YZDA 5J9YA 4K18A 4HNIA 1YXXA 1R0EA 4Z7GA 3Q60A 3GCPA 4DH7A 4DH5A 1FOTA 3K3JA 3FE3A 5BVEA 4G3CA 3F3WA 4L42A 4BCGA 4MXXA 3MI9A 5KCVA 3NNVA 3D7TB 5FM2A 5C1QB 4OTWA 5E4HA 2BHHA 3QYWA 3UTOA 3EN6A 3QQUA 2Q0BA 2Z7LA 3FMHA 4KRCA 5AX9A 4O0VA 4YMJA 1MRVA 3OFMA 4RIWA 4EUUA 2UVXA 4HNFA 4IDTA 2XNNA 2ZV8A 4LG4A 4YTIA 3L9PA 3A4OX 4ASEA 4UALA 4U97A 2J9MA 3NPCA 3SKCA 1KE8A 4XUFA 1F5QA 2X2KA 3NEWA 1JKSA 4XYFA 3ZM4A 2QO7A 2RG6A 4QMOA 2GNLA 4WG5A 4BDJA 3ZRMA 3KRWA 2X81A 3Q6WA 3CJFA 2RL5A 4FV0A 4YZCA 3I5ZA 5HIBA 2R3HA 2UZEA 2XB7A 4GFOA 3FBVA 4ZOGA 3ZCLA 4MEDA 3LKMA 4DN5A 3CSVA 3EFWA 2FSLX 3UYSA 2CDZA 3OW3A 2LGCA 2YM5A 4I21A 4ZY5A 4OAUC 3NUPA 3QQKA 3PPKA 4J7BA 2W9ZB 3QHRA 3CE3A 4FSWA 5IH6A 3MH0A 4FT7A 4MWIA 1YXTA 5IQFA 4NIFA 4ALUA 3O7LB 3OOMA 2C3LA 4M14A 1G8SA 1BI7A 2FSTX 4TKSA 4YO4A 1YHVA 2XP2A 3QYZA 2HELA 3OXIA 4RJ3A 3GC0A 3Q53A 1J1CA 4BGGA 5JRQA 4IZYA 5BVOA 3E87A 4H3BA 2C6MA 2CNQA 3LFBA 1GAGA 4FNWA 3BLHA 3GOKA 3BE2A 5AP1A 3TN8A 4JRVA 1OPJA 3VJOA 2P2IA 4P7EA 4L68A 4I5HA 4WRSA 3LAUA 5I3OA 5CALA 4M8TA 4LOPA 3RJCA 1AQ1A 4CLIA 3AT4A 4HVSA 2OJGA 1GIIA 2ITPA 4KS8A 5IG1A 4BTMA 2BIYA 5C8NA 2QI8A 3HP2A 3THBA 4BBMA 4WRGA 4XG8A 2FH9A 3QRKA 4Y8DA 1GZNA 4PL5A 2WELA 3FI8A 4L44A 4ZJJA 4FTTA 3GB2A 3W8QA 4A9TA 2PE2A 5C8KA 4FEWA 5JQ8A 3FQHA 3KFAA 3DXNA 5LXMA 2HYYA 3Q9WA 3C4WA 2CCHA 3ZRKA 5FBOA 1E9HA 3HKOA 4BZDA 1WVWA 3LVPA 4X3FC 2B9FA 2O8YA 3NIZA 4P5QA 5BYLA 5G6VA 3O17A 2H96A 4AXAA 4WUAA 3AT3A 3PSCA 3G2FA 3PFQA 3R63A 3TV4A 4FT0A 5I9ZA 2ZJWA 2H8HA 4J53A 4TYEA 4ZP5A 2XNGA 1CKPA 3DKFA 4RC4A 4CFMA 4YJRA 2YLEA 3P78A 3Q9YA 5AX3A 1M2RA 4HYHA 2O65A 3DKOA 3BX5A 3BGPA 4E6AA 4IC7A 3WF5A 4ANBA 4QMTA 3VS5A 3IW8A 2YITA 4H3PA 4DG3E 1UV5A 1UKHA 2ZM1A 1JKKA 1U4DA 2F7XE 1OUKA 4X3FB 2J0MB 3EQPA 3KGAA 3E8DA 2PYWA 3RCDA 2J50A 3ZZEA 1R78A 3ODZX 5AP0A 2HCKA 3TXOA 4A06A 3O0GA 4NK9A 2QVSE 3L8PA 4D55A 4FYOA 5L8KA 4QP9A 4EH3A 3EFKA 3FHRA 4LOQA 1M52A 3OTVA 3PXRA 4II5A 3V6SA 3I7BA 2PPQA 5HE0A 4QPMA 3U54A 2SRCA 2ITZA 4CT1A 2FGIA 2UW3A 1TQPA 2ZV2A 3I6WA 4CFVA 1J7LA 3ALNA 1KUTA 4I6BA 5CF6A 3PYYA 2PZPA 4E8AA 3PY3A 4IACA 3R9HA 4RBLA 3O51A 5JRSA 5EQYA 4KINA 2XJ2A 2XNMA 5I0BA 2RFSA 2R3QA 3MPMA 4FODA 4FOCA 4W8DA 3KN5A 3TDVA 4CT2A 3G0FA 4DF3A 2BZHB 2VN9A 5ANOA 3H0YA 3H9RA 4UYNA 5LVNA 4QMWA 3OF0A 3QX4A 4P5ZA 4TT7A 4J1RA 4XP2A 2IG7A 3W2OA 4EHEA 4C36A 4JIAA 4N4SA 1XH8A 2UZLA 3DFAA 5HIDA 3HAVA 5IH4A 4KA3A 3KB7A 4I0RA 5L6WL 3GOPA 3VBYA 3C5IA 3NX8A 4EK4A 5FP6A 5EM5A 3BKBA 5DHJA 3IPHA 2W5HA 3V04A 4EEVA 5LJJA 1R39A 4RLLA 4GT3A 3NCGA 4WBOA 2QLQA 3K54A 4ZY6A 4BDDA 5CAUA 4EQUA 1KV2A 4D28A 3F9NA 2GNGA 3L1SA 4AGDA 1I09A 2BAJA 2ZAZA 3Q4TA 4V01A 5GNKA 2OZOA 2QO9A 2WEVA 3E92A 3UNJA 4NFMA 1H8FA 3LM5A 4F9YA 5AP5A 3MA3A 5A3XA 4ANNA 5AUTA 3TIZA 2ONLA 3KCKA 3ZYAA 3DB8A 3KXNA 3TV6A 5EYCA 3R1QA 5EI2A 3NVKI 2XM9A 3MTLA 4JDIA 4IBMA 4FTAA 2YIXA 4OTQA 4GEOA 4L9IA 4FSTA 3ULIA 3KRJA 4F09A 2Y8OA 4B99A 3D9VA 3QZFA 5FP5A 1GZ8A 3R8VA 1O6LA 2VTPA 2W1CA 1ZAOA 4ZTNA 1WBVA 3MA6A 2F49A 2BDWA 3RHKA 3KQ7A 4AZVA 2PE1A 2WQMA 1WMKA 2B54A 2XBJA 5TO8A 4ZAUA 4X6RA 5DR9A 4L53A 3COHA 5ICPA 3MSSA 1H07A 5CSVA 3BYSA 2W4JA 4EKKA 1NVQA 3FZSA 1GIJA 2VRXA 2UW5A 4FV3A 1KE9A 4DGGA 3R7IA 3WBLA 4QO9A 2UW9A 4RIYA 3CP9A 4I0SA 4K77A 1IAHA 1TQMA 3ZH8A 2C0TA 4DITA 2X8EA 4YP8A 5JSMA 1Q8WA 1ZRZA 3SA0A 4G16A 4FTCA 4N57A 3OCSA 4YBJA 2BAKA 5F95A 3R2BA 3HUBA 3NMUF 1OUYA 3FY0A 5J7HA 3UMXA 3TUBA 3B2TA 3P4KA 4FIFA 5IEVA 2G01A 4YLLA 3CD3A 5B2KA 3RK9A 3LIJA 1LPUA 2VU3A 2WFYA 4JOAA 4OTPA 2UV2A 4O21A 4XV1A 1UKIA 3W10A 4DLJA 3HV4A 5E8XA 4YJPA 3EL7A 5ETAA 4LM5A 2R64A 4LMNA 4LUEA 5AUZA 4TL0A 4JBPA 3SLSA 4N70A 4GU9A 1U54B 1PXLA 2UZTA 5E8TA 1Y57A 4O7LA 3SAYA 3Q4ZA 2XK3A 1P2AA 3A8XA 4D2WA 4ZLOA 4BBEA 1AD5A 4N6ZA 2JBPA 3OROA 3OWLA 3QC9A 4FVPA 1HCLA 4QPSA 4S32A 3ACJA 3VBQA 4D1XA 4YSMA 4QP3A 3IOKA 4LGHA 4ONAA 5BX0A 2C3IB 3HV6A 5FG8A 3AD6A 4ANMA 4PDSA 2VTSA 4FICA 4XRJA 3W8LA 3I1AA 3FKLA 1OZ1A 4ANQA 5M06A 5CSHA 5DOSA 3R00A 5EYKA 3Q6UA 4XEYA 4RWIA 4UWBA 3Q4UA 3TUDA 4U8ZA 2O5KA 2XK9A 3IK3A 3F6XA 4FIIA 5L6OA 1NW1A 2W05A 2LAVA 3T8OA 4GKIA 3NNUA 5I3RA 1K9AA 4L3PA 3F82A 2O63A 4QTCA 3BPRA 3M2WA 4CGAA 2BRNA 4O91A 4DFNA 5J5SA 4HCUA 4O84A 2BUJA 4LGGA 4O0XA 2ONLC 4QYYA 3NYNA 3MWUA 3ZLXA 2BRGA 2QHNA 3FAAA 3KK9A 2VTHA 4WOVA 4G31A 5JZNA 4M84A 4DLIA 3ZDIA 1PXMA 2CKOA 3DBQA 3HVCA 2A19B 4G6NA 3KN6A 1OL5A 4HZRA 5DI1A 1BX6A 4J71A 4NT4A 3VF8A 2CHLA 1B39A 4EH8A 4ZK5A 5DR6A 2ZM3A 1F3MC 1LR4A 3NAYA 4NM7A 4R3CA 4Y95A 4OTRA 5DIAA 2EB3A 5C03A 3RHXA 4ZY4A 3R02A 1OBGA 1IASA 3BHUA 5EOBA 4BCPA 1OI9A 3KRLA 2HW6A 4Z3VA 3LMGA 3O50A 4ALVA 2C68A 2NPQA 2Y9QA 2REIA 2FSOX 2BFYA 2W4OA 3NNXA 4JT3A 5LWMA 4FGBA 4FZAB 5DR2A 3BIZA 4M13A 3Q5ZA 1KE7A 4XG3A 4K1BA 3HV5A 4IB5A 4BDHA 5A54A 4GUBA 2WTJA 5AP4A 4XG7A 4TY1A 3FLNC 3WYXA 1OIQA 3AMBA 2A2AA 3KKVA 3PTGA 5KHXA 1UWHA 4MNEB 4BKYA 5KMKA 1OIUA 5M4IA 2QLUA 2ITXA 4GU6A 4RIOA 2GTMA 4OAVB 2I40A 3AQVA 4EC9A 2WHBA 3NLBA 4GG5A 2C5XA 2VNWA 1L3RE 3MH1A 4FSNA 4JVGA 3TIYA 4AW0A 4F7JA 2Y0AA 3QRJA 3RZFA 1W98A 3DDQA 2XKDA 2GPHA 3EQDA 4QTDA 5TOZA 2IJMA 3ZUVA 4AA4A 4PPCA 2GHLA 4BI2A 4BYJA 2C30A 4ALWA 4Y72A 3MGYA 4FL1A 4DE4A 2BKKA 4QTAA 3A8WA 1G3NA 2J4ZA 3FMKA 3BCEA 5HBEA 5JFXA 3AC2A 3E62A 1R3CA 1JSTA 4LV8A 1PMNA 3DQWA 4PNIA 3ORLA 3EIDA 4F64A 2YDIA 3KF7A 4FBXA 3V5LA 1J3HA 4XG2A 5T3QA 3PE2A 4J8NA 4FTUA 2OJJA 5EW3A 3EOCA 4E5AX 5FEDA 2GDOA 3C7QA 5A6OA 3QZHA 4KIKA 5IEYA 4H39A 2OH4A 3SV0A 1QPDA 1G8AA 4BDAA 5DNRA 1FGKA 4X3FA 3CGFA 4C2VA 2JITA 1UU9A 3LMIA 4IEBA 1Q99A 3VUMA 4ANLA 4AU8A 4F4PA 3G9NA 2P55A 3MY5A 2PU8A 4RIXA 5D9HA 3BZ3A 5EG3A 5H8BA 4DINA 4ERWA 3ACKA 3BEAA 4GFMA 4GK4A 2ITOA 1ZMUA 5ANDA 3VW8A 3S3IA 3UPXA 3DOGA 1PY5A 4RGJA 4RA4A 1PRYA 1W82A 3E88A 3RKBA 5LOHA 4JAJA 5KZ0A 4DEHA 5HKMA 3VWAA 4IZ7A 3W16A 4OLIA 5CENA 4EH4A 3VUKA 2XIZA 2IW6A 5DT0A 4X6QC 1PKDA 2UZWE 3RNIA 2EUFB 2RIOA 1DAYA 2PUIA 4HPUE 5K4JA 3BHTA 3FKOA 2EB2A 2PVLA 3WOWA 3IW7A 4QTBA 1WBPA 1CDKA 3ITZA 3QTIA
chains in the Genus database with same CATH superfamily
1PXPA 2HOGA 3TNPC 4G9CA 4ZTQA 1QCFA 2B55A 3QX2A 2YM7A 5HO6A 3QUPA 4CRLA 4I92A 3FEGA 2UW7A 3ZC6A 3QRIA 5M55A 3WILA 3P7BA 4YC6A 3MFUA 3P9JA 4X21A 3ZRLA 3H3CA 4RJ5A 1PXOA 1U5RA 3ELJA 3EQBA 3ZSGA 4KKHA 1CKIA 1TZDA 2GS2A 4FUXA 5IF1A 2ZFYA 3HAMA 3JR1A 2WEIA 2W1GA 1WFCA 5IMEA 2R3NA 4O6EA 3NUYA 1ND4A 4BF2A 2YIRA 3MPAA 4BYIA 1UWJA 2YZLA 2XIKA 5TE0A 5HX6A 5HEZA 2I1MA 4USEA 3PVGA 5E8ZA 5AFVA 4ASXA 5HG9A 4HVGA 5BVFA 3R30A 3QXOA 4BWKA 3LFSA 3GU4A 5BVDA 4YZ9A 2XK4A 3ZBFA 3TJDA 4FGRA 1Q24A 4C4JA 4HCTA 2ETMA 3UOHA 3LOKA 3JPVA 4FV4A 4A4LA 3DFCB 4BCMA 3S1HA 1H24A 1PJKA 4R7HA 5AWMA 4RFYA 3MH3A 3UOKA 4Z55A 4CFUA 5EW8A 4BBFA 1H25A 2PVRA 5DG5A 4MUQA 4PPAA 5HO8A 5L8JA 4DGOA 5IQDA 3CXWA 3DBDA 3MW1A 4F9BA 5IPJA 1FINA 2YACA 4I4FA 4PF4A 1OKVA 5AJQA 2PWLA 5CY3A 5HG7A 5FWKK 4E6CA 4F9AA 2B52A 4W9WA 5JMSA 4EORA 5BPYA 5L2IA 4G34A 3RALA 3MESA 3LPBA 4N6YA 1VR2A 1FVTA 4DG0E 3COKA 3FMMA 5CSWA 2VUWA 1AGWA 5M56A 3WF6A 1RE8A 4M12A 4BVUA 3ZXZA 4NM0A 3WARA 4F63A 3CTQA 4XHKB 3LXLA 4XLVA 5GIPE 4KWPA 5IA4A 4H58A 4UMUA 2E2BA 3WF7A 4RX9A 4I41A 4IVCA 3RAKA 5BQ0A 1JSUA 2OZAB 4DAWA 5F94A 5M08A 5DLSA 1NA7A 4UXLA 3R9DA 5FTOA 4NH1A 4ZZOA 2PL0A 4GK2A 2JKKA 4RQVA 4TTHB 3MH2A 4XS2A 5CVHA 5LCJA 3CTHA 2GHGA 3Q9XA 3ZLWA 4DFUA 2ZDTA 4YJUA 4H05A 4HGLA 2OLCA 2EVAA 1OITA 1YVJA 2XZSA 3UYTA 4HVIA 2NRYA 5CVGA 4BDBA 4DH3A 4TWCA 4CD0A 2B9HA 3LFQA 4OTGA 4EKLA 2PVFA 3OEFX 2E9PA 1J7UA 4IC8A 2B7AA 4MD7E 3NW7A 4CZTA 5LMAA 4DEGA 2HAKA 3A7FA 1HCKA 4IXPA 1OGUA 2X0GA 4EOJA 4NCTC 5EDPA 4EHZA 4H36A 5KBRA 2BROA 5AIRA 3SRVB 5AM6A 5E9EA 2GSFA 1BKXA 1WBNA 3GXLA 3LMHA 4CQGA 3V3VA 4NM3A 4BKZA 2BTSA 2GNJA 3I5NA 3ZO2A 5DGZA 4I5MA 3LXKA 1JWHA 4E4LA 3HMOA 1SNUA 3LM0A 4TYHA 1H27A 5IISA 1X8BA 2VTIA 4KKEA 4EJNA 3C4FA 4I20A 4G6LA 4IB3A 2XRWA 4IADA 4F7NA 3PE1A 2BZIB 1R1WA 4AGWA 3DNDA 3V5QA 2VTMA 3C1XA 2KULA 3RTPA 2WU6A 2CPKE 2UVYA 3QUEA 4C3PA 4IX6A 1VEBA 3VS2A 4A9SA 2OGVA 3CS9A 1GZOA 2IO6A 3A60A 5DFPA 3GU7A 2KTYA 1YOJA 2E9NA 3MBLA 4UXQA 3UE4A 1V0BA 4EH6A 4ZTLA 5HE3A 3R7OA 2BVAA 3LLTA 3E63A 4OTFA 2A98A 4GCJA 4MXCA 5CX9A 5EHYA 4FEXA 2XNPA 3I7CA 3KXGA 4JL9A 5KMLA 1IR3A 2JDSA 4HCVA 3BBWA 4ORKA 4I5PA 3ZZWA 4YHJA 4E6DA 4IH8A 5HO7A 2VTNA 4J97A 2XEYA 4I93A 4ZJIA 3QLFA 3C13A 2C6LA 4Y5QA 5EM8A 5AV1A 3IECA 5TR6A 4QYEA 4AZFA 3DAJA 4AZWA 1WBOA 3VHKA 4R5SA 4FTQA 5AR3A 3GEQA 1PXJA 4FKIA 3GFEA 2XARA 3FJQE 5L2QA 2IW8A 4BC6A 3ODYX 2XK7A 3FZ1A 2X0PA 5HOAA 4ACMA 5I9YA 3DJ7A 4R7BA 2F57A 5KKRB 5ANEA 4M15A 1Q61A 4IWQA 4PRJA 4H1JA 3F61A 1FGIA 1XHAA 4DGNA 2B1PA 1BI8A 2YM4A 4YLJA 5F4NA 2E9VA 4GT5A 2VNYA 1U54A 3GGFA 1GY3A 4ZEGA 4NKSA 4XV2A 5HE1A 1M14A 3F2AA 2VTQA 4MBJA 4OT6A 4W4WA 4O0SA 4EH9A 3FMEA 3RPRA 3RM6A 4IZAA 4QMZA 4M97A 4V0GB 3LCTA 4MF1A 1BLXA 4UMPA 3NUUA 5A4EA 5CLPA 2ZDUA 4OUCA 4RA5A 3DKCA 3GNIB 4I3ZA 5HNBA 5KKRC 2X9EA 3G6GA 3QWKA 5CU3A 2GS6A 5CT0A 3UC3A 4FSRA 4JNWA 3P7AA 2F2CB 4P2KA 4O4DA 3ID6C 5IDNA 4IQ6A 4MTAA 3LQ3A 2CCIA 4L52A 5B7VA 4NTSA 4MD8E 2ITQA 4QMVA 4FEVA 5IUHA 3WF9A 3DCVA 3ORKA 2R3LA 4BCJA 1S9IA 3DK7A 5FXRA 4F1OA 4U40A 4C35A 2XIXA 2Z8CA 3BYMA 3O2MA 3VF9A 4L6QA 4BWXA 3B8QA 4CFXA 5JZJA 3CY3A 5HICA 2PVNA 1KOAA 5BYZA 2PULA 3FUPA 1H1WA 2JKMA 2G15A 2VWIA 3IDPA 3CQUA 3W0QA 4LGDA 4AF3A 4AGUA 2I0HA 3TV7A 4D9UA 3QRTA 3IGOA 2EWAA 3QTRA 4MBLA 2G2FA 4NJ3A 3A7JA 3OEZA 2XF0A 3PP1A 4YC8A 5I9XA 4NZWB 5JFVA 3RI1A 2FVDA 3GI3A 5EH0A 3D7TA 4C34A 4CFFA 4QMNA 4YPSA 1FMOE 4J52A 4A9YA 1ZARA 2GU8A 2OBJA 4GVJA 4O6LA 2C6TA 2HY81 2JC6A 2CNVA 2HXLA 3RBWA 3FZTA 4FC0A 4QD6A 2JFMA 4AT3A 1PXKA 3OXTA 3PSDA 3NW5A 3QKKA 5M51A 4BTJA 4RIYB 2BDJA 5BUEA 1RW8A 2HIWA 2BIKB 4EQCA 2GFCA 3R7GA 2QO2A 1WBWA 3I6UA 2VTOA 3OP5A 3G33A 4ITIA 5CXZA 2PVMA 2A1AB 2QR7A 2GQGA 3FQSA 2PTKA 3AXWA 4HOKA 5HD7A 4FF8A 1YDRE 5A4LA 5DH3A 4F0IA 3SVVA 4AZSA 5CU6A 3IS5A 3K5VA 5T68A 3FYJX 2R3IA 4ZSGA 4MK0A 4DCEA 3QGYA 4OBOA 3FPQA 4UMTA 4WKQA 1UNGA 4FG7A 2JGZA 4XP0A 4D2TA 3P5JC 1H0WA 4R6VA 3C4ZA 3DXPA 1ZYCA 2VTLA 5IQHA 3QL8A 2QOFA 2X1NA 4AACA 4NW5A 2C6EA 4D2RA 3KXMA 2YWPA 2V7OA 2XYUA 4O7TA 4YLKA 3MVMA 1SMHA 4FA2A 4Q9ZA 3AGMA 4ACCA 4G9RA 4BDEA 3QZGA 2C5OA 3LFFA 5ETFA 4BDIA 5AV4A 1G8KA 1XBAA 4TWOA 5ETCA 3HECA 3QQHA 2R2PA 4WG3A 3EYGA 4FNYA 1YXSA 3WIKA 5IQEA 2WMVA 3HV3A 3OUNB 2C5VA 1DS5A 3TNQB 4E73A 2XUUA 3ZC5A 2CLXA 4QNYA 5E90A 2FB8A 1MRYA 2VAGA 1Q3DA 3RAIA 3UNKA 4DHZA 1XBCA 3NIEA 3PG1A 2JIVA 5K0XA 4GT4A 2CGWA 5BVKA 3BV3A 3R9NA 5KHWA 4NCTA 4BHNA 3VRYA 3UOJA 5M4UA 5A9UA 3WI6A 4E5WA 3AKKA 3ORMA 4AG8A 3UZRA 5A4QA 4IAZA 4EOMA 3E3BX 2WMAA 2VTJA 4FMQA 5E7RA 1JKLA 5L2SA 1GZKA 1H08A 2JIUA 3F5UA 5CI6A 2HZ4A 3VUGA 4GRBA 4YBKA 4DA5A 3FZRA 3DTWA 4H1MA 4EQMA 4YJQA 4O2PA 4YR8A 4BR3A 1Q62A 4CFWA 1IAJA 4JMQA 3MPTA 4ZS0A 1OM1A 2VO0A 1ATPE 1VLRA 3R22A 2RGPA 5FXSA 2CN8A 2VO6A 4MD9E 4RVKA 4ANSA 4ITJA 5AR7A 4BWPA 1QMZA 4ZTRA 5L2WA 3U6JA 4BY9E 3W0SA 2JD5A 4FJVA 3HGKA 4ZJVA 4CSVA 4DGLC 3QTQA 3P1AA 3C4EA 5J95A 3Q9ZA 4WD5A 3JUHA 4EK8A 3SQQA 2ZV7A 4XOYA 3VVHA 5IKWA 1VJYA 2VO3A 4KBAA 5GZ8A 4MHAA 3NYXA 1YDTE 2JAMA 3JVSA 3QU0A 3T9IA 4YPDA 4APCA 4M3QA 1P4FA 1ST0A 4IZ5A 3W1FA 3W2SA 4YU2A 4PP7A 2I0YA 3QCXA 4HPTE 1JPAA 3P79A 3UQFA 5HCYA 4EZ7A 4RMZA 3D0EA 4FKJA 5HE2A 4U3YA 2JDTA 3FMJA 1K3AA 3MVHA 3Q4CA 1OECA 3E8CA 3VUTA 3HLLA 3C5UA 2Y6MA 2XNEA 1UU7A 4NSTA 3C9WA 3C4XA 5CTPA 5D7AA 3L9LA 4FV6A 2W1DA 4G5JA 5KMNA 3COMA 4H3QA 5BMMA 3PLSA 2J51A 3GVUA 5M09A 1OIRA 5KZIA 2YAAA 4WA9A 3CKWA 4GH2A 1B6CB 4L3LA 4N0SA 5C4KA 1W8CA 4HGEA 4E4NA 4R8QA 4LFIA 3D2KA 3DZOA 4TXCA 2ZB1A 4E3CA 2OW3A 4B0GA 1GJOA 2WOTA 4QMUA 3OWJA 2B53A 3H10A 2WQEA 4IM2A 4UX9A 5FGKA 1R0PA 2X7OA 4L7FA 2VWWA 4GFGA 4NYEA 3G15A 2FUMA 4DFBA 1H28A 2YCSA 4R3PA 4U45A 4KAOA 2QHMA 3EN7A 4EBWA 3HUCA 3QQLA 3TACA 3MFSA 3QD3A 4WUNA 2VX0A 5DRDA 4O7RA 4O38A 1CTPE 3UIUA 4BIEA 1OL6A 3D2IA 2Y6OA 2CKEA 2XJ1A 2UW8A 2XK6A 2BTRA 3QRUA 2QOQA 4V04A 5TKDA 4B8MA 4CMUA 2ETRA 3PJ2A 3TMOA 4G5PA 2DS1A 3OWPA 2WQNA 4AA0A 4F0FA 1DAWA 4O0YA 3ZFYA 1PMEA 1YWRA 5HHWA 4ZSEA 2WIHA 4U9AA 4RC2A 3HMMA 3JY0A 4MAOA 5DA3A 4GG7A 4ASDA 4S34A 2EU9A 3RK7A 4PL3A 4BCFA 2NP8A 3DNEA 3MYGA 1BUHA 2XA4A 5AR2A 3KREA 3E7OA 2QU6A 5KBQA 2WZJA 5G1XA 5LVOA 2J7TA 4WNMA 5D41A 5GZAA 4FTKA 2F9GA 4HVHA 2FA2A 5HX8A 4F99A 4APPA 3DGKA 4PY1A 4JX7A 5H8EA 4QYGA 2XKEA 2WTCA 5DVRA 2HWPA 4PMTA 3MFTA 1REKA 3GC9A 3MVLA 4L7SA 5EDQA 1JLUE 3TEIA 4ZIMA 2WMQA 4D0WA 4QYFA 4A7CA 5ANJA 1MRUA 3KXXA 2CNUA 5LWNA 4RC3A 2ACXA 4Q2AA 4FKGA 4QMXA 3NYVA 4QMPA 4YTHA 3R7EA 4TYHB 4M69A 5HVYA 4IWPA 4D5HA 2F7EE 5KE0A 2XM8A 3KXHA 3ORNA 5TT7A 1VZOA 3EL8A 3GP0A 5CEOA 3QD4A 3EKKA 4FTOA 4ZSJA 3R83A 2W9FB 2X2MA 4NU1A 2VV9A 4FTJA 2R3RA 4FKPA 5DE2A 3LJ0A 2QOHA 2PUUA 4Y5HA 3VAPA 5CAPA 3HA6A 4L8MA 4L67A 1XH4A 2R3GA 3M1SA 4HZSA 5CEIA 4F0GA 4DYMA 3RWPA 1Q3WA 3BBTB 2J5EA 3ETAA 4X0MA 1E1VA 4FKQA 3FMDA 3PA5A 5FTGA 3CY2A 1UU8A 2HZNA 4FZDB 3BHHA 5CNNA 5K3YA 3IDBA 2YCQA 1OL7A 2C1BA 1UVRA 2XK8A 4IFGA 4I4EA 4QRCA 2WKMA 3HP5A 2X0QA 3PVUA 4FZFB 5E92A 3VS7A 4MWHA 4YJVA 1IEPA 4BCHA 1Y6BA 4IANA 4EONA 3QCQA 3R1YA 5EM7A 5LQFA 3H0ZA 1V0OA 3N4TA 3POOA 3VS3A 5EM6A 3T3VA 4EZ3A 2R3KA 4UZHA 3H4JA 3E93A 3ZO4A 4YTCA 4DEIA 4UY9A 5H9BA 3GUBA 3C0IA 3ROYA 5IQBA 2RFEA 3O8UA 4D1ZA 1PYEA 3DA6A 1J7IA 3WE4A 3BE9A 1LEWA 5AA8A 5FUTA 4RFMA 3DT1A 3R8MA 4DFZE 5HTIA 2OKRA 3PJ1A 3QQGA 2I0VA 4K9YA 2C0IA 3PJ8A 3A7GA 4EHGA 3W32A 3U87A 2DWBA 2QODA 3OZ6A 4AOIA 1OL1A 1RJBA 3PP0A 4J96A 2G2HA 5ACBC 2V5QA 3R1SA 1SVEA 1WCCA 5M4CA 1P5EA 2OXXA 4BCKA 4PTCA 4KRDA 5JH6A 4XLIA 2W1ZA 1PXNA 1XO2B 2YDJA 2X8IA 5ITAA 4LI5A 3RNYA 4AP7A 4Q5EA 4AW1A 3ZBXA 4QNAA 4HYIA 2WD1A 2X6EA 4Z9LA 2ITWA 4UYAA 4RX7A 3R8UA 3UP2A 3FZPA 2QOCA 4QYHA 5GJFA 2X39A 2OZAA 3R1NA 4LOOA 4CMOA 2AEGA 5IU2A 2PZYA 1Z9XA 3ALOA 4AZTA 1YI4A 5IMXA 5HU9A 3EQCA 3A2CA 3HRFA 3UP7A 3L9MA 5AEPA 4FKVA 3VBXA 1GNGA 4E6QA 1ZOEA 4UZDA 2CGXA 5CU4A 3QALE 3P23A 3PRFA 4FUYA 3FWQA 1CKJA 5C26A 2PSQA 2UZDA 2RG5A 4DFXE 3BHYA 3GENA 3VUIA 1XR1A 1DM2A 2VGPA 4X2NA 2IVVA 3RM7A 1DI8A 4DG2E 3VQUA 4AOTA 5IH5A 2OIBA 3REPA 3KEXA 4QP4A 2WPAA 4J95A 3CPBA 4U42A 3FSKA 3SGCA 2X9FA 5AUXA 4O0UA 4I22A 4KUJA 4XH6A 3ULZA 3JYAA 2IN6A 3EWHA 4BB4A 3ATSA 2UZUE 5E8YA 4QP6A 3EHAA 5KMOA 3RAWA 1XWSA 4C4FA 4HW7A 2XEZA 4FKOA 4FVQA 3EQGA 2QD9A 2WGJA 5CAOA 3TNHA 5LMBA 2W4KA 3I0OA 4IM0A 1H1RA 2IVTA 4MVFA 4CEGA 4O7WA 2QOOA 3QGWA 4Z16A 2YN8A 3A7HA 3WZJA 2WMTA 4XV3A 3NSZA 5HG5A 4EI4A 1KE5A 2ZV9A 4EK5A 2J0IA 5AV3A 3AC8A 2QG5A 4Z7HA 3BL9A 3G51A 2OFUA 4O22A 2V62A 3QKMA 4XG6A 1O6KA 2ITYA 3GCVA 3OVVA 2C5NA 4FEUA 5C01A 4EUTA 2ITUA 4C4GA 4AT4A 5CF8A 2YWVA 4DBNA 1H4LA 1YI3A 4RT7A 2WMUA 3EQRA 4DTAA 1ZYDA 4GS6A 5HCZA 3BLQA 2C47A 1BL6A 3DAKA 3ORIA 3NR9A 3AT2A 4JI9A 3S0OA 4TWNA 5HIEA 3W2QA 2X6DA 3SOAA 4O4EA 3I60A 5FQDC 1YWVA 4DEAA 5DBXA 4AE6A 4D1SA 4ZMEA 2ITTA 5K5XA 1KE6A 4EK3A 3Q3BA 4YJTA 3CR0A 3F2NA 3LXNA 3R8LA 2PMOX 3PZHA 3VHEA 2PZIA 4FNXA 5IDPA 1ZY4A 5I9WA 2BDFA 4E26A 5KMIA 1PMUA 3DLSA 5EI8A 1FVRA 2BRMA 3O8TA 4FKLA 2YABA 3R04A 2RF9A 4M0ZA 1YXVA 4WG4A 4GVAA 5AA9A 5AV0A 4KIPA 4FVRA 1E1XA 4GYGA 2BFXA 2VX3A 3UDTA 3DBEA 2Q0NA 3FQEA 4ERKA 4O7VA 3GQLA 3DJ6A 4LUDA 2A4LA 4CYIA 1PF8A 4PV0A 1K2PA 3VS4A 1URWA 3OG7A 3QTXA 1CMKE 3AMAA 3PY0A 5GIOE 1OIYA 1LEZA 3LFNA 2C69A 1OKZA 4FOBA 5K5NA 2B0QA 2P33A 5CWZA 3UMWA 3O96A 4ZZMA 3LCOA 1A48A 3QD0A 3TI1A 4E1ZA 5HG8A 4U80A 4YJOA 1TKIA 4U6RA 3S2PA 4Q5HA 4JIKA 4NM5A 4HYUA 5HESA 2XIYA 2OK1A 3UGCA 2YJSA 5LCKA 3LFCA 4AW2A 3NUSA 2CSNA 2VZ6A 2BZKB 3I0QA 3GFWA 4FV7A 1Y91A 1QPJA 2HZIA 4YNEA 2NO3A 3VQHA 1NVSA 3PRIA 4MXAA 4PDOA 5E91A 3F2RA 2A0CX 4HJOA 3PXKA 3D5WA 2VWVA 3MJ1A 3ZLYA 2GQRA 4FSYA 3AD5A 5FEEA 1BYGA 1HOWA 3ET7A 4IM3A 3CQWA 3SW7A 4L43A 1YWNA 3BHVA 3DPKA 4K33A 4KIQA 4KS7A 2ITNA 2PMIA 2JDVA 4WNKA 5M07A 4EZ5A 5BUJA 3PDTA 4C57A 3AC3A 1OVEA 4PDPA 3UZPA 2JBOA 4CXAA 4DH1A 2CN5A 1A9UA 1OPLA 4I6QA 4ITHA 3E7VA 1XMMA 2ZM4A 1W84A 4L46A 4LMUA 4Y46A 4YURA 3BL7A 3V8TA 4RQKA 4BN1A 1IG1A 3VUHA 5CEQA 5J79A 4EHVA 2HXQA 3OTUA 4FTIA 5AUUA 4O27B 3G5DA 1UNLA 4TNDA 1W2DA 3UVPA 5IQCA 4F9CA 4FSMA 4MX9A 4G17A 3FC2A 3BRBA 5B0XA 2BKZA 5BYYA 5F20A 2W17A 4YZMA 4IX5A 2C6DA 2QURA 3TYKA 3ZEWA 4CCUA 3VUDA 2XRUA 2XKFA 4C0TA 3IGGA 4X3JA 1OMWA 2X4ZA 3F3VA 3PG3A 2GNIA 5AP7A 4CYJA 3EH9A 2BRBA 3E64A 4O86A 4LYNA 3D4QA 4M68A 5IA2A 3QCSA 2W96B 3MVJA 3BYVA 1SM2A 3PZEA 3PJCA 2PVYA 2R3MA 3HA8A 4RX5A 4FG9A 3F69A 3IW4A 3LW0A 3F3ZA 1DI9A 1QPCA 2PMLX 1XQZA 4WHZA 5A46A 5AAEA 4DCAA 3OMVA 2CGVA 4WNOA 5J5TA 5AR4A 2W06A 1U5QA 3G0EA 4K0YA 4O1OA 2J2IB 4RFZA 2I7QA 1GIHA 1FVVA 2IVSA 3FI3A 3KXZA 5BVNA 5HTCA 3DK3A 3OBJA 1ST4A 3D5VA 3P5KA 3UDSA 5AIKA 4BDKA 2WTWA 3R71A 4IB1A 2R7IA 4G6OA 4GSBA 3PIXA 4PTEA 2UW0A 3FSFA 3IOPA 5EHOA 4CV9A 4C8BA 2E9OA 2JEDA 3PJ3A 5A6NA 3DBCA 2CKPA 4XMOA 3NVMB 1VYZA 3CEKA 2QR8A 3PLAE 4PUZA 4G3EA 5H8GA 3R2YA 5E1EA 3FXZA 4FK3A 3UIMA 3KVWA 3BYUA 4WSYA 4QMSA 3N4UA 3MV5A 4JQEA 3DBFA 2C6KA 3MY1A 2GNFA 1P4OA 4C02A 4HYSA 3QQJA 3E5AA 3EFJA 4FK6A 4WSQA 4XOZA 3UO5A 1YRPA 1SVGA 3AC1A 3DZQA 3GQIA 4M7IA 4RPVA 3K5UA 4AXDA 3PUPA 2BMCA 3PXFA 3F3UA 5TF9A 3V8SA 4NL0A 1SVHA 3NRMA 1ZOHA 4FIJA 4U41A 3WF8A 4YUQA 3NDMA 2YEXA 4L3JA 1J91A 4MF0A 3HMPA 3POZA 4LRMA 4CFNA 5ANKA 4FKRA 5HLNA 1P14A 3FLZA 2Z7RA 4W4VA 3KF4A 3ZFMA 5HQ0A 4FRFA 1WVXA 5CEMA 2YHVA 2J6MA 3C4CA 4FT3A 5CNOA 4ZXTA 4D4VA 4FZ6A 1F0QA 4C38A 4Q9SA 5KMMA 3FLSA 2W1FA 5AR8A 2P4IA 4C4HA 3D5UA 2NRUA 4XBRA 2J0LA 3CPCA 2QONA 3HYHA 5JQ5A 4ZZNA 5CAVA 3FZOA 2F2UA 1J1BA 3IKAA 5AAGA 5EK7A 3RVGA 3AKJA 4IX4A 1ZYLA 1ERKA 2GQSA 4UB7A 3PFYA 2RFNA 1SZMA 4AW5A 2WMXA 1ZOGA 3FMNA 2Z7SA 3IO7A 4KD1A 4OW8A 4XRLA 2OIDA 4C61A 2XJ0A 4GYIA 4V0GA 3KRRA 5IQGA 4DEEA 3LHJA 2H34A 4CVAA 4MNFA 4W8EA 2PVKA 4ZTHA 4AA5A 4AOJA 4ZLYA 5KX8A 3COIA 2OXDA 4GJ3A 5EOLA 4BIDA 4U44A 2GMXA 3OUKA 2YIWA 1JBPE 1RQQA 4I6FA 4IVDA 3EYHA 3OCTA 1JNKA 1FMKA 4LL5A 4Y85A 5AUYA 5FTQA 5I9UA 3OC1A 4U5JA 5AP3A 4C58A 4JAIA 3ZUTA 3AD4A 3P0MA 3UJGA 4IFCA 3PWDA 1SYKA 4FIGA 4LRKA 4EOSA 4LQMA 4BDGA 2XNBA 3KMUA 3PXQA 3Q96A 4XX9A 3E8NA 3L8SA 3E3PA 3LFDA 3OW4A 4PP9A 5CSPA 3ZU7A 4WT6A 4FTRA 4L00A 3U4UA 2JAVA 4TYGA 4S2ZA 1CM8A 4YHTA 2OO8X 5JT2A 4QT1A 1O9UA 1MP8A 5KMJA 3H9FA 3PVWA 3HMNA 3R21A 4U79A 4WO5A 4S31A 4KIKB 4TYIA 4AWIA 4BCNA 4BIBA 4W4XA 4BI1A 4FIHA 2B9JA 4B7TA 3GC8A 4C7TA 3RPSA 3LJ1A 1OL2A 3NGAA 3NZ0A 3BWJA 3BQRA 4IWOA 3EFLA 3RPVA 4BHZA 3EKNA 3NAXA 2JFLA 2R3PA 5JFSA 4LRJA 5FXQA 3TWJA 3LZBA 4MH7A 3BI6A 4O4BB 4QQCA 3UPZA 1MQBA 3AOXA 2OU7A 4TYJA 5IA5A 2PY3A 4MBIA 5GJGA 3W0OA 1YOLA 3P08A 2EXEA 3RCJA 2X7FA 1JKTA 4TWPA 5CEKA 2JDOA 4GUEA 1UA2A 2IVUA 2XYNA 2X4FA 3H9OA 4IAIA 4IAAA 3TNIA 4GIHA 3FL4A 2IEWA 1M17A 4EBVA 1Q8ZA 1ZY5A 4EOLA 4ZSAA 4S30A 4O84A 3R7VA 2YZAA 5T6KA 3GU8A 3ZONA 4ZTSA 4F6SA 2V0DA 3M42A 3KY2A 2IZRA 3V5WA 3W55A 4DC2A 4F1MA 2GHMA 1TVOA 2WMBA 4O7YA 3TKUA 4JLCA 3ORXA 4FKUA 4O4FA 4HGTA 3U4WA 4D4RA 4DHIB 2WTVA 4QPAA 4RJ6A 2VO7A 3BU3A 4CV8A 4PL4A 5J9ZA 3OCBA 3VBTA 2O3PA 1MQ4A 5LARA 5J1WA 3G9LX 4DEBA 1XH5A 2YCRA 4E20A 5CS6A 2R5TA 4O81A 3VW6A 3R73A 4MCVA 5CT7A 3VS0A 4EH7A 2UVZA 3WZEA 4AT5A 4FNZA 4D4YA 3CTJA 3DY7A 5IA3A 4QQJA 5LVMA 2O0UA 2WU7A 5IQIA 2EXCX 1W0XC 5DN3A 3UBDA 4PMSA 3ZFXA 5DMZA 1LP4A 2RKUA 4YTFA 3G6HA 3NCZA 2G1TA 3MJ2A 3A7IA 3FPMA 2H9VA 2Z2WA 4BTFA 5D11A 2JKQA 4XG4A 4AQKA 4FL2A 4M69B 1ZMWA 1ZYJA 5FRIA 5HGIA 2AUHA 3JVRA 4CRSA 3IQ7A 4AE9A 2C3KA 3TZMA 4D4SA 4R3RA 5H3QA 4D2VA 3LFEA 3ML1A 4E4MA 4EWQA 3RK5A 3OS3A 1REJA 4YC3A 4RZVA 1Q8UA 3OY1A 5LVLA 3BU6A 2ITVA 1NY3A 3A99A 3GC7A 3MS9A 4FKSA 5HBJA 5AR5A 5L4QA 1I44A 3D94A 4R1YA 1TFFA 4PNKA 5DEYA 3ZTXA 4BJJA 1LUFA 4IWDA 2UZOA 3V5PA 4YJNA 5L8LA 1WZYA 3RMFA 3JS2A 2VWBA 1JQHA 1IA8A 2QQ7A 3PXYA 3TZ8A 4RVTA 2O64A 2WMRA 5C4LA 3CIKA 5DRBA 1PYXA 4X2KA 3E8EA 3FV8A 3WZDA 2YM6A 4QP1A 3PSBA 5IUIA 4JQ8A 5CAQA 4JDJA 3U6HA 3QCYA 2ZB0A 1M7NA 4JG8A 4AXCA 5ANGA 5L3AA 4TRLA 2P0CA 4B6LA 4RRVA 2BALA 2WIPA 3F5GA 3Q04A