1Q3HA

Mouse cftr nbd1 with amp.pnp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
281
structure length
265
Chain Sequence
TGIIMENVTAFWEEGFGELLEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of nucleotide-binding domain 1 of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 92
structure length 265
sequence length 281
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1q3hA00
2ZI5A 1RIFA 2GJAA 2FFBA 1AN0A 1CJVC 3WYFA 5TY0A 4WW0A 2PZEA 1HYQA 1O87A 5CM9C 2OAP1 4BRWA 3GLIE 2DFTA 2WSSD 4GT1A 3FFAA 5LDDC 1BS1A 3C5CA 3LDAA 4G0NA 3ZLJA 3TR5A 1VCOA 1XMVA 2VSOA 3FOZA 3ZZTA 1B23P 3THYA 1R0ZA 3QKUA 4DDUA 3TSWA 4JLBA 1VIAA 4DLWA 4WOPA 4DKXA 5E95A 3AKCA 3P26A 2OCAA 5KHOC 4RCYA 5FBWB 1D9XA 4B6EA 1RJ9B 2ZE7A 2IXGA 3BK7A 3PV0A 1OB5A 1XD8A 3B1ZA 4DEXA 5HCIA 3DHWC 5KNCA 2BOVA 2FX3A 4Q21A 1JJ7A 2QU8A 4LV8B 2IYXA 2WIAA 3BH7A 5KSYA 1N5KA 2D2EA 2ZE5A 5IDVA 5DISB 1ETUA 5GJBA 4KAXA 4EUNA 2F43A 4WAUA 2I1VB 5KOYA 2A5YB 1KY3A 2W0MA 3NTUA 4L5BA 2YOFA 1T9HA 4HZUB 3GJ0A 4L9WA 3AKEA 1OHHA 2O5VA 1S0UA 2OBMA 4LJ5A 2WWHA 2HUPA 3LV8A 5FBLB 1FW6A 1Z6XA 3ADDA 4OK5A 3VKGA 2ZYWX 1FUKA 2QL6A 2VHCA 4JT4A 2PLRA 4OI4A 4RY2A 4U02A 4PC7A 2AWNA 4LZZA 2KB0A 3LO5A 3LX5A 1QHHB 3W34A 3WYAA 4BLSA 3CRRA 3FMFA 1XTSA 2IHBA 4DRZA 2Q0HA 1NF3A 1LB1B 1Z2CA 1UPTA 3GFPA 2H1LA 2G0NA 1KNQA 4OHWA 3RYTC 1XJQA 4LJ7A 1N5JA 4TMVA 4RKFA 3HPQA 2ZJOA 5KPJA 3TUIC 3BB1A 2ODNA 3EZ6A 2V9PA 4TSFD 2G6BA 3IKJA 5IRCD 3VKHA 4KODA 3T35A 2KSQA 2IUSA 1LVGA 3QXJA 3R7WA 3UG7A 2JA1A 4PZZA 1L2TA 1AKEA 1G291 4KI0A 4TMXA 4YMUA 3Q5EA 5BN3A 2ZRAA 4KLNA 1KDOA 2P67A 3GJ3A 4WZ6A 4DLYA 1Z2AA 2P6RA 3PUVA 1C1YA 2FU5C 5DE3A 2J0UB 3QY0A 2GXUA 1T5LA 2VP4A 4ZKEA 4F92B 2FZ4A 4UXIA 2RAPA 3NC1C 2MSCB 4EPYA 1N6KA 2NPIA 4N0DA 1YQTA 4Q1CA 2VP9A 4Q4HB 3F5FA 2ZJ2A 3EASA 4QNMA 1CR1A 3TUJC 4GDFA 1J99A 3LBIA 1IJEA 3AVOA 4V02A 1KI8A 3KL4A 3B13B 5FOXA 5EE1A 4PSKA 4O25A 4A82A 1VECA 1G21E 4TT3A 1NMYA 1FNNA 3O8DA 4QBGB 3AVVA 2AD1A 3DOFA 1E2GA 4OJQA 2GVDC 3MAAC 1JECA 4FXPA 2WSSA 2JEOA 1WMSA 2FZLA 1UF9A 2BCGY 2PMDA 1H8HD 4ASUD 1E69A 1YJ5A 2HT6A 2ORIA 3MD0A 4B75A 2B92A 1TU3A 1SKQA 4ERNA 1TEVA 2AL7A 3WMEA 2ZU6A 3WHKA 1MO3A 5GVSA 2ZI6A 5J4YA 2CMKA 2YWHA 3QXSA 3BH6A 2EYQA 4MRVA 1RE0A 2IYVA 4R98A 3D3QA 1M6NA 4L15A 3ZS8A 1DS6A 2XTZA 4C4PA 3N70A 1KI9A 3L2OB 1OH5A 1HQCA 2CK3A 3ZD7A 1E9DA 2J0QA 5BYJA 2NGRA 4QJ5A 4DLZA 1UKVY 1NVUQ 3Q8XB 3THOA 3C8UA 3IO5A 4US1R 1WBDA 4QOSA 1XTKA 1GITA 3DMDA 3OAAA 3KXIA 3B85A 1II8B 1XD9A 2IF2A 5FL7A 4LOAA 4XJXA 4OYHA 4J0QA 4XWAA 2NO6A 4GI7A 3UWOA 3HDTA 3ADBA 3ZVMA 4HUQA 2ZROA 3W9YA 1S3SA 2QT0A 4Q03A 1Z83A 3IHLA 3EZ2A 4ON9A 2F55A 1LF5A 2BMFA 2GF9A 2IYZA 1R6BX 2ZJAA 1JBKA 4GL2A 3GJ5A 1JQLB 3SYLA 1DADA 4P4SB 2IS4A 4B6FA 3QF7A 3TAHA 4B35A 1DO0A 4M4SA 1XEXA 1G5RA 1UEJA 3V4RA 3AV0B 3HJNA 4YXWD 2IYWA 4A2PA 3B7GA 2GA8A 1W5SA 2HLDA 4W5HA 3RWOA 3OEEA 2XNSA 3U61B 2PMKA 3C41J 3FMIA 1XEFA 3WBKA 1MR3F 3I32A 4Q00A 4ABYA 2Z0MA 2ZR7A 2YC2C 5FTKA 1CULC 1QHSA 1QHYA 3X1DA 4QJ4A 3U44A 1OXSC 3EARA 1Q3TA 1K5DA 4IXMA 2ZI4A 1PLLA 5EQTA 4CEJB 3BFXA 5A5GA 3RS2A 4FIDA 2Q9AA 1PUIA 3B1WA 4TYYA 2YJTD 1P9RA 3E5HA 1ZU4A 3B8HA 3A1TA 2WICA 4CGZA 1KYIA 1P2VA 1E2MA 4XVQA 2H57A 3AVQA 3L8YA 3T5GA 2O0HA 2O0KA 2ZSAA 4P33A 1IN5A 1N5LA 2HJVA 2QRZA 1XTIA 3NKVA 3VMFA 1E0JA 1E9FA 3FYHA 4A2WA 2FH5B 1TTTA 2ZRLA 5FR1A 5BN5A 5JWRA 1ZUNB 4XIGS 1G5PA 2PJRA 4TYWA 1Q22A 1CRPA 2J59A 2VHJA 3GFOA 4A36A 5ANRB 3VFDA 1R4AA 4F4JA 2RGXA 3VR6A 1W4RA 4LHYA 5EP2A 4S2EA 4IFBA 3HWSA 1SHZA 4DUGA 2GZDA 5JRJA 4HAUA 1NSTA 2XNDA 3QJYA 3SYNA 3SFVA 5LD2C 2VP0A 5L3VA 1DBSA 3A1UA 3ASZA 2VF7A 4Z8YA 2GK7A 1N6HA 1NIJA 1UJ2A 621PA 1KJZA 1WF3A 3VKWA 3VX3A 4PC6A 1EK0A 4JBWA 1KSGA 5HZHA 4R9UC 1YRAA 2XAUA 3ZJYA 2WWYA 4JLVA 3MWKA 5JS8A 2R6AA 1G4AE 2QQ0A 3NBZC 5GJWC 5B64A 3OE7D 2FPKA 3LNCA 4GNKA 2V55B 3X1ZA 3RRZA 3ZIAA 3LVQE 4P4SA 2QM8A 1M7GA 3CUEF 3Q7PA 2EU8A 5JCPA 2JJ8A 4RZXA 5JI3E 3H2YA 2QP9X 2J5XA 1H8HA 4ASUA 1VIYA 1OFIA 2H16A 2ZRIA 4O3MA 3BB3A 1Z0AA 2A30A 1JJVA 2VO1A 2ZJ8A 4UJ3A 3U4QA 2FSGA 2CHVA 4FWTA 3AF4A 2IHYA 3K9HA 4MGKR 4RFSA 3W3ZB 4AKIA 4KVAA 3SBEA 4C0KA 3AVWA 5CB6A 3VHLB 3QVVA 2FSFA 2I1QA 4C0JA 1OF1A 3BERA 4C30A 4BZPA 4P4TA 2IXEA 1NLZA 4YQFA 4AYWA 4IOKA 4LHVA 4GZMA 4PO8A 3WXMA 2Q6TA 2OE2A 1KK3A 2HJGA 3K70C 4BFVA 1Z07A 2D62A 3B1YA 3BD9A 2E87A 3NG1A 5KPDA 1HA3A 3EPHA 4NL4H 5AJXA 1IAQA 4LPKA 4AG6A 1UBEA 2GXSA 1IN4A 2P2LA 4TLCA 1HQYE 3WHLA 5D3QA 4AURA 4C2TA 1DAHA 4JL8A 2OCPA 3QKSB 1AS0A 3EWAA 1F6BA 2X1VA 2W2VA 4OQLA 1NLFA 2QT1A 4BQSA 2CHQA 3QXXA 3BC1A 3T15A 4GOJA 4RD3A 1KZ7B 2RGNA 1QRAA 3W3AA 5C18A 4D4KA 2ZJ5A 2O8EA 2XITA 5JCZA 4NYJQ 5FI1B 2J87A 1P3JA 2CVFA 4AYXA 2G77B 1GL7A 3FDIA 4FW9A 5B58C 3LRPA 1IOZA 1O3YA 3GEEA 4HAXA 3U4QB 1DAEA 2OSBA 2BBWA 3QVUA 4M1MA 4QJ3A 3AVUA 1NIPA 1BKDR 1Z0JA 3SN6A 2FV8A 2IYSA 4IRUB 2GZAA 4KFSA 2FJUA 2G83A 1L8QA 3R8FA 3EG5A 4MRSA 5AR1A 2C95A 3ZD6A 4GMXA 4CT4B 1JR6A 2XTNA 1FTNA 2VEDA 3FWYA 1Z0IA 1S3GA 4D6PA 1TX4B 1LV7A 1FOEB 4N0EA 3UPUA 3BE4A 4CZ2A 2G1JA 3W6PA 1SVSA 3SU8A 4B3XA 4I1VA 4YMVA 1NG9A 4OL0A 2OHFA 2XB4A 2ZSEA 1DAKA 4JJKA 1XTJA 3QF4A 5H70A 3T12A 1G3IA 3KKPA 2CE2X 4PSAA 3BH0A 3DM5A 2RGBA 4P0TA 1G4UR 3WNBA 2XZLA 1E98A 4JYCA 2VBCA 4JL6A 4W5WA 4B33A 1XPRA 2NZ8A 1GKYA 5UKDA 3WNCA 2OILA 4FN5A 1VG8A 3OEHD 4BECA 3TMKA 1EFUA 3BXZA 4Q1AA 1DAGA 4ZDKA 4DSOA 1QHGA 2F1IA 3LFUA 4JLPA 4DCNA 3LVRE 1NN3A 2CLDX 2OFXA 2ORWA 2HDNB 3IO3A 2QTHA 521PA 2YWFA 2D7DA 1IQPA 4NZYA 1H8EA 5J5CA 2NQ2C 1NY6A 1NJGA 1XMIA 3ADKA 4NDZA 4ZIRB 3J81k 3THXB 1X3SA 1YHNA 4WZBE 4OI1A 3A6PC 2PZGA 1FX0A 1K8RA 4FI3C 4H9GA 3TQFA 2EW1A 4HATA 4O0MA 1XZQA 1AGPA 1P9NA 2JCSA 4HAVA 2P5TB 3NEYA 4TLAA 3K70B 2XXAA 1G8HA 2GZHA 3LXRA 1SXJA 3RNLA 4EQ6B 3I92A 2ZXUA 2DPXA 2ZSFA 3EC2A 4G5OA 4IOMA 5KUTA 1GUAA 2R6FA 1VCMA 2GXQA 3AF1A 2XX3A 4JMPA 3FMOB 3H1TA 2JGNA 3D31A 2EFEB 4MYTA 4DDWA 5L3SA 4TMWA 2GILA 4M9XA 2HEIA 2JATA 4DT1B 4P4UA 3LWNA 1YZGA 2OXCA 1HV8A 2W6IA 1N6IA 3A36A 2BDTA 2AN9A 2R2AA 4YLGA 1D8TA 2VA8A 4Q4AB 3B9PA 5B30A 3VU9A 1ZNWA 2BEJA 2Q9CA 4M2LA 1BMFD 4OQXA 3CW2A 3N5CA 4OI0A 2WPDD 4LJ4A 3QSYA 1SKYE 1ZU5A 2V1XA 2BMEA 3GEIA 4TTQA 2XZPA 3EZFA 3QXCA 3O8BA 4I99A 3GD7A 4PXAA 2DFLA 1Z0KA 4Q4HA 4AIIA 3SC3A 5HZKA 3AF2A 4XVRA 2OM2A 3A8TA 4DSUA 4G5GA 4MUAA 3VR3A 1E9CA 2J0UA 3UMRA 3QEJA 1Z8FA 5JRZA 3PG5A 4IVQA 2J9RA 2NPFA 2BMDA 4PC1A 3QKRA 4DBLC 1FQJA 4LPSA 2V4ZA 1KO1A 2WIBA 4A0GA 1P6XA 2J41A 2J0VA 2IUTA 3KX2A 3VQTA 1F60A 4IEIA 1T5IA 1GRRA 3OIYA 3DM9B 3FKSA 1U8AA 4PTLA 5KNBA 3W5JA 5LPNA 1T0HB 1G7SA 1KI2A 3ZZUA 1WB9A 4MRPA 4C0SA 3SI7A 3SZRA 4US2R 1W7AA 4JZKA 1W36B 4ARZA 1TUIA 2RGEA 3C7KA 3HYTA 3GLFE 1W36D 3IBGA 4MKHA 5K8UA 4B47A 1W4CA 2OFOA 1B0UA 1FZQA 3QG1A 1JEEA 1Y63A 4BASA 3TH5A 3NWJA 5DGXA 5AWFC 3REGA 1PZNA 1UBGA 4PZLA 5FOWA 1OXTA 1OXXK 2BJWA 3I73A 4NYJR 3PFIA 4GOXA 2PX0A 3W8NA 1A1VA 2R65A 2X8AA 2WKRA 1W49A 4B3GA 5FBRB 4PC2A 5SZIA 2ZYVX 4RVCA 2GCOB 3PUWA 4ACAA 4NPHA 4NCHA 2JLYA 1KIMA 1N6NA 2ZSDA 4HLCA 1GFIA 1NSFA 3Q5DA 2KBFA 2PCLA 2ZRPA 3KQLA 2J0SA 1TAGA 4O2LA 1VYTA 2BEKA 1E79A 1D2MA 3KQKA 1BH2A 1NNEA 1N25A 2AX4A 3KKQA 1G3QA 2CLSA 2IT1A 3H86A 2RGCA 4TTRA 1R2QA 3TJZA 4PQFA 3SJCA 1G64A 1P5ZB 2AXNA 5EE5B 3EPLA 3M0EA 4CVNA 4TSFA 2F1HA 1E2FA 2HYIC 2F7SA 5TMPA 2FF7A 4H1VA 1AKYA 5FUWA 5KSOA 1ZP6A 4PPNA 1VG9B 3FMPB 2ZUCA 4BGDA 3ND8A 1IN6A 2YYZA 2HV8A 1G9XA 1RYFA 4G5SA 4Q66C 2ATXA 3QF4B 3SDZA 4DJTA 3WBJA 3AGPA 5CDFE 4TL8A 4Q9HA 2Q9BA 3TIFA 1XZPA 2GKSA 2OO7A 3KQHA 5FOVA 4A15A 5AUNB 2FE4A 5FTNA 3ICEA 5E3HA 3AKYA 4XD7D 5CYOA 3Q7QA 4TMTA 3NXSA 2YVUA 3FGNA 5J4VA 1PV4A 4BFSA 2A9KA 1E3MA 2IBMA 3GLGB 3K0SA 4PANA 2QZ4A 5E7MA 4KSBA 3QBTA 5DNYB 2PX3A 1NVXQ 3F0TA 5CYPA 3B1XA 1E9SA 2H5EA 5JBQA 4U00A 1XJCA 2W83A 1W2HA 3ZVLA 5H68A 1CEEA 1E2NA 2PLFA 5BN4A 4B32A 3HYRA 4LDJA 4WA7A 2RH5A 3L43A 4ZCMA 3SNHA 5A4JA 3ETLA 2GEUA 1RZ3A 2CJWB 3D8BA 1VYUA 3NVAA 5SZJA 5F98A 2WOOA 2ERXA 2ZREA 4DUGD 5J4LA 4EAQA 3UK6A 3CX6A 3AM1A 4FMBB 2ECKA 1SXJB 3BIFA 5E7JA 4BWYA 1T3HA 3GJ8A 1DARA 1F48A 1G18A 2B8WA 1HEIA 3JZAA 4D26A 4DVGA 4QBIA 4OK6A 4QFMA 4MA4A 4EFNA 1U0JA 1MOZA 4GPTA 2GTPA 1Q20A 1KI7A 2C9OA 2CK3D 1ZW6A 2O52A 2B21A 1SXJC 1SVIA 4IVRA 4Z1MD 4M1YA 2JIZD 2W58A 1S1MA 1KK0A 2JLQA 3Q72A 4G5QA 4U5XA 2GJ9A 4JVMA 4M1SA 3TVTA 4OQFA 4P3YA 1NVVR 2CVHA 1HT2E 1WDTA 3HU1A 1KTVA 2H7VA 5CLLA 2J3EA 3I8SA 1AQYA 4BLOA 1QVAA 4P31A 4XOIA 4PQRA 1XD2A 2QMEA 3AUXA 4MRNA 5FPHA 5L3RA 1IY1A 5FH9A 2QENA 2QTVB 1XMSA 2J7PD 1EFTA 2ONKA 2W2XA 3PIRA 4LK2A 5GJCA 1NN1A 3BJIC 4Q19A 2QROA 4MDEA 1OJLA 4LX0A 4QXAA 1E2KA 4Q4AA 2KE5A 4M21A 5IK2D 1FPMA 4G3XA 3CH4B 1C4OA 4D81A 1IBRA 4YXWA 1E0SA 1J8MF 1G41A 1A82A 2AHOA 3B1VA 5KYKA 3LQRA 3KDSE 1U9IC 3EIHA 1X86B 3ADCA 2YNMA 3DKPA 1GVNB 1TQ2A 2ODEA 2ZR9A 5JECA 5DIFA 4XWKA 2PEZA 1IHUA 4O2RA 4JJZA 2VHQA 4C0LA 1NJFA 3TLXA 4URYR 2G3YA 4GFDA 4C0HA 2GRJA 1YR9A 4JVLA 4AD8A 1CS4C 1OH8A 2VLIA 2OV2A 1MRSA 2C5LA 3TAUA 2C99A 4F38A 1ZD8A 1U8ZA 3RWMB 3QPVA 3SFZA 1PJRA 5M04A 3GLHB 3REFA 1E2LA 3K9GA 4Z1MA 3B78A 1NRJB 2O8EB 1ZUHA 5C46F 3QI2A 2KJQA 1GL6A 4YONB 1R0XA 3Q9LA 1FX0B 1W0JD 1R10A 3M6AA 1Z6YA 4DLVA 1AS3A 4LJ9A 1KDTA 1XJ0A 1WE2A 4HB2A 3PEYA 1EESA 4JLAA 1XTQA 1OE0A 1P61B 2FDCA 1Q1QA 3QPWA 3BFKA 1WCV1 2GEVA 4MGYR 3FPAA 1KAGA 4OHXA 4YDSA 1YR6A 4G01B 3KJHA 3KJIA 4QGFA 2DY1A 5EZ5A 2CNWD 5G40A 1E1QA 1ESNA 2XNDD 3U44B 1SKYB 2UVQA 3IPXA 3KB1A 2ZANA 4IVPA 1CR4A 4Q47A 1KKMA 1X6VA 4DCSA 4W9MC 1Z6AA 2IS2A 3ZZ0A 3PR1A 2IUUA 3KQUA 2ZI7A 2WAYA 2ZUBA 5JSZA 4RFSB 4L16A 2NO9A 1N6OA 1ZM4A 3TRFA 3DVLA 2GCNA 4QHSA 4EJSA 1E2QA 3U3RA 1QHNA 1KDRA 3TGPA 3U5ZB 1ZC3A 2BJVA 3K0EA 2OBLA 4BFZA 3ZIAD 4DLUA 2VHUA 4S35A 3W5IA 4TYPA 3WY9A 5JI2E 5IT5A 1VCNA 4PAMA 4KU4A 2W6JA 3MG9A 1XX6A 5CIQA 1GKUB 4CEHB 4GOKA 1IN8A 2GBLA 4Q9JA 2QAGB 4FINA 4A8JB 1QHHA 2H92A 1G19A 1KK1A 4Q7MB 3W90A 3K0FA 1TU4A 2WWWA 4F91B 2GJ8A 1E4YA 2X77A 5JJIA 4RD4A 1XB2A 2X19A 2WTUA 4GMDA 2CE7A 3BWDD 4QBFA 1DAMA 4XH9B 2ZETA 5CB8A 5TXGA 3CRMA 3UIEA 1KI4A 1G20E 2B6HA 4PPFA 4WBSA 1NLYA 2CL7X 4PAOA 3TR0A 2JLVA 3BORA 1RRCA 1JNYA 1FUUA 3CWZA 3AF0A 1ANKA 2AK3A 5B57C 4KFTA 4TQAA 2IWHA 1BYIA 2D06A 3SHFA 3GLIA 4Q7JB 3U7EB 1P4SA 4D2IA 3GQBA 1SGWA 3G5UA 4KJZA 4CYMA 3LW8A 4B71A 1H65A 3H4MA 1SULA 3U6BA 5JEEA 1DVRA 2C98A 2QSZA 2C78A 3HP1A 1AS2A 4IDPA 3K09C 4K8OA 4V0MA 4ARZB 3UATA 2ZRMA 4GZLA 4UQOA 2WV9A 4NCIA 1OXUA 3AB3A 1N6LA 2ZRCA 4E09A 2BM1A 4OBEA 5LB4A 2CBZA 2AKAB 2PBRA 4FCTA 1EX6A 1UAAA 4DIEA 5KDLA 4TL6A 1XNJA 3QOFA 3I61A 3PJRA 3M4YA 5TVKA 4F4CA 3IILA 3QEOA 3LW7A 4B48A 2ZVQX 1Z28A 1RVDA 3CNLA 3QKRB 2ZEJA 1GIAA 1GNQA 3K9LA 3QUSA 2AXPA 2ZQ5A 1ZC4A 3VR2A 4UXHA 3I8XA 5EP3A 2R6GA 5JFGA 1GKIA 3S1AB 2J45A 1XCMA 2QPOA 3OFND 5D3MB 3GLFA 1YZLA 2OUKA 4II7A 5DN6A 4PO9A 4HAZA 1TMKA 3PUXA 2WBLC 1XD2B 2N1BA 4NBSA 2IYQA 2AFIE 4FMCB 3GEHA 4RD2A 2GEDA 4PFSA 3RRYA 5SZHB 3H0KA 1US8B 2XB2A 2GVZC 3CNOA 5HPYB 2FEMA 2QQEA 3W6OA 2O0JA 3SHWA 4EJSB 4HSEA 1G3RA 5LD2B 2EWWA 1NI3A 2IW3A 1X8LA 1EX7A 5G53C 2PEYA 3W8RA 4EPXA 4DC9A 3SJZA 4MYUA 2ZRFA 3TVDA 3GLHA 5L3SB 3U3KA 3EWSA 1M74A 1X8KA 1OFHA 2WWGA 3U7FB 4NKRA 3WRYC 1NVWQ 3GPLA 2CNWA 4V0ME 3V9PA 1RW4A 4PHGA 721PA 4BLRA 3WNDA 3CRW1 2H18A 1MRNA 2Q3HA 3IPYA 2OFWA 4R7ZA 4Q7KA 2WKPA 4BZQA 2XXAB 4V03A 1WBBA 5TARA 2ZRBA 1A2KC 3EAQA 3FTQA 1M8PA 3OHMA 1Q1BA 3IUYA 3RLFA 2IK8A 1SVLA 3SR0A 3KKMA 1KO7A 2YINC 1SVOA 4RFVA 3PUZA 3THXA 4DIDA 2Q3MA 3DDCA 4AY2A 1A7JA 1YZKA 1OIXA 3RRNA 2ANBA 1RRGA 1DG1G 5EE9A 2JASA 2P0EA 1W46A 4V0NA 1X1RA 2A5FA 2VQSA 3FB4A 1T3LA 1ZUIA 2BKEA 4XD7A 3EX7C 3QPUA 2NTYC 1T8UA 4MKIA 4K81B 1P62B 1YZTA 2REXB 3LLUA 4M1WA 4F93B 2GBLC 2JLSA 1OFTA 1UFQA 2VIIA 5EE0A 1BYUA 4LGMA 1CIPA 1TPZA 4LWZA 2J1LA 1G8PA 2RHMA 4NP6A 5GJVC 2DFNA 421PA 4AKEA 2RHDA 4BE7B 2XZOA 4URWR 1I2MA 3DPUA 4NONA 3OE7A 1SVMA 1CRQA 1W2GA 2QSYA 1X1SA 2AR7A 1TNDA 4JYBA 4MITA 2CEAA 1UM8A 2ERYA 3O47A 1OXVA 5F3WB 1KHTA 2O8CB 3L82B 5FFMA 3KQNA 1KGDA 5KO2A 4B74A 1KNXA 2A5JA 4DB2A 4HB4A 4HZIA 1R7RA 5JEDA 1JAIA 4EDHA 3EIQA 3C4JA 4QBHA 3KFVA 3MJRA 2ZAMA 2ONJA 1Z06A 4YMTA 2AD5A 4Q1BA 4QM6A 1GNPA 1M7BA 4M9SA 1QF9A 3AP1A 2IYLD 1SVKA 3QENA 3P27A 821PA 3ECCA 2OEPA 5SZKB 1KSFX 1FNMA 1JPNA 3BRWD 1NKTA 3I72A 1D2EA 3RDPA 4AI6A 5J47A 3GMTA 4HAWA 3KKOA 4I1OA 5DYIA 2KBEA 4NCNA 3X1XA 1G6OA 3LXXA 5C4GB 1S9HA 4C9BA 3P32A 3CB4A 1FQKA 2VTKA 4ZI3A 2EWVA 2QM7A 3QXHA 3EZ9A 4A6PA 2EFGA 1S1CA 3K70D 5C1BA 1ZAKA 1CJUC 1YKSA 2C8VA 1ELOA 2XGJA 4KYUA 1PVOA 2G1KA 1CLUA 5CK4A 1GZSA 4TLBA 1U94A 4H1UA 4XVUA 1ZM2A 4AG5A 1P9WA 4OQNA 5BW8A 4TWZA 1UBFA 1JEDA 4WIAA 4Q01A 2QPAA 2VSFA 3SBDA 3NBYC 5JLJA 2V3CC 1ZD1A 4LJ8A 4L8GA 1AJEA 2O8FA 1EWRA 2QORA 4LBYA 5FBVB 1EWQA 3N2EA 1GM5A 3K8YA 2ZI3A 1D5CA 5KTYA 1MO5A 4N1AA 4C3ZA 3S1AA 2P6UA 1Z0DA 1E2IA 2K5UA 1CJTC 3CNNA 3IBYA 2IL1A 3LD9A 1T6NA 4LJAA 4UNSA 5KDOA 4CEIA 4LY6A 4FWIB 1FMLA 5F2EA 3NBXX 3CRQA 4NTZA 1SXJD 1RYHA 1E2PA 4C7OA 1G8YA 4X8MA 4BLPA 3B9QA 2ZUDA 4JT2A 3WP1B 4YDHB 4A6XA 1FL9A 3IQXA 3PITA 4B3FX 2NOAA 2FGKA 5F9HA 2O8DB 2C77A 2DB3A 1U9IA 3EC1A 5DN6D 2D4HA 1EFHA 1CTQA 2IS1A 2NO0A 2VH5R 1JALA 3QNUA 4AWXA 3M1IA 3U2QA 4ZI2A 2ZRGA 3KUCA 4WZAE 3HR8A 1XU4A 1CXZA 4BFWA 4DLRA 2P6NA 3JVUA 4CDGA 3NC0C 1NY5A 5JJLA 1OB2A 4KO8A 2B8TA 4LC1A 4IDQA 2BHRA 3U3MA 5BYKA 3R9XA 4HLDA 3V4FA 3WRXC 1G3MA 2V8OA 1IM2A 1BIFA 1VHTA 2QE7D 2HT1A 2WWXA 4KBGA 2JLZA 1MO4A 4N3NA 3RS0A 3Q3JB 4NH0A 1H8ED 2JDID 3ONWA 4D0LB 4LV5B 3U60B 5DSZA 2CL0X 2OAQ1 4WXPA 4KITB 1G6HA 5G3YA 4M9ZA 1XPOA 1S9DA 4PAQA 1P7CA 4A0FA 4DSNA 3MWYW 3UG6A 2B7CA 5K8LA 1AGRA 1W0KA 1W47A 2ZR0A 3N2IA 2CLCX 5JJKA 2PT5A 2QPTA 3CIOA 4A0HA 4FCWA 2GJKA 4V0KA 2O8CA 4D0GA 1OW3B 1QZXA 3KTAA 2C2HA 4PSVA 1RJ9A 4W5JA 4BUJA 1DOAA 4ESVA 2IWRA 3VHXA 1TUEA 4ZKDA 2YOGA 1VDZA 4EPWA 3U7HB 1YRBA 1TQ6A 1OFUX 2XTMA 2QMUA 1US8A 1W5TA 1KSHA 5K8TA 2ANCA 4JVNA 2G0TA 3SQWA 4RZ3A 3NBFA 4US0R 2GWHA 1E2HA 4GBMA 3ZQJA 3QKTA 4FMCF 1OIVA 2ZIAA 4BEBA 4TZ6A 2MMGA 2UZIR 3B2EA 3KXLA 3GCGA 3RC3A 4LHWA 4BRUA 4UNRA 3PCRB 1A4RA 4MRRA 4I1UA 1XEWX 2C9CA 1IXRC 4NE2A 4Q48A 2WJGA 1M1YE 4Z54A 2VPPA 3CPEA 2ODWA 1VG1A 3IIMA 5KNDA 1U0HC 2QMOA 5BXQC 1UDWA 2QTFA 1XRJA 4DT1A 1IJFA 3D6TB 3P20A 3PQCA 4R2HA 1W4AA 5FTJA 3T1OA 1D2NA 1Q3HA 5EP4A 3THYB 1C9KA 1CF4A 3WMGA 1KI3A 1VKJA 1XXHB 1Q0UA 3MMPA 4HI0E 4QRHA 3G0HA 2C9YA 1F3OA 3EZ7A 2WMNB 3LQQA 4HB0A 4RD6A 4DZZA 2GETA 2IA5A 4KV9A 3HU2A 1NMXA 3L8ZA 2HLDD 1U99A 4EQ6A 3JVVA 3T1QA 4HLUA 1KI6A 1DPFA 2YV5A 4IFEA 2FSIA 2QGZA 2FFAA 4EFMA 2ZITA 3HR7A 4B44A 1G16A 1R5BA 2D7CA 3RS3A 1J70A 2CCGA 4AK9A 4OHVA 3VU9B 4PHFA 4M53A 2ZS8A 1L4YA 1PLJA 2VP2A 1R0WA 2BBSA 1XPUA 2X2EA 4IHQA 1D9ZA 1J8YF 1Z63A 1Q57A 3CKLA 121PA 4PQYA 3AQ4A 2WHXA 2L0XA 2OXRA 2DR3A 2WVJA 3DKVA 4M9QA 2EFCB 1NBME 2WWIA 4QGGA 5FPSA 4TTPA 5TB5A 4EPRA 4Z51A 4BPBA 4YMWA 1UADA 1ZNZA 1AQUA 2GCPA 2OBNA 3NH6A 4FCVA 1U90A 2RGGA 2ZJBA 2Q21A 3CR7A 1AM4D 1KJYA 1NBMD 5EXPA 4JBYA 2I4IA 3G82C 3R20A 1Y3AA 3RS4A 1E6CA 1SXJE 1WQ1R 2H17A 221PA 3ZDQA 4ACBA 1IXZA 1ZINA 1QDEA 1KAOA 2IYYA 2GHIA 1OYWA 2IYTA 2LKCA 2Z4SA 1XXHE 3B6EA 5AJYA 1S8FA 4PO1A 1E99A 3SJBA 3UXMA 1CBUA 4BZXA 4FMDF 4JBXA 2ZRKA 3T1TA 1HURA 4NCKA 5EXSA 1SHKA 2CDNA 1QHIA 1MT0A 3R7WB 4Q9KA 3GLGA 4BFXA 3TE6A 3X2SA 4JVSB 2ZYUX 3C16C 2MSEB 4A9AA 1MH1A 1VG0B 4Q5IA 2HXSA 3NHAA 1E9BA 4C0AC 1NN0A 4TZ0A 2QAGC 4NHOA 1GNRA 5FR2A 3PEVA 4LYJA 5P21A 1AK2A 3OIUA 5FUVA 2BCJQ 2PCJA 3NEJA 5FI0B 3K9NA 1GG2A 3FVQA 2OG2A 5EXXA 4I1SA 1OH6A 4LSGA 4M0LA 4X8HA 3QE0A 4LYFA 5CJPA 4LJ6A 4JLJA 5DO9A 2ZE6A 1DE0A 3HU3A 4BFTA 2ZRJA 5JHGB 4YMSA 4A0RA 4DCVA 4URVR 2P65A 1U81A 3OZXA 4R2IA 2YOHA 4KBFA 4DDTA 1YVDA 8OHMA 3PXGA 1CKEA 5HE8A 4XWOA 2C04A 2OLKA 3OF5A 1NBMA 3GLIB 3TQCA 1ODFA 2ATVA 3SOPA 1W44A 3C5HA 4LHZA 4URUR 5FUXA 3K0AB 4JIMA 1G8GA 1YZUA 4MH0R 1XMJA 4Z8XA 2GF0A 5H1YA 4URXR 3IGFA 1JAHA 3EA5A 2IX3A 4QHTA 1E9AA 4HUTA 4V0LA 1XCGB 2QN6A 3UMSA 4B3DA 1KMHB 2VL7A 5JMTA 5FPKA 2JLXA 2QAJA 5EE3A 1KZGB 2FN4A 1KY2A 1U98A 1SQ5A 1A5TA 4KVGA 2I3BA 4A2QA 3ICQB 4D4MA 2ZSBA 4HZUA 2BC9A 3C15C 5L8VA 2JJ1A 5JS7A 1F2UA 4LC0A 2MMCA 4GSYA 2BWJA 5HKKA 4DCTA 2DWPA 2XSZD 5EUQB 4KFRA 1V43A 1Q1ZA 3AVYA 2AFHE 2JJ2A 2V1UA 1JR3E 4CW7A 2G9NA 4KHZA 4QKQA 3TW4A 1DO2A 3VR4A 1TQ4A 1YR7A 1EGAA 2F1RA 5FOSA 4K46A 3V00A 1I4TD 3VAAA 3EW9A 4IDHA 1XFAA 4QNRA 3OEHA 1TEXA 1ZM9A 2QA5A 4NMMA 1EXMA 4XSGA 3FKQA 4G1UC 4JSYA 3T06B 2V7QD 2W6ID 2F9MA 3CBQA 3DO6A 2P3SA 4DB4A 3WYGA 1DEKA 2JLUA 1UKZA 4LBWA 1N0UA 3HPRA 4LYAA 1OYYA 4QHYA 4CEHA 2FPMA 1OV4A 4LJYA 5DI3B 3U7GA 1S96A 5HR5A 5IHPA 2D2FA 3OFNA 4LRWA 2O8FB 4X8OA 3T5DA 4C0QC 4TYNA 2JLRA 4RZ2A 1KKLA 2R62A 2QGNA 3OAAD 3CX7A 2JAQA 2IS6A 3P1JA 4NYIR 3AKDA 4L9SA 3KJEA 2YWGA 4HDQB 1HH4A 4QGAA 3OEED 4V0OA 2OCBA 1G8FA 1ONBA 3MRSA 3SYKA 4DLSA 1Z0FA 4KCGA 1ZJ6A 3QBVA 1CJMA 1WA5A 5KDDA 5L3QA 3KTAB 4Q4JA 3I5YA 5AK0A 5DHAA 3A4LA 2X2FA 4LI0A 3RS5A 4OK3A 3K0CA 2W00A 4BFYA 5CM8B 1LS1A 1ZNYA 2A78A 2BM0A 4RD1A 1Z6GA 2REBA 2JJ2D 2NO1A 2JIZA 2V54A 4Q1EA 2BVNA 4C0BA 2RB4A 2WKQA 3CF6R 3X1WA 4B76A 2HF8A 5DI9A 2FGJA 4IDNA 4D80A 1JXMA 3E1SA 4IXNA 2IF0A 3NDPA 1E9EA 1M2OB 1MO6A 3BOSA 3FE2A 3MLEA 3RRMA 1GSIA 1OKKD 3RAPR 2N46A 5FTMA 3PVSA 1Z08A 1GOTA 2J7PA 4B3BA 2UKDA 5GADl 2VYFA 4XTRA 3WMFA 2FWRA 3FFBA 4JLKA 4F4IA 1E94E 3MGCA 4EPVA 4Q4JB 2H8KA 2GK6A 2ZYTX 3VR1A 1IY0A 2VSXA 3BFVA 3NIBA 4A1FA 2XJ4A 1Q12A 1OH7A 3F8TA 2A5DA 2O8BB 1R8SA 3BS4A 4I4LA 2QP4A 2YC4C 1OPXA 2WWFA 3MUFA 1LNZA 1KI6B 2TMKA 4EPTA 4CIDA 2RCNA 4B2PA 3AVPA 2O8DA 1G7TA 2A7QA 2ZJYA 2WM9B 4W7SA 2JJ1D 1Z47A 3CF2A 4JS0A 3ZVRA 4Q9IA 3SQXA 2RGDA 5HKKD 2ZRNA 2R6CA 4M1KA 1NG1A 4HUQB 5HTKA 1E4VA 5ELXA 1HE1C 5E7IA 1KO5A 2F9LA 3GJXC 4Q18A 1Q1EA 5CK5A 2LWIA 4C2UA 4DDVA 4OJKA 2QP3A 1Z29A 2Z43A 3MJHA 2ZJZA 3L0OA 2W6JD 2ZRHA 2FG5A 5GVRA 1E2DA 1E0KA 2RGAA 1KMHA 1N2CE 2ZM5A 3KB2A 1T4GA 4OQMA 3OIWA 1W0JA 3X1YA 2V6JA 3U3OA 2W0SA 3CM0A 2OLJA 4TQUS 3K1JA 1AZTA 1GDDA 3A4MA 3A4NA 5DYGA 2ZS9A 4RD0A 3CLVA 1QG4A 4XTCS 1JQJC 1RFLA 3QG5A 1R5NA 2GXAA 1M34E 2CL6X 4M8NE 4TYQA 3B82A 3NDBB 4QGHA 3SS8A 2QEQA 2WMOB 1BOFA 4IW3B 4EFLA 4Q1FA 1F2UB 2IYRA 3FKSD 2XOKD 5B2ZA 1CR0A 4ZCLA 4XSHA 1ZCAA 5FTLA 1I4LD 3U6KA 2R9VA 1P75A 3QKSA 4E03A 5KU1A 2GJSA 2PJZA 3KKNA 4FMDB 5AJWA 2DYKA 1I4DD 3RVBA 1VCIA 1CU1A 3LY5A 3GFTA 2EFHB 3L0IB 3VX4A 4JKIA 2DWOA 3AEZA 3PUYA 4MGZR 4ESHA 4Q9LA 1N0WA 4A8JC 2QBYB 1HY3A 3CRVA 1TQDA 1EFRD 1JR3D 1QVRA 2DHRA 1JB1A 3AF3A 4ZO4A 3SE0A 4E22A 1GWNA 1ZRHA 1PLKA 3SJAA 2QY9A 3TSZA 3JZMA 2NZJA 2NO7A 5DLQC 2EYUA 1YU9A 4EJSC 3A1SA 1ZYUA 1G7CA 1L7VC 3K0FB 2R8RA 2F6RA 3BBPA 3W6NA 1JXOA 4A8JA 5J4KA 4QM7A 5G41A 3CR8A 2F1JA 5G3ZA 1LS6A 1FP6A 1D6JA 2D74A 1E96A 2DFKB 4PC3A 2PZFA 3U3JA 1K6MA 4FD2A 1EFCA 1UDXA 2BKUA 2XEXA 4KLZA 3EPJA 4ITRC 2NG1A 5KSPA 2XJ9A 4KSCA 4DXAA 1LFDB 1TL7C 4PHHA 5HCNA 3THWA 5FOUA 2IC5A 5FBQB 1FP7A 3PEWA 1E1RD 4DSTA 4DLTA 4C7OB 5EZ6B 1DAIA 5IF9A 4D0NA 3VNUA 4LHXA 3L0SA 1II9A 2N42A 4LCBA 2IEYA 3AH8A 4HLUC 5AJZA 1CR2A 1Q21A 1RKBA 2QNRA 1Z3IX 3L0PA 3RC8A 1YE8A 3C14C 5JWOA 2VF8A 3IEVA 2VP6A 1XF9A 3CPJB 4RKEA 4AC9A 1R0YA 1RRFA 3ZS9A 2GDJA 4M1OA 2IEZA 5LB2A 2R44A 4CF7A 2F3TA 4MKFA 1E32A 1UKEA 3B60A 2CCKA 4WVFA 4AYTA 1G7RA 1ZM3A 1MABA 2RKOA 2Z5FA 1P72A 2ASEA 3K0AA 4TMZA 2DBYA 2JDIA 4URZR 4WXRA 3RSOA 4HYYA 4A92A 1IY2A 1DG3A 1G17A 1KDPA 1KMQA 1NN5A 2YKGA 1E2JA 3TSOA 3RHFA 3A1VA 4MKGA 4U7DA 1F2TA 1VMAA 4LV6A 4BEJA 1YZNA 1AIPA 3CX8A 3AVTA 1V5WA 1ZVQA 2CHGA 1W0KD 2WJIA 4B34A 4ZDWA 4HB3A 1DAFA 1PUJA 4ZCIA 2C03A 1R5OA 3ZGXA 4CT5A 4D82A 4BLTA 4PHTA 1ZMXA 2EFDB 3QIAA 5CLQA 1S4QA 1P60A 4POAA 1KI1A 1E2EA 5A0FA 1GILA 2C96A 1AZSC 4CRWB 4DEYA 4JLMA 3MWLA 5IK2A 1VPLA 2RMKA 2FOLA 4BLQA 2DCUA 2FNAA 1J7KA 2GNOA 3IIKA 2PL3A 4G5RA 2W2TA 1FMJA 3RANA 4B73A 1KK2A 5F9FA 3I1FA 4IOJA 1QG2A 3CONA 1NKSA 1XXHA 2WAXA 2QG6A 3Q85A 4NYMR 2ZTSA 5HE9A 2REOA 1II8A 3K09A 5AUPB 4DCUA 1CJKC 4GP6A 3PEUA 4M22A 3VNVA 1ZNXA 4KFUA 4LBZA 3E70C 4PPGA 2YHSA 1XEXB 2OCYC 1J2JA 1ZIPA 3OESA 4LBVA 2ODBA 1COWD 3R8CA 3GP8A 5BWMA 1FFHA 2WJHA 4X8LA 1F2TB 5EP1A 3R9WA 5DH9A 1DELA 1I2DA 1P73A 3CO5A 1GL9B 1Q44A 4Y0AA 2OESA 2XOKA 5J4HA 4PX9A 4RZUA 1K5GA 1TF2A 2FMXA 4ZDJA 1KSJA 3KFXA 5JHHB 3CWQA 3DMNA 2WZQA 2NMVA 3FHOA 2UZ3A 4KYIB 3TW8B 1KO4A 1N6PA 2O8BA 1TF7A 3EA0A 1Z6TA 1N6RA 1W36C 1SZPA 4OKSA 5L3QB 5CITA 5J40A 1RC8A 2VHTA 3EPKA 1U2RA 3KXKA 1KOFA 2ZPTX 1BO6A 4Q02A 1RPZA 4JLOA 3ZYCA 3UWKA 1M7HA 6Q21A 4ZIRA 4JLNA 2EQBA 4JLDA 4ZDIA 1T8TA 1P2UA 2Q3FA 4HDCA 5E4FA 1XP8A 4HAYA 1ZD9A 3DZ8A 4HLQB 2RGNC 3R9IA 2BBTA 4OHZA 4P32A 3IDQA 1YZQA 1XCPA 3LX8A 4UNQA 4TT3D 2PT7A 4OHYA 4AKGA 2CJWA 1ZM7A 2FPLA 1W1WA 3F3YA 3MSXA 5D3MA 2P5SA 2AWOA 3EXAA 2WJVA 3KJGA 4Q7LA 1LTQA 5AJVB 1N5IA 5FL3A 4EKDA 1GAJA 1LY1A 4JKYA 1TADA 4M1TA 2QRNA 3CZQA 5CIWA 5FPYA 2QI9C 1DTSA 1GRQA 3KUDA 3E2IA 3QQ5A 1FTSA 4UXJA 4MGIR 3TBKA 3AVXA 1QBKC 4D4JA 2GESA 3DOEA 5JWHA 4QL3A 5LBIA 1NL3A 3THWB 3I62A 1KJWA 4OI2A 2OT3B 1AA9A 1E79D 4IJMA 1E9RA 1E1QD 3P4XA 4D4LA 2KWIA 2QMHA 2WJJA 1W48A 3I4LA 4PPQA 3BGWA 3UMFA 2E1RA 1OKKA 3LH5A 3MFYA 4IOLA 2DWQA 3RSLA 1XEWY 3AGQA 3DL0A 4UJ5A 5K8IA 3I5XA 2ZAOA 1NP6A 2ZS7A 2FEOA 3IQWA 4NU0A 4Q4LA 4BFUA 5JSZB 5DHFA 1KO8A 3CZPA 1S2MA 2ZVPX 1E1RA 3P4YA 3BB4A 2EVWX 2FFQA 1P2SA 1HT1E 5AUOB 1GRNA 1R8QA 3O8CA 4TQ9A 2VRWA 1E0AA 5C4MA 3ZQ6A 3DEFA 2ZE8A 3FHCB 1HE8B 5KSZA 5BQ5A 3T1VA 4IEEA 3H84A 1LW7A 1UEIA 1NVVQ 3LA6A 3WP0A 2Z6VA 4MUBA 5FUYA 2AK2A 2FFHA 3K0CC 1RRPA 1T3SA 1XTRA 2WPDA 4DHEA 1JPJA 2WSMA 2CXXA 3GJ7A 2V7QA 1G5TA 3KZ1E 2A5GA 1JI0A 2QBYA 2J46A 1ESMA 2BV3A 3T61A 1EG7A 3TK1A 2A3RA 1HTWA 1XDBA 2GAOA 2GCOA 4MQBA 4B3CA 1N0VC 4MDFA 1NMZA 1IXSB 1G3UA 3I3SR 4LYHA 1A2BA 2YWEA 4UNPA 2HF9A 2LKDA 3TUZC 1XBTA 3A58B 4PZYA 1WP9A 5AUQA 3TKLA 3ASYA 2QAGA 1F5NA 2ZRDA 2LCFA 3K53A 4TLEA 1OLOA 3CPHA 1GTVA 1L4UA 2BMJA 4UNNA 1IONA 2FSHA 2F43B 2JLWA 3FHTA 2KI5A 4GP7A 3RS7A 3IIJA 2R6DA 2XSZA 2MSDB 4MYCA 4ILEA 2HCJB 4PR0A 1VYVA 3ZH9B 1YR8A 3SEAA 3GJ6A 1U0LA 2GAAA 3ND9A 1TF5A 4NYIQ 2PH1A 4HDOB 5H8WA 2IYUA 4Q1DA 5FOTA 1GP2A 3D7MA 4KXFB 5JZVA 2SHKA 3GLGE 4NYMQ 3NH9A 3EIEA 2J7KA 3UKDA 1U8YA 5TV2A 2BIFA 4JL5A 5TDHA 1ZBDA 2B7BA 4TL9A 3AP2A 1UKYA 4CEIB 1Z22A 2Y8EA 2CCJA 1N3BA 5CDFA 1XWIA 3ZVNA 4LUCA 4TMKA 1COWA 5FL7D 2Z83A 4TN1A 1OT3A 1J90A 2QE7A 4I81A 1MV5A 4TL7A 1OHHD 2F3RA 4QG7A 4YC7A 2FA9A 4EIWA 3LAWA 5CJ2A 5C2JB 4QC2A 4B2IA 1G1MA 2E9SA 3GJ4A 1Z5ZA 2BBOA 1WRBA 4E07A 3A37A 5EXTA 2OZEA 5EUMA 3NHBA 3GLHE 4RCZA 5FPTA 2ZI9A 2IXFA 3IEUA 2G88A 4AKHA 1P2TA 1QHXA 3DZDA 1CP2A 4Y0VA 3TNFA 1W4BA 2HXYA 4IKEA 2YZ2A 4UKDA 1T0JB 1MKYA 1OSNA 2V6IA 2WOJA 3AP3A 4ZV4A 3OIVA 3LLMA 3CF0A 3BAFA 4B43A 1T91A 2ORVA 4L4UA 4ZPXA 2ZU0C 3IHWA 2A2ZA 2HYDA 1UBCA 3A1WA 3AUYA 4HEJA 4D25A 4NCJA 3T34A 1X8JA 1ZCBA 1ZIOA 2VP5A 1HUQA 1SVWA 1MABB 3LBHA 3VR5A 4B2LA 1II0A 4E5UA 4RSGA 4TLDA 2D3WA 3CH5A 1IN7A 4DWJA 1WXQA 3B5JA 3PENA 2QUZA 4DLXA 1VHLA 4F7WA 2Z4RA 1OIWA 4CEJA 3GLFB 2AKYA 4IDOA 5DI3A 3MCAA 4A4DA 4R71A 5EJEA 4GRAA 2NIPA 4MYHA 3RABA 2WJYA 3VTKA 1LF0A 4JSTA 1JR3A 1EFRA 4RJLA 1BMFA 3UANA 3O8RA 3MWJA 3LBNA 1VTKA 2HCBA
chains in the Genus database with same CATH superfamily
3NALA 2JGDA 1HDGO 3HM9A 2JJYA 4B6SA 1JAYA 4ND4A 1WXFA 5K51A 1OWOA 3IT3A 3WYFA 2QXTA 3CO0S 5CM9C 1O87A 4DXAA 2OAP1 3NR2A 2DC1A 2JZNA 4P4GA 3HDHA 4PWYA 1FQWA 3HA3A 1K2VN 3GNLA 1VBKA 2XGGA 1PD0A 5HKAA 1K6EA 3BMQB 3LDAA 1F14A 3CS3A 1VCOA 1DHRA 3GBVA 4Y67A 1XMVA 2VSOA 3O9VA 4EW3A 2P11A 3FPKA 4C0XA 2AEJA 4MCAA 4HNAB 1MT3A 1UMDA 4KIWA 2XBUA 3GJZA 4JLBA 4A3SA 4IIBA 2QLNA 2FZWA 4J0CA 1EYZA 4CQLA 4X90A 3EFHA 3P26A 4QRIA 1NI4A 4Y6PA 4DC0A 3DW1X 3GDFA 4BQEA 5KHOC 4B6EA 4HH0A 4K9LA 4E4RA 3DZHA 3GEPA 4L9RA 2HJRA 3BK7A 2RC5A 1V7QA 3L1KA 5KNCH 4DEXA 4P80A 5H3CA 1CZOA 1FVOA 3F78A 3UY4A 1V41E 1JT2A 4MPTA 3EXIA 5HFJA 4EP1A 3TBFA 4MQLA 2OHIA 3FYUC 2OSVA 4MUEA 2CLLB 2PAFA 3QWBA 4Q21A 3UK0A 4C06A 2IYXA 1N5KA 3I6BA 1W52X 2EOAA 3N86A 5F5NA 3ZHUA 4EABA 1YL5A 3RFFA 5GJBA 4WAUA 1B0ZA 1WD5A 1VE9A 1W19A 4R1MA 1N78A 1ISGA 1KY3A 4YRZA 1Y5MA 2IXDA 3V4PB 3NTUA 4BMXA 4L5BA 4EQZA 1NVDA 2O5RA 4BGUA 3GJ0A 1PGNA 4L9WA 3D9QX 4U2DA 2O5VA 4ZRNA 2R6R1 2GEJA 5IBCA 4LJ5A 3FYUA 4C4AA 5FBLB 3RFVA 3IHKA 2PUCA 1Z6XA 3ADDA 1SHJA 1SBHA 1YS4A 3OX1A 2ZYWX 3HLKA 1KFCB 3URKA 2XA1A 3SIXA 4U02A 1RHUA 2AWNA 4N49A 4AY4A 5IN5A 2RBKA 4HDMB 3UGQA 3BWMA 3W34A 2X76A 2XGSA 2BR3A 1FVXA 4L2IB 4BX0A 2Q0HA 1JAZA 3OQHA 1NF3A 1U8CB 3NLLA 4A5SA 1UPTA 2MR6A 5B3JC 2H1LA 2UVPA 1F3LA 1EE1A 3GLTA 4GQAA 3RYTC 1QKJA 3IP5A 2G9QA 3NATA 1QYIA 4LJ7A 1I3LA 2B78A 2B34A 2AV6A 4KQIA 4MOWA 4FD3A 4Z5XA 3TUIC 2O3RA 2PMFA 4NK4A 5DK6A 5E9WA 5AMXA 1S2NA 3KT3A 3R3SA 4EMBA 3IKJA 5IRCD 4KODA 1LRJA 3V33A 1SD1A 1ML3A 3L4SO 4KO4S 3AEQA 2WFAA 4NRDA 3PK0A 4M7OA 4P5DA 5D7NA 3WLFA 1CUFA 5JBNA 1Y42X 2A6PA 1KFKB 1WZ2A 4X6XA 1REQA 1OWPA 2PZ8A 2XOEA 3MK31 3UXYA 5AK3A 2Z2KA 1Y8RA 3S99A 4J3JA 3QJGA 4A03A 3D6JA 2VP4A 1ZD2P 4O5AA 2ZW9A 3OTQA 3U7QB 5CX1A 2QN1A 3O95A 2MSCB 4EH1A 4QIHA 4B7AA 1HETA 2NPIA 5JARA 2R7AA 5CLJA 4UTNA 2B8JA 3F5FA 3EASA 2P4EA 5LCXA 3FWZA 3IMCA 4QNMA 3VSEA 4WBNF 2FPIB 2EARA 1Z15A 1EVYA 5G4LA 4AULA 5JPCA 3LP6A 3LBIA 5JTUA 2IIPA 1KP3A 1Z5VA 2JGMA 3NC4A 4O25A 5IJAA 4A82A 3N1UA 5HK9A 1V8OA 2WINI 3PZRA 4KOEC 2WILA 3OY7A 2OHXA 3ANNA 5HJ5A 5JNVA 3UB3A 3NHWA 2RGRA 1XHEA 1U28A 3KYDB 3NAGA 3DOFA 4N54A 2BTQA 4OP1A 4OYRA 1I2CA 3W5HA 5IVPA 4NEQA 1JECA 4LFAB 4J2TA 3AR5A 1Z73A 1U5BA 5E38A 5JNRA 2FZLA 3KRTA 4K26A 1CERA 3HVJA 2C2GA 2SKDA 2WT8A 4NZPA 1E69A 1I7QB 4YT2A 2XNHA 1DV1A 1D4ZA 2YXPX 3B8EA 5BUZA 3SWWA 4Y18A 3WIEA 2SCUB 1Z6ZA 2ZQYA 1B76A 5LMCA 1R6AA 1W88B 1LSJA 2B92A 3ZBPA 2C82A 3VSDA 4MP3A 3FCAA 1SKQA 2JPDA 3NCTA 3DWFA 3Q3HA 2SKCA 3ESBA 2Y05A 3JQAD 3D3KA 4GLLA 4P4NA 3BXHA 2VBGA 2WJAA 2AL7A 5FYDA 1K1EA 3AXSA 1MC4A 5AKYA 3ED5A 3AUKA 3ZE2B 5GVSA 3D8TA 2ZI6A 3JWPA 4G0VA 3U1VA 4Q4CA 3QXSA 3BH6A 3KJNA 1RE0A 2IYVA 3ZKWA 1J00A 5BP7A 2XMCA 3AIIA 3ACCA 3C6YA 4L15A 5AQEA 3TR6A 3TTXA 1DS6A 4BXOA 1CX9B 3N70A 4CI9A 1O6CA 3L2OB 4C3OB 5BURA 1OH5A 1ZW1A 4DQDA 1T1IA 4I9UA 2FUCA 5IVKA 1RQXA 2CL5A 4EITA 2EFYA 1CEXA 1FUIA 3O91A 4NEGA 1QO0D 4QJ5A 4W82A 5JAZA 2GUGA 1Q19A 4F5EA 3NYWA 1IZ9A 4EFKA 1HZZC 2WHYA 2NT4A 4MI3A 1NFQA 2V7PA 4QOSA 5IP5A 1H66A 5J9FA 5EJ8A 3ZWNA 4HDRA 3A9WA 2KYRA 4GMKA 5EMKA 1Y7TA 2OZVA 4MWZA 2JJMA 5IMSA 4ZZ2A 4M49A 4GO1A 3BFJA 3HV0A 4XJXA 4CMJA 4R2KA 4WA8A 2H07A 3HDTA 1RMYA 3JQ9A 3W9YA 1NHGA 4LXHA 5COAA 1W1IA 1JA0A 1J8DA 4Q03A 4B6GA 1Z83A 4AJ9A 1TVEA 3GAMA 4R2XA 2RH8A 1H42A 5A6SB 5JH7B 2WTNA 1T2CA 3IERA 5KOHB 4FILA 4QE3A 3VBCA 2BT4A 4AUEA 4YRBA 5FQNA 2RAFA 1JBKA 1HXHA 3A1DA 1JQLB 2C5FA 3AHGA 4NMLA 1DADA 5GOZA 4E1AA 3K9FC 2FW0A 1H2AS 2X4GA 4B35A 1WNTA 1GQFA 1XEXA 1H22A 2RGUA 4M4SA 5MN6A 3AV0B 3HJNA 3U3ZA 1WD7A 3VJMA 1N2GA 4YXWD 3DKRA 3RWOA 4QQ8A 1NURA 4OHZA 3WK8A 4ENUA 2OQVA 3PPYA 4BMDA 2OO3A 1WXEA 2PMKA 2YZNA 3UQYS 3WBKA 4B85A 3WBBA 2ZYGA 2Z6QA 5KQMA 3PHJA 1O0SA 2Q4TA 2WWTA 2YC2C 1CQJA 1W85B 1ZK1A 5AOVA 4P1ZA 5EAIA 4BL5A 3LI2A 1THTA 1JEAA 2QRKA 1N32B 2B82A 2P79A 4MAFA 2UXCB 2BDEA 3QFTA 1Y6QA 2VHYA 2IDZA 3KQYA 1E7SA 3INNA 1K5DA 3AY0A 5A5GA 5JROA 5KNCD 4OAOA 1OYVA 2PR7A 1RXUA 1YMQA 1AXRA 2EQ5A 3B1WA 4TYYA 1EFPB 2YJTD 3O4GA 3PC7A 4R6XA 1LNQA 1P9RA 1CRZA 2H59A 4NZMA 4RTJA 1Y1PA 4IJVA 1DC5A 3B8HA 3Q8WA 2X6TA 2ACWA 2CXSA 3RQIA 3DP9A 1ZXBA 2WICA 4RY8A 4YT5A 4CGZA 1P2VA 5AHRA 4JEMA 3KOZA 4F60A 2ZKIA 3A05A 3NTVA 2ZIWB 1FSZA 2O0HA 4NG5A 3T5GA 4DLNA 4EBFA 3KL2A 4DR4B 5BY2A 4JEUA 4D4GA 3N2YA 1BHQ1 4P33A 3T0IA 4GPBA 5KYYA 1Z5NA 2Y0PA 3H1GA 2F8MA 3EVZA 5HUQA 1E9FA 2IPMA 1M0EA 1J23A 2ZRLA 5FR1A 1DBPA 1RBYA 1ZUNB 1XDUA 5AW4A 1G9TA 2GYYA 4A36A 5DHQA 5LR6A 1ICEA 3VFDA 4ZEVA 2OR3A 3ESRA 4ZO6A 3SC4A 3VR6A 3LIPA 1HYHA 1DO8A 2BFNA 4IFBA 4HWGA 2Z04A 1SHZA 4QU5A 5DASA 2GZDA 3WIUA 4N7BA 4HAUA 4DMFA 4BAGA 1ILEA 1NSTA 1C7QA 3DJFA 1CY6A 5LD2C 3Q9SA 3S2SA 2VF7A 1JPUA 1CR6A 2RHGB 1MX3A 4RPGA 3VKWA 1AZWA 1WF3A 3HH8A 4QUDA 3A6KA 1EK0A 1ZD4A 2BW0A 3IDZA 4YRMA 1ZSNA 4RY0A 4R9UC 5HZHA 3ZJYA 3E4DA 4P7KA 3BJEA 3ENVA 3EQZA 3L5OA 5FNVF 2R6AA 2YASA 4XOUA 2X86A 4MIOA 2ENWA 5GJWC 4PEVA 5B64A 2Y1XA 7GPBA 1SXIA 1UOQA 4GNKA 2V55B 4RVDA 5LZ9A 2F1OA 3ZIAA 2I0FA 2HX1A 3AIOA 4XVCA 4ZMSA 1M7GA 2GA9A 2HI0A 4KDRA 4Y98A 1O57A 5JCPA 1UFKA 2JJ8A 2FPIA 1LH0A 4RZXA 4O4IA 5JI3E 2J5XA 1H8HA 1SB9A 1VIYA 4B84A 1DJPA 4JJGA 3RIHA 3WMXA 1JH9A 1JJVA 3O6VA 1RZUA 1IB6A 2ZJ8A 4J0EA 1Z62A 4LVNA 4UJ3A 1OZFA 3SICE 2QVLA 3TNLA 2IHYA 4RFSA 4WESB 3PDIB 3TECE 4KVAA 1CNMA 3SBEA 1A9XA 3K2IA 1I80A 3HEMA 5KKCA 4AM8A 4ESOA 3VHLB 3QVVA 2FSFA 4C0JA 4TOIA 2UZ1B 1NQXA 1D1QA 4BZPA 4P4TA 2IXEA 1NLZA 3GMDA 4YQFA 4BU1A 4QYIB 3K35A 3BPSA 1EBFA 3ZDCA 2I5PO 4BQIA 4F9FA 4UUOA 1RMTA 4GZMA 2Q6TA 2ODTX 2OE2A 2V3VA 2Z1NA 3DC2A 4FYWA 1YQEA 2H1VA 3Q7TA 5K0JA 3K70C 2G25A 4ZAGA 1Z07A 2XCLA 1E20A 4DCOA 3DSRA 1DXYA 4INAA 2B0CA 3NG1A 1FSGA 5KPDA 3UB2A 2Z2ZA 2J48A 4L6CA 3EPHA 4G24A 3RAEC 3X1JA 4MCIA 1IAQA 3EG9B 4Y7CA 5CDUA 3KT0A 3PD7A 3QLUC 4TLCA 3CVYA 4X95A 3WHLA 3SHTA 4C2TA 1DAHA 1F06A 3OCVA 3QKSB 2FWAA 1SCKA 4K3UA 3EQ8A 1CHNA 2W2VA 1GTL1 3F4LA 4JI1B 4DQVA 1BWQA 1RXCA 2I9KA 3T15A 4NDAA 1L4HA 5FB3A 1KZ7B 3O1HB 1GZ7A 5I3CA 2X2PA 2QKYA 3WQHA 1TJNA 5JCZA 1U1CA 4L73A 1KQOA 3EGDA 1W6UA 4NYJQ 4QUJA 4B8YA 4BVAA 5DTEA 4XYLA 2X5XA 4YJHB 3SQDA 2ISCA 4LY9A 1B42A 1TM5E 1UCFA 4W99A 1DAEA 4D9JA 3OOWA 4M1MA 4G1MB 1BKDR 1Z0JA 4RHFA 3N07A 3EK2A 4B80A 5JFOA 4U2FA 2GZAA 4LJSA 5AQ1A 1TC1A 3R8FA 3EG5A 4MRSA 2C95A 6LDHA 3I8OA 5F5LA 5AKGA 2XTNA 1UBLS 3FWYA 3CSUA 3JZFA 1JTEA 1LV7A 1LZKA 4N0MA 5DB4A 3BE4A 3WLTA 4ZJUA 1V95A 2G1JA 3HJFA 4KMRA 1J25A 3C98A 1G21A 4YMVA 2UYHA 1IZZA 1NI4B 4QELA 4UHBA 2AOUB 2HD4A 5BW6B 1E1CB 3R4CA 1G3IA 2Y6VA 4MVJD 3T12A 2CFSA 1A27A 2VDWB 3R3WA 3PNYA 4OHBA 2W2MA 3DBRB 1E98A 2I3ZA 4JI4B 2GUWA 4B33A 1SOUA 3L8EA 3WA6A 3WNCA 1ZI9A 1FDUA 1W1UA 3GG9A 1FB5A 2RH4A 2IKSA 1GFZA 4TYMA 1DFHA 1OBFO 2D5IA 2RHRA 2VR1A 3GFQA 4WMLA 2I87A 2X41A 4Q1AA 5DHPA 4PGFA 1DAGA 5F78A 1PQ4A 1HNXB 2YHUA 1C30A 1ADCA 1TM3E 2QJTA 3DBHA 3T3PB 2F1IA 4DSOA 1XRLA 3UT6A 1YDMA 2OFXA 2ORWA 4RIGA 4DKJA 2OHGA 1U1GA 3FNQA 4OHOA 2C2BA 3WYBA 4ZC8A 3ZJ4A 1DJNA 2ZXFA 4FFLA 4NZYA 2HREA 5I7AA 2BH2A 1K06A 3DQPA 4FHEA 1HLFA 4KDFA 4HQKA 3BF8A 5CP8A 4ZIRB 3M8KA 2DUNA 2XYQA 1YJ8A 2EJWA 2W37A 3RFXA 4JUFA 1IHDA 4OI1A 3H0CA 3K6SB 4IIYA 4ZGBA 4J16A 3TQFA 1IEXA 1CDDA 3C8MA 4J90A 2FEXA 4F4UA 1T13A 3NEYA 4TLAA 4YMHA 3K70B 2XXAA 2EF0A 2GZHA 3LXRA 2EKLA 2UYCA 4EB3A 3RNLA 1X8XA 1KC3A 2WYIA 2FHPA 2DPMA 2R7NA 2EKQA 1MC1A 2Y1DA 4Q3KA 1XAJA 3W4JA 4G5OA 1VRWA 3V8PA 3DBHB 2ONZA 4KAAA 4JI8B 1ZOPA 1JFRA 1T36A 2GTHA 5AVVA 3CZCA 3DDZX 3PGLA 4U8HA 4WK2B 1ISIA 1VCMA 3PRYA 3AF1A 3FTPA 2TECE 1CUEA 1W6RA 3FMOB 2AMJA 1JHPA 2RBGA 3D31A 4MZXA 2JGJA 2UUBB 4PICA 4DDWA 2I4TA 4TMWA 1XVAA 1QZUA 2GILA 4ZVUA 4JLSA 2QX4A 3KSRA 1YZGA 3BM5A 2ZIXB 4ZV7A 4R1TA 2OXCA 4QVIA 4FNOA 3ZI4A 2BDTA 4YLGA 2VA8A 4C0HA 4RVHA 1R66A 5DTRA 4ZAWA 1DKMA 2HPHA 5B30A 5BV0A 2XE6A 4NFLA 4P3XA 1BX1A 3C3BA 3PQ3A 4EHKA 4ISBA 4OI0A 2HW8A 2WPDD 4LJ4A 1L7OA 1S6YA 3QSYA 1SKYE 3ZGZA 2HTFA 3FDJA 3GEIA 1Z7EA 4LXGA 3T38A 2WTEA 2ARKA 3HUFA 4UHHA 2RGYA 2PRIA 2HWUA 5BRNA 4D3YA 1Y6GA 3GD7A 2QN8A 3FRJA 4DYHA 1NQ5A 3UMBA 3LHKA 4F45A 1TUGA 4GPIB 4Q4HA 1FFCA 2Y0BA 2YNMC 3ROXA 1L7QA 2CC2A 2PUJA 3SC3A 5KYTA 1TM2A 1B4DA 5D2CA 2Y1LA 4QA9A 1ACJA 4G5GA 1KOJA 3P0FA 3K2BA 2H1FA 1Z8FA 3VYSB 4IVQA 2ZG6A 3RT7A 3FYCA 3KAPA 3MYRA 2Q6LA 4UTOA 3WNVA 1QH1A 3QKRA 3O0TA 1DWPA 1A5AB 4BCCA 3OO0A 3O8NA 4Z86A 3RQSA 4EA6A 2ZJ0A 2GYVA 1NRIA 1O0BA 2I7XA 4QZVA 2J41A 1RQ2A 1PX2A 4HTFB 4COKA 2PD3A 3UAGA 4C2AA 1WSDA 1T5IA 2A1UB 1C5KA 4D96A 2YJ3A 2C4UA 1U02A 5IJWA 4BGVA 1A8PA 3FG9A 1HTTA 3ADPA 4PONA 4RVOA 4Y9RA 4WK6A 3CURA 3T5TA 2I3AA 2JHFA 1W7AA 5E2AA 2HF2A 4NBRA 4AZ3B 2P2CA 1BHSA 2RGEA 5K20A 3GLFE 1DXOA 1W36D 2G4VA 2LGJA 2VAPA 5K8UA 5TRTA 5JCXA 3KJFA 3D4OA 4B47A 2FF5A 3UT5B 4TKVB 5JSKA 4K6OA 1FZQA 1HNZB 1JEEA 1Y63A 4GLBA 3TH5A 1M2EA 5EZSA 2PBZA 3USCS 3QJ5A 1ADBA 1MB9A 2Q1WA 4LHSA 3C3EA 4PZLA 3M6LA 3TB6A 1OXXK 2BJWA 3I73A 4HADA 4RTQA 1TU0A 5EQDA 3BMOB 1QVWA 2WKRA 1W49A 3I04A 2JH8A 2WC1A 4PCLA 2WM2A 4PC2A 3VBEA 5LBTA 3DHVA 2X0RA 2AG1A 2GCOB 4KQGA 2C7BA 4ACAA 1ODTC 2CB9A 3CVJA 4HLCA 5C8YB 1GFIA 3D64A 4CLOB 5JSYA 3T7AA 2ZRPA 1JIKA 4FDLA 5GMOA 3KQLA 2J0SA 4XUDA 1TAGA 3E22A 1HSZA 2QZZA 1IEQA 1VYTA 1IJKA 1BH2A 1UMKA 3C5EA 2AX4A 3L7AA 1QYVA 1G3QA 4I3GA 2UXDB 1VPWA 3G0OA 2UYOA 4KG7A 4EJ6A 3TJZA 1XZLA 3AESA 3M49A 2H08A 4G4IA 5FLYA 5C52B 3CRNA 3M0EA 4L4ZA 3TI9A 1TM7E 1JBQA 3ZE6A 4TVSA 4KLCA 4UM8B 2FF7A 4RL6A 3EYAA 5FUWA 1RRMA 3QUBA 1ZP6A 4OBBA 4PFKA 4PPNA 3CEJA 1RZVA 3R0QA 2CN1A 3WGOA 3L4JA 4Q66C 4ZFNA 3SDZA 1KEEA 3HCAA 5CXUA 1YRLA 5CDSA 5HRAA 3WBJA 3AGPA 4BX9A 4P86A 3FWPA 1ZD5A 4QBTA 1T43A 2GKSA 4ETMA 1TGYA 5T6MA 1K5PA 2W6QA 4HEA1 2FE4A 2AQIA 2ID9A 3IDFA 3LHFA 2XTAA 3CY6A 4DCMA 3AKYA 4XD7D 5CH8A 5CYOA 5IXSA 5B1EA 5F1PA 1TYDE 3LSTA 3PRJA 3TGLA 2XCUA 2RKBA 4M9RA 1U2DC 3MTQA 1L9XA 1YFJA 3ANYB 2Y71A 2IBSA 2QZ4A 2NSLA 3I9NA 1GEGA 4C4TA 3ACDA 5JXHA 3F0TA 5CYPA 3VV3A 3ZU6A 3HACA 4CV2A 3U3DA 4YRAA 3U1BA 3RTBA 4U00A 1Q0HA 2QG9A 5KYYB 4M36A 1MZVA 2OBXA 4QU0A 3R7DA 1NC3A 1NUHA 2XGMA 3EDRA 3QYPA 4TLMB 1LZLA 1KIFA 5L45A 5JUWA 1B74A 2J32A 3I04M 2RH5A 4R1LA 4WA7A 3VYWA 2R96A 2ZT5A 1EVJA 1TB4A 4W1RA 2HIHA 3UOAB 2QTCA 4BKOA 5TNXA 2ZREA 4AP9A 4ES6A 5AO9A 1AO0A 4EY4A 3IDOA 3QW4B 1T29A 2GN4A 2L42A 4F4HA 2HGSA 3PXBA 4GD3Q 4FFBB 2NW6A 5JO9A 5TS3A 3BIFA 3QUTA 2V6MA 1T3HA 3GJ8A 3LIIA 1DARA 5E7JA 1G18A 3UPDA 5AM5A 1H2EA 5L4SA 4AQYB 3E6AA 3VI4B 4GBED 5D3ZA 3J81A 2AJBA 4D9MA 3N2LA 1BX3A 3MJCA 1Z4MA 2XDQB 4URFA 5I7FA 2ZYAA 2PS1A 1YFZA 2YQ5A 3F9IA 4MA4A 5FRDA 1FDTA 3OMLA 5FA5A 3KTOA 1I4OA 1L3CA 3URMA 4EZEA 4B3SB 4L3WA 3EEIA 4NPCA 3K5WA 3F5MA 1E7MA 3SBXA 2BEWB 1R0SA 2UAGA 3VR4D 4E6PA 2XCIA 3MMSA 3OOHA 1TJ3A 4GS5A 2CXPA 3UO8B 4Z1MD 3VU8A 1FSFA 4ZYWA 2DECA 4FGZA 2W58A 1EVQA 4EVIA 5DCLA 1GPAA 1OZHA 1EI9A 2NO5A 3ROGA 3O3MB 4OQFA 4BC1A 2NYAA 2D0DA 1WDTA 3COVA 4QU9A 2H7VA 3H87A 3I6IA 2J3EA 4UBLA 2QN3A 3S28A 3KM0A 1M6WA 4QQRA 4XOIA 2J9YB 4GZ6A 3NYQA 1HE4A 3UA4A 3N2NA 2J9FB 1Q2XA 2QENA 4NZNA 5CYFA 4D4IA 1VCHA 3BJIC 4Q19A 3RSFA 3VNSA 1ULAA 5IJXA 3JVIA 3HG7A 3PHBE 5ESWA 1ECJA 1OJLA 4LX0A 1E2KA 1NM5A 2KE5A 3VVCA 4IJ6A 4OQYA 5IK2D 1CPYA 1C4OA 1QGUB 2GK3A 2XYPA 5C8ZA 1TA4A 4YRDA 2AHOA 4R8SA 2GARA 2D1TA 2BONA 3HN2A 4ZOAA 3KSUA 2AN4A 4DFDA 2ZUUA 3EIHA 5KTKA 2VTDA 1X86B 3HJTA 5T3UA 1UMCA 1KJNA 4WHMA 4JI2B 5LC1A 2D5CA 2PEZA 1U2GA 2IYEA 2QUJA 3PI7A 3N5KA 4O2RA 4JJZA 4C3VA 4CQMD 3K8OE 2B4TO 4KWIA 2G3YA 4GFDA 4ML3A 5GP1A 3TLXA 3HCEA 3W1EA 2ZIFA 4MWGA 3PVCA 1CS4C 2C88A 1RADA 5EL0A 1JDBB 4HQ0A 1UQTA 3LQ1A 1ZA1A 3O2SB 4PYIA 3WWEA 3Q3GE 3JD2A 4YRPA 4LISA 4LK3A 1OVMA 1N0HA 1X1CA 2I2XB 1NXQA 3ZNPA 3SFZA 1VL1A 1NJ6A 4K6MA 1Z74A 1CVRA 2AI1A 3I5MA 4Z1MA 2XLCA 3B78A 2WQZA 2O8EB 1NWHA 1E6UA 2EERA 5CMLA 3ASVA 2KJQA 3MCZA 2H7XA 3UJHA 4OFXA 1R0XA 1L5ZA 4N8SA 2IZ0A 5CVDA 1W0JD 4RTLA 2FRXA 2LR0A 2IITA 1Z6YA 3DNPA 4BX3A 3ZY6A 3B7WA 1XJ0A 1T1GA 3JAKB 3TF5A 4WPGA 4X0EA 4JLAA 1OE0A 2RD2A 4X7BA 2Q2OA 1UBSB 1CEYA 1NFRA 2ZJFA 4J8PA 3AILA 1PNOA 3GUUA 5CX4A 3DGEC 2EX4A 4AUNA 2XMDA 1AUPA 4IIVA 3H3XA 4C5BA 4IKOA 5ER9A 1SZJG 1GR0A 1W93A 1PNTA 4I2VA 4OHXA 1XO1A 1YR6A 2MYUA 2X0NA 4YUAA 2CZQA 5J5AA 1DOHA 1QGAA 3RSZA 1E1QA 4OP2A 1RSZA 3CUWA 1QH0A 4DOMA 3D0RA 2B5OA 1BHJA 4Q47A 1KR2A 1G8JA 5J2UA 1SU8A 1Z6AA 5BN1A 2IUUA 2FWNA 2QVGA 1PL8A 3CU5A 2ZUBA 3I6QA 4KN6A 4LNAA 1N36B 1N6OA 2YFHA 2HQBA 1H05A 4F3YA 1E4OA 3RU2A 1LDGA 3BGOS 3VKUA 1IZ0A 1EX9A 3GPCA 1KP2A 1QHNA 1U0FA 3KYDA 2FAXA 1IG0A 1UC4B 5C5IA 4CKCB 2P78A 1U0NA 1KMNA 4OQEA 4QQFA 2QDKA 3U37A 3JYLA 4ZREA 3ZWPA 1GKKA 1QFJA 3GVXA 3ZU5A 3W3AD 4DLUA 3MBOA 5JI2E 2FK8A 2NO4A 1OI3A 2DPHA 2H1HA 3GL9A 4HXGA 3PTZA 4GDFA 2I80A 3JYNA 1GKUB 1F4LA 2DG2A 4KN5A 4FGUA 4I1IA 2RAVA 4DIFA 1NYRA 5E1DA 4Q93A 2GBLA 1Q0ZA 4Q9JA 2QAGB 4G0UA 1QHHA 3KWFA 3O26A 1G19A 6CHYA 4FPXA 4KXVA 4XKJA 3LDHA 1RYZA 3LXMA 5LZ2A 4NBUA 3ZWYA 5CNMA 2X77A 2ZCUA 2HO4A 3K4HA 4B7UA 1XB2A 3K0BA 3ZTWA 4CKBB 3PL1A 2AF4C 3BWDD 2C2OA 5ELMA 3VJRA 1DAMA 3LUBA 2ZETA 5ECYA 1X1TA 2VDOB 4FQ7A 5CB8A 5TXGA 3HFSA 1E1KA 2ZBGA 3CRMA 4YK7A 3UIEA 1X9GA 2O2EA 4CG3A 1G20E 2IOFK 3IBCA 1O6BA 4WBSA 2PGNA 3KLOA 4GUDA 3BORA 3KYCB 1D4FA 1JNYA 1ZH0A 2DUMA 4QFCA 3AF0A 3V1UA 4TXJA 1ANKA 5B57C 3AI2A 2ZT6A 3ZWXA 1OLSB 2IWHA 1BYIA 2BHNA 3EMVA 2D06A 1N1DA 9ABPA 1RLJA 5TMEA 3DOCA 3DYBA 1GPUA 4GBGA 3TTYA 3EFEA 4XM1A 3VOTA 4GH5A 5H5JA 4I19A 4J7CA 2ZSJA 5CCXA 5GZ3A 1WR8A 1EB8A 1ZA2A 2WFZA 3HY4A 4EVQA 1GGEA 1KKUA 4I1YA 1JVBA 1A77A 1SULA 5KYUB 5JEEA 1DVRA 4LWQA 1R16A 1QO9A 2XYHA 1R8JA 2FQWA 2C98A 4KBYA 3QX8A 2WQ7A 4IV8A 5I4IA 2C78A 2WP8J 1M2NA 5PGMA 1XCOA 4K8OA 4Y6QA 3A25A 1NTOA 1X92A 4V0MA 5IBPA 3SVLA 4AZ3A 1XLUA 3JAWA 5AOAA 4NCIA 2GOYA 5B53A 3V7WA 3VVLA 5HQ3B 3TIIA 4E09A 2ZRCA 3BWVA 5D00A 2AKAB 1G0NA 2PBRA 1RJWA 4TS4A 3DJYA 5KDLA 1QPBA 2BZ0A 1U6IA 3PJRA 1Z5WA 5BSEA 2PSEA 4QPZA 5TVKA 4BMPB 2MSWA 2OZLA 3PX2A 1DCFA 1ONOA 3NT2A 5KHLB 1V5GA 4CKBA 6YASA 1BU5A 5CA0F 1Y7IA 3HBAA 1QH1B 1RVDA 3CNLA 3JASB 3DYVA 3QKRB 5EZYA 3QUSA 3ZH2A 3DXYA 3PHHA 3U16A 1ZC4A 1NLUA 4MXDA 4PYNA 5TSDA 1WPXA 4EY6A 4DV1B 2PPLA 3I2GA 3JQPA 3B7PA 5JFGA 5JTTA 4QJBA 1XQVA 2F3QA 3KR9A 2HF7A 3H9QA 4BWGA 1YZLA 4II7A 1M5RA 2ORED 2AYYA 5DEOA 4HAZA 1BJRE 5FO0A 3PUXA 3R76A 5MFZA 5CH3A 1XD2B 5FWXB 4FMCB 2WHEA 3GEHA 2Q6VA 1BN7A 1JQEA 3RRYA 2HRQA 1UPCA 3EQ7A 3LWBA 3H0KA 3COWA 3HRHA 5LQDA 1J97A 1AHPA 2ACKA 2IELA 4G09A 4BNWA 4GKAA 2WHPA 3W6OA 5CT5A 1EE2A 1Q84A 1Q91A 2CF5A 1J42A 1T8SA 3AFMA 3RUEA 3ZCUA 4CG0A 4FNAA 2FW9A 1D6MA 3F74A 4BBZA 3Q87B 4PX3A 2WAOA 1JVSA 2AZXA 3NNSA 4LX8A 4MYDA 1QK4A 1A95A 1EX7A 1ZN9A 4WL0A 5G53C 1T4BA 3PD0A 2XIJA 4LVUA 4MYUA 3VH2A 4AJJA 2NU7A 3AW8A 5U1PA 5LQSA 4QSHA 3TVDA 1CUXA 3GLHA 5LYJF 2I6GA 5ERXA 4MR8A 1VPTA 2PZMA 4C2BA 5IANA 3F6EX 1F7UA 4FP9A 4EB6A 2WWGA 4AP6A 5HBGA 3TPFA 5BWBA 1Q7RA 1PR4A 4FJ2A 2VTEA 5E2IA 1RXSA 2L19A 5LIPA 2AZMA 2RIRA 3I58A 4YFVA 2GYWA 721PA 5HYVA 2I6FA 1P80A 4BLRA 3GVIA 4I8DA 6GPBA 1P4HA 2OFWA 4R7ZA 2R60A 2RJ3A 3E8XA 2XXAB 4XM0A 3COYA 3OZDA 3I9FA 4GGPA 1FNCA 1L5MA 3J7TA 3EA4A 4V03A 3WNQA 4B7XA 4AUKA 1A2KC 2XQGA 3EAQA 1M8PA 3EXHA 5D8DA 3IUYA 3F9RA 3RLFA 2FR1A 4D5GA 5B2EA 4YCLA 1I7LA 2X58A 4FJ1A 4E13A 5BPHA 1SVOA 1KA9H 1FVHA 1SUCA 2PTGA 2Q3MA 3N76A 4YMGA 2QDXA 4RZHA 1QRTA 2VQ6A 5D87A 4UOZA 5KNBH 1DG1G 2P0EA 4C9BA 1H2RS 3LOUA 4RGQA 3RIEA 1X1RA 4IDDA 4BJ1A 3ZXYA 4GSLA 5L51A 4AUMA 2OV1A 4I55B 3NAZA 1X0VA 3GW8A 1K27A 4XD7A 3ZLTA 4LMBA 3QPUA 4B87A 1TO2E 3B6IA 2C4WA 3E15A 3FW1A 3HSKA 3I0ZA 1V25A 4K81B 4OMCA 3D8UA 3R5XA 2REXB 5I9TA 4M1WA 5CT8A 4QDTA 2NU8B 5JDCA 1UFQA 1U2ZA 2HSGA 1DRJA 4BBPA 3HXPA 1BYUA 2VYNA 2QB5A 3QITA 4BE7B 4TXHA 2XZOA 2VUHB 4MV7A 4DQUA 4EYOA 1OROA 5CFNA 2DCMA 4MEJA 1I5RA 5A9SB 4RKQA 4OUDB 3T3OA 4PIPA 1HT0A 3WOHA 2X5OA 1SVMA 4ISCA 1K0FA 3I1IA 5A2GA 3TI7A 5F73A 4RACA 3WDKA 1HL7A 4Q3EA 3KSDO 4UM9D 1XIVA 3KYBA 4MPDA 3UV7A 3VSAA 3S8MA 1MG0A 4RMGA 3HKBA 3WQSB 3QHQA 2R00A 3TS1A 4G6ZA 4Q3LA 3VYUB 4ZICA 4YAJA 3JQGB 2ZAMA 4G07A 1Z06A 5CNKA 2AD5A 3KKZA 3RR2A 5ERYA 5KC8A 1AXEA 3AP1A 3PNQA 4KRFA 2OEPA 5SZKB 3GDHA 2PRSA 3BRWD 1L4FA 1NKTA 4F46A 2N75A 2MU1A 3C5VA 4MQFA 4U2CA 2Y92A 4I36A 4FBMA 1H6BA 4IGKA 5BNZA 4IZHA 5I7EA 1HMPA 4I1OA 5DYIA 1ZH4A 5LZ8A 4KLRA 2LP4Y 3HB7A 1G6OA 4BCBA 3DC7A 4JEIA 3RHTA 4W5OA 4JXZA 2FKAA 4ND3A 4BNFA 3TQSA 1NVFA 4EA8A 3NWPA 3P32A 4J29A 3CB4A 2VTKA 4ZOLF 2B4AA 3U7RA 2O2DA 5CFOA 3N0VA 1M8KA 2OKGA 5I7HA 3EZ9A 4A6PA 1OLXA 1JEJA 2EFGA 1XELA 1T4CA 1ZAKA 4CMEC 1M2KA 1VGQA 3C1TA 3RHSA 4Y2VA 2R25B 4GLFA 5CK4A 1GZSA 3G0BA 1WXXA 2FEAA 3K6KA 1LPPA 1P9WA 2H0AA 3DBLA 3P52A 4V24A 1Z6QA 3DTTA 1GR1A 4OQNA 5C3UA 2B35A 3PJDA 3UFXA 3WL6A 4TWZA 3H83A 2C1ZA 4X7RA 4EUFA 4WIAA 5MN5A 1AXGA 1MAVA 4DVJA 2P7IA 3IL2A 1BRTA 3HA5A 3NBYC 5JLJA 5A62A 4L4YA 4GRIA 3MOGA 1M2GA 3IKLA 3JQAB 2AI3A 4L8GA 3UTCA 1THMA 2AMFA 5F7ZA 3R7NA 5A3QA 2QORA 1AJEA 5B3AA 2ZJ1A 4B3JA 3L0YA 3HUEA 5FBVB 3EXFB 2PMBA 4DR2B 1GM5A 4GYWA 1RHKA 1ZCFA 2NTEA 1QPGA 3AJ8A 3QTBA 1PZMA 1RM0A 3BCHA 4N1AA 3X1KA 4C3ZA 3H75A 2XMRA 3LD9A 3S5UA 2GPSA 2ZUVA 1RAEA 2IL1A 1IMOA 1ENPA 4N7JA 4PX5A 4UNSA 2JS7A 4LY6A 3SEFA 1FMLA 3DE3X 4KAFA 1OR8A 5F2EA 3LPMA 5EPEA 3ZGLA 3C7DB 3HXMA 3I2JA 5D86A 2GSWA 3BTVA 1XKXA 1EK6A 3F6YA 3VNQA 3ZXXA 3NT4A 3S4YA 4C7OA 4YR9A 5AW5A 3E82A 5SY6A 3WP1B 4MVYA 1SRQA 5EI5A 2W8ZA 4EYKA 3BDIA 1L7NA 4V3CA 4J3FA 4JD5A 3RSCA 4UPEA 3LUFA 1JE1A 1C3JA 2HFJA 2Q2QA 1ULUA 2D4HA 4C4XA 1O6GA 5L95A 2VH5R 3OMXA 1Z12A 3MILA 5JCOA 4LMPA 4KVFA 4WZAE 3V4OA 3W06A 2QVXX 3G5TA 4CWAA 4EHLA 1FSPA 1YQGA 3OLVA 4N5MA 1KVUA 2C9ZA 3JVUA 2X22A 3VUEA 4TM7A 1NY5A 4CDGA 3KETA 3L9XA 3OCWA 4LZNA 4YRTA 2BHRA 2X5JO 3LQKA 3PKZA 4HLDA 2H4HA 5FUBA 1L6RA 4ZVNA 4PX2A 4IQFA 3QOWA 3AFOA 3K2QA 3QVJA 1YCHA 2QE7D 3OQPA 4EB8A 1PR6A 3ML1A 1VJCA 3JARB 1JRLA 3LCUA 4N3NA 4V39A 3N0WA 3RS0A 1TT7A 2JLZA 3PL5A 5J2TF 1IPHA 3AXTA 3ME5A 5GWXA 4O4IF 3EISA 4LQLA 3I5UA 4A6DA 3ZCQA 3ONWA 1SKBA 5CBPA 3OURA 1BCRB 2IY7A 4QUKA 5AVSA 5DSZA 1SQFA 1N57A 2OAQ1 3UQZA 1JL3A 2OG1A 3RODA 1XPOA 4PAQA 3GEBA 4G84A 1TTPB 1V6CA 2JCVA 3BBLA 4KXNA 3U19A 1WUJS 2FUG1 1AGRA 1CUDA 5JJKA 4GHWA