1Q3HA

Mouse cftr nbd1 with amp.pnp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
281
structure length
265
Chain Sequence
TGIIMENVTAFWEEGFGELLEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structure of nucleotide-binding domain 1 of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 92
structure length 265
sequence length 281
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1q3hA00
1QHNA 5DSZA 1XZQA 4F4IA 3CWZA 1XCPA 3Q5EA 4LV5B 2WMNB 1YU9A 5EXTA 5FOXA 1YR6A 2XTNA 1XD9A 2X1VA 3GJ7A 4BRWA 5FTLA 4OHZA 1DVRA 3MAAC 3H86A 4C0SA 3SE0A 3B9QA 3P4XA 1T3SA 2O8DA 3VMFA 4PANA 4PZYA 3AF4A 1NKSA 2XOKD 1U8ZA 4DSOA 4KXFB 3K70D 3DHWC 5JWHA 4F91B 3FVQA 2R8RA 1J8YF 4DSUA 3U44A 4HZUA 4V0KA 3FB4A 3QPWA 3WXMA 2QRNA 2EFHB 1Z8FA 4A15A 1N2CE 4LC0A 3LY5A 1W49A 4QBFA 4Q9HA 3VNUA 4M0LA 5AJWA 1E69A 4TTRA 2HJVA 2YNMA 5E7MA 2WTUA 1ZD9A 4MUBA 2GCNA 1KJZA 3O8DA 3A37A 5AJZA 5LB4A 4EPTA 3REFA 1P60A 4YONB 2ERXA 5HE9A 2IEZA 3AVYA 3RWMB 1SVSA 1K8RA 1MR3F 4U5XA 2J0QA 1TADA 1U2RA 1T0HB 2CCKA 5EE0A 2VTKA 1CP2A 3SJAA 5C4MA 1NN0A 1KGDA 1ZIPA 4BEBA 4RD4A 1NLFA 4MRNA 2XNSA 3AP1A 4DDWA 3WNBA 3WMEA 1RRFA 2ZUBA 4DRZA 4OL0A 4EIWA 3BAFA 3GEEA 2QPOA 4HAZA 4BFTA 5KPJA 5JCZA 5GADl 4E09A 1HT1E 5AUQA 2PL3A 4KFUA 5HZHA 4HUQB 5FPSA 3U2QA 4DLXA 4URZR 3X1XA 1BH2A 2NIPA 4ZDJA 5M04A 1D5CA 1XD2A 4A1FA 3R7WB 2CK3D 1FQKA 4JIMA 2V7QA 4FCVA 3VKGA 4A9AA 4M1KA 3QF7A 1KY2A 5E3HA 4NZYA 1K6MA 3E1SA 2ZI9A 1MO3A 5FPKA 1AN0A 1TQDA 4I1UA 3WYGA 3X1DA 5GJCA 4B76A 1WDTA 2O52A 5CB6A 2A7QA 1A1VA 1MO5A 2EFGA 1NLYA 3A4MA 2ZU0C 3WNDA 2WICA 1ZNZA 4I4LA 4NYJQ 1G291 2QROA 4QC2A 1IN7A 2X2EA 4OK5A 4PC3A 4LYFA 1UEJA 1T0JB 2Z4SA 4A92A 621PA 1IXSB 2AKAB 3SQWA 4F38A 4B2PA 1QHXA 3UIEA 1J99A 2ASEA 1R0WA 3EARA 1R8SA 1F2UB 3MLEA 4IXNA 1PVOA 3R20A 4GZLA 2VHJA 5FUXA 4IHQA 1YZLA 1WF3A 3K9HA 1CR4A 1TUEA 4O3MA 4PAMA 3GJ4A 4PFSA 4D0NA 3LD9A 4MRRA 4LSGA 1TEVA 1GSIA 3QNUA 3RC8A 3VKWA 1YZUA 1A2BA 2W6ID 4KFRA 2B6HA 2QZ4A 4BFXA 3ZQJA 4BFSA 1DEKA 3QXXA 5F2EA 3DDCA 3GLFA 2ZEJA 2RKOA 4E5UA 1DG3A 1JBKA 1C1YA 4L9WA 5FFMA 3CRQA 1E2EA 2CE2X 2ORWA 2BHRA 3U3JA 1OYYA 2OO7A 3GLIB 5DLQC 2BJWA 2L0XA 4KHZA 2V1XA 4O0MA 3GLFE 3I61A 2JDID 2NTYC 1OJLA 2ZE7A 1EESA 3O8BA 3AF2A 2MMCA 4DLUA 1KMQA 1NSTA 1E32A 1C4OA 4P4UA 3GLGB 1YRBA 2GXSA 1VHTA 1G5RA 3TW8B 5B58C 1UDWA 3IIJA 4BECA 4XTRA 4HB4A 3GEHA 5FL7A 1US8B 3GCGA 5BQ5A 2VSOA 1EK0A 4M4SA 3W5IA 4AG6A 3CF2A 3ND8A 3PUWA 2AFIE 2LKCA 3ZS8A 3THWB 2WWGA 4MRPA 1TQ4A 4ZDWA 4CVNA 3EXAA 1HE8B 4AKHA 1RJ9B 5FI1B 5BN4A 2F1RA 1UJ2A 5D3QA 4M1OA 4QNMA 3PR1A 1S1CA 1YR8A 3N70A 2XZPA 1XFAA 1G7CA 1NMXA 2VIIA 3HPRA 2ZS7A 2W6JD 1E2HA 4W5HA 1ZIOA 2ORIA 2QAJA 2ZUCA 3BH6A 3ZGXA 1DO2A 3FMIA 4BE7B 3QG5A 2UKDA 2P5SA 1EFTA 3DEFA 3W8RA 2QT0A 5JJIA 5FPYA 2CLSA 4Z1MA 1I4TD 1G3IA 1U81A 4CT4B 4KU4A 4GDFA 2FSIA 1W1WA 5DE3A 2QP9X 4XD7D 4P33A 4D26A 2OXCA 3DKPA 1II0A 3A1SA 3QBVA 4MGKR 5TV2A 4Y0AA 4F7WA 2JLXA 1AS0A 1KZGB 4G5SA 4YMWA 1DAEA 3NXSA 3B2EA 1P2TA 3Q8XB 1BYIA 2FF7A 2PEYA 1II8B 3OFND 4FXPA 4MKFA 3A1UA 3K0AB 5CM8B 2R62A 1MOZA 3AF3A 2N1BA 1KO4A 2QAGC 2V6JA 3NIBA 2IL1A 4PPQA 1H8HA 1DAFA 1ZJ6A 1N6LA 5JJLA 4A6XA 2IXEA 4HLUC 4D81A 2VHTA 2P3SA 2ZE5A 1E2KA 2JGNA 3DM9B 4D4LA 2BCGY 3K09A 1FFHA 2JJ1D 4TYYA 3KKNA 4NTZA 3TNFA 1ZC4A 2WJJA 3H84A 1QRAA 4XH9B 4DIDA 3AUYA 2NZ8A 1AZTA 1CJMA 1Z2AA 2BOVA 2QMHA 5DN6D 1Q22A 3DOFA 3I5YA 4CIDA 1M2OB 2JEOA 2WWWA 4EPRA 4WZ6A 2HF8A 2ZRMA 3DMDA 4I1OA 1KK1A 3K0FB 3KQNA 1D2NA 3K1JA 4WZBE 5B64A 4A82A 4B44A 2H7VA 1XEWY 1I2DA 4OKSA 4UNRA 1GOTA 1OH7A 4QGHA 2OFWA 1HY3A 1ZD1A 3FFAA 3BOSA 5AJYA 4YLGA 4JT2A 1KNQA 4US1R 2C03A 4OI0A 1P2UA 2QI9C 1O3YA 3FKQA 1N3BA 2C8VA 3LX5A 4OK3A 1B23P 1Q1BA 1JNYA 1PLLA 3O47A 1FUKA 4LJ9A 5SZKB 3R9XA 3LXRA 3TK1A 1CRPA 3CUEF 4PX9A 5GJVC 4TLBA 4HLDA 4PZZA 121PA 5L3VA 5KPDA 1AGPA 521PA 4NKRA 1DAKA 1KSGA 2PZGA 4W5JA 3PIRA 4JLAA 1HH4A 4QJ4A 1WP9A 1E0AA 2CBZA 4FCWA 1XP8A 4ACAA 3RS3A 2C96A 1UAAA 4QBHA 1N6RA 1W0JD 2FA9A 2JAQA 2OFOA 2QUZA 3RANA 4C0QC 5IK2D 1P6XA 2Q0HA 4U7DA 5DI3A 1OFTA 4IEIA 4V03A 2ODBA 3TUIC 1DAMA 1KZ7B 2CL6X 3BFXA 1JJ7A 1N6NA 4QXAA 2QORA 3HR7A 3NDBB 1OYWA 5FUWA 1VYVA 1XTKA 2O5VA 5DISB 2Y8EA 1NL3A 2IS1A 1UBCA 2H17A 3CM0A 4Q1EA 4JT4A 3VR6A 3KUCA 4JLOA 3NH6A 4AURA 2F55A 1U94A 1HE1C 2GA8A 2QN6A 4UJ5A 3Q85A 4C7OB 2P6RA 4PQFA 5KSZA 1ZNYA 3M0EA 3QY0A 1UBFA 1G41A 5KYKA 3UXMA 5EUQB 2V55B 1GKUB 3GLHA 5FBRB 4O25A 1VG9B 821PA 1SZPA 2J59A 1TMKA 1BIFA 3L8ZA 2NOAA 2AN9A 4JMPA 3GJ5A 3SQXA 1KI3A 3GP8A 4JS0A 2GXUA 2Z4RA 2ATVA 3CR8A 4LBYA 4DIEA 1HUQA 2WSSA 3LW8A 1G4AE 2FMXA 1G7SA 4C0JA 1MT0A 2OCPA 1IN4A 1RFLA 3AKDA 3AKEA 4QJ5A 2PJRA 4KLZA 3PITA 4EFMA 1NMYA 1NJGA 4GI7A 4AY2A 3H1TA 2BM0A 4MRVA 3RDPA 4G01B 4DUGD 2YJTD 1BKDR 1AM4D 3OEEA 4IVQA 2IS6A 1MRSA 4JL8A 1KHTA 5K8UA 1JXOA 1W0KD 4WOPA 5GJWC 3I4LA 2P6NA 3K9NA 1Z3IX 1FTNA 1SKYE 4RZ2A 1ZM2A 4ASUD 2RB4A 4BFUA 1OIXA 4IFBA 4QG7A 3C8UA 1NBMD 1OH6A 3B6EA 3KJHA 4L16A 5JSZA 1K5DA 4DLYA 2RMKA 1M34E 3F5FA 4LPSA 2W58A 2RGNA 3UG6A 3IGFA 2HT1A 4WBSA 5BN3A 1AS2A 1JR3D 3CNOA 3KQLA 3U3OA 5KHOC 2QG6A 1ETUA 4G3XA 2BC9A 2ZE8A 3GD7A 2YINC 4JLVA 3NDPA 1FMLA 1OXTA 3FDIA 4O2RA 1GIAA 2IYWA 3QKRA 4Q9LA 5H1YA 4Q7KA 2ZROA 4ZIRA 3MRSA 2WWFA 4S2EA 2Q9CA 1Z6TA 3EC1A 1Z6XA 2PZFA 2ANBA 2C95A 2GVZC 3E2IA 2NPIA 2ZI7A 3TAUA 2GRJA 4X8OA 4TMVA 4BZXA 3R8CA 1P61B 4EPVA 1E2PA 5B57C 1GRRA 3NTUA 4NH0A 2F9MA 1Z22A 4Z8YA 2W2TA 2WKPA 2GJKA 3RRMA 4N0EA 4DLWA 2ZJZA 3AVOA 4LDJA 3FHCB 5FTJA 5FOTA 1R0YA 3PXGA 2F43B 4DCUA 1XNJA 1ZNXA 4B32A 3X1YA 1K5GA 3K9LA 2R44A 1WMSA 4D4JA 3Q9LA 4IKEA 4M1WA 1TNDA 4US2R 1E2FA 3UMRA 1Z07A 4OI1A 4JVMA 4P32A 3CR7A 4URUR 1KI6B 5HZKA 4OQFA 2GZHA 2KB0A 4UNSA 1VHLA 2H16A 4DCNA 1XEXB 3LBIA 2ZI6A 2ZRNA 3TLXA 2J0UB 5LDDC 1CEEA 1AQUA 1OW3B 1GFIA 1G5PA 4B3CA 4W7SA 5LB2A 1X8LA 5BN5A 5JJKA 1V5WA 3NBYC 4UQOA 3PENA 1P4SA 4TSFA 2SHKA 3TQCA 1YQTA 2WWHA 3T15A 1CJVC 4YC7A 2V1UA 3A1WA 1XWIA 4QGFA 3BB4A 3T5GA 1M7HA 4PZLA 4Q9IA 5CYOA 3T35A 2ZRAA 4JKIA 2ZANA 3DL0A 3G0HA 2NO0A 3WBJA 3BH0A 1KI1A 1E1QD 1KSJA 2XB4A 1Z83A 3DMNA 1MABB 5CJPA 3SFVA 2HCJB 1YZTA 1KJWA 2IT1A 4WA7A 1W7AA 4DB2A 1G6HA 3BERA 4YXWA 4KITB 4BFVA 1QVRA 2ZRHA 4DKXA 5HKKD 3IHLA 3IQWA 1GM5A 1Q20A 2H1LA 4D4MA 4V02A 5L3QB 1F2TA 4PC6A 5EE3A 3MWYW 4A0FA 4CEIA 4BZPA 4CEJA 4GOXA 3WBKA 3B7GA 2DBYA 1XD8A 1QHHB 1BMFD 2QAGB 2QY9A 1GL9B 3OIWA 3PQCA 2JIZA 3ZZTA 3R8FA 3CO5A 5JBQA 1W4AA 1KI8A 3NBFA 5EUMA 3A8TA 1VCOA 2UZIR 4TYNA 1UKZA 4LHVA 2B21A 3QI2A 5JEEA 4QL3A 1S4QA 2ZRDA 3TJZA 3OF5A 4V0OA 2J3EA 1SVWA 2GILA 1LY1A 4IDQA 4CW7A 5H70A 2HF9A 4Q4HB 3FMPB 4XIGS 3SJBA 4UJ3A 2FE4A 5FOVA 5A4JA 4MYTA 4NU0A 1JB1A 2BBOA 1Z28A 2Z5FA 3IEUA 2GEUA 1E1RA 1LFDB 4ZKEA 2FJUA 4RFVA 3ZD7A 2XSZA 3ICEA 2F6RA 3TGPA 2KJQA 4ON9A 1A7JA 1E2JA 3H2YA 2IWHA 2HXSA 3CH4B 2IC5A 1NVXQ 2UZ3A 2V8OA 3LRPA 1GNRA 3F8TA 4PO1A 2N46A 1UADA 3ECCA 4I1VA 4DWJA 2FEMA 2YYZA 1DARA 4Q1BA 4Q4AA 421PA 2XB2A 4E03A 4TL9A 3QKSA 3ND9A 2ZETA 2WM9B 4FCTA 1SVKA 1PZNA 4ZKDA 2HLDD 2IUTA 4Z51A 2E9SA 3P20A 5H68A 4M21A 2AXPA 1XMIA 4TQAA 1PUJA 1Q3HA 1ZYUA 4Q21A 5AR1A 3K09C 3WHKA 4DCTA 3KTAA 4I1SA 4LBVA 1U0HC 3ADBA 5TDHA 2G1KA 4P3YA 1RIFA 3SYLA 2O8DB 2VYFA 2JA1A 3PJRA 3KB1A 2WZQA 3LDAA 2EU8A 2IUSA 4NDZA 5DH9A 4D80A 3P32A 3K0SA 1M1YE 4ILEA 3U44B 1DAGA 1JEEA 1VTKA 4HZUB 1PJRA 4DCSA 2CNWD 1QG4A 2R2AA 1KDRA 2C04A 4BWYA 1G8GA 4LJAA 3L8YA 3A6PC 4WXRA 1G19A 2RHDA 5DYGA 4Q7JB 2A2ZA 2CCGA 3GJ6A 4UXHA 5EE9A 3B1YA 5BWMA 3GPLA 1KI7A 1NY6A 2FSGA 4TT3A 5BYKA 2P0EA 1IXRC 1QG2A 3KKOA 2MSDB 4J0QA 1W36C 2RGAA 2WAYA 3Q3JB 1LB1B 1E0SA 2H8KA 3CZQA 3MGCA 1WE2A 4Q5IA 3RABA 4BFYA 2ECKA 3B9PA 2IF0A 1AQYA 2FGKA 4IVRA 1FNMA 2GF0A 1SHKA 1EXMA 3AQ4A 3FYHA 2WJVA 3THYA 2GTPA 3AVWA 4TYWA 2A5DA 2OZEA 3DVLA 3TR5A 3GFPA 2H92A 1CF4A 4MH0R 2G3YA 1QDEA 4HDQB 3PEVA 2D4HA 2GCOA 2O0HA 1D8TA 2V4ZA 4M2LA 4PPFA 3M6AA 1CS4C 3ASYA 1IM2A 1Q1EA 1ZRHA 3SEAA 1OSNA 1KY3A 1NIJA 2IEYA 2VSFA 4Q48A 1NVVQ 1NNEA 2O8CA 3TW4A 1YZGA 1LF5A 3AEZA 4OQMA 2F7SA 3LVRE 2J46A 4TYQA 4BZQA 1OFHA 3BD9A 4PPGA 2G1JA 1G3QA 2PZEA 2VP0A 4RY2A 4GP6A 1Z0FA 4RZ3A 2JLUA 3SFZA 1IN5A 3K53A 4OQLA 5UKDA 4AK9A 2TMKA 1F5NA 721PA 2NPFA 1JR6A 1X6VA 5K8IA 1IONA 4FI3C 1GRNA 4DLRA 5K8TA 4XOIA 4XWAA 1S0UA 4KBGA 3VR4A 1NN3A 5FH9A 2DFNA 1RC8A 4K81B 1UM8A 3UWOA 3W9YA 2BV3A 4PR0A 3PEUA 2Z0MA 1SULA 5E95A 2OLKA 4BASA 1U98A 5GVRA 2JLWA 4QHTA 2G0TA 2H5EA 3LW7A 5BYJA 5KTYA 1F48A 2ZYTX 4PSKA 2W2XA 3BGWA 5TY0A 1XXHE 1KIMA 4M1SA 5LBIA 1E2NA 3T34A 4LJ7A 3QSYA 3AVUA 3UATA 3U60B 1OXUA 1IJEA 1XX6A 2BIFA 1UFQA 4Q02A 2OSBA 2PH1A 2RGNC 4EJSA 1OFIA 2V7QD 4N3NA 1GAJA 1IJFA 2Q3MA 3CF0A 4PHTA 4QHSA 3RS4A 4DC9A 3G82C 5JCPA 2VH5R 2BMEA 1MKYA 3AVVA 1E9CA 3EA5A 1D9XA 3SC3A 4HB0A 5CYPA 1YZQA 4TL7A 4HUTA 4UKDA 2ZU6A 1CXZA 1R0ZA 2JJ2A 5EE5B 2HYDA 4CZ2A 2AWNA 4UXIA 1TQ6A 2ODWA 2GNOA 3AUXA 4KFTA 2DWPA 3KKQA 4TL6A 1Q21A 1II9A 1I4LD 2OESA 3FKSA 3LNCA 5K8LA 3IBGA 4MKHA 2QSZA 5EE1A 2FOLA 2WSMA 4NCIA 4EPYA 3QQ5A 1E98A 1CLUA 2R9VA 1W2GA 2WWYA 4ARZA 1RKBA 3OAAA 3PFIA 3VR5A 3VHLB 5CDFE 4US0R 2XTZA 3BBPA 4TMXA 3W5JA 1N6IA 2QRZA 4TQ9A 1RYHA 3KXKA 1GNQA 1R10A 1KYIA 1BO6A 2NZJA 1VPLA 1J2JA 4LPKA 4V0NA 1HT2E 1XJCA 1GP2A 3NEYA 2FFAA 2RHMA 4M9XA 2ODEA 1EWQA 1G18A 4LWZA 2KWIA 3B60A 1N6OA 1LW7A 3BE4A 2RGBA 4M22A 3EX7C 4B43A 1TF5A 4Q19A 1MO6A 2A78A 2VL7A 3S1AA 4QBGB 3UKDA 2ZJBA 2OXRA 4E07A 2C9OA 3V4RA 2QE7A 3IKJA 5CK5A 2V6IA 1U90A 4B48A 2ZREA 1Z0AA 2ZRIA 4OBEA 4PPNA 4RCYA 3TKLA 1JAHA 1JAIA 1DAHA 3Q7PA 4M9QA 2PCJA 2R6AA 1GILA 1ZAKA 4DEYA 1UPTA 2WAXA 5FOUA 1Z6AA 2I1QA 3BH7A 1Z6YA 1VYUA 3GJ3A 2KI5A 1CRQA 4Q1CA 1SXJA 4XSHA 1W47A 5FBQB 4KVAA 1ZCBA 1R7RA 5FL7D 3CRW1 4C9BA 4ESHA 4GT1A 5FUVA 2AXNA 4LJ6A 3VFDA 3OIVA 3KJGA 5C46F 1XF9A 3GJ0A 1YZNA 1SHZA 1SXJE 4JBYA 1KDOA 3SYNA 1GRQA 3WP0A 1E79A 1Q1QA 3VU9A 5TMPA 3QPUA 1XTIA 3MCAA 1N0VC 4JZKA 4R9UC 2B92A 3U7HB 2J7PD 3B82A 4DDUA 3ICQB 2BEKA 5P21A 3I62A 3QEJA 1KK3A 3PUZA 1M8PA 2GXQA 2OAQ1 2AK2A 4B2LA 2BKEA 2GEVA 4NHOA 5L3SA 3AVPA 1VECA 1OLOA 2J87A 3RRZA 3THOA 3AVQA 1NN1A 2WV9A 4A8JC 3ZYCA 4EQ6A 1ZVQA 2QGZA 1HURA 4JLKA 5J5CA 1CULC 4S35A 2CMKA 4TZ0A 4IDNA 2FWRA 3B85A 4IOJA 3SOPA 4ZDIA 1P9NA 1LS6A 2ZS8A 4JYCA 1P9RA 4ZO4A 4Z1MD 4RVCA 2FH5B 4FN5A 2YWGA 2GZAA 3ONWA 4HEJA 1F2UA 3VX4A 1FOEB 4PC2A 2ZSDA 2ZTSA 1E3MA 4LGMA 2FFHA 4P31A 5KDDA 5H8WA 1FW6A 4C0AC 3EZ2A 5CM9C 3BB3A 2I1VB 1RE0A 3U7FB 1AS3A 1W36B 1EG7A 2WWXA 5G3ZA 3PV0A 3OIUA 5EXSA 2WOJA 1IQPA 3M4YA 3IUYA 3KFVA 5ANRB 1QHGA 5DHFA 1H8HD 4D4KA 2ZRKA 1NLZA 1TF2A 3B78A 4JSTA 1YHNA 4AC9A 3IDQA 1X3SA 2HUPA 4EDHA 1L8QA 4B35A 4WXPA 5DI3B 3FPAA 3UANA 5FTKA 4HB2A 2XXAA 1AZSC 5JHGB 3KQKA 4Q4JA 1F3OA 2IYZA 3GLIE 4JVNA 4KYUA 4D82A 1W4CA 1ZM9A 2PLFA 2R6DA 2X2FA 3EZ7A 4D2IA 4OHWA 4AKIA 1S3SA 3A58B 2IYLD 1L4YA 2VF7A 2ZRFA 1XTQA 1T8TA 1T5IA 2XTMA 3GLGE 1OKKA 1TU3A 2D62A 2PT7A 3CX6A 4ZI3A 5LPNA 1G4UR 2BJVA 3VX3A 4NCKA 3DO6A 3GLHB 5FPHA 4BPBA 1S2MA 3KJEA 5G41A 3FHTA 4GOJA 1UKEA 4LYAA 4NYMQ 4QJ3A 1W36D 2R6FA 5C1BA 1FUUA 4A6PA 3W6NA 2GAAA 3EW9A 2QA5A 4URYR 2C98A 4QOSA 3L82B 2IYQA 3EPKA 2DFLA 5BW8A 1M7GA 1E4VA 3WY9A 1FQJA 4F4JA 1XMJA 3BORA 4HAVA 221PA 4LY6A 2QMUA 4FWIB 3C41J 4JBXA 2VQSA 2P6UA 1BOFA 3AH8A 5JHHB 3LVQE 2QSYA 3EWSA 4LBWA 3ZVRA 4TQUS 5KUTA 1P5ZB 2CE7A 4RKFA 5SZJA 3TIFA 2BMFA 2J45A 1UKYA 2OEPA 4BLRA 3DKVA 2IYVA 2XZOA 2D2FA 1G6OA 2BKUA 1PV4A 1HEIA 5JSZB 1T4GA 4MYCA 3LQRA 1AKEA 1GDDA 3QVUA 1L4UA 1GITA 2FPLA 3L43A 1AJEA 1OIVA 3H4MA 4F92B 2QTHA 2IYSA 3PUVA 3LBNA 4KVGA 3I3SR 3KX2A 4IOLA 4D25A 2GDJA 2FZLA 2ZYUX 4N0DA 2GJSA 3KJIA 1Y63A 1CKEA 1Z0IA 1EFHA 2WJGA 1E9FA 3KQUA 1TAGA 4GNKA 3QKRB 4K8OA 1II8A 3ZDQA 3ZIAA 1TF7A 2OLJA 1T8UA 4ZIRB 4TTQA 2O8EA 2WPDA 1KK0A 1R5NA 1KK2A 1XJQA 5DI9A 5A0FA 2WKQA 3X2SA 4KI0A 3FMOB 4B33A 2QGNA 4AD8A 2REBA 3ZH9B 4QKQA 2J7KA 3SS8A 3UMFA 1E2MA 2QM8A 2IYYA 1FX0A 3QXJA 4KYIB 1IOZA 3JZMA 1SQ5A 1KO8A 1JQLB 3AF0A 4Q01A 1ZUNB 2DY1A 3OEED 4GFDA 1KDPA 4KBFA 3MWLA 5CLQA 4G1UC 3V9PA 2OG2A 5KSPA 2CL7X 1XTJA 2CJWA 2REXB 3TR0A 4EPXA 2GCPA 3QXSA 4L15A 4XSGA 3NHBA 5FR1A 4DT1A 1X86B 3Q72A 3B5JA 1OHHA 3LA6A 3LO5A 5TARA 3REGA 1HA3A 4LBZA 4EJSC 3QJYA 2CXXA 4JLDA 2R65A 1J90A 4Q66C 4QM6A 1E4YA 4JVLA 4QGAA 5EJEA 5JWOA 2O0JA 1T5LA 1Z2CA 3BXZA 1M6NA 4Q00A 1L2TA 5KSYA 1XEFA 4PHFA 4Q7LA 3CWQA 1IY0A 4PO9A 4AI6A 3ADKA 4RSGA 2PMKA 4PHGA 3W6OA 5G3YA 3W90A 5CIWA 4Q47A 2ZI5A 3EWAA 5EXPA 1ZUIA 3QE0A 5KOYA 3IQXA 3A36A 1H8EA 1UBGA 1NSFA 2ATXA 1F6BA 2Z83A 3E5HA 1P3JA 4B3XA 5DNYB 2HV8A 4RZUA 2QP3A 2EW1A 2GEDA 3VQTA 3QBTA 4B3BA 1ZC3A 2C9YA 1E2IA 1OIWA 3RHFA 2A3RA 2JCSA 3BJIC 4II7A 2ZI4A 2VP2A 2JLQA 2OHFA 4PXAA 1XMVA 3K9GA 3KKMA 2ZE6A 3DOEA 2DHRA 3NG1A 3OESA 4NBSA 5SZHB 5JI3E 1NBMA 4QBIA 1F2TB 4Q9JA 2ORVA 4B3FX 2O8FA 4CEIB 4CEJB 2AR7A 3QKTA 2IK8A 5CIQA 5SZIA 1ANKA 1WXQA 2AX4A 3AKCA 5HCNA 2FGJA 3JZAA 1NBME 2QQ0A 1Z47A 2X77A 2ZJ8A 3CONA 3L0SA 3NH9A 3EA0A 4PSAA 5ELXA 1COWA 4ERNA 3L0OA 2C9CA 1X1RA 4MQBA 3I72A 4EKDA 4YDHB 3A4NA 3KXIA 1J8MF 1JR3E 1E2LA 1R8QA 1N5JA 3BS4A 5JRJA 2C78A 4QM7A 1IAQA 4M9ZA 5HTKA 3OE7A 3RRYA 4TSFD 2A5JA 3BFVA 4BFWA 1P9WA 3W34A 3EAQA 4M8NE 2O0KA 4OHVA 2QBYA 2YWEA 5CITA 2DFKB 2ZUDA 4JJZA 2QMEA 4GSYA 1OE0A 3B8HA 3LBHA 2J0VA 4OQXA 2LKDA 1S96A 5G53C 2X19A 1SXJC 2WHXA 3DZDA 3RLFA 3T1VA 2YKGA 4H1VA 2ZQ5A 5J4HA 1MH1A 4Q18A 2VF8A 3CKLA 1W4RA 2W2VA 1ZM3A 2DWOA 4XTCS 4XWOA 5F3WB 1KJYA 2NO1A 3QF4A 4JL6A 3D8BA 4YXWD 3EPJA 2ZJ2A 1OB5A 4Q4AB 1P2VA 4XVRA 3QKSB 4G5OA 2PBRA 4NYIR 1E9RA 2ZS9A 4ACBA 2J5XA 4JYBA 2XX3A 2FPMA 4IOKA 5D3MA 1B0UA 4JBWA 1CJKC 3THXA 3FTQA 4POAA 2B7BA 2JIZD 3OEHA 1G5TA 4CF7A 3KTAB 4TN1A 3SNHA 2D06A 4NCHA 3Q5DA 4BLQA 2IXGA 2X8AA 1KMHA 3B1VA 2RCNA 2ZYWX 4IDPA 4TMKA 3NBZC 2YOHA 1RW4A 1E2GA 2Q9BA 1G8FA 2P67A 2ZAOA 5JWRA 3MJHA 4FW9A 4C30A 3EZ9A 3L2OB 5EP1A 2YHSA 2XJ9A 5IHPA 1E1RD 5J4YA 2XSZD 3L0IB 4KV9A 3T1TA 4LK2A 1XB2A 1E1QA 4A8JA 4TMZA 4ABYA 1CIPA 2RGXA 4IVPA 3AGPA 3EIQA 3QOFA 5DHAA 2XZLA 2GAOA 1T6NA 3U3RA 2VLIA 2N42A 2QM7A 2Q21A 4LV6A 1CR0A 1I4DD 1YJ5A 2RGCA 2GESA 1EX6A 2CLCX 1A82A 3SBEA 1QBKC 4GMDA 3KKPA 3HU3A 1Q0UA 1HQCA 3I8XA 4TL8A 3WYAA 4PO8A 5FOWA 3J81k 3CX7A 3QVVA 4G5RA 4JLNA 4KAXA 4PTLA 2ZRPA 3THYB 2QU8A 4LI0A 3ZQ6A 2OE2A 2ZXUA 4RFSA 1JI0A 1AIPA 3WRXC 4CGZA 1XEXA 1EFRA 4G5QA 4P4SA 4JSYA 3ZJYA 1Q12A 5KNCA 1M74A 2I4IA 3P26A 3W3ZB 3UK6A 4NCJA 4ZV4A 1FPMA 2PX0A 2GCOB 4DCVA 4I99A 1NG9A 3RNLA 1KO7A 1R6BX 4CYMA 4LUCA 3MWJA 3IO3A 3LX8A 2ZRJA 4B3GA 3SZRA 1FZQA 5B2ZA 4DXAA 1XJ0A 4H9GA 1IN8A 1UF9A 1OFUX 3ETLA 4RD6A 1GZSA 3A4LA 2ZVQX 4RZXA 4DJTA 4F93B 4UNNA 1DBSA 2QMOA 4LRWA 3KXLA 5JI2E 1VDZA 4LJ8A 4CEHA 2ZM5A 1DG1G 4FD2A 1XZPA 4DLTA 4Q1DA 5KO2A 3BWDD 3GQBA 4TT3D 1P72A 4PAOA 2DWQA 3W6PA 3MJRA 1P7CA 1XEWX 2G0NA 4HAYA 1U8AA 2ZYVX 1QHYA 3C4JA 1DS6A 5DYIA 3QXCA 4ITRC 1NRJB 3CZPA 2QT1A 3CPHA 3U7GA 4LHYA 5EXXA 4ZCLA 1YR9A 4A4DA 5F9FA 4A2PA 2WIBA 3RC3A 1NY5A 2YOGA 4AG5A 1HYQA 5FBLB 4WZAE 3D31A 1E9DA 1GL7A 1NKTA 2EWWA 1H65A 2FG5A 3Q7QA 4LX0A 3ZLJA 2IXFA 3NHAA 2ERYA 2GKSA 4JLMA 2OM2A 4JLJA 4EJSB 3SHWA 1R2QA 2EVWX 2PJZA 3GJ8A 3TH5A 2CCJA 3KFXA 3QIAA 2BMJA 4B2IA 2LWIA 1ZD8A 4C0HA 2P2LA 4DLSA 4H1UA 3QENA 1F60A 1XD2B 5B30A 3I73A 4LCBA 3RS0A 2XNDA 1VCNA 3FFBA 4I81A 3U4QA 3AM1A 2A30A 2OV2A 4YDSA 1YE8A 3GMTA 4RD0A 3T06B 4HSEA 3SYKA 1ZCAA 4WAUA 3BB1A 1LS1A 3FOZA 1W48A 4EPWA 3SI7A 3AP3A 1R4AA 4E22A 2ZITA 3T1QA 1ZNWA 5JMTA 4MKIA 5LD2C 2WIAA 3LQQA 3FWYA 3IILA 4EFLA 4ARZB 1EGAA 2QEQA 2IWRA 1G8YA 4Q9KA 4L9SA 4QRHA 2AD5A 1PLKA 2AKYA 2MSEB 3LLUA 5CJ2A 2D2EA 5HE8A 3HWSA 1XMSA 1XXHA 2KBFA 4L4UA 3RSOA 1CJUC 3D7MA 2BDTA 1ZW6A 1NF3A 2XOKA 3RSLA 5AUNB 2AK3A 5G40A 3T5DA 4MGZR 4C0LA 2ZRGA 3PUXA 4AYTA 3ZD6A 3WMGA 2ZSEA 5IT5A 1OF1A 3LLMA 1E2QA 3BK7A 2XGJA 1GUAA 1KO1A 5JRZA 3AP2A 5HPYB 3S1AB 2XJ4A 2BBSA 3VKHA 1ZU4A 3EPHA 3RRNA 3GLFB 5JS8A 2RGDA 2IYTA 1L7VC 2AD1A 1ZUHA 3DZ8A 3LXXA 5FTNA 1G16A 1WCV1 1NI3A 3TSZA 1E9AA 3KZ1E 5DGXA 1XDBA 1XCMA 2O8BA 2JJ2D 3HU1A 1RPZA 2IW3A 4LHZA 3AV0B 1TPZA 3B1WA 1MV5A 2J0SA 3PVSA 4YMSA 2A5FA 3FKSD 4W9MC 1SXJB 2GJ9A 2YOFA 3I8SA 3IIMA 4JJKA 4QNRA 1KNXA 5C18A 4F4CA 2ZSBA 5J4KA 4AKGA 3N2EA 1CBUA 4FMDF 3IPYA 3SBDA 2ZJOA 2ZI3A 3CF6R 5FPTA 1GKYA 2VHQA 1BYUA 4DVGA 1OH8A 5TVKA 3MD0A 3OAAD 4WIAA 4LHXA 4RJLA 2I3BA 4HDOB 2JJ8A 5CDFA 3VU9B 1G3UA 1VCMA 2FNAA 1NVVR 2PCLA 4GRAA 2ZJYA 3GFOA 1RRPA 2C99A 1Q3TA 1HTWA 4UXJA 2RGGA 1G64A 1LVGA 1X1SA 2G83A 1SKQA 2BVNA 3C5CA 3VR3A 1LV7A 1GNPA 3CRRA 1XCGB 5L3SB 4WW0A 1AGRA 2CK3A 5KSOA 3C5HA 4EQ6B 1E99A 4HAUA 3AF1A 2R6CA 5JFGA 5L8VA 3MG9A 1TUIA 3TSOA 2H18A 2FSHA 1JECA 4IXMA 1UBEA 4XVQA 3PEWA 3FHOA 2AL7A 2EFEB 2QE7D 2VHUA 2Z43A 3SU8A 3HPQA 3VNVA 3K0CC 4OI2A 4TLCA 3TAHA 5EZ6B 1T9HA 3SR0A 3HYTA 4GP7A 4QFMA 4L5BA 1T3LA 1U9IC 4IDHA 4QGGA 4IOMA 4AWXA 1DTSA 2BBTA 3RS5A 1VG1A 2H57A 2Q9AA 1KOFA 5AK0A 1SXJD 2V54A 2VP9A 2VA8A 3CPJB 1OB2A 1G20E 1Q44A 3JVVA 5EZ5A 1WRBA 4OI4A 1G17A 4QHYA 1G3RA 4MGYR 5FR2A 4X8MA 5IDVA 3SDZA 4B3DA 5KNBA 3BRWD 1G3MA 5IRCD 3SJZA 2AFHE 2VSXA 1SGWA 1WBDA 4C2UA 1E79D 3EZFA 2F3TA 1IBRA 3T1OA 4IDOA 4G0NA 1S3GA 4Z54A 2AWOA 3RYTC 1DELA 4C4PA 1HQYE 5AJVB 4XWKA 2W6IA 4HUQA 3IEVA 1VYTA 3FMFA 4LJYA 2IF2A 1G8HA 4X8LA 1G8PA 1X8KA 2C77A 3FE2A 5KDOA 3N5CA 1FMJA 2C2HA 4DDVA 4M1YA 5IF9A 3R7WA 2XXAB 1ZM7A 4KJZA 2VP5A 4Q4JB 5TXGA 3ZVLA 1DOAA 2F1HA 1LNZA 4R71A 2FX3A 3OIYA 2VPPA 2IYRA 5GVSA 5L3RA 2EFCB 4NPHA 1ZINA 1SVIA 2GVDC 2JDIA 3KUDA 4PSVA 2D7CA 4R2HA 3NKVA 1EX7A 1Z0KA 1UKVY 3LFUA 4NYJR 2ZAMA 5C2JB 2FDCA 1C9KA 3CBQA 2R6GA 3U6KA 2Z6VA 4TMWA 5FBWB 4MYHA 2C5LA 2XEXA 5EP2A 1D2MA 2FEOA 4TZ6A 2JLRA 1R0XA 2NO9A 2HDNB 4LV8B 2HYIC 1T3HA 1Z0JA 2ZJAA 3WRYC 1Z06A 2ZSAA 1KDTA 5EQTA 3UG7A 3I5XA 3QG1A 2GWHA 1U0JA 1OT3A 4GZMA 4KSCA 3LH5A 2ZJ5A 3C15C 1Z29A 1NMZA 2J7PA 4KLNA 1OXSC 1W46A 4YMTA 2E87A 5GJBA 4LC1A 2OCYC 1S9HA 4LHWA 1ZP6A 3ZZ0A 4DSTA 2GBLA 2VP6A 1WBBA 4R7ZA 2QNRA 3G5UA 1NJFA 3CB4A 4JKYA 2IBMA 2G9NA 1JPJA 2CHVA 3U3MA 3UPUA 3WHLA 3QUSA 4P4TA 5JS7A 4Y0VA 5EP3A 4BUJA 4V0LA 4B71A 2HJGA 2GF9A 1MO4A 2BCJQ 2HEIA 2W6JA 3BFKA 1N6HA 2CLDX 3GLIA 3EG5A 3ASZA 1ZBDA 2YC4C 2FSFA 4Q7MB 1OXVA 3MMPA 4R98A 2ZRCA 2OAP1 3P1JA 1A4RA 4PHHA 4AKEA 1NVUQ 1VKJA 3EASA 2UVQA 3KB2A 2Q3HA 2DCUA 4MRSA 5E4FA 4HLCA 1OKKD 3CRMA 5FOSA 2ZSFA 3W8NA 3GLGA 1CU1A 5EP4A 2QENA 3KQHA 2VBCA 4LZZA 2A9KA 4B74A 3I32A 4XD7A 5KNDA 2V3CC 1JEDA 2VP4A 3B1XA 2NMVA 2OCAA 1TX4B 4HDCA 4Q1AA 3GEIA 2O8EB 2PMDA 1W44A 4U00A 1TEXA 4EFNA 1US8A 3VAAA 4MUAA 2IS4A 5C4GB 1XRJA 3OZXA 4R2IA 1J70A 2GJ8A 2WWIA 1YR7A 1WQ1R 2ZVPX 4L8GA 2OBLA 1FX0B 4JLBA 1G7TA 3THWA 3OFNA 3ADCA 3TE6A 1RJ9A 2F1JA 3NWJA 4ZCMA 2IHBA 2BMDA 1CR1A 1FTSA 1Z6GA 2CHGA 5JZVA 1G1MA 3X1WA 3I92A 4URWR 5LD2B 2GXAA 2CJWB 1N6KA 1SVOA 4B47A 5DIFA 3VR2A 3PCRB 4KSBA 4DEXA 2EFDB 2JJ1A 1SKYB 3AGQA 1ELOA 4DT1B 4DBLC 3MSXA 1LTQA 2B7CA 1W4BA 4IFEA 5HR5A 1WB9A 4MGIR 1GVNB 5AJXA 2ZPTX 3H0KA 4NCNA 3TMKA 3HDTA 5CB8A 5DN6A 4M1TA 4UNPA 5DO9A 2DFTA 4BEJA 1JALA 4XVUA 1ESNA 1J7KA 2XITA 4C0BA 4A36A 2OT3B 1IHUA 1VG0B 2YWFA 1IY1A 3PUYA 2B8TA 1S8FA 1W5TA 4GPTA 3HYRA 4TYPA 3I1FA 2WJYA 4D0GA 5BXQC 1PLJA 2HXYA 2NO6A 1Z0DA 2QPAA 4GMXA 3ZIAD 4NMMA 1OXXK 4AYWA 4FMDB 2Q6TA 3IIKA 2YWHA 2WPDD 3EC2A 4RD3A 1G9XA 3RS7A 2JATA 4KFSA 3QKUA 4B73A 3U7EB 1UDXA 2IX3A 4YMVA 2W0SA 1AA9A 4LOAA 2QP4A 3K0AA 1NP6A 4HAWA 2RGEA 1CJTC 3NBXX 1RYFA 1RVDA 1VG8A 1GL6A 1YVDA 2KSQA 2W00A 2WOOA 3CH5A 1GWNA 4HYYA 4LJ4A 4P0TA 4NP6A 3EIEA 2RH5A 2WSSD 2EQBA 2J41A 3P27A 2OBMA 4PQRA 1W0JA 4KCGA 5IK2A 4JL5A 3ZVMA 4A0HA 1DAIA 3CNNA 2O8FB 1BS1A 1FL9A 2HCBA 3O8CA 5HCIA 1Q57A 2LCFA 3K8YA 2JLYA 4DLVA 1OHHD 8OHMA 2V9PA 2YV5A 3K70C 3WMFA 1SVLA 4WVFA 1OPXA 4FMCF 4OHXA 1RRGA 2B8WA 2HT6A 1VMAA 4AIIA 4YQFA 2WBLC 4C0KA 1QF9A 3K0FA 4CRWB 1DADA 5J4VA 5E7IA 3OHMA 3QPVA 2FZ4A 1CR2A 2G88A 3LAWA 1N0WA 4NYMR 4LYHA 4HI0E 4KODA 2A5YB 2WJHA 2D7DA 3HR8A 2GK6A 1ODFA 3A1TA 1AK2A 1N5IA 4IRUB 2VO1A 1P62B 1TL7C 3GLHE 2Q3FA 2QQEA 1JPNA 2D3WA 2GK7A 1H8ED 4HATA 2QBYB 2FV8A 4K46A 1Z5ZA 1IY2A 2DB3A 2BWJA 1X8JA 2FPKA 1YKSA 1N5LA 2NO7A 3F0TA 3D6TB 2F1IA 2GHIA 3P4YA 1E2DA 3BIFA 3VR1A 3C16C 3LV8A 4FWTA 3UMSA 3B13B 2MSCB 2W83A 1N6PA 1P75A 3MUFA 3JVUA 2CVFA 2G6BA 3QF4B 3R9IA 3O8RA 5FTMA 5AUPB 3T61A 5FI0B 2JLSA 4IJMA 1W2HA 2CVHA 1EFCA 4DUGA 4RCZA 4GBMA 2OCBA 4NYIQ 1XPUA 1W0KA 4TWZA 3NC1C 5F98A 2A5GA 4BLPA 4B6EA 1KAOA 1KO5A 5D3MB 4A0GA 4DSNA 4DHEA 3THXB 2GJAA 4TMTA 4ASUA 2YVUA 1XBTA 1G7RA 2ZRLA 3U6BA 1G21E 1N5KA 2FFBA 4RKEA 1E0JA 2PLRA 1E9EA 1D6JA 2E1RA 1COWD 1XTRA 3CIOA 3LWNA 4Z8XA 1GG2A 1KMHB 4DZZA 3W3AA 5CK4A 2REOA 4CDGA 4ZI2A 4MKGA 1RZ3A 3GFTA 2BM1A 4O2LA 4OJQA 1QHIA 3T12A 5AUOB 4A2QA 1E0KA 1JR3A 3TQFA 3U61B 4TTPA 3OE7D 2K5UA 1JJVA 4C7OA 3EIHA 1A2KC 1QVAA 2WVJA 4ZPXA 1KKLA 3HU2A 2PEZA 1A5TA 2AHOA 4A8JB 3IBYA 4CT5A 2IYUA 4IEEA 3NVAA 3TUJC 3WP1B 3IO5A 2OUKA 1U99A 5JEDA 2IS2A 4HAXA 2XAUA 3HJNA 3CLVA 4UNQA 5FUYA 2OBNA 1KKMA 3K0CA 3K0EA 1FP7A 3TSWA 2QPTA 1JXMA 3ADDA 1XU4A 3V4FA 3A1VA 1U9IA 2WKRA 4GL2A 4G5GA 2DPXA 4M1MA 1Q1ZA 2YZ2A 3HP1A 1IN6A 3BC1A 2JASA 5J4LA 3AB3A 1R5OA 3B1ZA 4RFSB 1IXZA 5KU1A 2W0MA 3OEHD 1EFUA 1VIAA 1S9DA 1KSHA 1U0LA 4GOKA 4DLZA 5FBVB 4P4SB 4TLDA 2CL0X 2P65A 3N2IA 3ZS9A 2GZDA 4PC7A 1TTTA 1MRNA 2NG1A 2YC2C 1OH5A 2WJIA 3DPUA 5A5GA 1KTVA 1YRAA 1E9BA 3CPEA 3ZZUA 1NN5A 2GETA 3SN6A 1XPRA 3AKYA 4EUNA 3QEOA 2EYUA 3ZVNA 2ZR7A 5J40A 5FL3A 4IW3B 4AYXA 3SHFA 1ZM4A 2BEJA 3CW2A 1Z63A 1EWRA 1FNNA 1NVWQ 2ZR0A 3RAPR 3L0PA 4OYHA 1PUIA 4RD2A 1R5BA 2DYKA 2RAPA 2CHQA 4CEHB 2D74A 2MMGA 4Q1FA 4ZDKA 5F9HA 4D6PA 1DO0A 4MYUA 1DE0A 1KI2A 1LF0A 2FN4A 2G77B 1WA5A 1NG1A 1ZU5A 4Q03A 5AWFC 3SJCA 4Q4LA 5JECA 4PAQA 2NGRA 3D3QA 4MDFA 3AVTA 3C7KA 2JLVA 1V43A 3E70C 4LJ5A 5HKKA 2P5TB 2GBLC 1KSFX 2F43A 4RD1A 4PC1A 3WNCA 4BLOA 1ONBA 2WMOB 1N0UA 4BLSA 4TLAA 1EFRD 4D0LB 3TUZC 5J47A 2QL6A 1BMFA 1GKIA 3NEJA 3X1ZA 4URVR 4ESVA 4NL4H 4X8HA 4XJXA 1QZXA 1KI6A 1P73A 2IYXA 3CX8A 3WYFA 4YMUA 1QHSA 4BRUA 4MA4A 4B75A 3V00A 2CEAA 1AKYA 2ODNA 4JVSB 2J0UA 2CDNA 1NIPA 3U5ZB 4HLQB 1OV4A 4HB3A 2PX3A 4FINA 4MDEA 2QTVB 4NE2A 1TQ2A 1UEIA 4B6FA 6Q21A 1S1MA 2ZR9A 4URXR 4BQSA 2FFQA 3M1IA 4KO8A 3CNLA 2OFXA 4M9SA 5CLLA 1T91A 3RWOA 3VHXA 1D9ZA 4OHYA 1JQJC 4A2WA 5KDLA 3RS2A 3U3KA 2KBEA 1DPFA 4NONA 3RVBA 3U4QB 2PT5A 4BLTA 2O8CB 3R9WA 2F9LA 3VTKA 3AVXA 4W5WA 2IUUA 1ESMA 5E7JA 3MWKA 1MABA 1N25A 3IHWA 2DR3A 4LYJA 4N1AA 2VEDA 4JLPA 1P2SA 1XTSA 1KAGA 2FU5C 3PEYA 1VIYA 1KI4A 1D2EA 1TU4A 1Y3AA 2J9RA 1RRCA 2BBWA 4PQYA 4MITA 4BFZA 5TB5A 3C14C 3NC0C 5L3QA 3IPXA 2HLDA 1M7BA 1E96A 3F3YA 2ANCA 1HV8A 2ONKA 4TLEA 4C3ZA 2QTFA 1QHHA 1ZMXA 2QAGA 1YZKA 3GJXC 4FMCB 2JLZA 4DB4A 4HLUA 1E9SA 2KE5A 1Z08A 2ZIAA 3MFYA 4ZCIA 2ZRBA 4OJKA 1XXHB 1XPOA 4C2TA 1I2MA 3TVTA 1E94E 4M53A 4FMBB 3K70B 4OQNA 4V0MA 4Q4HA 1SVMA 2EYQA 4OK6A 3DM5A 4HZIA 3EZ6A 4FIDA 2ONJA 2J1LA 2CNWA 5JLJA 1CTQA 4EAQA 3TRFA 4V0ME 3EPLA 2XNDD 3CRVA 3KL4A 4BGDA 1VCIA 2IA5A 3TVDA 2IHYA 4U02A 3FGNA 4A0RA 1FP6A 2VHCA 4DDTA 1GTVA 1W5SA 2VRWA 2EWVA 3UWKA 2O8BB 3TBKA 3PG5A 4B34A 2NQ2C 1KI9A 2F3RA 1E6CA 1U8YA 2OILA 3QXHA 3KDSE 1O87A
chains in the Genus database with same CATH superfamily
4YJFB 3C3DA 1LBTA 1P18A 1XZQA 2GI4A 1Q74A 4OBWA 1DC8A 3CWZA 3RT9A 3PHJA 5CM2Z 3U9TA 1P4AA 1BVHA 1BW9B 3VOSA 4X95A 1YU9A 4UM9D 2XTNA 2WDZA 2XGMA 2N1MA 3DNPA 2RE8A 2IU4A 1N92A 3HL0A 4BRWA 5FTLA 1Q7GA 5ALVA 4F3YA 1TM3E 2Q6KA 3P4XA 1T3SA 4O5OA 1EI9A 4FSXA 3AF4A 1WV0A 4OJMX 1WXXA 1JA9A 5ECDA 1XL0A 1MCZA 2XOKD 4QRDA 3Q3VA 1IBKB 1U8ZA 4M99A 4DSOA 4F46A 5AYVA 4B79A 3TI9A 2FRDC 3E8XA 3QVKA 4YPOA 5F1YA 3UM9A 3C6KA 1Z0ZA 3FVQA 1RYDA 3AW8A 1RQ7A 4JC4A 3DHEA 4DSUA 4G5HA 3ZXUB 2ZTLA 3QPWA 5AKHA 3UWPA 3GEMA 3EK2A 3GZ4A 3VBEA 2EFHB 2XUHA 2XWJI 4K6KA 4BB6A 3UXYA 1ISRA 1GQFA 2VBFA 1W49A 3EXFB 4Q9HA 4M0LA 4MVJD 3IUQA 4K6FA 3V1YA 4ZOQI 1EM6A 3PVCA 4J49A 3SKXA 1VRVA 4F06A 3E9MA 3RAEC 4ZQFA 2YWXA 3IKVA 1I32A 3JZFA 4YONB 1F8UA 5HE9A 3UZUA 3KTFA 1BGXT 1K8RA 4R7GA 3WV5A 1V16A 1CY1A 2XE4A 2JKVA 4U6NA 3R7BA 1EP3B 2VTKA 4TYMA 3LHDA 3IJ5A 4MRAA 3AR3A 3IOBA 5DX1A 4OAOA 4BJ5A 1RLTA 3LFHA 1PYGA 4W8GA 3T54A 1S2GA 4ZVQA 2VWHA 3NVDA 1EJ6A 4BEBA 4RD4A 1NLFA 3P71T 2B1RA 4F8EA 5BV8A 3GUUA 3WMEA 1KRHA 1FYFA 1PQUA 2AYXA 2NNWB 3UAVA 2OGWA 2ZUBA 3BIXA 1CUSA 3SC2A 1K3TA 5ITZA 3K71B 3D1VA 5GAJA 4YV0A 5HMMA 2YWDA 4KQEA 3WXBA 4BFTA 1KMMA 4ZGWA 5KPJA 4O4JF 4UAGA 4C7JA 2BGNA 1QGOA 3Q0IA 2GYYA 1U11A 1GCUA 1BHJA 1Z33A 2TMGA 4WDRA 4YJGB 3U2QA 2I80A 2AUNA 4DDMA 1ZMRA 3BUSA 1SZJG 4XIFA 1U0EA 4P5EA 3A06A 2ZIZA 4Y6GB 4CL8A 2WQ6A 1SXPA 1LVHA 1IRIA 2NIPA 4XEHA 1D5CA 4IDDA 2E3JA 3SIPA 1FYWA 1WMAA 1Y3BE 2XMRA 3R7WB 2CK3D 1FQKA 4RZHA 3FB1A 4IUDS 4DG5A 5FUQA 1RS0A 2YV1A 1RMTA 2R1ZA 2ZI9A 4IQ4A 3RYIB 4BO9A 1MO3A 4ZK2A 1OU0A 4XUGB 1AN0A 1SXGA 2WLSA 1YQWA 2F59A 4I1UA 2P4SA 4XIJA 1RKUA 2O52A 2FWNA 1I0IA 2B36A 2HMVA 4KWEA 4QAJA 4R2WA 1EJBA 2J9YB 3DYIA 3A4MA 3BE8A 3WNDA 2ZBFA 3BE6A 1Y34E 2GCGA 3E7PA 3EF0A 4I4LA 2WSLA 4F9TA 1G291 4KN6A 1XRLA 3OUZA 2NV0A 4D6YA 2KLHA 4PC3A 5K0BA 1QV7A 2W42A 1H6DA 621PA 2IVFA 1IXSB 2O2HA 5EHXA 4CQNA 2V9ZA 3UAWA 2BR3A 1GNSA 5CNKA 3DZKA 3SQWA 3NAGA 1WD7A 4EKYA 1U2DC 1QHXA 3UIEA 4DNPA 2Q8NA 3KLOA 3E9DA 4NIMA 4K9NA 4JX8A 1PVOA 4LGVA 1EFPB 1MTOA 1TK2A 4GZLA 5HBGA 4HCJA 4MJ3A 1OU4A 3K9HA 1R3UA 1TO1E 3D5TA 3OOYA 2E6UX 3FG9A 3QA9A 4PAMA 4PFSA 4MRRA 3QLJA 4ECAA 3W5BA 1AKQA 4CUZA 3EQ7A 1AZWA 1NHGA 4GGMX 1TIKA 2FCRA 3ZOKA 1Z0SA 3KO8A 4GX1A 3JW8A 1X1QA 4BFSA 1CYEA 3F90A 1CR6A 3QXXA 4HRAA 5MN6A 5F2EA 2REQA 2YHIB 5CR9A 1GG9A 3GROA 1M2HA 1NJSA 3TZEA 2ZEJA 4CR6A 1JBKA 3NHZA 2R96A 3UW1A 5IWAB 4X5OA 3NAMA 2C2MA 4MCJA 2GLUA 5IVDA 5L51A 2ORWA 2BHRA 3U3JA 1JQBA 3WLFA 2OO7A 5DLQC 3MRXA 2BJWA 4O0MA 1U7HA 2BF7A 2V1XA 5AW9A 4BNFA 1F0NA 3CNQS 3GLFE 4PS0A 4EVRA 5DM0A 4J1TC 4DLUA 3PC8C 4FEGA 2QRMA 4W5TA 16PKA 3K9CA 4IDCA 4MUNA 2W2NA 1NSTA 1N1DA 5ERYA 3SYMA 4ZAZA 3P19A 1JIXA 4ZO9A 3UH1A 3VPHA 2WUGA 4E15A 2VQ6A 3WJ2A 2R00C 3V8BA 2QQFA 1KH2A 1QE0A 2VF2A 2C59A 3N05A 3TLAA 1NYLA 5EJ4A 4IIJB 1T2VA 1CK4A 3LPAA 3NTXA 2X9QA 4UEWA 4BECA 4BQQA 1RR6A 1VL2A 3GEHA 3CZAA 4M0KA 4RHEA 1DV2A 3PPYA 5AJTA 2X3YA 3DGEC 2YY7A 3CF2A 3ZS8A 1G9TA 2AFIE 3EB9A 4OLHA 5A0TA 3MB8A 1OYOA 3R5SA 4JJ7A 1XWWA 3W8FA 4HNUA 5I8WA 2W8BA 3THWB 2X23A 2ZP1A 4EB6B 1HE8B 3LZDA 1RJ9B 5HHTA 2A94A 1ISPA 4M37A 5EG5A 3QYJA 2F1RA 4QJBA 4HNSA 4BEVA 5CG1A 1PR3A 5EYPB 4BMXA 3EPRA 2C4VA 4BU0A 3OOHA 4QNMA 2YZKA 1UJMA 1S1CA 4EUHA 1EIZA 2A9RA 4R3UC 3I9MA 3SE7A 4KGDA 4CVNA 4Z9XA 2JAPA 2V6BA 3FUWA 1HDCA 4AFNA 4N4AA 1NMXA 3FYSA 1ZJYA 1QC5B 4IV0A 2HUNA 2WU0A 1MORA 2XMDA 2W6JD 4Q3LA 2I03A 3N59A 4PG5A 3NEPX 5D1HA 3OQBA 1ZIOA 3BYZA 3C8ZA 1UWKA 3AUSA 4WRRA 2XECA 2ORIA 3DMTA 3RSHA 4EG7A 5K2OA 4HGZA 4P0QB 1DO2A 2Y1XA 1MLDA 1OWNA 1Y9DA 3GMIA 5GZ6A 4EY5A 2ONZA 2CLEB 4XGKA 4TRNA 3SQOA 1T9AA 3O1HB 1NXOA 3DEFA 5JU6A 3OQIA 3T7RA 1PJAA 1VGVA 1DKLA 5FPYA 5JJIA 4NU6A 2PHZA 1XK7A 3CJQA 3K8ZA 4S2UA 2WVGA 2MSWA 3ABOB 3F7TA 3EVAA 3R1IA 1I4TD 2C4TA 3Q6IA 4YO8A 1YAHA 4Z1MA 3FN4A 3UHAA 2XBLA 4DHWA 3OT4A 1RI5A 4GDFA 4GMKA 5DE3A 4C5AA 1P6QA 4IIXA 4P33A 4D26A 4NV0A 3DKPA 3OA0A 4BO1A 1II0A 4I5IA 5KOIA 1EBFA 3VAYA 4R2JA 4NU8X 4WINA 5TV2A 3RD5A 2HDOA 4Y0AA 4F7WA 2B4AA 3FOWA 3AR4A 1DQPA 1L5NA 1QG0A 3OWXA 4ATNA 3BJZA 5TPWB 3B2EA 3EXHC 3GA7A 1BX1A 2F1OA 2FF7A 1GU0A 2ISCA 2C7BA 1YL6A 3ENQA 4YJ3B 4FNAA 3A1UA 5CM8B 1L6IA 4X93A 3ROZA 2CY0A 2N1BA 3IAFA 4XD2A 1LX6A 4AAYA 4D3YA 1KAEA 3VH3A 1H8HA 1JWAB 1MVOA 2ZBDA 3DAOA 3ORYA 3PYLA 4I66A 4EARA 1DB3A 1J9EA 1NX9A 3OU6A 5CDTA 2ZE5A 1GTRA 4D4LA 1SN7A 4OXQA 1E6LA 2JJ1D 3GDOA 5IFKA 4PLWA 1JRLA 3LOPA 3HXTA 1DPGA 4Q37A 3DV0B 3FJOA 5BW5A 5DNCA 3IE1A 3H84A 4XH9B 5TS2A 3MTGA 5H81A 1G38A 1YK0A 1AZTA 4JC5A 4A73A 2G1PA 2BOVA 4EGJA 3LPCA 4XM1A 2QMHA 4II3A 1QO7A 5DN6D 1OZGA 3EVBA 4NLLA 1Q22A 2VJPA 4AJ2A 4NEGA 5F3DA 2JK1A 4ZCPA 3UKJA 2C82A 3PXCX 1IZ0A 4I1OA 4DARA 3K1JA 4HDRB 3BZUA 4B44A 1NDHA 4DS3A 1I2DA 3ZGYA 4G23A 2PMEA 4IGEA 2V7EA 1JP7A 3BMQB 5BR7A 3EGDB 3BOSA 3FFAA 2DFVA 2PX8A 3BMXA 3B9RA 3DVQX 4QUDA 1GFWA 2AKEA 3HV2A 4ZGGA 4OI0A 1YB6A 1O3YA 1O6GA 2YHBA 3PNSA 3I58A 1EPUA 4RGYA 2EIXA 2GO1A 3FYUC 3LX5A 3O4VA 1P1HA 3Q3IA 4OK3A 1B23P 4LXYA 2C2ZA 4IX1A 2QE6A 4LJ9A 5SZKB 1WABA 3DWIA 3LXRA 1RCTE 5FT9A 4KWTA 3CUEF 1SCAA 2Q1XA 3MZ0A 3NAQA 4P3PA 5GJVC 1QB8A 4I6JA 3DYBA 1SCDA 5JCJA 5L3VA 5KQSA 2Q1TA 521PA 3TRHA 1JR4A 5AKJA 1E3WA 1V2HE 2AV6A 3H8SA 1EFLA 4QJ4A 1TKAA 3UTCA 5IVHA 5JD6A 1SXQA 4UUMA 4AQDA 5MGBA 4AP6A 3N2GA 2NU6A 3B3GA 3CSUA 1N3IA 2QUZA 3D0RA 2PRJA 2HADA 4U7DA 1BQ4A 2G72A 5D00A 3MGBA 2G80A 2JGIA 2COEA 4R2KA 2EKBA 3ZY6A 1DAMA 5AM4A 4W5QA 3EVDA 2OCLA 4EI8A 2DQKA 1CS0B 3N0RA 1ZAYA 5FLXA 3HR7A 5AVUA 1JE0A 4CN8A 4CIAA 2P4EA 1HOXA 2HPHA 2QLLA 1XTKA 4IYRA 4OP1A 4RQTA 1YZYA 2IS1A 3ETDA 2C3OA 3M89A 6REQB 1Z8NA 2UAGA 3SSMA 3IP5A 3NH6A 4ZTUB 4PG4A 3F78A 4AP9A 3WOVA 2F55A 4UQLA 5JE8A 4RIIA 2VXCA 2D1RA 2FZEA 3BRSA 2P6RA 1ZMTA 5EZSA 1UBFA 2QJFA 4U2GA 1Y89A 5L95A 2F8TA 1E8NA 4O25A 1VG9B 821PA 4YT4A 2AXEA 3HB7A 3USZA 2JD2A 4ZOCA 4B8WA 3D6FA 3JWPA 4JMPA 3SZMA 2BFAA 1Z13A 3L7MA 3D2LA 3NHMA 4XGQA 2HX1A 2ATVA 4QDKA 5CLJA 1Z2OX 2Q7XA 3WK7A 5ICSA 2I3AA 4I1YA 3ZG6A 2FMXA 3TL2A 1U2SA 1IN4A 1RFLA 4S24A 5CU7A 3DTVD 2DTEA 2PAAA 3PXXA 1B76A 1R8XA 3BHIA 5CXSA 1NMYA 1Z7YA 5G0TA 1U0SY 1Y80A 2HNBA 5IAOA 1BKDR 4K9RA 3OEEA 4ZT3A 2RC5A 1MRSA 2Q6IA 3SK0A 1LDEA 2GPYA 3QU5A 4JOBA 4NK4A 3AZOA 4FNGA 1Z3IX 2ZBQA 4RK0A 1SKYE 2G06A 3WRWA 4ASUD 5ALJA 3ENWA 1P1RA 2RB4A 4NABA 2V7WA 4WCVA 4BFUA 1BA3A 1YS1X 2XW6A 1J39A 1XU9A 2KPOA 1T1IA 4IIYA 2AOUA 3B6EA 4QDXA 3ED5A 1ID8A 4XQ0A 3CEMA 2BEVA 1M34E 3C2QA 3K2BA 4EYKA 4HN4B 5DOVA 1PEDA 2GBGA 4LPSA 4JB2A 2AA3A 3C6XA 2EF0A 3EXG1 4AJHA 4LG1A 4RVSA 1DQZA 1GEGA 4UE2A 2WIGA 5I7SA 3T9AA 1RQPA 3MIZA 4NFSA 4O2AF 3N74A 5J63A 3N8NA 3QMPA 5BSGA 4ML3A 3RSZA 1N2ZA 2JGMA 1QH9A 2C3PA 2ZE8A 3FWNA 2YINC 1KYVA 4JP8A 2Q3DA 4E5PA 4GOMD 3BA1A 3BF8A 4BGEA 1QJ4A 4O2RA 1BXZA 4LXXA 3IRVA 2BFEB 3QKRA 5E6SA 5H1YA 1TQ8A 5BOVA 2FQ1A 1SBQA 2V7GA 2XMSA 2I8CA 2IELA 2WE7A 4I0WB 3QV2A 1Z6TA 1JKFA 3P0HA 3NCHA 1XC7A 2PZFA 3SP1A 4IL5A 3WNZA 1BFDA 2ANBA 4C4YA 4H7EA 3E53A 1D8AA 1PW7A 4R7TA 3FWHA 3H5TA 4KNYA 2QR5A 4LRQA 2R68A 4MRMB 2PUCA 3BT7A 4NH0A 2OZKA 1WUYA 4OSOA 4N0EA 1FFEA 1DSSG 4DLWA 2ZJZA 5KC8A 5B2EA 1GAQA 1Y9AA 4W1PA 3PXGA 1KYXA 1R0YA 4XJSA 2EGUA 4I19A 1ZNXA 3UUEA 2X8LA 4B32A 4J0GA 1K5GA 4CHTA 4E1BA 3P9SA 5I7EA 3AI7A 1FLVA 4KI7A 4YJ2B 3HBMA 1TNDA 4G0OA 3HVIA 1TTPB 3SEFA 4BX9A 1KH3A 1M2FA 5AIBA 5LQJA 1JKXA 1YZ3A 1Z07A 3QVLA 4JVMA 4MO2A 3OLWA 2OV4A 3TQOA 1R74A 2KB0A 1U9ZA 3M6XA 4X1OA 1HDYA 3U7JA 4MI9A 2HA2A 1T8SA 2G5TA 3WKCA 4BWFB 1ZLXA 4QX6A 4X1IA 2NO4A 2ZIWB 5JRDS 2ZI6A 4YCJA 2B9VA 1JU9A 1RWWA 1AQUA 2GEJA 3FW1A 4L27A 4B3CA 1AA6A 4W7SA 4UARA 3E03A 4JBHA 3MGKA 1TEHA 3AEXA 3KC2A 5BN5A 1MX5A 1SCJA 3NBYC 5ILOA 4UQOA 1P1CA 5DNDA 3UEOA 3TQCA 1ZGZA 1VSVA 4Z3OA 2ZB3A 4DNQA 3M6IA 4ZVUA 3Q87B 1RSZA 3T15A 1MJNA 1CJVC 1YJ8A 3NO4A 4YC7A 4CLOA 4TSKA 1BDBA 3A1WA 2V1UA 4QGFA 1YI1A 1AF7A 1E63A 1M7HA 2GAFA 2I1LA 2V9CA 1FXWA 3T35A 1OLUA 4HX9A 3D0QA 1JDVA 2PBZA 1M1XB 4OJTA 1KI1A 2CUNA 4OGWA 3PD7A 1NA5A 3P9PA 4HDAA 5FV4A 5CJPA 4JI0B 1MEJA 1YZTA 4TKVB 3NCTA 1KJWA 4JYZA 5CVTA 3IDZA 2FVXA 1VHWA 1UJ4A 4K5QA 4RZQA 4CG0A 3G2IA 1G6HA 3O83A 3TCNA 4KITB 4TRMA 2COKA 1BXGB 1QVRA 2JCBA 2ESRA 2ZRHA 4UOQA 5HKKD 4HX5A 2GYWA 4HLNA 4UREA 3WGVA 4CI9A 3ZE7A 3EXHB 4FHCA 4V02A 1F2TA 4PC6A 5L3QB 1ZWKA 5EE3A 3MWYW 1PJSA 4A0FA 3LYUA 2C3MA 8ATCA 4CEIA 2PX2A 4BN5A 4GOXA 1JDBC 3WBKA 4CIYA 4R1PA 1PSWA 4CEJA 1QHHB 1BMFD 1KXZA 2G4CA 3OIWA 2OHOA 2JIZA 2AR0A 3DE1X 4HEA1 4OGLA 1GAEO 2I7VA 3OTHA 4KVZA 3CO5A 4RVUA 1W4AA 1OZHA 4NJMB 4BYMA 2PD3A 4AZTA 4EHAA 4KRXA 5B7PA 1N2SA 1A5ZA 3A8TA 3GLTA 5JR3A 4TYNA 3M1AA 4Y9TA 4UPVA 3F2IA 4QYMA 1L4HA 3DMTC 1RHUA 1UZMA 3QI2A 4MUFA 3OJFA 1S4QA 3HJTA 4RESA 4F9GA 5JEEA 1XJWA 2J3EA 3TLBA 2GILA 3RHTA 1M67A 3FVTA 1L7XA 1ZIXA 3FTEA 1DX9A 2A5LA 2GM5A 4ZARA 3C3XA 1PQWA 1A9PA 1DRKA 3CLHA 1ZH0A 2FE4A 4UJ3A 5FOVA 1PSDA 3EAFA 4MYTA 2BBOA 4CGYA 2QB5A 1ZGGA 3W7AA 1W29A 4I4TB 3RSGA 1LFDB 4ZKEA 2H51A 3ZD7A 3UJ3X 3ICEA 1C30A 2FFJA 1LVUA 4HEQA 3S8YA 2KJQA 2EXXA 2Q2NA 1J8VA 2VQDA 3DD1A 3NDJA 5JS6A 5E3JA 1V9SA 3KV3O 2ZZNA 3K1YA 4K9OA 3KZKA 4DPMA 2NQTA 1JKJB 5J43A 1UMCB 4FX5A 2VR1A 4A6EA 4NPCA 2GT1A 1U2GA 2HH9A 3CMCO 1FFCA 2I55A 3D7SA 2N46A 3UK7A 3FYUB 1N2XA 3QTBA 2YYZA 2YUIA 1A27A 4UCWA 1DARA 4HRYA 2AN4A 1HSZA 3EUWA 2UXBB 1EZZA 2OBFA 3IELA 4TL9A 3AI1A 2QRQA 4O02B 1R66A 3TDKA 2EDCA 1QANA 1NBAA 1U8FO 1ODIA 5CLFA 1XN4A 2A9JA 3RKSA 3WI7A 4H3VA 1N8NA 2J9XB 4JB3A 3MF4A 2EIHA 2YS6A 4QARA 5F35A 1PUJA 1Q3HA 4BVBA 4Q21A 5AR1A 5JS1A 1THZA 4RKWA 2PO5A 2PR7A 3CTPA 3S44A 3ADBA 4QWMA 3RYCA 1MJGA 4LZPA 3WYNA 4F84A 2G1KA 3VR0A 1FRNA 4ZVKA 3HR4A 5JD3A 3SYLA 1GVHA 1Q0SA 2GHQA 3KB1A 1J23A 3H1BA 2WZQA 3E4DA 4O5AA 5J2TF 2H2AA 3RWBA 4JI7B 3QX3A 1A2OA 1M33A 5DH9A 4PTYA 4YYEA 1BD4A 1DTWA 1V11A 3D8RA 3ENZA 1PG2A 2NTVA 3TTVA 4ILEA 1DAGA 4L4YA 2DZDA 3E1KA 5HJ2A 1QGYA 3H17A 1KDRA 1N2EA 2C04A 3UENA 4UVIA 5I4IA 1G8GA 5A7GA 3A6PC 2OO5C 3RBAA 2VDPB 1CV2A 3EIWA 2V45A 3ADOA 1PTKA 4Q7JB 4PZCA 1W52X 4DV4B 3B1YA 3VZSA 2P8JA 2W6ZA 3A6HA 4YAIA 5LM3A 1NY6A 1EVIA 4X6UA 4YP0A 4TT3A 1CEQA 1B41A 2NXNA 1ZHHA 2Q50A 2HXGA 2OXEA 2Z2KA 1IXRC 1QG2A 3OI7A 3AIOA 3V8NA 1MC1A 1V16B 3CN7A 3DEAA 3F9RA 4IJUA 4QYIA 3Q3JB 1UZUA 1X2EA 3DVAA 4RLHA 2O8VA 3IR7A 1LCIA 3UCEA 3VPSA 1GPWB 2H2WA 3WFIA 1BEZA 4FYYA 2UXDB 4OHMA 4JN6B 3DO5A 2GEBA 4JR0A 1ZD4A 1AQYA 6PFKA 5HEKA 2GF0A 1EXMA 1DCKA 3E6AA 5HDBB 2WJVA 3THYA 5C5DA 2OR3A 4ZJPA 5B6PA 1EP9A 3AKZA 4Y2JA 3SC2B 2H4WA 5NLLA 2A5DA 1JDTA 2IUYA 1X87A 3DVLA 3FMVA 1I3MA 2C58A 3UJ8A 1QF7A 1CF4A 1SUWA 1QDEA 4HDQB 2FWAA 1QQAA 5E9JA 2I78A 5D5QA 1E6WA 5HWSA 2CDCA 2GCOA 2O0HA 4M2LA 2OQVA 2NZ2A 1F6WA 5BNIA 1T9DA 3L6UA 3MT8A 3FJYA 3R09A 4PPFA 3COSA 3PWTA 4K7JA 2P78A 5AI6A 4DNOA 3REQA 4FS3A 4MWCA 1OSNA 3MJCA 3IT0A 3NNNA 2IEYA 1D2HA 3L1VA 1RMQA 2XRMA 4WCFA 2DMRA 4Q48A 1NVVQ 4DR6B 1TA4A 1K9VF 2BE9A 2G6TA 5FO1A 4KTTE 2O9JA 3FHJA 3N8HA 1KAMA 3ZWNA 4RDCA 3HYLA 2HHAA 1QYXA 1XN1A 2F7SA 3HKBA 3PJEA 4BZQA 3GAAA 4JUCA 5GPBA 2VPTA 3LJKA 3BWYA 2YNMD 1I5OA 5IJ0A 2PZEA 4H18A 4Y98A 1FP4A 3A6GA 4UCFA 3SLGA 1U8UA 2XUDA 3UNXA 3LVBA 3K32A 4RZ3A 1VHJA 4BJ3A 4EMBA 1NVMB 3GDWA 2VJDA 4FYIA 4AB1A 1DX6A 721PA 1ID1A 5CT8A 2D0OB 2FG6C 4IH1A 1V48A 5EMHA 1QZ3A 1IEVA 1IONA 1NLMA 3DLTA 3FDJA 3LLVA 4XCQA 5K8TA 4XWAA 2HQBA 3JTMA 4TLMB 1GKKA 1RAAA 3A3PA 3FPHA 1CIVA 2AMYA 3JSAA 1ZJJA 1MA0A 2C5FA 3PFGA 3TQIA 5FH9A 3GRAA 1S5PA 4YK7A 1BXRA 2A6PA 3W9YA 4PR0A 5FAKA 2ENWA 4MA0A 2Q1WA 3VH2A 4NZNA 3WA6A 2AQKA 1C9NA 2CHEA 4H4DA 2P6OA 1KFCB 1CHNA 4EGSA 4QDOA 5REQA 4I4IA 3OH8A 3PJFA 3HI4A 2WNSA 3FCCA 4MUMA 5IBQA 2H5EA 2FXIA 3K9WA 3WR5A 4NAVA 4PSKA 1T2NA 2W2XA 2H3HA 5B3AA 3WJ1A 5K01A 2XUGA 2IHNA 3SXPA 1PWEA 1W5EA 4XAQA 2BIFA 2R87A 4CCSA 1HE3A 1UBNA 4H0CA 2H5LA 2REQB 2OSBA 3C7AA 2PS9A 1LK0A 3BSSA 2QRLA 3QU2A 4CLRA 1UXKA 3PPIA 1IJFA 2BFBA 1VLMA 2G1UA 3CF0A 4DC9A 2Z5LA 3A9VA 3B5EA 3G82C 3K6RA 5HIAA 3KTOA 1RKVA 4FYHA 1GO2A 1EK5A 2DRIA 4BQEA 2VH5R 1U1CA 3OZAA 2P68A 1MKYA 2C4WA 5IABA 5B36A 4R16A 1TJ5A 3FD8A 2CYCA 2BHLA 4NV1A 5A71A 1X9GA 4HUTA 3SC3A 4INZA 1OWPA 4N5MA 1XNGA 3O31A 4UKDA 1RVV1 1IPHA 2GBCA 1PT6A 2ZU6A 5AHOA 5DCWA 4LJSA 1SOWA 1VRCA 2HHJA 2YV3A 2R48A 4UXIA 4YPFA 1J06A 2C1XA 2GNOA 1TCBA 4KFTA 2DWPA 4ND5A 1SCUA 3GJQA 1PZMA 3FDFA 4OXKA 2OESA 1TFUA 1WBJB 3LNCA 3IBGA 3AERA 4GEGA 4M9CA 2I71A 3PC6A 2FOLA 2EHDA 2LUOA 3NHJA 5ALGA 5JPIA 4IG9A 3AF5A 5A3RA 1MG0A 4XUCA 4GZ5A 3KT8A 1E98A 1UJCA 1KDZA 1ZONA 4GAEA 2JJMA 2W8BB 2XQKA 5ERXA 3S68A 4ER0A 5CDFE 2DPLA 2SECE 1SCKA 1P7VA 1N6IA 1LRJA 1V4BA 1VMIA 2AJTA 1L6RA 1P6UA 1RYHA 4I55F 1GNQA 1ISFA 2V7XA 1GCOA 4KQ6A 4NCAA 1BO6A 4V0NA 2W2PA 1TD1A 4H77A 4KR2A 2C9BA 2Y1EA 2RBEA 2RHMA 2C5HA 2ODEA 1LDNA 2BI4A 1EWQA 1ZD5A 2GRUA 1A96A 3HSYA 2XRYA 2D7JA 4BGUA 1M66A 4YCNA 3ZOZA 1K6IA 5TC4A 2XWSA 3KQOA 3A6DA 3W6ZA 4M22A 3EX7C 4B43A 2COUA 3K96A 1JMYA 5E2BA 2QL7A 4PWYA 3RF7A 2JBAA 4Q19A 3KLNA 4NOLA 3ZCSA 1HT3A 4HQOA 1LD3A 3UKDA 1X39A 2QVCA 1KAQA 4IICA 2C9OA 4EH1A 2QE7A 1YQGA 3KPWA 3M9XA 3DAHA 3O95A 4N18A 2C94A 2GR9A 2ZREA 4B48A 1Z7EA 3G49A 3OQIB 3ZBQA 4PPNA 4YBZA 3N86A 1TT5A 5IAJA 4CM5A 1DIHA 2ZJ3A 3DJYA 1JAIA 1DAHA 2JFYA 1O4VA 3Q7PA 4QQFA 1JLLA 4BMCA 1EYZA 3FPCA 3LTEA 5DBOA 4ZALA 1RHRA 4W99A 4KR6A 5LZ4A 1Z6AA 2QVGA 1AXEA 1Z6YA 2LRHA 3CVJA 2Q2QA 1CRQA 3E58A 4GPIB 4Q1CA 1R50A 4HWSA 5DT2A 3A4YA 3RIEA 1F7UA 3PEEA 4C9BA 1U4OA 1O96A 1XLVA 4P3NA 3STTA 3M6VA 1M5UA 1ZD3A 2F90A 5C46F 3KJGA 4MVYA 3SMQA 1SHZA 1B74A 2J3IA 2XY4A 3BRWA 4D4IA 3UC9A 1KDOA 2QUAA 2O1EA 3SYNA 2CBGA 4IZ6A 2XT9A 1E79A 3AY0A 1ACJA 3V4LA 1W9HA 3ISVA 3QPUA 5HM6A 1M54A 1N0VC 2CF5A 5C7YA 3QEAZ 1RABA 4BB0A 3B82A 4B7CA 3SWWA 2BEKA 2VVTA 5P21A 3I62A 1E0AA 5KQRA 2C97A 1L8LA 1RYMA 3K72B 2WHYA 5IS2A 4KR7A 1UIRA 3LOQA 4Y1RA 3IV9A 1VECA 5FWAA 3DOIA 1OLOA 5ALWA 3RRZA 5B7GA 1JTVA 4PX2A 2WV9A 1UZNA 3P2OA 4GRIA 9MHTA 3IMEA 4ITUA 2QGZA 1HURA 3WZMA 1SJ9A 1N5DA 2VDQB 3LWZA 2DX7A 3RFFA 3JVDA 2F1KA 3B3FA 5F4BA 5IKPA 3ENKA 1BE1A 4CTNA 3PZBA 4L07A 4DZRA 1EB8A 1QP0A 1UPBA 3BGDA 1UQTA 2A1TR 4XR9A 3M5DA 3NDRA 1PZFA 4RVCA 1GQYA 3HKCA 3ONWA 3VX4A 4JB0A 4F4DA 4RUKA 1FOEB 3KOYA 4DIOA 4DQUA 2J3KA 2RI1A 2ZZMA 4ZAVA 5K3BA 2ZTSA 4KQWA 4UNIA 1AO3A 5KDDA 3R0QA 1RHQA 4JI2B 4C0AC 3AL0C 2PA3A 1GPYA 1FU4A 2G36A 1EG7A 5G3ZA 1WP4A 5EWLB 1YFZA 5EXSA 4RBNA 7REQA 1LDGA 1YA4A 3GHHA 1E3WB 2C2XA 4Y2UA 5TIIA 3O8NA 4RH0A 3MJFA 1Y1PA 4AZWA 4HNGA 1C7JA 3TW0A 3V4VB 3UJ6A 5ESRA 1BG6A 2FN3A 3FAKA 2ZRKA 2VSQA 3WL5A 5BMVF 5F2OA 4M0FA 3N2GB 2NU6B 3KVOA 4JSTA 2ZUUA 1DKQA 1V8FA 3LX6A 1KWKA 4CODB 4YXFA 1VCHA 1C3JA 1L5LA 3LY9A 1EESA 4HB2A 2XXAA 4DLNA 4GRDA 2XUZA 3PL1A 4Q4JA 2X4GA 3NAZA 5H3LA 1CUVA 3EBLA 4CE6A 2IHKA 1RXVA 2IYZA 3EEQA 4J2HA 4KYUA 1YZHA 3VYTB 1A04A 4NBTA 2YIMA 3HP4A 4HK4A 3T9DA 1WZIA 2LGJA 2VDOB 4C4OA 1EWVA 2Y66A 3ZWYA 3KQMA 4NICA 1J5PA 1NXSA 2R6DA 3EZ7A 4P6VF 4AKIA 3V97A 1JSRA 3ETJA 4YP9A 3A58B 1Z8DA 2B8EA 1SBHA 2CVOA 4YQZA 4MWSA 3WB9A 4F6LA 2Q5IA 2VPYA 1L4YA 2XBUA 3D8TA 1XTQA 3GMDA 5K9ZA 4JP1A 3DB1A 2IOHA 4KB5A 4Q15A 2D62A 3CX6A 4HDKA 2H63A 3C5VA 3VX3A 4CG3A 5K0SA 5LPNA 2FJ0A 3DL4A 2PL9A 4NCKA 3I52A 4ER6A 3IMGA 3JQDA 4Y18A 3CEHA 3KB8A 4RKYA 4RPKA 1A69A 1NOKA 1D1QA 4QSHA 1G8AA 2UYQA 4NE9A 2ZQZA 1L5KA 2Q8PA 1HYHA 3FHTA 4NZ9A 3L7JA 1UKEA 2VHVA 4D0SA 2F64A 3KZCA 3H5VA 2G7MC 4H1TA 3JWHA 1QS0A 5BOSB 2QA5A 4KIUA 2C98A 1H2XA 5DX8A 4E3ZA 4K9MA 2CWDA 1SC4A 2Y71A 3N8IA 1E4VA 1MH9A 2OC4A 1FQJA 4F4JA 1HYBA 5AVTA 2FW6A 1T5TA 2CVPA 2JFBA 3A4VA 4QTXA 1LBSA 4H0NA 4H15A 4LY6A 4WWHA 4FWIB 3E5NA 4JXKA 4KIJA 4R1MA 1AVTA 2P6PA 5FI3A 3FOFC 1BOFA 3U62A 2QRVA 1RJFA 1YVUA 2PV7A 5JJBA 3L02A 2QN9A 4L0MA 4FW8A 5FTWA 3WMXA 5I9TA 2BMFA 2FZCA 3IH5A 5JMPA 3YASA 4B6JA 1H1TA 4D98A 4KGXA 4CIWA 2XZOA 1EDDA 2BKUA 2P9TA 1DKRA 1GSAA 1U7DA 3GLSA 1HEIA 2AOUB 4NG5A 4I50A 4QEKA 2R751 2BEVB 1JPVA 4BO5A 2J3QA 5TRTA 1OLSA 3ETCA 1FFXA 4F92B 1EQAA 1K7YA 2FEKA 2IYSA 3OBBA 3ZBTA 4D8TA 1FDSA 3REOA 3TXYA 3ZXXA 4LC9A 4IDFA 1N7JA 2FX5A 2XVMA 1KDYA 3PX7A 1R37A 3I3SR 1RQXA 3PJGA 4PIPA 2FI1A 1FVOA 4EUSA 2GDJA 2FZLA 1MU0A 1P45A 3KJIA 1Y63A 2WZDA 4K28A 1EFHA 3UXEA 5LVAA 2Y0DA 3TM5A 1HI9A 1THGA 3QKRB 3HYSA 4EL5A 2BONA 1TF7A 2K4MA 3L46A 1T8UA 1JT2A 3S4YA 3IBSA 4UTNA 2BH2A 1R5NA 1E5VA 5A0FA 4KR9A 3WIVA 1OI7A 4F6CA 3B6IA 1BEEA 4CTKA 2XLBA 2Q4BA 3KZVA 4FVTA 3UMFA 1C9DB 3AXTA 2G82A 4CFSA 4YRAA 1FX0A 1SPBS 2JVJA 3LIPA 5HF6A 4IWNA 4GE0A 4B5LA 2I4TA 2PZ8A 3K9FC 1IU9A 2N3ZA 2JD1A 2W22A 3AF0A 3C3JA 3L8MA 2DY1A 4GVPA 3G85A 1KDPA 4KBFA 4QVKA 3MWLA 5CLQA 1OFUA 4G1UC 1YHYA 2OG2A 4JNCA 3KUUA 5KSPA 4YAKA 3CLKA 3W3AH 2CJWA 1BDMA 4Z9AA 5DYNA 3TR0A 4E7OA 3E9CA 1NDUA 4HS4A 3NHBA 4BKPA 1Z3CA 1YKFA 3D7RA 3FOEC 4B4WA 2XUKA 4DT1A 1ORRA 2ZJ1A 1PJ8A 3V1NA 5JNLA 3AZQA 4DLPA 4DV7B 1Z4OA 1OHHA 4OJYA 4HBZA 1TK9A 2CXXA 4JLDA 4ZOLA 3TSYA 4X3CA 4CTMA 3JTEA 4QM6A 3DH0A 4QDJA 1GRCA 2YCBA 5TNXA 1GGMA 1HE5A 2O0JA 5DCUA 5JWOA 3HFGA 5KEIA 4LVOA 1M73E 4X1IB 3BXZA 2I66A 4Q00A 3ZI7A 1XEFA 4PZEA 4G8CA 1OC4A 3CWQA 2JGRA 1UPXA 2XCIA 1TM2A 3ANSA 5BN5B 3WSWA 2JIDA 4QPZA 4AI6A 3ADKA 2IY7A 3W6OA 5G3YA 3U13A 2PUHA 4DXHA 4CMBA 1H85A 2XZTA 1GA6A 5KOYA 1ULSA 3PQEA 3IQXA 3QVJA 3G79A 4CLOB 1APBA 2FJPA 1UBGA 3TSAA 4C5CA 3SHTA 1XE3A 2WU8A 2RSLA 5HOEA 5IT0A 1F6BA 1NZFA 4MS3A 4BX0A 3FCUB 1C2YA 3OY7A 1QIIA 1OLUB 1SHJA 5EWMA 2QP3A 2EW1A 4PN3A 5AM3A 3QBTA 4N82A 2H2IA 4MWZA 1YGYA 3GL9A 5LZ7A 4ER7A 3HSKA 2ALJA 4H2DA 3BJIC 1JW9B 2O6HA 3JX9A 2KHZA 3Q9NA 1M0WA 3T7TA 4HL6A 4YMHA 1ORTA 1SBIA 3VSEA 1XMVA 3PDHA 3S2GA 5SZHB 3NG1A 1AB5A 2FPXA 3WGTA 5JPDA 1OTYA 1UBRS 3KYDA 2HHHB 4PZUA 1F2TB 1J8FA 3OZIA 3B7PA 4CEIB 2E48A 1EINA 2E49A 3ETEA 5JASA 5E9QA 3QEBZ 4CEJB 5SZIA 2X5KO 1M2EA 3JASA 1WXQA 4ZYLA 1UPCA 1GPLA 4KIWA 1DLIA 2IDMA 5HCNA 1E89A 1QH0A 1M2KA 2X77A 3OJWA 3EA0A 3VZPA 3WK4A 4HXYA 3E3OA 4RTKA 1GUDA 1COWA 2V74B 1G98A 5JTUA 4BC0A 5CVCA 4C21A 1UFOA 3A4NA 3KXIA 4YP7A 1EE2A 1JR3E 1ULTA 2BISA 3EUEA 4MOWA 1R8QA 1A72A 3BS4A 3HBFA 5JRJA 2C78A 4LF4B 4P4GA 5T4HA 1IAQA 3OU7A 4RACA 4TSFD 4UE3S 4BFWA 4KPYA 2BM8A 3EAQA 2PD6A 4M8NE 2HNKA 2O0KA 4GPD1 1SWWA 1GSHA 4UUQA 1XT6A 3GGPA