1Q3HA

Mouse cftr nbd1 with amp.pnp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
281
structure length
265
Chain Sequence
b'TGIIMENVTAFWEEGFGELLEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structure of nucleotide-binding domain 1 of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 92
structure length 265
sequence length 281
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1q3hA00
2V8OA 2ZS8A 1RYHA 3QKRA 1IHUA 2ZS9A 2BC9A 5IT5A 5J40A 5EJEA 4CEJA 2C77A 2CXXA 1FNMA 5DI9A 5HKKD 1G6HA 1IONA 3SOPA 1OXVA 1DADA 1Z0AA 1AQYA 1E1QD 3SFZA 4DXAA 2FFAA 2AXPA 2FN4A 3JZMA 4KYIB 2LCFA 1CS4C 1R0ZA 2JIZA 2CVHA 4JVSB 4AWXA 3C4JA 3THXA 1BMFD 4PR0A 5CITA 1H8HA 3KQNA 4TMWA 4Q9LA 1CTQA 3L82B 1SKQA 3PENA 2RH5A 2YC4C 4GSYA 3KJGA 1ZRHA 4XTCS 1OV4A 2JJ1D 3KUCA 4PAOA 1C9KA 3I8SA 3KTAA 4LHXA 2O8DB 2WMNB 2GRJA 2H7VA 1XRJA 2ATVA 4GI7A 1FUUA 4PO1A 3GLFB 4PX9A 1P75A 2QMUA 2AN9A 2WHXA 1IN8A 5F3WB 4AKHA 1CJKC 3G82C 4S35A 3OEHA 3QVVA 4BLTA 2ZI5A 5B30A 4DLSA 2RGXA 1S3GA 3TE6A 3THWB 1WMSA 3HYRA 3GJ0A 2BCJQ 1G5RA 3QXHA 1JEDA 5DN6A 1U81A 1LB1B 4U5XA 4KSCA 1YR8A 2QMEA 4BFUA 4UKDA 5K8LA 3I4LA 2WICA 2IT1A 1XMSA 1W0KD 2ZI6A 3CW2A 4HAWA 4A2WA 3I5YA 2BM1A 2E9SA 2FSIA 4D4MA 2O8EB 1GUAA 4D81A 2QAGA 4BPBA 3N70A 4DLWA 4QJ3A 2XNDD 1ZUNB 3CZPA 4FCVA 3DOEA 1VG9B 4I4LA 1XX6A 4WZ6A 1VCOA 3KQLA 3FMPB 2WSMA 2NIPA 1WXQA 3CNOA 2W00A 2J46A 5F9HA 4JBWA 4UXJA 1Y63A 4AC9A 1WDTA 3WMGA 4NYIQ 4P4TA 4M8NE 4AG6A 2J7PA 3GLGB 2P65A 3BFVA 4XD7A 2OCYC 5TVKA 2ZPTX 1KO1A 2J7KA 3AVOA 3CNNA 2XOKA 5TV2A 1Z0FA 3QEOA 5IK2D 2G0NA 3GP8A 2O52A 2IYTA 1JAHA 4M1YA 3AVYA 4RD6A 5G40A 3OIYA 1Q3TA 1N5JA 1SXJE 3LFUA 2O0HA 4FIDA 1XEXB 1L8QA 1XTKA 4NKRA 1ZCBA 3AKDA 4QOSA 4A0HA 1MO4A 4B47A 2OLJA 3KDSE 4MRSA 3IQXA 5EP3A 1KMQA 1D2MA 2MSCB 3THYA 4KVGA 2V6IA 3RLFA 4M1SA 3RAPR 2ZI3A 4L15A 1I4DD 1XTIA 3B6EA 5AUQA 4I99A 4QGFA 1HTWA 2VRWA 2F43B 1VCNA 2QP3A 2H18A 2D2EA 1BS1A 3FFAA 4TQAA 4DLUA 4CEIA 4N3NA 4XOIA 1JQLB 2ZSAA 3B1XA 4EPRA 3BFKA 2FX3A 1TU4A 2W58A 1KO4A 3PUWA 1ZJ6A 4HAXA 1KAGA 2WJIA 5GVRA 3AVXA 2P6UA 3AVPA 1EFRA 1T4GA 1JR6A 2GBLC 1Z0IA 4PSVA 2P2LA 1HE8B 2WWXA 4JL6A 4XJXA 1XTRA 3SFVA 3GLHA 1KY2A 3OESA 1OH6A 2G6BA 2VHQA 3VFDA 2HJGA 1E2HA 2KWIA 2XAUA 3EZ2A 4B76A 2QEQA 2GF9A 4ZO4A 3AUYA 1OF1A 4XWKA 2IX3A 5FUWA 3U4QB 4WOPA 1U94A 3EX7C 4AKGA 4F38A 5DYGA 1KY3A 4LPSA 4S2EA 5CM9C 4A4DA 4UNSA 4ON9A 2R9VA 3PG5A 4O25A 1CJMA 2L0XA 2W2TA 3QSYA 1E0JA 1NL3A 1VIAA 4M9ZA 1Z0KA 3CWZA 1N6RA 4G5SA 3TMKA 1EFHA 4D80A 2RGCA 1E2NA 3SYNA 2N1BA 3NKVA 1GTVA 3K53A 2D62A 2NQ2C 2PCLA 3VQTA 3M1IA 4HLDA 4ILEA 3LX5A 3U3KA 2BWJA 5D3MB 2FMXA 2WTUA 1NLFA 4IFEA 1R5NA 2FH5B 3WBKA 3U2QA 4M53A 2QA5A 4K8OA 2CEAA 1VECA 4IEIA 4Q48A 5JWRA 1OJLA 1PUIA 2C78A 2HXSA 2WPDA 2BV3A 2VP6A 2A3RA 1CR2A 2NG1A 3DHWC 3NTUA 4M21A 5L3SB 2EQBA 4A82A 2G1JA 5EUQB 1MO5A 4G1UC 4M2LA 3KQKA 4A1FA 1SVMA 1JAIA 1Z6AA 2YV5A 3GFPA 3HPQA 3U5ZB 1BYUA 1P3JA 1E9BA 2TMKA 1UKEA 2V6JA 4AK9A 3K70C 4EAQA 1ZNXA 2R6CA 3I73A 3K9LA 3N2EA 4P4SB 1OYWA 2ECKA 5C4MA 3T5GA 1X8JA 3CR7A 3AB3A 1GL7A 2W6ID 3B2EA 5ELXA 2UVQA 3OFNA 3GEEA 5EP4A 4PO9A 3KXIA 3TSWA 5KPDA 1FP6A 2BBTA 1ZU5A 3FWYA 4P33A 2QSYA 1AZTA 4Q4AA 2DWPA 1S0UA 2ORIA 2IF2A 3DOFA 1GNRA 2OAQ1 1IXZA 1W48A 2A9KA 2VQSA 1DPFA 1P73A 1HQCA 1R7RA 1Z6XA 3HPRA 1H8EA 2DBYA 4LV6A 4HB3A 1OHHA 3SNHA 4QGAA 2VP5A 4DWJA 2XB2A 1FQJA 4PO8A 4JYBA 2ZRDA 3TUJC 3SN6A 2FFHA 4DCTA 2O8FA 1U9IA 1KJYA 1LS6A 2FFQA 3T34A 4F4CA 2ZSFA 1PLLA 1G5PA 1T6NA 3P4YA 1Z2CA 1Z0JA 1HEIA 3Q3JB 3B5JA 1FMJA 2YVUA 2Z5FA 5TMPA 1Z63A 3KB2A 4IKEA 4LBVA 3L0IB 3PV0A 4HAZA 4X8HA 4BUJA 2DB3A 4II7A 4W9MC 1KIMA 1PLJA 1JBKA 4OQXA 4B73A 3QI2A 3QJYA 1P62B 4DZZA 2ZE5A 4D4KA 4DSTA 3W3ZB 2RGNA 4O0MA 4TSFA 1W44A 2RAPA 2WIBA 1KSHA 2J0UB 1UFQA 2HYDA 5FL7A 4DCVA 4Q01A 1E69A 3ND9A 1TQDA 3ADKA 1KGDA 1XTSA 4HLUA 1CRPA 3AP1A 4QNRA 4V0NA 2BM0A 3TUZC 2J9RA 1US8A 1TL7C 2WJYA 4EJSB 3X2SA 1QHSA 1RYFA 2NOAA 4G5QA 1OKKA 2NO1A 5FI1B 1XBTA 1G64A 1KZGB 2Z83A 4V0OA 5BN4A 5HCNA 4LJ9A 3ZIAA 1TQ2A 3PITA 1OFIA 2Z0MA 3B9PA 1KO7A 3C41J 5CB6A 1XNJA 2BMFA 4Q9KA 5KSYA 2GCOA 3EC1A 3RRNA 2IWHA 1BKDR 5A0FA 1Z8FA 4V0KA 4LUCA 4F4IA 1FMLA 2FNAA 2VSFA 5JEDA 3GJ7A 4MGIR 2PT7A 4PQFA 1NF3A 4OQMA 4KSBA 2FE4A 3SYLA 5BYJA 2Q21A 1L2TA 2XSZD 4A6PA 1KYIA 2CNWD 1Z29A 1E2KA 1D6JA 3BS4A 2NPIA 4HUQA 4LC1A 2RKOA 3AF2A 4DT1B 2O0KA 5FTKA 1ZP6A 1IY1A 4RY2A 3SBEA 4TTRA 5JSZA 3AKYA 3RS2A 2PLRA 2EYUA 1XF9A 2VP0A 3V00A 2IUTA 1GL6A 2YWGA 3EIEA 4KBGA 3M6AA 2JLUA 6Q21A 4DBLC 4QNMA 4C2TA 2QU8A 2VPPA 4LJ8A 3SR0A 2OM2A 4EFLA 1Q3HA 3RS3A 3UK6A 1S9DA 1UAAA 1KI3A 3U44B 4MQBA 5H68A 1AKEA 1KJZA 3KXLA 3W9YA 2O8CB 2AKYA 2IYSA 1AGPA 3V9PA 1AS2A 3Q5EA 1DAGA 4HDOB 4EFMA 2KB0A 1OB5A 2QUZA 1KOFA 1X86B 2P67A 3ADCA 2OV2A 3ADDA 5CM8B 4Q47A 1WBDA 4KI0A 4A8JB 5HCIA 1OFHA 5FBQB 5FTLA 1ZC3A 1KJWA 1YR7A 2A5GA 2VSOA 3NBFA 4MRNA 2ZRAA 4W5JA 4YDHB 3TKLA 1ETUA 2AK3A 4M0LA 3GJ5A 2RGGA 1CRQA 2XTMA 2DFLA 3KKOA 4Q4HA 3T35A 4Q1DA 1X1RA 1F60A 1SXJA 1P9RA 1UF9A 3EZ6A 3KXKA 3I32A 3LO5A 4URYR 3TAHA 3VKGA 4D25A 1QHHA 1FOEB 4YMTA 5FPTA 1J90A 1MABB 2NO9A 4Q4JB 1TQ4A 1NRJB 1VG0B 3C7KA 4Q1BA 4QHYA 4IXMA 1FX0B 2HV8A 4L9WA 3K0SA 3CRQA 3DM9B 2F9MA 4BEJA 4R9UC 3ZLJA 3WNDA 1E1RA 2Z4SA 1DAFA 4FN5A 4ACBA 2A30A 1E9EA 3AVQA 3S1AA 3SJAA 4D4JA 1CF4A 2R8RA 1VHLA 5L8VA 2XJ4A 2W2VA 2FPLA 1RRCA 4QFMA 3PXGA 3LVRE 3T12A 4CEHB 1ZD8A 5LDDC 3B1VA 1W47A 3NC0C 5EXTA 1F48A 3G0HA 2IW3A 2R6GA 1JNYA 3IBYA 2CK3D 2GVZC 2DCUA 3Q7QA 4DDTA 1ZNZA 2ATXA 4R98A 1XD2B 3AF4A 4CT4B 4FINA 3C15C 3SJZA 1NY5A 3VHXA 1KHTA 3U7GA 5LPNA 2V4ZA 2X8AA 1T8UA 4NCNA 3RS5A 4EIWA 3A1UA 2F9LA 1M2OB 4OHVA 4I1UA 1NSFA 4LC0A 3GEHA 4YMVA 3ZGXA 2JIZD 3UMSA 2R65A 1OT3A 1ZM4A 2JJ2A 3TSOA 1H8HD 3W6NA 4RSGA 3FMIA 4ZIRA 3RS4A 3UMRA 2YJTD 5JJLA 3CX7A 5BYKA 1WRBA 1SVOA 3E2IA 4ABYA 2GILA 3DZ8A 2ZR7A 2D74A 4Q1CA 3K0EA 4G5RA 1W4CA 3A1VA 4R7ZA 2IL1A 1MRNA 1IN5A 2GCPA 2GESA 3U7EB 2IEZA 1I4LD 2QMHA 1KO5A 3BC1A 5JCZA 3OEHD 2BMDA 1CEEA 2GBLA 2ZITA 1SKYE 4L5BA 1K5DA 4H1UA 3QKSA 1N0VC 3K0FB 4TTQA 4ZDWA 1EXMA 1M7BA 4EPWA 2HDNB 5C1BA 2RCNA 2GJSA 1NP6A 1A7JA 1L4YA 4HYYA 4JJKA 1XPUA 2VP2A 1XEFA 4RD3A 1R5BA 3DKPA 4TMXA 1K5GA 4OK5A 5E7IA 1GL9B 821PA 2FDCA 1V43A 4G5OA 1E9SA 1CJVC 1VYVA 1DAEA 4B2IA 4IDHA 3RABA 4BLOA 4PHTA 4UQOA 221PA 4ZCMA 4Q7KA 1Z3IX 2DWOA 1W5SA 4HB0A 3K9NA 3PUZA 1Q1BA 4RKEA 2D4HA 5CK5A 2WSSA 1QVAA 1CLUA 2GK6A 3X1WA 4KU4A 3IIJA 2AKAB 1UBFA 1CU1A 2QTVB 3AVTA 3B9QA 4LPKA 4PSAA 3CKLA 4DDWA 1GFIA 1W2HA 3TJZA 1U0LA 2J7PD 2ZJ8A 3CPEA 4XD7D 3H4MA 5CIQA 5IHPA 3ZZUA 2YYZA 3L43A 4YQFA 2WAXA 2ZJOA 3BFXA 2B21A 3QBTA 2F6RA 1CP2A 2YZ2A 4MKIA 3SDZA 2EYQA 3KQHA 1IY0A 1P72A 4MKFA 3BOSA 3K1JA 3R8FA 1D9ZA 5FH9A 1OSNA 2O8BA 1E0SA 4Q18A 121PA 2ZYWX 3RWOA 4JVMA 4MKGA 3F5FA 2NO7A 1W49A 4UNNA 4URZR 1QHYA 2VIIA 1YR9A 2ANBA 3TQFA 2BEKA 1M8PA 2GVDC 3IKJA 5L3QB 3LBNA 3UWOA 4QBIA 3LW7A 3RC8A 5JHGB 2C03A 3K0AB 1N6HA 1AN0A 4EFNA 4BFTA 1N0WA 2DWQA 5E95A 1EFRD 2KJQA 1R0WA 1R5OA 3L8YA 3VKWA 4C0BA 4QBGB 1BOFA 2ZI7A 2Z4RA 4QM7A 3ZVNA 4OK3A 4PXAA 5JFGA 2ZYVX 2ORWA 4GDFA 2EFHB 5CYOA 3UG7A 5AR1A 4ZDIA 2JJ8A 1UM8A 5HE9A 4HEJA 4Q00A 3FHTA 4JZKA 5H1YA 5DSZA 4BFWA 3T1VA 4B44A 4DEYA 4AYXA 2HLDD 5DYIA 5C4GB 4PANA 3A8TA 3E5HA 4LHYA 2BOVA 4URXR 1LY1A 2AWOA 5LD2C 3A1SA 2V9PA 4TLBA 1M1YE 2J59A 1Z83A 2IHBA 2PX0A 3IBGA 4KLNA 2Q6TA 3HU2A 1NNEA 3VNVA 2HUPA 2O0JA 3I62A 3MUFA 4JLDA 5A5GA 2IYWA 1UKYA 4IHQA 1AA9A 2GK7A 4NHOA 3ICEA 3FGNA 4FXPA 2EWWA 3FFBA 4M1OA 2ZRCA 3PEYA 4PAMA 3X1DA 1NBMD 2VHUA 4U7DA 1IN7A 2V3CC 3OE7A 3FHOA 4UJ5A 1RJ9B 2Y8EA 1W36B 3QQ5A 4KVAA 2C8VA 1U98A 4DJTA 5K8UA 3DPUA 3BIFA 3EPJA 5EQTA 4ESVA 4KCGA 3ZS8A 2WPDD 1I2DA 2YWFA 4NH0A 1O3YA 4A2PA 1A2KC 1A2BA 1QRAA 3TQCA 2AWNA 4QG7A 3T1OA 4C7OB 1R8QA 3I92A 3NBXX 2E1RA 5FTNA 4I1VA 3CH4B 4JBXA 2REOA 3FTQA 3QKRB 3MLEA 2CCKA 3P1JA 4IEEA 3TGPA 2QQEA 1G5TA 4CEJB 3MG9A 4PQRA 4RCYA 2WBLC 1WB9A 5B57C 2C99A 1N5IA 4JLMA 3B8HA 3CO5A 3KJIA 1T5IA 2FWRA 2HT6A 4A8JC 1G9XA 1NY6A 4K46A 3THXB 2C96A 3LX8A 5JS7A 5BW8A 4WIAA 4D0NA 3CRRA 3W8NA 3SS8A 1CR0A 4F7WA 3GLIA 3FOZA 5F98A 4OYHA 1ZIPA 1U2RA 3EPHA 2OFXA 1XFAA 1KSGA 1P7CA 3WP1B 4JT4A 4N1AA 3N5CA 2FFBA 1U0JA 4NCIA 1E79A 1FQKA 1H8ED 1SQ5A 3H1TA 3KTAB 3WHKA 3ZVMA 2BEJA 2BKUA 2I3BA 1P6XA 1OHHD 2WJHA 1EFTA 1AZSC 3AVVA 3ECCA 4CT5A 4A0FA 4KITB 2CHQA 1DOAA 3ICQB 5P21A 3VR6A 4PHHA 2QPTA 3ETLA 3WP0A 4V0MA 4LJAA 1Z6GA 4ZDKA 3W5JA 2WJGA 3CRVA 2JLVA 1NJFA 4R71A 1TADA 2FEMA 4UNRA 2WJJA 3UANA 5L3VA 3EPLA 3LBIA 5EXXA 4B32A 2PJRA 3AM1A 4DIDA 1G17A 5EP1A 5AJWA 4P4UA 3U7HB 1DAKA 3BH6A 3SC3A 4GRAA 4ASUA 3H2YA 5JI3E 2QAGB 4LOAA 4Q1AA 2Q9BA 3U3RA 5FPSA 2JLWA 2FA9A 1UEJA 4LY6A 1X6VA 4FD2A 3DM5A 1RE0A 3LA6A 4TZ6A 4URUR 4JLKA 1UEIA 2QPAA 4YMWA 1T3HA 5K8TA 1YQTA 2GNOA 4E5UA 4W5WA 2BCGY 1KDRA 3W90A 5FL7D 5G41A 1GILA 1MT0A 3BB1A 4YLGA 4B6EA 3LAWA 3BD9A 1VTKA 4J0QA 3GJXC 4TYYA 1DAIA 1GIAA 1WBBA 2WKPA 4XWAA 3I8XA 3THYB 3B78A 4OI1A 4TWZA 4NMMA 3QVUA 3A4NA 5HTKA 3THOA 4C0JA 1AGRA 5DNYB 5KSPA 1A5TA 5HZHA 1O87A 1XP8A 5G3YA 2AR7A 4KFRA 4P3YA 5D3QA 1OKKD 4ACAA 1KMHA 4TL9A 4OI0A 3CIOA 3WXMA 3B85A 3ZIAD 4BRWA 3L2OB 2MMCA 2CLSA 1CR4A 3IO3A 3T06B 2QTFA 2VHCA 1OE0A 2H17A 1E2IA 2ZR0A 3CM0A 3DKVA 3BRWD 3HDTA 1XJQA 2A5FA 1SHKA 3AP3A 4MGYR 1VYTA 1P9NA 3EWSA 1OW3B 4B2LA 4DLZA 1L4UA 1G3QA 2BJVA 4LYFA 1Z6YA 3FMFA 1P2TA 5EE5B 4B48A 1JQJC 4OI4A 4RFVA 1LFDB 4YXWD 5KNBA 4CEIB 2C2HA 2C9OA 3U61B 1T9HA 2RHDA 1QHIA 1E9AA 2XX3A 1ZD9A 2ZE6A 4N0DA 4QJ5A 5EP2A 3SE0A 4URVR 3CH5A 2CLDX 1LW7A 5DLQC 1XEWY 1GOTA 2OO7A 2XJ9A 3CBQA 1XZPA 3E1SA 4ESHA 3D6TB 1HQYE 3SJCA 2PL3A 3TAUA 2MSDB 5DH9A 5DHFA 3GLHB 4TL6A 3MJHA 1Q1EA 2H92A 1SVWA 4GFDA 4D6PA 2G88A 4BE7B 2Q3MA 2QROA 2V1XA 1UDXA 1KI6A 2WM9B 3NC1C 2XITA 4MITA 2JGNA 4JT2A 4B3DA 2AHOA 1CXZA 3QOFA 5JEEA 5FOSA 1CR1A 1W7AA 1SKYB 1T91A 2W6JD 3T1QA 2ZRGA 5IF9A 4ZI2A 3LY5A 4KFSA 4TMZA 4Q7MB 4Q21A 1IN4A 1NJGA 2H57A 4PHGA 3T5DA 3UXMA 3VX3A 4DB4A 2DR3A 4BFZA 4D2IA 4CF7A 1YR6A 4KFUA 3IHWA 4D82A 5TY0A 1R6BX 1W5TA 2CE7A 4ZKEA 1SZPA 1AM4D 1KK0A 5SZKB 4TYWA 1F2UA 4TTPA 2WVJA 4D0LB 1EG7A 1NKSA 1G16A 3L0SA 2ONKA 1NG9A 2ZRKA 5FOXA 3DO6A 3TVDA 4FWIB 4DRZA 1GSIA 5BN3A 4NCKA 2GJ9A 1QG4A 5B64A 4I1OA 3IO5A 4I1SA 2YWHA 1SXJD 3A1TA 4JSYA 1KI4A 5F2EA 3QKTA 1CKEA 3BBPA 3IILA 5JWHA 1KNQA 4XTRA 3NXSA 4UXHA 3TBKA 1HURA 1YZNA 1ZCAA 1IXRC 3GCGA 3VU9B 1IJEA 4PPQA 2ZJYA 1YZUA 3WYFA 4Q1EA 1G19A 2ZSEA 2XGJA 3N2IA 1N6OA 4QBHA 4Q7JB 2WKRA 4DHEA 5JCPA 2UZIR 1E1RD 5HZKA 1VPLA 4U00A 5KHOC 1COWA 1EK0A 1HYQA 2DY1A 2FPKA 3CRMA 4A0RA 4ZI3A 2FZLA 3MWLA 3B13B 3FKSA 3U60B 1II8A 2R2AA 4JIMA 4ZPXA 4MH0R 4NCJA 3ZD7A 3FKQA 2A78A 1MV5A 1R8SA 2YOHA 4NE2A 5AJZA 4WA7A 1DTSA 4MYCA 2GKSA 2OXCA 1TEXA 1PVOA 5CJPA 1F2TA 3UIEA 4Q4AB 2P5SA 4B33A 4PC6A 3W6PA 2A7QA 1Z28A 5B2ZA 3R9IA 4HAYA 1Q1QA 2OCBA 1KI8A 2FEOA 2PEYA 5CB8A 4MDEA 3VMFA 4EQ6A 3WMFA 1LTQA 2REXB 2AFHE 3R20A 1J99A 5CIWA 2R6DA 4LBZA 4LZZA 1FUKA 4TQ9A 1D9XA 2FJUA 1U8YA 4RZXA 4Q9JA 1YVDA 4DVGA 4MA4A 2I1VB 3T61A 5EE0A 3Q9LA 2JLXA 2O8FB 3MJRA 1NIPA 1B0UA 3LVQE 2F1JA 2OILA 1GP2A 4LJYA 2XZPA 2XNDA 3A6PC 2JJ2D 1XMIA 3EIHA 4OQLA 1OLOA 3SHWA 2PEZA 4TLAA 1XXHE 2QPOA 2QY9A 3EASA 4GNKA 4QM6A 4PZLA 5EZ6B 2IYRA 3BXZA 2ZRPA 2R6AA 3K09C 1JPNA 5F9FA 2IEYA 4R2HA 4OJQA 3BH7A 5J4HA 3ADBA 3F8TA 2GTPA 1HV8A 2EVWX 3OHMA 1EX6A 5LB4A 2NPFA 5GJWC 1S1MA 1VKJA 3K0CA 1W1WA 2DHRA 1ZAKA 3HR7A 4H1VA 1RC8A 5IK2A 4XSHA 1T3LA 1E0KA 4TYPA 3D8BA 4DUGD 3WBJA 2OBNA 4HZUA 2EFDB 1Q20A 4PC3A 1A4RA 4KYUA 4Q02A 1N5KA 2EFEB 3DDCA 2ZSDA 2QRNA 3GD7A 3H84A 1W46A 3NHBA 1KDOA 2RGEA 2VHJA 5GVSA 3VHLB 2IYUA 1US8B 4BZPA 2JAQA 1TF5A 2X77A 3LW8A 1NIJA 1Z22A 1NN5A 1OIVA 4C0LA 1G8PA 4O3MA 3C5HA 3I61A 4TZ0A 1W0JA 1VCMA 3AV0B 3OIUA 4JLVA 4RKFA 4OHYA 5JJKA 1DO2A 4KFTA 2ZRLA 3LBHA 4LBWA 4A36A 5JJIA 3AEZA 5DISB 3J81k 1XB2A 3OEED 2BJWA 1G7SA 3D31A 2WV9A 1ONBA 5EE1A 1RRPA 2GCOB 4F91B 3KFVA 2QT1A 3X1YA 2IF0A 2PCJA 1Z5ZA 1FFHA 2YKGA 1NMZA 3BERA 2R44A 5GJCA 3Q8XB 4JMPA 4YONB 4DT1A 3B1ZA 4L9SA 5EUMA 1R10A 3LLUA 3WRXC 2J41A 4M1MA 2A5DA 1U8AA 1OXSC 4BWYA 721PA 4PSKA 4IOJA 1KSFX 4C3ZA 5HPYB 1E2JA 1OH8A 4O2RA 1XTQA 3ASZA 1B23P 4TL8A 4HUQB 4LJ7A 3NIBA 5AK0A 1J2JA 3KZ1E 2D2FA 3MGCA 1XJCA 5FTMA 4EKDA 1YRBA 2QAGC 4NL4H 3MRSA 4RJLA 4Q4LA 4ARZA 1SVSA 2O5VA 2OUKA 4WW0A 5JSZB 4GBMA 5FOWA 1E98A 1VDZA 3EA0A 4PZZA 2D06A 3GLFE 4PAQA 3VKHA 1TUIA 2GDJA 2ZRIA 4LHZA 4B71A 3GLIE 1DAMA 1Q57A 2YOFA 2N46A 2YNMA 4Q7LA 4QBFA 3KUDA 4QL3A 3GMTA 1OB2A 2ODBA 3PEVA 1F5NA 1QZXA 3MD0A 1Z47A 1ZUHA 2X2EA 4P32A 3PUVA 4BLRA 4AYTA 2CCJA 2H8KA 1TQ6A 1KK1A 4M1WA 2VO1A 2P6NA 2OE2A 2WJVA 2MMGA 2ZETA 1LNZA 4GZMA 1S9HA 2AK2A 2CJWA 4V0ME 1ZBDA 2IUSA 5AJVB 3GJ4A 3AKEA 2F1IA 2FV8A 4DEXA 1I2MA 2IXGA 3RRYA 2YWEA 4KXFB 2ANCA 4B74A 1BO6A 2C9CA 4B3BA 2GA8A 1ESMA 1SHZA 4A0GA 1WA5A 4Q4HB 4EPVA 3DZDA 3VX4A 1YJ5A 1SXJB 4IDOA 2G0TA 3EC2A 2VLIA 2WIAA 3TRFA 3X1XA 5JZVA 4GMDA 3NDBB 2GAAA 5CK4A 5KNCA 1QHHB 3U6KA 3F3YA 1RW4A 3NEJA 3LRPA 2JDID 3EARA 5H8WA 1W36D 1X3SA 3VR5A 2W6IA 4TMTA 1OIWA 3AF1A 4KLZA 2R62A 1VCIA 4MYHA 3Q85A 3IEUA 2J0QA 1LF0A 5CYPA 3R7WA 2IS1A 1U90A 1GNPA 3B7GA 2ERXA 2IXFA 4BZXA 2BIFA 2QSZA 4E07A 2NTYC 1WCV1 1VIYA 2KI5A 3S1AB 2QBYA 2PJZA 2HJVA 1Z06A 2J5XA 2JLQA 2PZFA 4P31A 1NG1A 2N42A 4YC7A 3GJ6A 2MSEB 3OE7D 3WHLA 1E2MA 2WWHA 2QAJA 1XMJA 1FPMA 2GXSA 1AS0A 4FMCB 4US0R 1QBKC 4AURA 3D3QA 2QZ4A 4RZUA 4X8LA 2Q9AA 3IUYA 4QKQA 2YOGA 1Z08A 3CPJB 1AJEA 2GZDA 2XTZA 3BK7A 2JEOA 1FTNA 1FP7A 4UXIA 3RRMA 5K8IA 3CWQA 1RKBA 2W0MA 5GJVC 2QRZA 2F3RA 4OQNA 4PHFA 2ODWA 3L0PA 1FTSA 3W8RA 1GWNA 1VG8A 1S3SA 4JLPA 1BIFA 4KODA 4OHZA 3X1ZA 2B7CA 4RD1A 1UJ2A 5SZJA 4MDFA 1R0YA 2ZYTX 4JLOA 3KX2A 1R2QA 3BJIC 2ZI9A 4M9QA 3GFOA 3AVWA 3EG5A 1S1CA 3TW4A 2VYFA 2CVFA 3PVSA 1XZQA 2HF9A 3LLMA 1IOZA 1HH4A 3W3AA 4RD2A 1E2QA 2F3TA 2OFOA 2ZJBA 1FL9A 3OF5A 4ZIRB 1X1SA 4MGKR 1HT1E 4LGMA 3VR1A 5DN6D 2QP4A 4QGGA 4A9AA 3A37A 4Q19A 1XDBA 1ZIOA 4GOKA 4B6FA 4RD4A 1E79D 4Q03A 3DMNA 1NLYA 5KYKA 1LVGA 3ZS9A 1II0A 4TQUS 2BVNA 1JR3E 2NMVA 1DG3A 1GNQA 1XWIA 1ZNWA 2FPMA 2XB4A 4OBEA 4E22A 1E3MA 1QHNA 2DFTA 1M34E 3QKSB 2IA5A 4GOXA 1LS1A 5IRCD 4JLNA 4LYHA 3R9XA 4V0LA 2SHKA 4PZYA 2FU5C 3LXRA 4HATA 3TLXA 2E87A 1KTVA 1OXUA 3PCRB 4QRHA 4DDVA 1ESNA 3QG1A 4LJ4A 3QPVA 4ITRC 1RFLA 1Z07A 4TL7A 3RHFA 4BECA 5DE3A 1ZM9A 3QENA 3WNBA 4A2QA 5B58C 1ANKA 2ZXUA 4ASUD 3NEYA 2CL7X 2QM7A 5H70A 1ZVQA 4XVQA 1QHXA 2ZE8A 2GWHA 1E2EA 3QUSA 2RGBA 2QMOA 3EAQA 2XOKD 2RHMA 2ZQ5A 1N5LA 4LRWA 5DI3A 3AVUA 2CCGA 3GJ8A 2C98A 4LDJA 3B82A 3IPYA 3I5XA 4GL2A 1MOZA 2CNWA 3B60A 4LK2A 5C18A 3CX6A 2XTNA 3PEWA 1D8TA 2ZSBA 1QDEA 4FMCF 2GF0A 3AGPA 1YU9A 2BBSA 2X1VA 4BLQA 2PH1A 3EZ9A 5KUTA 5E3HA 3OIVA 4BQSA 4CYMA 5FBVB 3IDQA 5L3QA 4IDNA 5JS8A 2DPXA 2WWWA 1ZW6A 3PUYA 4HZIA 2O8BB 2F7SA 4Z54A 4I81A 2H16A 2WAYA 2IYYA 1TF7A 2OXRA 2UZ3A 3QY0A 4WXRA 2CHVA 4AKIA 3R8CA 2GZAA 1XU4A 2KE5A 5CDFA 4EJSC 1XXHA 2HT1A 2GXQA 4MYTA 4RFSA 5FBRB 3I3SR 4IVRA 1R0XA 4Q9IA 3SHFA 4JS0A 3TH5A 1OXTA 1P5ZB 1JJ7A 4LYJA 4CW7A 2QG6A 3REFA 4TLDA 2ZVQX 4PC2A 1NN0A 1ZD1A 3AF0A 2P0EA 4FW9A 5SZHB 3QF4A 4HLCA 1E2DA 2OLKA 2CE2X 3H86A 3MWKA 2EWVA 3P20A 3U3OA 2ZUCA 2J87A 1KDTA 4KJZA 5GADl 1CJTC 2QNRA 3TR5A 4D4LA 1CULC 3TR0A 3NBZC 3LDAA 4Q1FA 3MAAC 3RC3A 5BQ5A 3EZFA 5EE3A 1IM2A 4Z51A 2G83A 1Q1ZA 4DC9A 2QE7A 3KKNA 5FPYA 1NN1A 2H1LA 4JL5A 1XCPA 3ND8A 1DEKA 1GG2A 2UKDA 3OZXA 4B3GA 4DKXA 3R9WA 1G6OA 1W4AA 4OKSA 2XXAA 1MR3F 2V7QA 2RGAA 4LV8B 3MWYW 5E7JA 1XTJA 4F4JA 1KKLA 1NVWQ 3EA5A 1Q44A 2A2ZA 5KDLA 4K81B 3CX8A 2FGKA 4G0NA 4WZBE 4ZCIA 1HT2E 3W6OA 1TTTA 3OAAA 4AKEA 3G5UA 1EGAA 1N25A 3CRW1 4HLQB 3VR4A 4TT3A 4B35A 4A15A 3LV8A 4IDQA 3NDPA 2RB4A 1OH7A 2CBZA 3K09A 2IWRA 2FSFA 4RZ3A 1KZ7B 4NP6A 1Z0DA 2AL7A 521PA 4JKIA 1XPOA 4TLCA 4HUTA 5FPHA 3ZQ6A 5HE8A 3ASYA 2J45A 4IOLA 2QT0A 1LF5A 3C16C 2O8DA 1T8TA 1G1MA 5FUXA 2QQ0A 1KI7A 4Y0AA 4C0SA 3GLFA 3AQ4A 3LNCA 3OFND 3RNLA 3KQUA 1J8MF 4PQYA 3A36A 3H0KA 3A58B 3THWA 4OHXA 3KJEA 3REGA 1IAQA 1COWD 1ZYUA 1CBUA 3AH8A 3PJRA 3FKSD 1EESA 3CLVA 3SQWA 1DG1G 4IDPA 4RVCA 1HA3A 2PT5A 1I4TD 4WBSA 4X8OA 4PPNA 5FR1A 2JASA 2QGZA 4WXPA 5FBWB 2C95A 2BKEA 4RD0A 3GLIB 2O8EA 4C0AC 1NLZA 4EPXA 4CGZA 1SXJC 3V4FA 3U3JA 1YZKA 1M74A 2LKCA 4EPYA 3QNUA 3GPLA 4CVNA 3GQBA 4MUBA 2XNSA 3BWDD 3BH0A 3ZJYA 2PZGA 1SGWA 1J7KA 3RSOA 1G3IA 4F93B 1G20E 3QIAA 1KK3A 3NWJA 1QF9A 1EFCA 5FOUA 1N6NA 2X19A 2ZE7A 2ZTSA 1TX4B 4PTLA 3ZZ0A 5EZ5A 3GLGA 3NVAA 2ZAOA 3CF0A 2VTKA 3E70C 3RYTC 3ZD6A 3FE2A 3MSXA 4TSFD 4BFSA 4LHVA 2ZEJA 4C0QC 5AUNB 1XCGB 2FF7A 1P2UA 2F1RA 1PUJA 2D7CA 1XEXA 3FHCB 4IXNA 2ZI4A 3VTKA 2CDNA 1LV7A 4KHZA 4TMKA 1E6CA 4BGDA 1T3SA 1HY3A 1H65A 2BBOA 1NVXQ 5JHHB 2Q0HA 2BDTA 1GKIA 4LBYA 1RVDA 4DIEA 1IQPA 4GPTA 3UG6A 2QGNA 2BBWA 1R4AA 2QI9C 2J3EA 3VR3A 3QBVA 1DE0A 2F43A 4MUAA 3HU1A 4Z1MA 3ZDQA 2J0SA 2ZRJA 3PEUA 2W83A 4B2PA 1AK2A 3LD9A 3P32A 4MRVA 4YMSA 5HR5A 1KI9A 4ZKDA 1TU3A 4OHWA 1GDDA 3IQWA 4UNPA 4Q66C 1YZLA 2GEUA 4QJ4A 3FMOB 4JSTA 4M22A 4CZ2A 4C0KA 1MRSA 2VF7A 5KPJA 1XMVA 1E9FA 5TDHA 3RS0A 4D26A 4R2IA 4HB2A 4Z8YA 1NKTA 2ZRBA 1D5CA 2LWIA 2ZJ5A 1RPZA 4Q5IA 1JXOA 1W0JD 1KMHB 4C0HA 5AJXA 4CDGA 3DL0A 4TLEA 3U4QA 3PFIA 1TUEA 4OI2A 4X8MA 1KK2A 2B7BA 4EDHA 2AD1A 5KOYA 4A6XA 3AUXA 1W4RA 4M9SA 4QHSA 4C9BA 1EWQA 1DS6A 2KSQA 1QHGA 4GMXA 1DARA 4PC7A 3C8UA 2JLSA 1OFTA 1WQ1R 3RSLA 4YMUA 1MO3A 3W34A 1QVRA 3T15A 2HEIA 2QENA 1E96A 1WE2A 5BXQC 1JR3A 4G5GA 4JBYA 1CIPA 4IJMA 3QE0A 2ZUDA 5J4LA 1NMYA 2NGRA 2VA8A 2HLDA 1IXSB 2FZ4A 3AKCA 2PBRA 5D3MA 1E2GA 2BMJA 2WKQA 3IIKA 3VAAA 4AI6A 2F1HA 4JYCA 3K8YA 4UJ3A 3A4LA 4NCHA 4JKYA 1UKZA 3KKQA 1VMAA 1KI6B 3FYHA 4G01B 4W7SA 3IEVA 2IYZA 1G7RA 2OHFA 4BRUA 5E4FA 2P6RA 1OPXA 2J0VA 2ZU6A 2VP4A 5JMTA 4IW3B 3KKMA 4FMDB 3RWMB 5L3SA 2B8WA 4LWZA 2Q3FA 5UKDA 2OSBA 2OFWA 1E32A 3BORA 3LQQA 1Z2AA 3BB3A 2IYVA 1G7TA 4NDZA 1P61B 3TK1A 4E03A 1NBMA 5DIFA 1XPRA 3BGWA 3IPXA 5BN5A 3CB4A 1AS3A 3K9HA 3BAFA 1M7GA 4DCUA 2C04A 5FUYA 1U0HC 5HKKA 4U02A 4M4SA 1A82A 4QC2A 5JRZA 4DDUA 4P4SA 1V5WA 1AQUA 1E1QA 1NI3A 3Q5DA 2KBFA 1G291 2Z6VA 4CRWB 1F2UB 5G53C 4DLXA 2ODNA 3VU9A 3MWJA 5AJYA 5J4YA 2F55A 1DVRA 1BMFA 2GXAA 3M0EA 2AXNA 3B1WA 3ZVRA 1GVNB 3KB1A 4DCSA 5KNDA 2JLRA 1TEVA 1II9A 2CLCX 2W0SA 1JJVA 2JJ1A 5KTYA 1ZNYA 4JL8A 4HSEA 3JVUA 2AFIE 5FUVA 4EPTA 4LI0A 2WWIA 4MYUA 3M4YA 2ZRNA 3PIRA 2IC5A 2ZYUX 2OCAA 4IOMA 2ZREA 1TAGA 2IHYA 3O47A 5KDDA 3O8RA 3SBDA 1UBEA 5EXSA 2IUUA 2OCPA 1X8LA 2WZQA 2NZJA 3HR8A 2Q9CA 1E99A 4LYAA 4V02A 1N0UA 3EWAA 1EFUA 1II8B 1A1VA 4BZQA 4WVFA 2G9NA 5M04A 1QG2A 1NVVR 2YINC 2ZJ2A 4BLPA 1G7CA 1IY2A 3SEAA 3O8BA 1S8FA 8OHMA 1W0KA 5KO2A 1ZUIA 1VG1A 3P26A 3QXSA 1ZU4A 2ODEA 1F2TB 4UNQA 1E2FA 3NH6A 4WZAE 1N6PA 2VL7A 5FOTA 2K5UA 1TF2A 4YDSA 5JECA 2ZANA 4IRUB 1RZ3A 2BMEA 3NHAA 2HF8A 1GKUB 4ERNA 2G77B 4FCWA 1W36C 1BH2A 3QKUA 1J70A 4NYJR 2OBMA 4EQ6B 2OBLA 1F3OA 3FVQA 3KFXA 5LBIA 5CDFE 2OG2A 2J0UA 4DLTA 4C2UA 2P5TB 2IYLD 4RZ2A 3RVBA 3FB4A 3SYKA 4AG5A 1XCMA 1Q21A 4URWR 2JATA 4FI3C 2REBA 1T5LA 2V54A 4FMDF 1IN6A 4NTZA 4IOKA 3QXCA 4XVRA 4EJSA 1E2PA 1G8HA 1G3MA 1U99A 2DYKA 3LQRA 3LWNA 2HCJB 2FSHA 4DLVA 2I4IA 2X2FA 2HCBA 1KAOA 1GKYA 4B3FX 3ZVLA 5FPKA 4TYNA 3VNUA 3DMDA 1DO0A 2ONJA 5C2JB 1KI2A 5DGXA 2D3WA 3RDPA 3WYGA 2V1UA 2IS6A 4HI0E 2A5JA 5KU1A 2QORA 1PV4A 4NPHA 4TYQA 3L8ZA 4HZUB 3TUIC 1S96A 3GEIA 4JLJA 4PPGA 1U8ZA 1X8KA 2OZEA 4KO8A 4MKHA 2WSSD 4ZCLA 2NZ8A 1OYYA 4Z8XA 5FI0B 1E9CA 3TSZA 2NO6A 3MCAA 3CF2A 4NONA 3F0TA 2ZROA 3JVVA 4MRRA 4TMVA 4OQFA 2OESA 3TNFA 1ZMXA 1TPZA 2FOLA 4YXWA 1DELA 2PMDA 2VEDA 2VSXA 4BASA 1HUQA 2GCNA 3O8CA 5GJBA 5LD2B 4LSGA 2B6HA 5FR2A 4XSGA 3Q7PA 4QGHA 2IS2A 4G3XA 1G3UA 5JRJA 2RMKA 2PZEA 2ZM5A 1JEEA 1GRNA 5TARA 3U44A 3CZQA 2PLFA 1G18A 2O8CA 4NYMR 4OJKA 2NO0A 1D2EA 2VP9A 5FTJA 1YHNA 1JPJA 1EWRA 3K70D 2G3YA 2W6JA 2FSGA 3RANA 2ZAMA 1S2MA 2OAP1 4XVUA 2WMOB 2VF8A 4A8JA 4H9GA 2Q3HA 5A4JA 2RGDA 1TNDA 3T1TA 4ARZB 1S4QA 2EFCB 3GJ3A 3MFYA 1WF3A 2IK8A 5KSZA 1YZGA 2ZS7A 3SJBA 1N6LA 4HAUA 4DCNA 1XD8A 2C5LA 1F6BA 1UBGA 2QM8A 4LX0A 2QN6A 2XZLA 2WOJA 3TIFA 3QF7A 1G4AE 1E9DA 4RCZA 1MABA 4Q4JA 4AD8A 2XEXA 1E4YA 1P2SA 3IHLA 3L0OA 4OL0A 4IVPA 2YHSA 5AUPB 5C46F 5J47A 4E09A 2WWGA 1J8YF 4IFBA 1FX0A 3R7WB 421PA 3UWKA 2JA1A 1OIXA 4HDQB 1UKVY 2GEDA 3UMFA 1PJRA 3QXXA 4BFXA 2KBEA 4A92A 2ZIAA 5AUOB 4P0TA 1SULA 4XIGS 2CJWB 2B8TA 1P9WA 1JXMA 1E9RA 1XD9A 1UADA 3GLGE 2PMKA 2QE7D 2OT3B 1GAJA 1N6KA 4DSNA 4O2LA 4PFSA 4KAXA 1JB1A 4LV5B 1RIFA 1C1YA 3CR8A 4BLSA 4CEHA 1W2GA 2ZUBA 2GJ8A 2GXUA 2CL6X 4EUNA 3VR2A 3EPKA 3EXAA 1FNNA 1G3RA 2V7QD 5J4VA 4L4UA 4BEBA 3OIWA 1KSJA 2HXYA 2ORVA 4Q9HA 1N6IA 2VH5R 3CNLA 4PC1A 1YKSA 5ANRB 4FCTA 1XD2A 3IIMA 1G4UR 3P27A 3OAAD 3Q72A 4IVQA 5TXGA 4OK6A 5LB2A 1OXXK 1ZC4A 4AIIA 1DAHA 3KKPA 4TT3D 2FGJA 2CMKA 1XJ0A 1DBSA 2GAOA 2J1LA 3EZ7A 2AD5A 4PPFA 4GT1A 2Z43A 4W5HA 2CL0X 5FOVA 1XEWX 2JCSA 2GZHA 4B75A 3UPUA 1GM5A 3DVLA 4V03A 2LKDA 1WP9A 4KV9A 2QBYB 2ZVPX 3RS7A 3ZZTA 2ZRFA 4NZYA 1T0JB 3U7FB 3ZYCA 2WWFA 1N3BA 2IYQA 1FZQA 2AX4A 5DO9A 1P2VA 3JZAA 1SVLA 5FBLB 4JJZA 1GRRA 3D7MA 3PR1A 3TVTA 2IS4A 3KJHA 2YC2C 1G8GA 1IBRA 1OFUX 1UPTA 1VHTA 3QG5A 2ERYA 2IYXA 2WWYA 1UBCA 4FMBB 2V55B 4GOJA 4GP7A 1C4OA 5EE9A 1D2NA 1JECA 2DFNA 3WNCA 1KDPA 5KSOA 4DLYA 1G8YA 3K0FA 1KI1A 1RRGA 4M1TA 4NBSA 1NVVQ 3GLHE 3ONWA 3ZH9B 1Y3AA 1YRAA 3EIQA 3DEFA 3CONA 4JVLA 1MH1A 4GP6A 2ZJZA 4ZV4A 621PA 3BE4A 3P4XA 1M7HA 4WAUA 5AWFC 4BFVA 1K8RA 2EFGA 2H5EA 2VBCA 1YZQA 3I1FA 4NYIR 2HYIC 1AIPA 2QL6A 1ZM2A 1ZM3A 2ZR9A 5FFMA 1VYUA 5FL3A 3ZQJA 3CUEF 1TMKA 3QPUA 4DUGA 2IXEA 3C5CA 4LJ5A 1CJUC 4NYJQ 2GJKA 2QTHA 3W5IA 3WMEA 1NMXA 1NN3A 3SQXA 5BWMA 2PX3A 4MRPA 5J4KA 5E7MA 2EW1A 3O8DA 1M6NA 1Q22A 3QEJA 4D0GA 3B1YA 3HU3A 4FWTA 4Y0VA 5CJ2A 1GZSA 4KBFA 4AY2A 1KNXA 4L8GA 4HB4A 3MMPA 2W2XA 4GZLA 2C9YA 4POAA 1NSTA 5TB5A 1SVKA 3SU8A 3C14C 4C4PA 1KO8A 3KL4A 1ZM7A 5L3RA 5JLJA 5SZIA 2BHRA 1KKMA 1G41A 1NBME 2P3SA 3OEEA 3U6BA 2FG5A 3LH5A 2XSZA 2GJAA 4N0EA 4ZDJA 4BFYA 4HAVA 1E4VA 1P60A 4US1R 1U9IC 3WY9A 2EU8A 1Q0UA 1SVIA 1W4BA 4XH9B 3A1WA 4C30A 5KDOA 3FDIA 4M9XA 3NG1A 2JLYA 3A4MA 1L7VC 4JLBA 2ZRHA 1G8FA 4LCBA 4NU0A 5DI3B 1EX7A 4Z1MD 1GITA 2D7DA 3NBYC 3UATA 1BYIA 4MGZR 3I72A 4US2R 1E94E 1YZTA 1P4SA 5DHAA 3K0AA 3NH9A 3TW8B 2R6FA 1UDWA 2G1KA 3WYAA 1ZINA 3HYTA 1Z6TA 3UKDA 2RGNC 4DSOA 1G21E 2I1QA 3GFTA 1FW6A 2IBMA 3AP2A 4XWOA 3RRZA 1E2LA 3K70B 2A5YB 4M1KA 5J5CA 4AYWA 1PZNA 3SI7A 1GRQA 3K9GA 3AF3A 4HLUC 1ODFA 1PLKA 5JBQA 4B34A 5EXPA 4F92B 5JWOA 3HJNA 4B3CA 2WOOA 2DFKB 1HE1C 1XXHB 2QP9X 1YE8A 3K0CC 1AKYA 4RFSB 5CLQA 4CIDA 2B92A 4LJ6A 5G3ZA 1OH5A 2GETA 4NYMQ 2GEVA 4JVNA 2OEPA 1RRFA 3IGFA 1Q12A 1JALA 4DSUA 5JI2E 2ZJAA 3QF4B 3QXJA 1JR3D 4DLRA 3PQCA 4QXAA 3HWSA 2XZOA 1T0HB 3PUXA 4B43A 1E0AA 3FPAA 5IDVA 3LXXA 1MO6A 1N2CE 4QHTA 2ASEA 1JI0A 2CHGA 4B3XA 3WRYC 1IJFA 2VHTA 4L16A 1RJ9A 2GHIA 2JDIA 4JLAA 2JLZA 1K6MA 3HP1A 4HDCA 3U3MA 3SZRA 1ELOA 1NVUQ 3CF6R 3V4RA 3CPHA 3BB4A 3QPWA 2ZRMA 2XXAB 4LHWA 3EW9A 4TN1A 2ZU0C 4DB2A 4C7OA 3AGQA 1MKYA 5CLLA 2CK3A
chains in the Genus database with same CATH superfamily
1CT9A 2V8OA 7ADHA 1FCJA 1HLDA 1QCZA 3DEHA 3WXBA 2O4CA 3HL0A 3QW2A 2AJBA 3OTIA 2ZS9A 2BC9A 1V3TA 4Q93A 2XB8A 1KH3A 5AVOA 3HDYA 1NXSA 4PZCA 1M76A 2CXXA 2ADOA 4NXNB 3DBLB 2QTWB 3VYUB 3SOPA 3FFXA 5LA6F 3S1SA 1Z0AA 1B3BA 4ZQCB 3E81A 2YIVX 3II6X 1JT2A 4DXAA 4ZGGA 1B1CA 2FN4A 1E6MA 1SG9A 2JD1A 2JCBA 1CS4C 1R0ZA 2JIZA 4J6FA 4QRIA 3MMXA 1FU7A 4AWXA 1VHDA 2YN2A 3C4JA 3EVAA 2FSPA 2V45A 3EQ9A 4PRYA 4PHCA 3D8NA 2P4UA 4TMWA 3ACCA 4Q9LA 3L82B 4D8UA 4HTFA 1IQ0A 4KMOA 3R0JA 2RH5A 2YC4C 2PWYA 1KZYC 4K03A 5BOVA 1DT3A 1V0JA 1ZRHA 2NUBA 1K2VN 1X13A 1OV4A 3FCYA 5AM1A 4I8IA 2Z1DA 1L0BA 4BO7A 3G9TA 2GEFA 5JYDA 3D8RA 3V33A 3VNSA 1W75A 2NVUB 3QU5A 4FFMA 3X0DA 2VQ6A 3KTAA 1YS6A 1J1IA 4BS9A 1ZPDA 5ARBA 1IEXA 3IDSA 2GRJA 2VC2B 2HOQA 4XAQA 1FUUA 2ONZA 3Q9SA 2GLTA 5I7WA 4PZUA 4CLDA 5F3WB 4XGQA 1NW6A 1CJKC 3G2OA 3ZXXA 3OEHA 4PO3X 2HSDA 1T36A 2NXNA 2ZI5A 3L07A 1N33B 3FTFA 5EESA 1KQPA 1WMSA 2PH3A 1G5RA 4GPD1 1JJBA 4WJZA 3TG8A 1WB6A 3GUYA 4WESB 5TC4A 1CUEA 4E0BA 5T4HA 4RSRA 5IXSA 3WRXA 3NVMB 5MN5A 4MUHA 1U28C 3VVLA 1YR8A 2QMEA 4BFUA 5GTDA 2GX6A 2E48A 3KT3A 1OX5A 3OWXA 3OX1A 3WLSA 3KSDO 4HT3B 4BJ6A 2CW5A 5KOHB 1A9QA 2WICA 3ZXSA 4R3NA 1ULUA 3MEQA 3E2PA 3QVXA 4PX5A 2D59A 2PHZA 1EK5A 2OV4A 3L6RA 1EGQA 2GHTA 4D4MA 1GUAA 1QWSA 1PYGA 1VJ5A 2QAGA 3N70A 2PT6A 4DLWA 1ORHA 2NNLD 1Y8RB 2NAPA 4GXNA 4L2IB 1N3LA 2BGGA 3AG6A 4ZTBA 5BSHA 5AKIA 4I4CA 4MUXA 1I01A 5DULA 4S1TA 1CUYA 4HWTA 5K2MA 2IITA 4B4WA 3O8NA 3AR5A 3KQLA 2PQ0A 4L0QA 1QZTA 3RVSA 4XX0B 3N74A 4P53A 5JATA 1QV6A 4KPEC 4JBWA 1N92A 1SIBE 2ZW9A 3INRA 1WDTA 3D5TA 3RBXA 4NJOA 3TS1A 2XCRB 1NJ1A 4I5DA 4NYIQ 3GJSA 3D6HA 2V58A 5FD8A 4AG6A 1W5BA 1RE1A 2E2WA 2XZDA 3CZ5A 3O75A 4G9EA 4MICA 4O4LA 1U1CA 2EZ8A 1QRDA 1XNGA 3AVOA 3CNNA 5TV2A 2XOKA 3YASA 1Z0FA 4JODA 5IK2D 2JA2A 4OLAA 3GP8A 1QF7A 2IYTA 1L6RA 4QREA 1O6GA 4U2CA 1G9TA 1EB9A 1G8SA 2JS7A 2ZOSA 5G40A 4F3TA 3KVOA 4FIDA 2OPBA 1O2DA 4O2BB 1Z5VA 2EJVA 4V0QA 2XYVA 4A0HA 3IQXA 3AUAA 3DDWA 1D2MA 1PW5A 3K92A 1FEZA 1XVAA 3P2IA 3ANTA 1XC7A 1SUEA 4WMLA 4B6JA 1LU9A 1U9CA 1ZSVA 4BDTA 5JAMA 5MFZA 1GVHA 3B6EA 3G2KA 1Q95A 5AUQA 2VRWA 2Z56A 2V7PA 2QP3A 3BE5A 3C74A 4BKUA 5K6RA 1WKVA 1T24A 2VWPA 1I33A 4DLUA 5EKUA 4MKRA 4QLOA 5JNTA 3B1XA 4LZAA 4EPRA 2W58A 1PR1A 1KO4A 1WB5A 2AGVA 2AOUA 4L1KA 1XYYA 4REMA 5GOZA 3GNLA 1EFRA 1JR6A 3HCRA 1CUVA 3ZY3A 4PSVA 2P2LA 4HR7A 1MQAA 1QK4A 4NG5A 4CFSA 5I01A 3BA1A 1KY2A 3GLHA 2A9OA 1OH6A 4DIFA 2NTJA 3RKSA 5GINE 2VHQA 5A6VA 5IARA 1W85A 5THKA 1DC5A 4TS4A 4B76A 1YIAA 4ZVTA 3L1UA 4Q16A 3C85A 4H18A 5FUWA 2H9YA 3RBVA 4XWKA 4DV0B 3U4QB 1YA6A 2B6NA 2J6IA 3JZIA 1E3IA 4KXXA 3SMQA 1IBCA 3TZ6A 4S2EA 4LPSA 3O3CA 3PHHA 4O5AA 4H6VA 1XZKA 5KQRA 5EMLA 3ZKWA 1YVUA 1F1JA 2I3ZA 5FP0A 1GPUA 1DJOA 1NL3A 2WKSA 2VYVA 3IXLA 3O9VA 4NU6A 1XTPA 1N6RA 3TTYA 1V25A 3FKJA 3TMKA 1PFYA 3U1VA 1N1DA 3UBTA 2H4YA 2CXPA 4FYJA 4LISA 3JASB 4EW3A 1CYEA 1GTVA 1JHUA 3VKUA 3ZNQA 1YH3A 3U0BA 3NUGA 2PCLA 2F59A 1OAAA 1P80A 4L78A 1KFKB 1BRMA 1RKUA 3I0MA 2AF4C 4YV7A 3KWJA 5A02A 2RHCA 1NLFA 5LQCA 1WG8A 1J5XA 4IFEA 1XQ9A 2D8MA 2IPOA 3HV0A 4DABA 4M53A 3FMVA 1W35A 3VRHA 1SCBA 2OVBA 3DL4A 5JWRA 2JFUA 2HXSA 3FF1A 3DXYA 2BV3A 2VP6A 1SVNA 1CR2A 3I04M 4RBNA 4IM7A 4D4GA 4PN3A 1IZYA 4FGWA 1NI5A 1PR2A 1XTVA 5CDUA 1RWKA 2OHIA 5C7IO 2A1UB 3SBXA 3MS2A 4M2LA 1SCUA 3HCFA 3AUSA 1SUAA 1JXAA 4PX3A 4IYRA 2Z8YM 4RHEA 4BP9A 1KEWA 3QLTA 4DXHA 4S04A 3C7DB 2BRUC 2OV6A 5BN5B 4BVJA 3GFPA 5DTJA 3WIVA 5IXYA 4UW9A 2HRRA 1YNSA 3FCSB 3W78A 5JD5A 4AK9A 2EKQA 3OZAA 3LRXA 3I73A 4U0JA 4P4SB 1W9MA 3WIDA 5KNCD 1ISHA 4G1BA 5CA0A 4CQLB 5AHRA 4TQGA 2XRMA 3O0DA 3LGAA 1O4WA 1X8JA 2XT0A 3CR7A 3FTDA 3AB3A 3G7UA 1FDWA 4Q0MA 1RXSA 4OXXA 3B2EA 1O5TA 2C4WA 1NR5A 1X7DA 3P9SA 1UK9A 4ZAYA 1I36A 1ZU5A 2PL1A 4P33A 4PEVA 5CVUA 1QRSA 3V46A 4ZREA 3DFZA 4GBED 1O9BA 1PVVA 1AURA 1NU6A 1S2LA 2HK6A 1W48A 2OAQ1 4GI2A 1UMDB 3KPYA 4INZA 4MW5A 3WFIA 4FOPA 4L6AA 5JD3A 2VWQA 4EGSA 1Z2OX 2JJYA 2P9JA 3I9JA 4CIVA 2XYRA 4LV6A 2BAGA 3ICWA 2CV2A 5LZ4A 2W6CX 3BWEA 3D0QA 1NASA 3JQDA 1E8MA 2H0RA 3OC0A 2H52A 3UWMA 4R6WA 3IJ5A 1OUMA 3RHSA 3JWIA 3W7VA 1KEEA 4PO8A 2ZRDA 2EP5A 1YOVA 4LZPA 1SOVA 1U1IA 1M2HA 4G4IA 4IWXA 2J3DA 1IBKB 3AMVA 2PUWA 4PQGA 2PGJA 1EE9A 3UJDA 4J3NA 4BNGA 2YXDA 4ZA2A 2XNKA 1E0DA 2E1PA 5TPWA 2XCTB 3GGSA 3KB2A 4IKEA 2HU2A 3L0IB 4LBVA 4CG2A 4KNWA 3T8YA 4HAZA 1Z0SA 2OSVA 1GXSA 1NJ5A 3ZWQA 1RTTA 1KIMA 2FUEA 1PLJA 3GJZA 1V4NA 4ZT5A 2GN4A 3AF6A 4Y2SA 4KWEA 3U4IA 3AEUB 3QI2A 3QJYA 1P62B 3IULA 2VJBA 2ZE5A 5EVJA 1K92A 1UOOA 4O0MA 1H85A 4NENB 4OGLA 5LCXA 1OVGA 4WX2B 1FDTA 4N5MA 4P93A 5HIIA 4F85A 1W44A 1Z3CA 2FP3A 1KSHA 2X8BA 3SHTA 2AOVA 3PK0A 3RD5A 4BN4A 4L5YA 4DCVA 4JT9A 1WUYA 4RA6B 1CWUA 1KGDA 4HLUA 4FXOA 1U2TA 1CRPA 3AP1A 3WLEA 3W4JA 3KV3O 5EFOA 3E7FA 5AI6A 2J9RA 5DV9A 1P9LA 2BTEA 4U7FA 2H4FA 2ZIXA 3HYNA 2YQ5A 1V3QE 4RJKA 5I9BA 4C7MA 1HDYA 4ZVQA 2I0FA 2JGDB 1ZH6A 4G5QA 2DH5A 1XR3A 1YT5A 2NO1A 5FI1B 1XBTA 1NUHA 4BWVA 5BN4A 5DBIA 3OY7A 3ZIAA 1HNNA 1FRQA 2ZPUA 2HK7A 3IYLW 1OFIA 3SKYA 1KO7A 5DNCA 3T3GA 3TLBA 3HYCA 4FR0A 1PEAA 1Z5NA 1IPEA 1Z0ZA 1RHQA 1ZDMA 2YVAA 4F2GA 2AN5A 3NJRA 4L3WA 3H9GA 3RRNA 2IHZA 3EBOA 4IZIA 1HE4A 1V6CA 1Z5GA 3E9QA 3UJPA 2O20A 2B20A 5CCEA 4V0KA 5I7SA 4KRXA 4D3XA 1N2XA 3VR6H 3T4XA 3T4EA 4RNDB 3BQNB 2LTAA 3B9BA 3UMYA 1J23A 4O6VA 5ARDA 4X66B 1K7XB 4KSBA 3RIXA 2FE4A 4NBNA 4YREA 3FPBA 3KR0A 4PAGA 4KAJA 1L2TA 2BEVB 2Q6OA 1Y6QA 4DWWA 1FQWA 3QU4A 4TWBA 4UBIA 4Y7CA 5H81A 4G8BA 2NPIA 4HUQA 2WB4A 4IIEA 5HM6A 4DT1B 1ZP6A 1IY1A 3W5AA 1Z36A 3NTRA 1RLTA 5JSZA 2UAGA 4ND6A 1T6BY 5LR6A 3NWOA 5JW6A 4R0VA 5TT1A 2V8BA 2C4KA 3V00A 4DMUB 2YWGA 4KBGA 4C2TA 1I30A 1NOJA 2VPPA 4NC9A 1QFXA 4DRXA 4Q6BA 4NEQA 4CE6A 5IG2A 3RS3A 3UK6A 4DCOA 1UAAA 1MG0A 3PRKE 3U44B 5CNIA 1D5WA 1P5HA 1SNYA 1Y1SA 1R4MB 3G9XA 1VFPA 4R9NA 3VOTA 2EBFX 4UTRA 1AGPA 1PK9A 3Q5EA 3VJRA 3WWDA 3IHKA 1F12A 5HTOA 4FZRA 2VJKA 2X1LA 4XGNA 5B36A 3HNOA 3IMFA 3G0GA 3MERA 2G06A 2IU6A 1F17A 2QUZA 4LDQA 1QH1A 3WLQA 1X86B 2QXTA 2PZAA 1CF9A 3ADDA 1EYZA 1LRKA 4HAOA 4R1NA 4UE6A 3ZHRA 4JQCA 2VDNB 3LUGA 1VL6A 2PVPA 5HCIA 4LS3A 1OFHA 1THMA 1TO2E 2EG5A 1R88A 1XF1A 3PLNA 5DYNA 2VSOA 3KLOA 2UUBB 4DMKA 1XGKA 1XHLA 1RI4A 4JB2A 4DG8A 5CVJA 1XQXA 1CRQA 2XTMA 2ZJ4A 3D0OA 3OBBA 2OQVA 4RO0A 3SX2A 3E23A 1UF9A 3KXKA 3WZLA 5ADHA 3CLSC 3LO5A 1Z37A 3N6XA 3STWA 3TAHA 4GW3A 3RRFA 1QQ7A 5EPUA 3ICPA 4KRYA 4B5LA 4D42A 1QHHA 4I66A 4C5BA 3KXPA 3B9RA 5KCZA 4FS8A 2NUAA 5KNBH 1TLLA 2LV8A 4WY8A 2GK4A 3DFIA 1TQ4A 3ZW8A 3KL2A 2R86A 3S40A 1W8DA 5A5EA 1VG0B 4QHYA 1T8PA 2C4HA 2FP4B 5KWIA 3ZY6A 1P1BA 1YZVA 2DULA 4JYMA 5F64A 4BEJA 3RRXA 4G5FA 1P2FA 2O6HA 2ZBVA 1DAFA 3N7AA 1NJ6A 3ZHTA 1OROA 3M33A 3I83A 3T9CA 2AOTA 2P9TA 3CCCA 3EW7A 1UT5A 1YDEA 4XA8A 2A30A 1E9EA 3AVQA 3MRVA 4BCCA 1HYHA 4Y1RA 4YAOA 5KC9A 5ISMA 4UEWA 4L8YA 2XI4A 4WK4B 1M8GA 4B81A 3RSCA 1NXTA 1PF7E 1O8BA 3MTEA 5TQ0B 1L5GB 2P3QA 4QFMA 4F9FA 2WJ3A 3LOPA 2R1TA 4CKCA 2Y2UA 4XZ3A 3PGMA 1B0PA 1OU0A 3IT0A 5E1DA 3T12A 5LDDC 3LDGA 3P0RA 2IH4A 2NNWB 3NC0C 3T4UA 2IOFA 1AUXA 1LK5A 2O14A 2ROQA 2ONYA 2FMIA 3P9XA 3WICA 4IIJF 4XXHA 4BV9A 4K87A 4BKOA 2DCUA 2BFMA 5CXSA 2A67A 4L5CA 3F98A 4TGLA 3G59A 1ZNZA 1BMDA 3I2IA 4DDTA 3MTQA 5AD1A 3ZU5A 3LFTA 4CT4B 4OB7A 4EW1A 1KFJB 4U2BA 5CMLA 4YQZA 3ODPA 1WXEA 5SY6A 4YAIA 3WNCA 1BKSB 2UZ4A 4PYRA 3GNQA 1CQJA 5IKXA 2EG9A 1G60A 2R1UA 1J2YA 5G0UA 4EIWA 3RTGA 2F9LA 2P90A 3PQ4A 4OHVA 1K4YA 4I1UA 4LC0A 4Q3EA 1M2EA 3GEHA 2I80A 2G8LA 3UV3A 1X7WA 1JQ5A 4KMMA 1OT3A 1GAWA 1I3MA 4YCDA 1H8HD 5FCDA 4Y2QA 4CCSA 4OKNA 2RCYA 2YJTD 5J5AA 3CX7A 5JJLA 1WRBA 5KI6A 1ZNQO 1ECFA 3DZ8A 4G5RA 2PU7A 1G5FA 3IR6A 2NM0A 2I7XA 2GCPA 2A86A 4K6OA 5F35A 4D9GA 1MC1A 2O0LA 4ZT3A 2MJLA 2C7QA 3TFQA 2EBHX 2H59A 2MSNA 1QKIA 1I24A 2IEZA 2OORA 4D8VA 4DIMA 5B1EA 4BQQA 2B83A 2B2CA 1QIIA 2R87A 1O94C 3GT7A 4J0DA 2PRZA 1KO5A 3BC1A 1TM3E 1GQRA 1AKMA 2D5AA 3EIOA 2ALJA 1SKYE 3EZLA 5A3QA 3E22B 3NI2A 3K0FB 4ZDWA 1LNQA 4JFAA 2AZDA 1LRLA 2WSBA 1M7BA 4XR9A 3PLAE 3OURA 1T15A 2XMRA 1ODKA 4D7AA 4I7EA 5AKHA 5KCMA 1QE3A 2X5OA 1EJ0A 1H1TA 3RI3A 4B3MB 1A7JA 1L4YA 1VKOA 2GYWA 3HI6A 4U8GA 2WU4A 1D2HA 3ZWMA 1XEFA 3QFCA 1R5BA 4Y7DA 4F9GA 821PA 1NPYA 3L4KA 2FDCA 2MTBA 3UCXA 1E9SA 1QIGA 2PFKA 3MS4A 1OFGA 4N5NA 2CDRA 4KAAA 4RZIA 1L3BA 2XIQA 5HQ3B 4IDHA 4D79A 3RABA 2PIAA 3HADA 2AG0A 4PHTA 2O2ZA 4Q7KA 3EUEA 4HB0A 2W8BA 2PQ6A 5ALRA 1Q91A 3B36A 4OFWA 3LLCA 3WZMA 2VHVA 1ACLA 1GQQA 2N47A 1VA4A 3OTOB 5KOJB 3DHNA 1LLCA 3X1WA 4IH4A 1SBZA 4DMGA 1U7HA 2AKAB 2BM8A 1GYQA 3ITEA 2WTXA 4IUDS 4LPKA 3GG9A 2PQMA 4EB0A 3QWHA 4B6QA 3N3BC 3N53A 2F8TA 1R0SA 2R4TA 3GOQA 3TM4A 4FFPA 3WB9A 3OSZA 2J7PD 4E21A 3CPEA 2YYZA 3DEYX 2G17A 5FIUA 1E6UA 3CT6A 4OJMX 5ER6A 5GP1A 2WD8A 4EUHA 1K4KA 1MN6A 1TCUA 3N05A 1CP2A 2YZ2A 4MWBA 5DFAA 3U4HA 3D6VA 1WQ3A 2A9RA 4MKIA 4NF2A 1P72A 2AS0A 4I3HA 3BOSA 3RKUA 4EAAA 4MS4A 3WK4A 1H3NA 1OSNA 4Q18A 3TI7A 4IJQA 3RFFA 3JQFC 1N2BA 2G71A 4P98A 5K3SA 4KN5A 3FZYA 2JVIA 3C48A 3F5FA 3WSVA 1OD6A 1Z6ZA 1DZIA 1SQGA 3HUEA 3I2KA 1U8CB 1W49A 4TUYA 4UNNA 4URZR 2VIIA 5DM2A 5E8RA 2ANBA 3TQFA 2BEKA 1VE7A 2E4VA 1A04A 2NSHA 2OK8A 3R3HA 2YH2A 3E58A 2L18A 1YZ3A 3UWOA 3GPIA 4O08A 4WJKB 5MGNA 3ZDBA 3LW7A 1A9PA 1E1KA 2IPLA 3L5KA 1TLTA 5JHGB 4OHRA 2QI9F 1Z68A 1DGQA 1NMSA 1LJLA 4Z5XA 4EFNA 3R6TA 4LMRA 5ICSA 1N0WA 2BGTA 3OLZA 5H3LA 1SQ6A 1WR8A 1SG0A 2DWQA 2H4WA 1JIUA 1HGXA 2X3YA 2Q8PA 3BMOB 4P35A 3TMYA 3VPBA 2WQ7A 1RXVA 4DLBA 2PSJA 4UMFA 5DTIA 1ATIA 3PWTA 5KTPA 4ZVNA 2FEKA 4RTMA 1WVMA 5KB3A 1U4NA 3EHEA 4ZVVA 5HFJA 3R7LA 1LZLA 2ZATA 4LCEA 2DBQA 4EMTA 3COJA 2ORWA 1EFVA 4MW9A 3CNQS 1GQSA 1ULHA 3ZI0A 2H2DA 3N07A 3ZIDA 3IT3A 3CNEA 3UB4A 3T1VA 3T1YB 5JD4A 2OQIA 3CVUA 4TVKA 4WCVA 5JARA 4E5KA 2FLVA 3GJRA 4PANA 5CEJA 1YRLA 3DDZX 2DP4E 4HRAA 2ARKA 3E5HA 2VDUE 4LHYA 3UJ9A 4LE2A 2BOVA 1KU6A 1MXFA 2AWOA 2QD4A 4YAFA 4C7KA 5I7HA 2V9PA 1ILEA 4TLBA 2D2VA 1THGA 4FS3A 1XZBA 2P68A 3A4TA 3RFVA 2J59A 1BD3A 1BOOA 1I7LA 3FGPA 1KJJA 1GCIA 1Z83A 2CUZA 2XWJI 3P97A 1VB3A 4GKJB 2FSVC 2BMAA 3WKEA 2F64A 3DO5A 4GKVA 3NOVA 4IHQA 1UKYA 3FNEA 3IDOA 2GK7A 5ALPA 2Q3DA 1W2WB 4FXPA 5AOCA 3L18A 5IEJA 5JTTA 4V39A 4ODIA 5AHXA 5BUCA 3IUPA 4EMBA 3X1DA 1FP4B 4ZOQI 3QVOA 4HVAA 1LFAA 2DFVA 2J5QA 2DUJA 4LZLA 4NH4A 1LC0A 1VXRA 5GIOE 3PNYA 3ESYA 3EPJA 4KCGA 1PZEA 3ZS8A 1I2DA 3MJVA 4XARA 3ORYA 1A2BA 1QRAA 1VFNA 2AWNA 1TOAA 3T1OA 3F90A 3I92A 1EEHA 2E1RA 1DXQA 5FTNA 3QX8A 4OX9B 3R77A 2REOA 1I2ZA 4IEEA 3P1JA 1ZK1A 3IH5A 1D0IA 3KUKA 2QQEA 5CDGA 1M1NB 3TGPA 4PNPA 3C7TA 4V0RA 2B5VA 4PQRA 1U2GA 4NCAA 3C3KA 3KQMA 3ESCA 3WL3A 5B57C 1KQOA 1N5IA 1OZAA 2P1ZA 3HO1A 4JLMA 1N8KA 2OV3A 3B8HA 4B7CA 5AVTA 1NFFA 2HT6A 1JF8A 2RDMA 2FRXA 1G9XA 1H6AA 3BHNA 4M37A 4QU9A 3A0RB 2DWCA 4LZOA 4HGQA 4K46A 2JPDA 1WW2A 5JS7A 1LI5A 4XFKA 5CM2Z 3E1KA 4D0NA 1IBLB 4ROTA 3GRRA 3RK1A 3ROXA 1CQIA 5AVWA 5F98A 2C7RA 2PUEA 2OFXA 1T6XA 2GZ3A 3H5WA 4Q3CA 3E18A 1GQFA 5AFSA 2YWBA 3N5CA 1QV7A 4QPZA 3QELA 1JLLA 1H8ED 1N7HA 1RYYA 2V03A 4IGKA 3WHKA 4Z7JA 1NOIA 4NMXB 1VPWA 3OOSA 2FEXA 3FYSA 3ZD9A 1OHHD 5KNCH 4N7JA 2UYCA 1PJ2A 5AK4A 5IAJA 4MJ7A 3LP6A 2O7NA 4UU7A 1LSOA 2HGZA 2CFOA 4M83A 3WP0A 3ND6A 4LJAA 5AXAA 5LWHA 3UK2A 1PJTA 4NESA 1DRVA 3BREA 4XYBA 5E7QA 4ZAWA 1T3ZA 3GQBB 4LAFA 2P2SA 4GGMX 1T5OA 1F5SA 5L3VA 2VDOB 2HMYB 3LBIA 1PSDA 5EJMA 1TPYA 3H83A 3EF0A 2PJRA 1YWGO 5AVYA 4HN4B 5MDHA 1RLMA 2P2CA 3UMBA 5DTQA 1Z18A 1BXGB 3ZEIA 5CYGA 3DV0B 2R8OA 4FDAA 4HLNA 4P7JA 5D8DA 2RHTA 3RJ9A 4AZ3B 4NBVA 2BF7A 4MUIA 5JI3E 1ZK3A 4WECA 5DX8A 2CUTA 2C4TA 2E89A 5CR9A 1W93A 2A14A 1JW9B 2PFGA 5FPSA 4RPKA 4LY6A 3BGIA 5FFFA 2V5VA 4IO0A 3ZJTA 3DM5A 1ZQ1A 1GCGA 4TZ6A 2VDWA 4P08A 2NZ2A 4YMWA 3R40A 4I2VA 5GAJA 5D51S 2W11A 4M0EA 5K8TA 3KK0A 4W5WA 3W90A 4GQIA 3DOUA 5KWJA 1Z4PX 1MT0A 5C5CA 1DQPA 1RHUA 2E37A 2OZLB 3QMMA 2QIOA 4G0YA 1IAVA 4MEJA 4UHJA 4LFCB 1XK7A 4YMLA 1DAIA 1E92A 1J5EB 4RTSA 3SJUA 2C3YA 4XWAA 4A3SA 4TKVB 3HVJA 2CNBA 2Y0EA 5GZ6A 3C1OA 3VSDA 4JI0B 5HTKA 1DXOA 1AGRA 4LSZA 4R01A 1A5TA 5DNYB 1F8YA 4LOJA 1E7MA 3ZE7A 4RXUA 1O5OA 1XP8A 4ZAXA 5HDQA 1H2EA 4KFRA 1OKKD 4J1TA 3RARA 3W8DA 4KACA 1DINA 1QXSA 2NU7A 3B85A 3U0VA 2W6MA 1F6WA 3JQ8A 1O5IA 5BP7A 1G38A 3HABA 3IQDB 3VMMA 5BWNA 1XQ6A 2VHCA 2XUHA 2ZR0A 3LJKA 1FYWA 4CW7A 4MGYR 1ISPA 3BRWD 3THYB 1XJQA 3U9TA 1SHKA 3AP3A 1GFWA 1P9NA 4TV9A 3PFGA 3EVFA 4V38A 1C3EA 1OW3B 3T95A 3ZV6A 3KYBA 4B2LA 5JC8A 3FHJA 1BCSA 1Z6YA 1BHSA 1JHXA 2XGMA 3JD1A 3ICCA 4B48A 1JQJC 4OI4A 1VGRA 2QE6A 2RGYA 3CHYA 3JALA 4G5YA 4MDHA 2C2HA 5JZBA 4PZAA 4CEIB 3ZWNA 1UIRA 1GU0A 4IX1A 4GR5A 1DKRA 1OGJA 1ZD9A 2PUGA 4QJ5A 5F7JA 1VLMA 3CH5A 1Z73A 5DLQC 4BGVA 2IZ6A 3D3WB 4KLCA 3CA8A 1XZPA 3E1SA 4QBKA 3USZA 4ESHA 5M7EA 1HQYE 1SBIA 3M4XA 2PL3A 3CEMA 3W05A 5KTMA 1N78A 1YDGA 2RBKA 3CEJA 4TL6A 4E7PA 1LSUA 2GAJA 2NLOA 3JD0A 1EXNA 3G2PA 4GFDA 4D6PA 3L4SO 1EAMA 2G88A 5AI9A 4Y18A 4XYLA 1R0RE 2V1XA 5T5QA 1CUIA 1UDXA 1KI6A 1VIDA 4MITA 2JGNA 1EK1A 3IC5A 4W7HA 1CXZA 2WT8A 3KJQA 4R9VA 1EM8A 1A71A 3GBVA 2EGGA 4AX8A 4KDEA 5FOSA 3S8YA 2BTQB 1CR1A 2BHLA 1IB0A 1QQTA 1CS0A 3K72B 3HG7A 4UCWA 4PTZA 1BAPA 5SY4A 4D74A 3HACA 5CG2A 1MDFA 1UXKA 1XZAA 1LDEA 2BEWA 1HEYA 1N5DA 3HA7A 2NU9A 4DQVA 4XRGA 4HS9A 4LHSA 4MMZB 2Z9BA 4YRKA 4Q21A 3FAZA 1X1CA 5EGNA 4PHGA 2YJ4A 2DPMA 2WLTA 3NONA 2V7TA 4B4KA 4J7XA 5ENVA 2W4MA 4P2GA 2QSUA 1NBHA 3FWKA 4FDVA 1G0OA 4Q3NA 1P7WA 3V42A 4D82A 3D4OA 4BU0A 2C7PA 1VRCA 2XVAA 5I5EA 5TY0A 2CE7A 1EDOA 3Q88A 1SZPA 3F4LA 1KK0A 3K5PA 4OKIA 2GLUA 3RH0A 2UYGA 4EX7A 2OLEA 4D0LB 3VC7A 1JH9A 3FBTA 1QNLA 2FX2A 4UTZA 2QG4A 4JIGA 3LCRA 4NCKA 2QK4A 1BHJA 1QG4A 5IM4F 2ZWVA 2HA5A 1EVZA 2Y71A 4MV6A 4RY8A 3VPXA 3KSBC 1E3WA 4I1SA 3OZDA 4F21A 3A1TA 3HXPA 1OGYA 1KI4A 4EKYA 4BZZA 3IILA 2DG2A 1ZOPA 2WI8A 3I37X 4XTRA 4OPMA 1TTPB 5JWHA 4NZNA 1S2OA 3B6IA 3GLSA 1EWVA 5CFMA 4ZFNA 5JADA 2C9DA 2JD0A 1MAAA 2E0IA 1PZXA 3KQTA 2HGSA 4JUAA 6GPBA 2X7XA 1YCGA 5G4KA 2J3MA 1G19A 2ZSEA 3FPSA 4MV9A 4EVSA 2I4LA 1RPTA 1CG6A 1N6OA 2PUJA 2ZSJA 2VI5A 2WKRA 3H97A 1WETA 2K87A 4OJYA 1E1RD 3HMKA 3G79A 1GG5A 3KQPA 5EKDA 2A58A 2HO5A 1Q3KA 2ATCA 1ZN9A 3DTNA 2FPKA 5KHOC 1P1HA 4A0RA 1KDVA 3MWLA 3U60B 1IEQA 4J0GA 1II8A 2CFIA 2R2AA 1P39A 4JIMA 5AW6A 4EUSA 3AU9A 3M49A 3AO0B 3DW1X 3N0VA 4RLFA 2QY6A 3U31A 4DIBA 1NFRA 1K1EA 1DV1A 3SM3A 3INYA 1WMDA 1IHDA 2GKSA 2Z5VA 3R3UA 3LUFA 1N2ZA 4W5OA 1SCAA 4P38A 3IKMB 3TQOA 3X44A 1RLJA 1RKVA 4ZOLB 4IJUA 2P5SA 2WJZB 3UIEA 4B33A 1IUOA 5AKXA 2I4RA 3C24A 4UEQA 5HILA 2RG1A 2XWQA 1UK8A 3P0JA 4TWJA 2B2NA 2FEOA 4L95C 4PIVA 3VMFA 4LNUB 4RKWA 1LTQA 2HIAA 2I3AA 4B9AA 3VZQA 1J99A 4XB2A 1LDGA 1I10A 3NVDA 3WGYA 5I7EA 2RONA 3MJEA 3IAHA 1D9XA 4IV0A 1JE0A 1VIMA 2VJOA 2P8SA 2GTIA 3RKRA 3VR4H 4MLDA 1JJAA 5ARCA 1NIPA 1B0UA 1M1YA 4IDGA 2C3OA 1GP2A 3OQIA 4INJA 4DY4A 2I8CA 2XNDA 3A6PC 3O1JC 2JJ2D 2ZB3A 3TINA 4O2AB 2PEZA 3PTLA 5B6PA 3I76A 3ZE1B 3HBNA 4JI8B 3BL5A 1LLFA 1N2CB 1HR0B 4B6OA 1D2CA 4N18A 2M9MA 4NFSA 3T3MB 3VYWA 1REQB 2ZRPA 2R6AA 3IT2A 3K09C 1JPNA 2R7KA 1K3TA 3BGOS 4CODB 5KYWA 4EEXA 5J4HA 4OJQA 3BH7A 1NC1A 1YQEA 3RUFA 5A4IS 2EVWX 2YXBA 4QRDA 2ORED 3ZV4A 1EX6A 4AN4A 1PQPA 4LTDA 3WL4A 5GJWC 1J07A 1VKJA 3TFWA 1W1WA 3JU3A 1V8BA 2FHPA 1RC8A 1JLSA 3HR7A 2GN0A 3HWRA 5JVDB 4CTOA 1T3LA 2X0NA 2Z6UA 3RV3A 1IOWA 5L7YA 4O02B 1B6RA 1SJ9A 2P30A 4NECA 2IGTA 4MP6A 3MGAA 5NULA 1ID8A 2VG8A 4FSXA 4CTMA 1JH8A 1RI5A 3KYDB 4KYUA 5A06A 4Y3UA 1EI9A 1JMKC 1S6YA 3GD7A 2HMAA 3H84A 3NHBA 1JDVA 1NF9A 4OHMA 1U8FO 3B5IA 5BPFA 5GVSA 3OLWA 3JAKA 4NULA 1N5OX 2IE0A 3ZXYA 1CUUA 4EF4A 3CE9A 1NN5A 4WFQA 4O3MA 2HBQA 3C5HA 1YS4A 4JC8A 3WOVA 6ABPA 1VCMA 3D5QA 1RRMA 3C0KA 4KFTA 1MG5A 2RHHA 4HDSB 4WASA 4YN3A 3WRYA 4A36A 1T4DA 3UW3A 1L4EA 1PJ4A 3H6HA 3VPDA 2MHCA 1LPBB 5K6TA 3J81k 3B3AA 3QUTA 1JSZA 3UJHA 4IHJF 4FNOA 2VBIA 2R8PA 5EE1A 1SBHA 1AKUA 1YB6A 5EXEA 2GCOB 3V2UA 4XB6B 2C2WA 2PGDA 3HMQA 4F91B 3X1YA 1RBZA 2YKGA 1GT6A 1QR2A 1G4HA 2BFEB 1M2GA 4PIPA 3VYVA 2YBDA 4B4OA 1J8VA 3LF2A 4JMPA 1ORWA 4YONB 2ZBEA 1ZCJA 4DT1A 1U6JA 2QX6A 5EUMA 2M6LA 1TA4A 4GUAA 3OEYA 2PBZA 5AHWA 3QVMA 4ZOLF 1AGXA 3QE2A 5EJFA 4PSUA 5TF4A 1NQXA 4BB0A 1DFGA 2RD2A 3WLTA 3DCNA 1QDUA 1OXSC 5K0SA 4PSKA 1SHTX 3RTEA 4EG5A 2HNBA 1I4EB 4JZYA 5AKLA 5E9WA 4C3ZA 1PDWA 3LDHA 4MIOA 4O2RA 4BNTA 3JQBA 1XTQA 5DLPA 3KCQA 1HQKA 5A4AA 1B23P 2VRNA 1UBHS 5AK0A 1J2JA 4ZGWA 1Y6ZA 4EKDA 1YRBA 4QE3A 1LBIA 4XQ0A 3MAGA 4W9RA 1SRRA 3AJRA 4ARZA 2C2GA 1SVSA 2O5VA 1V5FA 3PU6A 4FLMA 3PLRA 4KE7A 4L0CA 3SQDA 1O0CA 4M55A 3UCEA 1XVLA 1TUIA 1XA4A 2D54A 2GDJA 3L8EA 1IVSA 2HBYA 2Z3WA 5CCBA 3CIFA 1P3Y1 4FHEA 4F8JA 1K6IA 1TT5A 3HKBB 4M0CA 1F0KA 4B71A 2V97A 3ZHBA 3OKFA 4BATA 3AJEA 2N46A 2YNMA 3I30X 4AXXA 4BFCA 5A9SB 5CT9A 3X1JA 4O2AF 3B53X 1OB2A 1O8CA 3GMTA 1QIJA 1JHZA 1SWVA 2FW0A 3MD0A 1JKMA 4N49A 1VZ3A 3I04A 4DM3A 3DD1A 1YI0A 1ZWKA 1TQ6A 4G4JA 4CLRB 4L8VA 2VO1A 1I5OA 5KJ6A 2MMGA 3LUDA 1M2WA 2ZETA 3R6WA 3WI7A 1CIJA 4JUIA 1BDHA 1FRZA 2WU8A 1GLNA 1VE9A 1Y4UA 2Z8YA 3H2HA 3OLCX 3W8EA 4OH1A 2I7DA 5JVDF 1U5CA 5E3IA 4DA4A 3RRYA 2UXDB 3IOBA 3CG4A 5HFNA 1BO6A 3MJ4A 2K4MA 2NVWA 4AF6A 4JT8A 3N2KA 1VPEA 2B82A 2OXIA 6YASA 3T5AA 4DR6B 2Z1MA 4IFTA 1SHZA 2BFFB 3OOEA 1Y6JA 2O7VA 3CR3C 4DL9A 5HSGA 1SXJB 4EJMA 1DDGA 4H7JA 3UCFA 3NDBB 3VM6A 3X1XA 1VP3A 2PNFA 4MQEA 4XPZA 1U02A 3F3YA 1HOTA 3GPDG 4HDRA 4XIFA 3G8CA 4TYMA 3LRPA 5E6UB 1ND5A 3QMWA 3EARA 4ZGBA 1WSBA 1GQYA 1X3SA 4X1KA 4BGUA 3E1GA 2W6IA 2VJAA 2XR1A 5JDCC 1OIWA 3AF1A 3UPDA 4YEDA 1L5WA 3OQHA 3PQ2A 2JCVA 4QOJA 4MYHA 3RVKA 3ZU4A 3G23A 1ZIXA 4KQWA 4ZTZB 4RLSA 3DE6X 5CYPA 1K8XB 1U90A 2WF9A 3GAMA 3B7GA 2IXFA 1BDJA 1RC1A 3A6DA 3N6VA 2QSZA 3ZBQA 1EZZA 3OLXA 1WCV1 1QM5A 1NWHA 3AR6A 5AXDA 3S1AB 3K6SA 1VBKA 2HJVA 5BQXA 4CDNA 2JLQA 1T8RA 2JAOA 2N42A 4NWIA 4R1QA 3OE7D 3CLRC 3WX0A 4FMCB 4Q3KA 4US0R 3HBFA 3IAM1 4QKQA 3HXQA 2C61A 2CYAA 1Z08A 1MAWA 5LBUA 1LA2A 4BJ1A 5IWCA 1MJ5A 3KR9A 1Q0ZA 1XYVA 2AIRA 3OF3A 1WY5A 2H5LA 4AS2A 1RKBA 4RIHA 4ARSA 4PHFA 4D8XA 3K2EA 4BX8A 5B4VA 4YP0A 3NBQA 4EATA 1YL5A 1BIFA 5ICCA 2JD2A 2D0IA 3COZA 2FZ5A 1UJ2A 4UHFA 5L6MB 2I9KA 2IH5A 1R0YA 5F52A 5F78A 1H2HA 2BUBA 3VHXB 4CG3A