1Q45A

12-0xo-phytodienoate reductase isoform 3
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
380
structure length
365
Chain Sequence
SNETLFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEYYAQRTTPGGFLISEGTMVSPGSAGFPHVPGIYSDEQVEAWKQVVEAVHAKGGFIFCQLWHVGRASHAVYQPNGGSPISSTNKPISENRWRVLLPDGSHVKYPKPRALEASEIPRVVEDYCLSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQYGGSIANRCRFLKQVVEGVVSAIGASKVGVRVSPAIDHLDATDSDPLSLGLAVVGMLNKLQGVNGSKLAYLHVTQPREEEAKLMKSLRMAYNGTFMSSGGFNKELGMQAVQQGDADLVSYGRLFIANPDLVSRFKIDGELNKYNRKTFYTQDPVVGYTDYPFLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of Arabidopsis At2g06050, 12-oxophytodienoate reductase isoform 3
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
molecule keywords 12-oxophytodienoate-10,11-reductase
total genus 132
structure length 365
sequence length 380
chains with identical sequence B
ec nomenclature ec 1.3.1.42: 12-oxophytodienoate reductase.
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1q45A00
3DAQA 3O63A 1H60A 2GQ9A 3HPSA 2QCDA 4ZQRA 4BWLA 4MVAA 2QCCA 1FQ0A 1S5WA 5F4SA 3WJZA 1Q3NA 2I9EA 4LVFA 3WJWA 3HOJA 2VKZG 2CW6A 3FYPA 3LHWA 5AC7A 4HNNA 4GUFA 2X16A 1FDYA 4NXKA 3U8GA 3RK8A 3BW4A 1LTDA 1C29A 1XI3A 2A7PA 1LDCA 3CIWA 3M5XA 2GJLA 3L5LA 3WJYA 1X7FA 2Y70A 1JUEA 3KXQA 3SJ3A 3QZEA 3EX4A 4QAIA 1XBYA 2JKEA 2WKJA 1F73A 1SU5A 2FJKA 2QCFA 5LNUA 2YX0A 3NQGA 3W7QA 1GT8A 2Q8ZA 4HIBA 1ML1A 2DZVA 1MEWA 2A7RA 4LT9A 4OV9A 4UNLA 3PUDA 2ZYFA 1RV8A 3TU9A 1IXNA 4S1FA 4RZ4A 3NL5A 1KFJA 5K9DA 1LOSA 2G96A 3LI0A 4M7TA 3R2GA 3UY7A 4XWUA 3W7JA 3C3NA 1M7PA 1VZWA 3BVJA 2V82A 4PEKA 3TJXA 5LHEA 5AC6A 3A22A 4ICNA 1LBLA 4X9SA 3CB8A 3I7SA 1QNVA 2WPBA 1LROA 5IBXC 3MYOA 1QOPA 4M7SA 3QQ1A 1QFEA 2GJNA 3QEZA 3AJXA 5D2VA 3RLUA 5LGXA 1VH7A 3W7GA 1QPNA 4FX6M 5CZTA 1Q6RA 1P0NA 2VFEA 1W56A 3FOKA 3UNDA 1KFBA 5BW6A 2X1RA 2ZRYA 5HMSA 1YXYA 3NQ8A 4O0KA 1OABA 1GVRA 4O1CA 1VGAA 1OFDA 2GVJA 1KTNA 2DZTA 2ZTJA 1ME8A 3NQVA 2C14A 2JGQA 5CZ0A 2YGYA 4MFEA 2NX3A 1YTEA 2X2GA 3NQMA 1TJPA 2Y6ZA 4GXMA 4QITA 1VRDA 3RMJA 2A1YA 1YTKA 3G1VA 2HSAA 1SO4A 3VE7A 4O13A 3QMTA 2B7NA 3MUXA 2X1SA 3DGRA 3DI0A 4O17A 3S1VA 3BW3A 2ZBTA 4Y90A 5HR6A 1ICPA 1WV2A 2J9XA 2Y62A 1ZJIA 4QIUA 1SW7A 5HWMA 1DQXA 1VPXA 5KMYA 3K30A 1L6SA 4KWWA 1SUXA 2YCEA 5HQEA 4LVAA 2BZNA 1G4EA 2DP3A 1WYIA 4G1KA 3QPZA 3NPUA 3LCIA 3H55A 2A4AA 1H51A 4N4QA 3B06A 1W3NA 3SR7A 3MP3A 1W3TA 1FCQA 3MMTA 1AL7A 4PL2A 1QAPA 2H8XA 3ZR4A 2BXVA 3W1QA 2E09A 3PC0A 2V5BA 2HTMA 1T0OA 3LHTA 1W3IA 2WSQA 3N73A 3KHJA 1KBIA 4ONVA 3W70A 6TIMA 3A9IA 3G0XA 2GQAA 3GIYA 4RXFA 5AYXA 3G1HA 5BMXA 3NQ2A 4HN4A 4N4PA 1X6UA 3ABQA 4PH6A 4K7YA 4Z0JA 4OWGA 3GKAA 4MZYA 5DY3A 4IUOA 4ZQNA 1I2PA 4IX2A 1AW2A 3SY5A 4JTTA 4HKPA 4NNAA 4UMCA 1EWDA 1NSJA 3GDKA 2WSRA 1SFJA 4IMGA 4KWVA 1K8ZA 1TPWA 4ZQOA 3UZ5A 3STEA 3B03A 3A5VA 3LRLA 2B7QA 3IIZA 4OGZA 1SQ7A 3HGOA 3OVRA 3NAVA 4MYAA 4IX0A 5C6MA 1XCFA 3PS7A 4MZ8A 3W7OA 1TIMA 5C2XA 4NJIA 4RLIA 5IBXA 3CM4A 1R46A 1W8SA 3NOEA 1EUNA 2QAFA 4JD4A 3QYQA 3FKKA 2CLFA 2ZA2A 4MJZA 2ZZ6A 2LLEA 3G1SA 4ZVJA 1SZEA 1YADA 3KOFA 1P5BA 2ISVA 3QSTA 5LSMA 5HWJA 3BO9A 4HSOA 5EL1A 3FJLA 4O15A 3W2MA 1D3HA 2QCHA 3I65A 3PSVA 4J9JA 5DELA 4EF9A 2V81A 3TQKA 3Q58A 4ADUA 5C54A 1BWKA 3R12A 4HSNA 1H7OA 4Y8FA 1RQEA 3RLVA 2XN2A 5G2IA 1KM3A 2ZZ7A 5DBTA 1K7FA 3W71A 4BI5A 4DBDA 1XFBA 2VFIA 2VEIA 1YXCA 4O14A 1I45A 1W5OA 4NX5A 1MZHA 3QJAA 1RD5A 3QM3A 3TROA 1IXOA 4MY9A 4FHAA 1B3OA 4UFKA 3GYEA 4A3UA 2OT1A 4LRTA 1OF8A 2VFFA 3NZRA 2VEMA 4GUIA 3LLFA 3TKFA 1PIIA 3V1PA 3W76A 3UZJA 4WJEA 3GDRA 3ZWSA 4ORMA 2NWRA 2E5BA 3G1AA 1WAUA 4IMDA 5L9FA 1S5VA 2CZFA 5CG7A 2E6FA 4UR8A 1TV5A 3W72A 5G5IA 3LDVA 1DKWA 3GAYA 1H7RA 2NUYA 5FF3A 3FS2A 2ABAA 3STCA 4NJJA 3DZ1A 4O1DA 1FWNA 3ZS4A 2ZRUA 1LLWA 3YPIA 4H3DA 2NXHA 4IMFA 1K8YA 2R94A 1T99A 5AFDA 3UY8A 1K8XA 1DBTA 3TJLA 4YCOA 2QR6A 1X1OA 3C2FA 1TSIA 2I14A 1L9WA 1L6YA 2ZTKA 3PY2A 4O8RA 2PRLA 1ZY9A 3L9CA 4LC6A 1G7UA 4BI6A 1LBMA 2UV8G 2B7OA 3EXRA 4JTUA 3PM6A 1PL9A 3W7NA 4MY8A 2CU0A 3W7DA 3W22A 1LLZA 1R2TA 3P61A 1V7YA 3H53A 1TRDA 1SW3A 3L5MA 3QFEA 4DEFA 4IGHA 2ABBA 2EGZA 2TSYA 2YXGA 3NQDA 3GLCA 1BTMA 2ZZ3A 3W7LA 4UR7A 2CLMA 5FF4A 3TXVA 3ZFHA 3N34A 3U2OA 3FFSA 2H90A 3IEBA 1TMHA 4UIOA 4JYDA 4HNTA 4K38A 4MYXA 3BK0A 1TJRA 3LCFA 5A5WA 4YMZA 3W2LA 3W07A 2VEPA 2QKFA 3INPA 4Y9AA 2FPYA 2IQTA 1G6CA 3GR7A 4O12A 3NDOA 2TRSA 3KVLA 3EWZA 1V5XA 3P7YA 2NV2A 5CGQA 3F03K 1KW1A 5KTLA 1AW1A 3TX9A 2V2DA 4MUZA 4FNSA 2CLIA 4EIVA 3O6DA 3GXPA 2C1HA 3Q2DA 4X22A 1W0MA 4Z08A 4K6AA 3NG3A 1XKYA 2EF9A 4AXKA 1H1ZA 4FNUA 2BTMA 3TW7A 4LW7A 4WUIA 3OVQA 5CPNA 1FXPA 3HJZA 2D73A 5G2WA 1H61A 3UWQA 3W7IA 2DZUA 4MLRA 4LS2A 3UWUA 4RCXA 1KFKA 3M5YA 1UBSA 3W84A 3T7VA 1M7OA 1MEHA 1GZGA 1TCDA 1H1YA 4BWLC 3C4UA 2Y85A 2VOMA 3G1XA 3MW7A 1NVMA 3QW3A 4AF0A 1B4EA 1RPXA 1TPB1 4Q4KA 2V2CA 3NPWA 4GE8A 1KTBA 1FCBA 1GG1A 1N55A 3THQA 3IGUA 1FWTA 4LUJA 5AB3A 3S0CA 3MP5A 2X30A 1P0KA 3NQ7A 5TIMA 1NF7A 4TU1A 1TREA 4WOZA 2WNZA 4QSHA 3EX3A 2XFWA 3C8FA 2WQPA 3EWXA 1RZMA 4D2JA 1FWSA 4Q32A 1HUVA 4WXZA 5ABTA 5EPDA 3TE9A 5HWNA 1VQTA 3W9ZA 1YYAA 4O54A 4DF0A 3P81A 3BLFA 2OCZA 1KTCA 5LNVA 3I68A 3C61A 2NUWA 1YPFA 4AHPA 3RF9A 2A0NA 4LUIA 3GDLA 2XN1A 1SSDA 4JGDA 4DELA 1XM3A 2Y61A 4L4LA 3VCRA 1TQXA 1T8XA 4JTLA 3L66A 4WY0F 3TQVA 4PC8A 3GDMA 3H54A 3QSRA 4XBSA 3LXCA 4LVDA 2J6XA 1FWRA 1OX4A 3KVKA 2WNQA 3N9SA 4Z1DA 3IVSA 3W85A 2OMAA 4O0ZA 5K4ZA 4AF0B 4KKXA 3M1ZA 3QF0A 3TK7A 5HUOA 3BG3A 4RX0A 1XBXA 3HG5A 1P1XA 3W1MA 4JX6A 4IOTA 5F1UA 4LVBA 3M7WA 1A5SA 2KZHA 5I3KA 3NYZA 3IIXA 2CZEA 2Q3OA 2ZZ4A 5BOOA 4MLJA 3T55A 3PR2A 3N3MA 3CQ0A 4RR4A 2FIQA 2QUUA 1ME9A 1LRNA 1QMLA 3U6WA 3CLMA 4Z1BA 4AAJA 5D30A 5K3VA 4OHQA 4XKYA 4UMBA 3N19B 4LNYA 3THAA 3ABOA 2QUVA 3UWVA 5D33A 1W5MA 3M0ZA 4GC4A 4CNNA 1ZHAA 5TBOA 3S1WA 3GXTA 5K2ZA 5SWUA 2V8ZA 1VJIA 4M5PA 5FF0A 3G1DA 3DH7A 1YXDA 3G18A 3G8RA 3F4NA 3TIMA 3TR2A 2QJGA 4YCPA 4AVFA 2ATSA 5AHLA 3PBWA 4CCCA 1TPVA 2YR1A 1TPC1 2Y63A 3NM3A 5AC8A 3SIZA 1F74A 1B9BA 4EF8A 1LM1A 3CPRA 3P8JA 4O4WA 5H2ZA 4OQVA 4TR9A 4N2YA 2V0TA 1TTQA 1TV7A 1DHPA 4B5NA 2BX7A 1W5NA 2QCMA 2TPSA 2CWNA 3DU0A 5HUPA 4FNPA 5HJLA 1LRQA 4WXYA 3M9YA 3R13A 3TMQA 3MI6A 3W7MA 1C8VA 3LCWA 1HO4A 4K36A 1NF0A 1SFLA 3ATYA 4UTWC 1LRTA 3G1FA 3PSWA 2FQIA 4QM1A 1ADOA 1SO6A 1D3GA 3HG4A 2CZDA 2WO5A 3UPBA 5K7JA 4LS1A 2C15A 4AWUA 3EWWA 2NZLA 3AO0A 3C2RA 4MY1A 4UFIA 4TX9A 1GVSA 3TA6A 4ZZ9A 3FLUA 3NQEA 1K3UA 3B4UA 4AWSA 3E12A 5HR7A 1KM6A 3W1LA 1GOXA 5KZEA 4XTIA 5F4XA 1SR9A 4YL2A 1SO3A 4ZQPA 1DL3A 3G24A 1YDNA 5AHIA 5J5DA 4DPPA 1DV7A 2HS6A 4TO8A 4DF1A 1I2OA 3EB2A 4OU1A 2ATMA 1W5PA 5C55A 3ABSA 2ZQ0A 3W23A 4KFOA 2CLOA 4U28A 1A5AA 4JR5A 3C52A 1OYCA 1NFBA 3STGA 5BNKA 4AH7A 1K02A 1LCOA 2OZ0A 4GNJA 4NXSA 4CCEA 1YDVA 1NAL1 3EXTA 3GNNA 1OX6A 1KFCA 3IRDA 4N9EA 3IVTA 2ZFAA 2YPIA 4JX5A 4GWEA 4MZ1A 1ZENA 3KRSA 1AK5A 1AG1O 1Z42A 5DN1A 1LZOA 1H50A 2QCNA 3STFA 3OBKA 3TFCA 4ZQCA 3L0GA 3MHGA 2P1FA 1FBAA 2GVLA 2YW3A 1I2RA 4I7VA 3WJSA 1LORA 2G5WA 1KBJA 3CIXA 3TMLA 4UFJA 3QMSA 1I2QA 1OFEA 1AMKA 1QO5A 1ZAHA 2CLHA 1IGSA 2ZRWA 3PF3A 2H3DA 3LI1A 1JCLA 3MP4A 3FYOA 5EA9A 3TSDA 1Q6OA 5FEXA 3B8DA 1TPFA 4HHPA 3T4CA 2J9YA 1WOAA 3LCXA 3IIVA 1X1ZA 2Z6JA 4YXGA 1ICSA 2E1DA 3NA8A 2J24A 5I3FA 1IIHA 4QISA 1HTIA 3PBUA 1IXQA 4UXDA 1T96A 1CX9A 4FX8A 2ZZ2A 1BWLA 3MHFA 2EPHA 1JCMP 3G8EA 1WA3A 2QCDB 3PB2A 3SGUA 1A50A 3QH2A 3FIGA 3QC3A 2Y7EA 1K03A 1VCGA 4QNWA 4E38A 3O07A 2QDHA 4ZQMA 3W2JA 3LTSA 5F2MA 3GR8A 3NVTA 2VFGA 1ALDA 3I6RA 1FY6A 2E5CA 4BFAA 5G1TA 3DHDA 5EKYA 3P74A 5CSSA 1I4NA 1Y0EA 5F4WA 1O5XA 1TTJA 3EWBX 1QR7A 3VI2A 3OVPA 2A85A 3WK1A 1XL9A 1FUYA 4I9AA 1JQXA 3M41A 1A5BA 3PULA 5EBUA 2Y88A 3KX6A 1TTIA 1MSSA 2OX1A 2ZDRA 3LHVA 3BLEA 8TIMA 1UUOA 3W88A 1JQVA 1IXPA 1VHNA 1PHWA 3CEPA 5CKSA 1M6JA 5CSRA 3P84A 3HPXA 3B04A 1J5TA 5HNRA 1TYGA 1G4TA 3LRKA 3JS3A 1Q6LA 2Q3RA 2C3ZA 3GNDA 3TW6A 3F1QA 4JTSA 1SW0A 1OF6A 3TSBA 1TRIA 1PE1A 2WJZA 3DBPA 4O50A 1CI1A 3ATZA 4K7VA 4E2DA 1LOLA 2PE4A 4A2SA 4FNRA 4M19A 1IIGA 2VXNA 2RDTA 1UASA 1OFBA 5T26A 2E5DA 4UTIA 1BKSA 4JIPA 4IPJA 5LGZA 3B0VC 3W74A 3PUOA 5I3GA 3I7RA 2X1UA 3M16A 2WV8A 3UXDA 3NQCA 1VS1A 5K4XA 2WOQA 4Y6GA 3W7RA 1K7XA 2V30A 1KM0A 4P61A 5EYWA 3NQFA 3T78A 1WBJA 2BWGA 2PCQA 4O16A 1WOBA 1FDZA 2YYUA 3GAKA 2V5LA 1EIXA 4JY9A 2Q8LA 3LBMA 1S5TA 3E49A 2GUUA 1OFQA 1PCKA 4UCGA 3BG9A 2Z2UA 3W7PA 2YDAA 3TNOA 4MPQA 4H4IA 4A2RA 5D32A 2F84A 4S2CA 3TQ0A 1FCUA 3JRKA 3LHUA 1QO2A 1VC4A 3IVUA 3CTLA 3E0IA 1KLZA 1L2UA 4NJGA 3L5AA 3P82A 4FF7A 3G22A 1SPQA 4GBUA 1XDLA 4R53A 3HGJA 2QCLA 3P67A 3IIPA 4N9BA 1VR6A 3LX9A 4BK9A 4WY0A 3W1XA 2QAPA 1DORA 5LHFA 3W7EA 3B0PA 1JJKA 2BSLA 1W31A 3NPXA 2NV1A 4LWWA 1R47A 1JUKA 2NLIA 2NX1A 3PBVA 2NUXA 5DCBA 4EVZA 3WJXA 4ZMGA 3W2UA 4NVTA 2FTPA 3BPWA 4UTUA 4NUWA 1GVFA 2HS8A 1VHCA 1C9DA 1N7KA 2VENA 5G1YA 2FLIA 4HPXA 2HMCA 3LGEA 3BGGA 3RU6A 1VYSX 2Y7DA 3W3OA 2ZA3A 4RXGA 3OA3A 1F2JA 2OJPA 3T44A 2R14A 3HGSA 4RK8A 5DXXA 1TB3A 5IM51 3O6YX 4XBKA 4FNQA 1WDWA 3UWYA 3NL6A 1LOQA 4H6KA 4JN6A 3S5OA 3IV3A 2B0MA 1JCJA 2C0AA 3NR0A 3DI1A 1GTHA 5H91A 1D9EA 4O1AA 1R2SA 4N6FA 4HNVA 2O7SA 1QOQA 5KSWA 1BEUA 3V75A 1CW2A 4DXVA 1KV8A 1OFOA 1XDMA 3I7QA 4FIRA 1EP1A 4GJ1A 4UFHA 4JYFA 3N9RA 3MYPA 3S1XA 2DZXA 4O19A 3N14A 1ZAJA 1FCVA 1HL2A 2NX9A 1TV8A 3ELFA 5E0KA 2YFOA 2RFGA 3D0CA 4Z1CA 3P62A 2J88A 1HG3A 3SFKA 3DFOA 2YZRA 5D02A 4IJBA 3FA5A 4IPIA 3CWOX 3UPWA 3C0JA 3MJYA 4UTWA 5BMWA 5J5RA 2RDWA 3NO5A 1GG0A 2W79A 5D04C 4M6QA 3C56A 4GFSA 4WD0A 4MIMA 4DO6A 3TSMA 2F7FA 5FEWA 4TMBA 1Q45A 2E6AA 3C2OA 3LRMA 1EX5A 4JNMA 4JYEA 3TC7A 4RV8A 1QWGA 4E2BA 1W37A 4QNEA 4DPQA 1ZNNA 2AQWA 5K9XA 4S2BA 2R8WA 2FB2A 3UWZA 5D05A 4K8HA 3L0NA 4RZ6A 3NXFA 4NNBA 3ZWTA 2ZZ1A 4CQAA 3GK0A 4L4MA 1OYBA 1RVGA 4MKNA 5FEPA 4ADSA 4AHQA 3R89A 3Q37A 1N8FA 2P0OA 3KAOA 4DF2A 2QCGA 4JTKA 1Z44A 1W54A 5G2HA 4IXXA 4I7WA 2A5HA 1GPWA 4O53A 4UNKA 2PURA 4FIQA 1UUMA 2QF7A 3LV6A 3NL3A 3HG3A 1KM5A 3M6YA 3DFPA 1SZGA 3MI3A 3W75A 5I3JA 3SZ8A 3N2XA 3WK3A 2V2HA 3DFQA 5I3IA 3PVFA 3NQAA 3TFXA 2CLEA 5DCDA 1XUUA 2EKCA 4K8EA 2C18A 1AL8A 2FPTA 5LZLA 1HO1A 4JY8A 2YSWA 2DORA 4LTSA 3UQNA 1B4KA 1G4PA 3HQ1A 1O4UA 1OFRA 3A21A 1F6KA 4QJ1A 3M43A 1MO0A 1DQWA 2NWSA 6ALDA 4DBEA 3DKJA 3W1AA 2DJLA 3P5ZA 4POCA 2C16A 3OHIA 3LHYA 2R91A 1JRCA 3L21A 3VNDA 3BG5A 3SW6A 2ZRZA 2DZPA 2CLLA 1TTPA 1Q6QA 1FXQA 4O28A 3KRUA 3TUUA 5LNWA 3OIXA 4X2RA 2ZA1A 3MHUA 2DZSA 5LNRA 4FNTA 5F2GA 3W1TA 3MBFA 1WBHA 1ME7A 4JEQA 3IGXA 4RJEA 4NNCA 3ABRA 2OT0A 3HG2A 4LRSA 1OK4A 2A6NA 5CZJA 1KM1A 4PODA 3L2IA 4UUIA 2NXGA 2JGYA 1RR2A 3L0KA 1ZAIA 3VE9A 2VELA 1HFBA 3W1UA 1TPUA 3C6CA 2H3BA 1QPOA 3KVMA 1PCWA 2QUTA 4N02A 1GJPA 3G3MA 3KFTA 3S5NA 2RDUA 1WXJA 2W0UA 1LP6A 1MEIA 1F5ZA 1YLVA 2YYTA 1A5CA 4CNPA 1H63A 4JXCA 1GVQA 4RZ5A 5U4NA 1H62A 4U4MA 1JULA 3TCEA 2VC6A 3WK0A 1YTDA 1JCXA 4O11A 1LYXA 4PCFA 2TMDA 3TDFA 4O4VA 3UD6A 3MI2A 4JTEA 1J4EA 3G1YA 5D38A 1OYAA 2DZWA 3OEXA 4GUHA 1EA0A 2GVGA 2QJIA 2WNNA 3NZ1A 3T40A 4NJHA 2JK2A 4FB7A 2GOUA 2CZ5A 1GYLA 3B05A 4AB4A 1OHLA 5KINA 1UJPA 2J9ZA 1XC4A 3CU2A 4Z0SA 1DOSA 4JTJA 1RQHA 4UTJA 3W83A 1PVNA 2CFFA 1OVDA 3HMJG 4HNUA 3GVGA 1EPXA 5D2TA 4XUGA 3EX6A 3BGJA 4XKYB 2TYSA 4KFPA 4Z1AA 1VLWA 3O06A 3BARA 4AWTA 3GKFA 1YDOA 2V9DA 2W6RA 4JTIA 3R8RA 1XBVA 1F05A 2ALDA 3S6DA 3LOTA 3GXNA 4W9TA 2ISSA 5D09A 3CT7A 1THFD 3ANYA 4WZHA 2Y89A 3EKZA 4XQ6A 2GPTA 2NXIA 1RQBA 4UTLA 4WQ6A 1UB3A 2C13A 5G4EA 1DJQA 1OFPA 3LXAA 5BRBA 3PAJA 5CPLA 3W1NA 2Y7GA 5DLCA 1FDJA 4R7JA 5AYZA 3LTYA 2B4GA 2QDGA 1SZFA 4NU7A 4O18A 4O57A 4JTHA 1Z48A 4LU0A 2RH9A 2XN0A 5EMUA 3W73A 3NNTA 4QQ3A 3QRHA 1E51A 3VFLA 1QDSA 1OX5A 1O60A 5DCEA 1XXXA 1H5YA 3MWAA 4R33A 2G95A 1J2WA 4A22A 1KFEA 1X8FA 5HINA 4TIMA 1JVNA 1PS9A 4NX0A 1U5JA 3FEMA 4MOZA 4NJKA 4P2VA 2A2IA 3S9YA 3G0SA 3KRZA 1WQ5A 4LV9A 3SECA 4K39A 4UTTC 1O95A 4IQLA 3TH6A 4R34A 2GQ8A 3LBCA 3A5FA 3S5ZA 1ZCOA 2Z6IA 3SGZA 4PL1A 1TPDA 3DXIA 5K9CA 3MBDA 3DHFA 3S1UA 3CC1A 1F7BA 5E1QA 1JCNA 2VEKA 3PG8A 1SZNA 3NGJA 1TQJA 5D2YA 4A21A 4UTTA 5AHMA 3A23A 1PV8A 3EWUA 1O94A 4AEOA 2PRMA 5LNSA 1TO3A 1EP2A 3PUEA 5AN7A 4EOUA 5KZDA 4AHOA 3HF3A 4FX7A 2X1TA 3C2VA 1GWJA 3BW2A 4Y96A 4UTKA 1I8JA 3CHVA 3O6CA 2RHGA 3P60A 2ZZ5A 3LB0A 4UFLA 2ISWA 3BV4A 4OE7A 3DENA 1FWWA 5L6UA 1ZALA 3EWYA 3IGSA 3N2MA 3SI9A 3UWWA 4ORIA 1KLYA 3HO8A 4IMEA 1O5KA 2I1OA 1KM2A 4PFMA 2E6DA 2Z0IA 3B0UX 2VFHA 3UYCA 2ZRVA 4NZFA 4DQWA 1M5WA 4KFNA 5LKYA 1JCYA 1PHQA 4LC8A 4HT3A 3NM1A 5AYYA 4DO5A 1R2RA 3G0UA 4LS0A 2FFCA 3EEGA 2ZRXA 4JDYA 3TC6A 1EUAA 1SSGA 3E96A 2H6RA 4DO4A 4GRSA 4XZ9A 4ALDA 2A6LA 4M6PA 4IWWA 2FPVA 1U83A 2E68A 3W1PA 5AHEA 2AGKA 4Q33A 5C5YA 3LTPA 3USBA 1KV5A 1EEPA 4WX2A 1S3HA 4YLWA 4FEZA 3LLDA 3PB0A 3EKLA 3VKJA 3HIJA 2JBMA 2EAWA 4JIQA 4C1LA 1W1ZA 4LOCA 3LXBA 3EX1A 5CPMA 3CEUA 4I7UA 4ADTA 4AMAA 3RFAA 1WX0A 1XUZA 2BLEA 2QCEA 5FI8A 3IIOA 4UTHA 4PTNA 4OT7A 3LCHA 5HULA 2RKXA 1KA9F 1F76A 1DVJA 2PC4A 4C1KA 3L67A 1GVOA 4JX4A 3L68A 5AOUA 5E93A 4JDBA 2G97A 2EHHA 3DFNA 4CNOA 3FJ6A 3LCLA 1ICQA 4A29A 3W7HA 3S8HA 4XTDA 3GX9A 3FKRA 3G3DA 5DBUA 5F2LA 4BF9A 2B7PA 4ML9A 1YPIA 4NZJA 4GUJA 2A7NA 2E77A 4OBTA 4LY8A 1F6PA 3W2KA 2YFNA 3L65A 5D03A 5EY5A 1OX4B 1TPEA 1A53A 3TAOA 3BLIA 2VFDA 1ZFJA 4NT0A 1B57A 3MO7A 4M6VA 4JTFA 4CLMA 2J27A 4N9DA 3TV8A 1EP3A 4OV4A 1P4CA 5AHFA 3LERA 5KZMA 1H7PA 5F1VA 4MJMA 1VCVA 1G69A 4WY0B 5FEZA 4UC5A 3UXAA 1R30A 1OK6A 3R5EA 3EX2A 3P5YA 5GVJA 3EXSA 4UFMA 1EB3A 1OFAA 1VLIA 3GB6A 4X3ZA 3HGRA 1Z41A 3NEVA 4JICA 3HBLA 1FX6A 5F2IA 3W86A 1W5QA 3O15A 3OG3A 1QPQA 4LVGA 3QW4B 5D2WA 2JKAA 2Z1BA 4JTGA 5D2XA 5FF7A 1JRBA 2YW4A 2WSYA 3M5VA 3E02A 3P8IA 4FXSA 3W6YA 4IXHA 1VYRA 3NQ6A 1EWEA 2Y7FA 4FO4A 2C19A 3TAKA 3W7CA 2CLKA 3NL2A 3DFTA 5D37A 1GYNA 1TPH1 5CPOA 3HPZA 3QMRA 4UMAA 3S42A 4NQ1A 3M47A 2H8ZA 3W1RA 4CCDA 1XBZA 3HB9A 5U7SA 5I3HA 1JR1A 3NPVA 1NEYA 1K7EA 3C2EA 1DJNA 4TMCA 2QEZA 2C6QA 4BI7A 4CQ9A 4IMCA 4UTMA 4N6EA 1SO5A 2O7QA 3KVJA 3LHZA 3QQ0A 5CZSA 3PBYA 4RKAA 3O1NA 4WOQA 3GDTA 3SSJA 2AAMA 2E6YA 5TQLA 4N9CA 4EWND 1JUBA 1MXSA 4O1BA 3W2NA 4HPJA 3P80A 1KM4A 1QPRA 2FB3A 5DXYA 1IF2A 4O52A 3Q94A 5A8GA 1UCWA 1VCFA 2QJHA 7TIMA 1H7NA 3A24A 5G4WA 3W87A 3O16A 1G67A 1QCWA 3CWNA 3M5ZA 2ZCGA 3PWAA 3QPYA 4LV4A 4ZL1A 4FXRA 4BR1A 1G4SA 1H7XA 3RNDA 3LCGA 3JR2A 3O8AA 3E9AA 1VYPX 3LM7A 3GZ3A 1ONRA 2DJXA 3WFAA 1H7WA 4JS3A 1OG0A 3W7KA 3S5YA 3F4WA 2DU2A 4K37A 1GEQA 1KFLA 3PG9A 4GUGA 3M44A 2PRHA 5DY2A 3TXZA 3LV5A 4YWIA 1I2NA 2JKPA 1LBFA 1L6WA 5FESA 2P10A 1GQNA 4MFDA 1G7VA 3DKLA 1AW5A 5FF2A 3WK2A 5KITA 5MHBA 4CQ8A 4PA8A 3O05A 2FDSA 1OJXA 1GTEA 4O10A 2A21A 3DFSA 4E0CA 5AHNA
chains in the Genus database with same CATH superfamily
3O63A 2GQ9A 3N6JA 4Q4QA 1UP0A 4ZQRA 3EB4A 3AC0A 1VFSA 2D2HA 1IWBA 5F4SA 5A69A 4HYWA 3HOJA 2VKZG 3RHGA 3PZ9A 2VGGA 3DDMA 4C6OA 5GJNA 1FDYA 5HPOA 1SVDA 3ARQA 3BMWA 4DYEA 3H4GA 3IUIA 3WJYA 4JHOA 3LMZA 1RLDA 1UP3A 3MUZ1 2ZE3A 1C3FA 2QVHA 3IJQA 3KXQA 1EGMA 3E2SA 3UNTA 1XBYA 3AIBA 1M65A 3RJXA 1PUDA 2QCFA 4XAYA 3SM0A 1XYBA 1ZJAA 5E70A 3QVQA 5A2BA 1JCTA 3USZA 2PTDA 4DX3A 1TMQA 2A7RA 4MB4A 4L5ZA 4JFWA 4F9JA 1EJXC 3HZ3A 3NL5A 3T4WA 1LOSA 2G96A 4P7QA 3QZAA 1C7TA 4XWUA 3W7JA 3C3NA 1M7PA 1VZWA 3BVJA 1RVKA 1PWLA 4NI3A 3KBJA 5LHEA 1M1BA 1MDRA 3A22A 1KD0A 3CB8A 1QNVA 1LROA 2DIJA 4MWAB 3MYOA 2GJNA 1GCYA 1XRTA 4E8DA 1YPXA 5LGXA 1Z69A 5I03A 2DQWA 3GNOA 1VH7A 3W7GA 1B0IA 3VDGA 4XD3A 3FJ4A 1QPNA 4FX6M 1Q6RA 1W56A 2GK1B 3FOKA 3GFYA 3GG7A 4HZ8A 5E09A 3N13A 2XIOA 4OBRA 1EZ2A 4R85A 1VFMA 4CN6A 1OABA 1C8XA 1KRCC 2GVJA 3ZT6A 1KTNA 2DZTA 3VIIA 3NQVA 2C14A 4KESA 4Q8NA 3FA4A 4JBRA 4C7GA 4PMJA 5CZ0A 1YTEA 3EDDA 3GTFA 2Y6ZA 3BSGA 3UETA 1IEQA 3LBOA 3MVTA 3MO4A 5HNUA 1UKPA 2I5GA 2D2OA 3QY6A 4O13A 4DJFD 4CEUC 3QMTA 3MUXA 1RCXB 1TIWA 3K46A 4XZHA 3WLMA 4ZFMA 4B5VA 5MF5A 1WV2A 2BHUA 1TV4A 3SB0A 1RH9A 1DXEA 1ZJIA 4AU0A 3F2DA 4QIUA 3TYZA 1V51A 5KMYA 3K30A 1H2JA 2YCEA 4NY2A 4PUWA 2DP3A 1QATA 4G1KA 2D1ZA 1TZZA 3LCIA 2A4AA 5CSUA 3GH4A 1S5NA 4PZVA 5M5DA 1W3NA 2VP8A 2DSZA 3SR7A 3MP3A 1W3TA 1X6NA 4MKSA 3IAPA 1UPMB 4LEFA 2ZXBA 4TUFA 2H8XA 2WJEA 4GYFA 4FLSA 2W63A 3QC0A 5A6SA 1K6WA 3W70A 2XGZA 1L6GA 3AS2A 3BLPX 3P93A 4RXFA 1IWAA 8XIAA 1RK5A 5I5RA 3NQ2A 4JIIX 1QI0A 4HA4A 4OWGA 4MZYA 3GYCA 2G0WA 4HP5A 1I2PA 1EJVC 3T0CA 1VEMA 4PMVA 3L7RA 3SY5A 4JTTA 4QGCA 3CB3A 1GJWA 2XH4A 8CGTA 4Q8MA 3I6TA 1CXFA 1BKHA 3MKCA 1ESWA 2D69A 1QI5A 3LY0A 3A5VA 5H6HA 3WO8A 4IG2B 4OGZA 3HGOA 3OVRA 2ASHA 4TX6A 4ZCWA 3W7OA 1TIMA 4RLIA 4RDVA 2XGIA 4JD4A 5EU9A 1WKFA 2QJNA 2ZA2A 1CGYA 2LLEA 3G1SA 3KOFA 1P5BA 1TJ0A 1F8IA 1E4NA 4HSOA 3CTTA 5ECVA 3PWGA 3KBMA 3FJLA 3UJSA 2ZWYA 2DSUA 2UBPC 4EXQA 3W2MA 3PSVA 3I65A 4J9JA 4EANA 2V81A 1VBGA 3COTA 3QOKA 5C54A 3KOXA 1BWKA 1CB7B 4L64A 3AMLA 2OWCA 4Y8FA 3RLVA 5EBAA 1WZAA 5DBTA 3FGCA 4BI5A 5I6SA 4GD0A 1I45A 4QE5A 4D6GA 1MZHA 1RD5A 1IXOA 4PTDA 3RMEA 2WNWA 3VZYA 9RUBA 1OF8A 1XPYA 2QULA 3PTMA 3TKFA 3W76A 2A79A 1A5LC 3NYDA 4UTFA 3ZWSA 2YCIX 5L9FA 3FVDA 2CZFA 1FFRA 2X1IA 1DKWA 5FF3A 3OLDA 3STCA 3VXGA 3DZ1A 4EPDC 3ZS4A 2ZRUA 2NXHA 2R94A 1RPKA 4WR3A 1T99A 1ADSA 5AFDA 1UPPA 3UY8A 3GHSA 2X7WA 3TJLA 4PTVA 1X1OA 3BSMA 1BWVA 2Y5JA 2I14A 2X42A 4X9YA 4O8RA 4LC6A 4PRWA 1XWYA 4XAPA 3WQ5A 1ZL1A 3VOIA 2UV8G 4HU0A 3OIHA 1QK2A 2INEA 3B0YA 3W7NA 2CU0A 2YCLA 1LLZA 1V7YA 1EO7A 1XH0A 3QFEA 1ZBVA 4IGHA 4DBWA 3BOXA 4EE9A 3NQDA 1V8EA 1R9ZA 4JCMA 5FF4A 2FVMA 5REQB 3A64A 1BXNA 4HNTA 4MYXA 3BK0A 3LCFA 3CUXA 1V3KA 1MVYA 2XWEA 2PEVA 1ODUA 4GVFA 4WIWA 3TC3A 4AZ5A 1Q6CA 5CJMA 3ARTA 3BCFA 2NV2A 5CGQA 4FSAA 2J62A 2XZ7A 2X2YA 3RM4A 3B8WA 2DV0A 4WKHA 3RG6A 2VRQA 1GUVA 1TFVA 4MUZA 4FNSA 4EIVA 3O6DA 2CBIA 2VDGA 3M0JA 2YLLA 2G3MA 4GQGA 4I5UA 4X22A 4Z08A 3V36A 1NFGA 3PZMA 4HOWA 4KCUA 5EMMA 4A3YA 2E1WA 3HJZA 1PEZA 1H61A 3NUKA 3BZJA 4EPBC 1VFLA 4LS2A 1DWAM 2VC9A 3T42A 4B3KA 2BG5A 4WKAA 4AF0A 1YNQA 4V1YA 4Q4KA 1UD2A 2DT0A 3NPWA 2GQ3A 2J47A 1GJUA 3CMGA 2OEMA 4EPEC 3THQA 5TIMA 1AUSL 1NF7A 1TREA 1E56A 3H7UA 3Q4DA 2XFWA 4W5ZA 4LBSA 1RZMA 1L6FA 1BXCA 1HUVA 5IOBA 5EPDA 5E6YA 3W9ZA 4DF0A 1JNDA 2H9AB 4GINA 4ERAA 5LNVA 4LAUA 1IT7A 4N0RA 4PB4A 1AH3A 5HANA 2NUWA 3VOHA 4AHPA 4LUIA 1PZ1A 4DELA 4L4LA 2F2KA 3VCRA 3WQVA 4MWAA 1TUFA 1TQXA 1T8XA 3L66A 1R8LA 4Q4MA 2ZX8A 3I4EA 2PBGA 3QSRA 3MDWA 2Z27A 3LXCA 4AD4A 3KTCA 2PI6A 3KVKA 4C6PA 2J13A 2VCBA 1L2QA 2NQ9A 4YYCA 3K4WA 2WQDA 3CT2A 5K4ZA 1JDAA 2RJHA 3M1ZA 3QF0A 2WC4A 1GORA 5HUOA 3RYSA 2B31A 1KGUA 1EOKA 4RX0A 3UYIA 4D72A 3GS6A 1M41A 2KZHA 5D9OA 2CZEA 3KS6A 5G1MA 2HZGA 1LQAA 4ZSTA 4P7NA 4ZE4A 3N3MA 1I60A 1ME9A 3U6WA 1EQPA 4Z1BA 4RPPA 4AYGA 4XKYA 3GHUA 1CB2A 3N19B 3KZSA 2QUVA 3UWVA 5D33A 1S2VA 1W5MA 4GC4A 2ACRA 4CNNA 3S1WA 4YVPA 5K2ZA 4F9DA 4GMEA 6CGTA 4QCEA 3DH7A 4H6QA 4XV0A 3G8RA 4DN1A 4DXXA 3TR2A 3TYUA 4CCCA 1TPVA 1KBBA 4NP7A 5AC8A 5IFTA 3VIMA 3CPRA 2WCAA 3P8JA 3ZT7A 3BANA 2R1NA 4OVXA 2CHOA 1DHPA 1E6SM 1JZ8A 4I90A 3LMYA 2CWNA 4JHMA 5M3WA 4DJDC 3U48A 2AL1A 4IIFA 4DWDA 4WEVX 5IDIA 1DXIA 4YNGA 1XINA 4KBXA 4E3TA 5TNVA 1M53A 1MFVA 1HO4A 3LCWA 3GG0A 1NF0A 4H7CA 4J35A 1E6PA 4UTWC 1MW2A 3PNZA 3T08A 4XZMX 3L4TA 2I56A 3IAQA 3SN4A 3HG4A 4KS0A 2AKZA 2CZDA 3UPBA 1QI4A 1E6NA 2NZLA 3CZLA 1IZCA 1FVPA 1CYGA 1GVSA 1WKDA 1ISVA 3NQEA 3UXKA 1K3UA 4AWSA 2O4QA 3OLIA 3CNYA 2BY3A 3UBPC 1KM6A 3W00A 4Z42C 2WVSA 1BQGA 2HS6A 4AZCA 4TO8A 1V6TA 5LIKX 5H1WA 1QW9A 4WF7A 1QNQA 3THCA 1XR2A 5CC5A 3ABSA 2WLYA 3CH9A 1LCOA 3BTNA 4C1NA 3B3DA 1HJWA 3GNNA 2DY3A 5FSDC 1GW1A 1AQ0A 2O9PA 3IVTA 3VA8A 2YPIA 2Q71A 4FOUA 4GWEA 1PBGA 4UNIA 3AHZA 3VDBA 4HQVA 1AK5A 4QDMA 1H50A 3OBKA 5FA5A 4GO9A 1GKRA 3ITOA 4DI8A 1PTGA 2JF6A 3F5KA 2P1FA 4CU7A 4U33A 1W1VA 2WMKA 3P3BA 2W92A 1KBJA 1ADDA 1HJVA 3QMSA 3TTEA 1ISZA 1FKWA 3BAWA 3LI1A 3MP4A 4UR9A 1S46A 1Q6OA 5FEXA 4D6CA 1WOAA 3IIVA 3SCRA 1GPFA 1X1ZA 3RGTA 3ZVHA 1XJBA 1ICSA 4GKLA 9XIMA 2J24A 4ZO9A 1IIHA 2ZUMA 3CIVA 4JEJA 4QISA 1HTIA 1IXQA 2GGEA 2JE8A 3WQEA 2OEKA 1T96A 3T09A 1Q85A 3ID7A 1VRXA 3UT0A 2V63A 1FA2A 4HSHA 2BXYA 2QCDB 3U57A 2YBTA 4PUJA 3LD5A 5IHRA 3SGUA 4DUOA 3N3TA 4ZB0A 3FIGA 3QH2A 1V6VA 3KCJA 3U7BA 4FXFA 1K03A 1VIZA 1K77A 4GY0A 2QDHA 3RO8A 3VKKA 3KBVA 6ENLA 2HISA 1UR8A 3DHDA 1BG4A 3TYEA 5CSSA 3SQMA 1TTJA 5BWAA 3A13A 3ARPA 3OA5A 3VI2A 3OVPA 1A0CA 4I9AA 4W7WA 1EC8A 1JQXA 5EBUA 2OX1A 3RR4A 3P14A 8TIMA 1LQ0A 5BXRA 1MI3A 3W88A 2FTYA 1IXPA 1PHWA 1JZ6A 3L4WA 5CKSA 4BKNA 4J40A 1J10A 3B04A 3ES8A 1J5TA 1G4TA 1JG9A 1RD6A 5FAGA 3JS3A 1V77A 4Q6XA 2Q3RA 4JTSA 1S2UA 3ZT5A 2WJZA 2ACSA 1XRVA 3ATZA 3APGA 1N82A 5CAHA 4AEEA 2RDTA 1UASA 3GUWA 1BKSA 4JIPA 1NOFA 5FJPA 2BVTA 3IRSA 3SJNA 3PUOA 1UQYA 5K4XA 4XG1A 1EX1A 4JQAA 1UD6A 5JBEA 3NQFA 3T78A 2OXNA 3F2BA 4O16A 3MZNA 3WQ4A 1V02E 3FDKA 1UH3A 1ITXA 4ZO6A 1MQRA 3R58A 1R7OA 1OFQA 3LENA 3WMCA 3W7PA 2IKIA 3DESA 4H4IA 1KQZA 2HV5A 3SEPA 3TTSA 3QZ6A 2J7CA 3UXIA 5EMJA 3IWPA 4H7VA 1F3EA 3L5AA 3G22A 2V5JA 4R53A 3P67A 2QCLA 4NILA 3IIPA 1VR6A 3LX9A 4BK9A 4LF2A 2VZOA 2BSLA 1W31A 1UKOA 3FDGA 2NV1A 2QHAA 1UZDA 1JUKA 5AVNA 2QV4A 5FJTA 3PBVA 1TZ9A 5A6MA 2NUXA 4EVZA 1JNEA 3W2UA 2INFA 2FTPA 2HS8A 4DJFC 2QMKA 5G1YA 4HPXA 2HMCA 1FWEC 2V6AA 4BHYA 2ZA3A 1HJSA 4RXGA 4DJFA 1WKYA 3CUJA 1K8CA 2R14A 3WNLA 5DXXA 1FKXA 4J5NA 2QJJA 3AS1A 2FHBA 4H01A 1GKQA 4XBKA 5HOSA 3LGDA 4DJDA 1CECA 4B2DD 3UWYA 3NL6A 1BXBA 4JN6A 3S5OA 4AIOA 3IV3A 1DIOA 5BOFA 2V69A 3VMNA 1BGAA 1JYNA 1E5JA 4O1AA 2O7SA 1QOQA 5KSWA 1BEUA 3APYA 1CW2A 3AI0A 1AH0A 2QPUA 1MXDA 4JYFA 4UFHA 3MYPA 4O19A 2PB1A 5A3HA 3K4AA 4YN5A 2VX5A 3EDFA 4FS9A 5E0KA 2GGGA 3ELFA 4D6JA 1XG4A 3D0CA 2A3AA 4A6GA 1JL8A 4MDOA 1R86A 3SFKA 3QGAC 4XAFA 1SJBA 4UTWA 5BMWA 4H83A 3KBSA 4M3PA 2Z7GA 3H23A 4GI4A 5D04C 4DNHA 1XLMA 4GFSA 3F4DA 5FJUA 1KRAC 5FEWA 3VGGA 1Q45A 1GZ1A 4RV8A 5ABFA 5EB8A 4F2TA 1QWGA 9XIAA 1W37A 4TV6A 4QNEA 4S2BA 1POKA 7XIMA 2UWFA 4RE0A 3GK0A 5FEPA 4AHQA 3B9NA 2R1KA 2WZTA 2BVWA 1N8FA 4IIEA 2QXWA 3UCQA 1P6WA 4YTTA 4GXWA 3FYYA 4IXXA 4X61A 4I7WA 1GPWA 3R79A 5CEWA 4FIQA 4LYRA 2QF7A 2ICSA 3V5OA 4ACZB 1M03A 2VNCA 3N2XA 4ATDA 2BY2A 3BAXA 1IEIA 2V2HA 3NQAA 1YE6A 1R3RA 4K8EA 1UD3A 1AL8A 2C18A 2GOKA 5LZLA 4J3XA 1V0LA 3UQNA 4YHEA 3S6TA 2Z29A 1ZRQA 4S3DA 4XZNX 5TF0A 3A21A 2XGBA 3RRXA 3CAWA 5CQ1A 1F6KA 4NRSA 3WNNA 2VGFA 5DANA 4REQB 3P5ZA 5IDZA 3OHIA 2RGLA 4K3ZA 1HVXA 2O9RA 1HW6A 4C6KA 3LHYA 1JRCA 4DVOA 2GL5A 3VMOA 2WXDM 2ZRZA 4Q8VA 1TTPA 2BNJA 2HVMA 4O28A 3KRUA 4MNLA 2ZA1A 2Z1SA 2E67A 4JEQA 1LG1A 1EJTC 4NNCA 4IIHA 3A12A 2WVVB 3VD3A 2HXTA 2NXGA 1ZAIA 3VE9A 2VELA 4OKDA 1QPOA 3GBDA 2BB0A 2WMGA 4WGXA 1GJPA 4I5RA 1IZJA 1P1MA 1WXJA 1LP6A 3F5LA 3VPLA 1F5ZA 4PB5A 2YYTA 2YA0A 3CUIA 4A35A 2EBNA 4L80A 5U4NA 3GFZA 5I02A 2VC6A 1RSCA 3WK0A 5FIPA 1JCXA 4HTBA 3VDHA 2TMDA 3TDFA 1A5MC 4YHGA 3E6EA 4Y7EA 3MI2A 4JTEA 1J4EA 3WELA 1OYAA 5AECA 4OTKA 3IJ9A 1EA0A 1BSLA 3TQPA 5A8MA 2PLMA 3NZ1A 3T40A 1DYSA 3AAMA 2JK2A 1GYLA 3B05A 3CV7A 4AB4A 2F8QA 1XD1A 5BROA 1W1B1 2DPEA 4Z0SA 5ENLA 2P88A 4Q8TA 2VR2A 3TZNA 2CFFA 4XAZA 1EPXA 4IH3A 2OQHA 4XUGA 2PODA 1ODZA 3WFLA 4KFPA 1VLWA 4AWTA 1UKSA 2ACUA 1DWGM 2V3FA 2W6RA 3S6DA 1DE5A 2MANA 3RLGA 1HNYA 2DUAA 4W9TA 4LY4A 1A80A 2BXZA 2UZ9A 3HPAA 5D09A 1HJQA 5GJPA 3VCCA 3ANYA 2PDQA 3T0AA 1QUMA 2HVNA 3ORWA 1SMDA 1UB3A 1DJQA 5E9AA 2WJFA 4J7RA 2X41A 5CPLA 2XH0A 2ON3A 2ZC8A 4R7JA 4JL1A 2GK1A 1HT6A 1Z48A 2YIHA 2OELA 1EL3A 5EMUA 3LM3A 3GNPA 1DWIM 3WEMA 3QRHA 2D2GA 3VFLA 1XF0A 4D8LA 3U2ZA 3BXWA 1ZBCA 2PZNA 1E3XA 1XV8A 4R88A 2WLZA 3DG7A 4E2VA 1W17A 3MWAA 4R33A 3FSTA 4LFYA 4YVVA 3QTGA 1XIMA 1RHCA 1Z89A 1VJZA 1U5JA 4DYJA 2X09A 4NJKA 3BZGA 3VOJA 1J6PA 4KRTA 1J8VA 1XC6A 1YHTA 4IQLA 5T9BG 1U22A 1TPDA 3DXIA 4G5DA 3N2CA 4W86A 4Q8QA 5FJIA 1XQLA 1HKKA 2VEKA 3PG8A 3NGJA 1I6NA 1TO3A 3V0UA 4HOZA 3EOOA 3KLKA 4WRHA 1T5AA 3C2VA 4M1RA 3OQ8A 1GWJA 5GJMA 1V03A 1P48A 3CHVA 3P60A 3A3HA 3H22A 2PP0A 5CJ5A 3LB0A 3DENA 1ZALA 3C5QA 1E0XA 3WD2A 3M46A 4JQ3A 1UQZA 3HO8A 4KEZA 4C6NA 1QNPA 3ZZ1A 1O5KA 4C6EA 1LT7A 2RAGA 1CWYA 4PMYA 1J9YA 3FCPA 3KL5A 4V33A 3WQ6A 1YQ2A 1S38A 1JD9A 5LKYA 2NVDA 3BLKA 4HJFA 3MKVA 4DO5A 1GQJA 3E2RA 2FFCA 3TC6A 1FFQA 1W3JA 7PTDA 4IT1A 4PUNA 3S2JA 4KCTA 1HKVA 4IWWA 2FPVA 1ISYA 5C5YA 1W9DM 4KQNA 2DT3A 3A4JA 1KV5A 4URIA 3ZLHA 4QAWA 4ZOAA 1VIWA 3TN4A 7TAAA 3UCDA 4C65A 4JIQA 2D0GA 3EX1A 1GOOA 4ADTA 2DIEA 7ENLA 3RFAA 3WUGA 1XUZA 2QCEA 5FI8A 4GA8A 3UR7A 4PTNA 4OT7A 3LCHA 5H8UA 1F76A 3WEOA 1GGOA 1DVJA 4C1KA 4JX4A 1UROA 4KRZA 3F5JA 2BOFX 1J6OA 2PA6A 3U5UA 2G97A 2EHHA 3DFNA 4CNOA 3PJXA 1X97A 1ICQA 4A29A 2OZ8A 3DFHA 3W7HA 3VX1A 3NWRA 2J66A 5LXXA 4WDWA 4C1NB 1EJUC 3UXLA 2YJQA 4HZ6A 2YDSA 4NZJA 2BVDA 3BLLA 5M17A 4GUJA 1F6PA 1TPEA 1A53A 3BLIA 1RALA 4NT0A 4CLMA 1WXYA 3RXZA 1WO2A 3MUAA 4OV4A 5KZMA 1H7PA 2QQ6A 3GH7A 3H2NA 2IPWA 1G69A 4NZ4A 4IFKB 4QEEA 3W38A 3JVAA 3P5YA 4GISA 4UFMA 3CHEA 1OFAA 3MDUA 3PPGA 1Z41A 3NEVA 1OC6A 3HBLA 5F2IA 3O15A 1QPQA 5D2WA 1DTNA 2X0HA 5D2XA 5FF7A 3UJRA 4QG8A 2YW4A 2W5FA 3P8IA 1VYRA 3NQ6A 5BRPA 3TAKA 2C19A 4ZENA 4S23A 4IM4A 3DFTA 1TPH1 3HPZA 1IR1A 3OBEA 4E5TA 4FLOA 8RUCA 3S42A 1R3QA 3HB9A 5U7SA 2DH2A 3OQEA 2QDEA 2HE8A 3XINA 1DJNA 2BGSA 3M0XA 4D6IA 4H8NA 2C6QA 3SADA 2JQXA 4H2HA 2KAUC 3LHZA 3QBUA 4F0HA 3PBYA 4F2UA 3RITA 5HK4A 2A3BA 2C0HA 3AZSA 2V5KA 3XISA 4B3ZA 2PWGA 4N9CA 1JUBA 1MXSA 3W2NA 4HPJA 4XZIA 2PLJA 2R6OA 3S2CA 4B90A 2F2HA 5DXYA 1XIBA 1IF2A 2NT0A 2WC3A 1VCFA 3VGEA 1PO9A 3A24A 1WDQA 5JIPA 1IR2A 1QCWA 3AALA 4GX9A 4LUSB 1F3TA 3PWAA 4FXRA 1PYFA 1G4SA 1H7XA 3LCGA 3O8AA 3E9AA 4NKCA 1LG2A 1OGSA 3T0BA 4JS3A 4AXNA 3S5YA 4ICCX 5C7VA 4WDUA 3N4EA 2PMQA 5LIUX 1MDLA 4GUGA 2Q09A 3WH5A 3LV5A 1I2NA 1UR2A 1B1YA 4KERA 1E1EA 4ZEPA 4NSBA 1GQNA 2REQB 3LA4A 6TAAA 2C91A 5CPSA 4G7FA 4IJCA 2Q02A 3WK2A 5MHBA 4CQ8A 2FDSA 2XSBA 3TZFA 4H8HA 3AISA 3PZGA 3BV7A 4BWLA 4MVAA 1FQ0A 3U7VA 5BYWA 4HTYA 3WJZA 2AKMA 2D2JA 2XFYA 2XSAA 1VBUA 3TWAA 5AC7A 2YL5A 2ZUVA 4XZLX 2X16A 3U8GA 1VFFA 3BW4A 3GW0A 2ZXAA 1K9EA 1XI3A 3T8LA 1LDCA 3M5XA 3RX3A 3L5LA 3BCJA 2V3EA 2Y70A 2DGAA 4FMVA 5FSEC 2WSKA 4L9YA 1Z32X 3W53A 3QZEA 4QAIA 1EHNA 3V5CA 4MHBA 1TKKA 2OU4A 5I79A 1BYCA 4A05A 3ZVHB 2YX0A 3K2GA 3ZJ8A 2CWXA 1ML1A 1MEWA 1KXVA 1V3IA 1XIGA 3W02A 4LT9A 5E6ZA 4UNLA 3PUDA 1UA3A 2ZYFA 2RGMA 3WQWA 1RV8A 1IXNA 4XO7A 3AYSA 4S1FA 3EYPA 4RZ4A 3LI0A 4ZB5A 3QGVA 2GVYA 2V82A 4WSJA 4DLMA 4PEKA 2ZX7A 1QRQA 1XCWA 4ICNA 1ISXA 2L5HA 4ATLA 1EPVA 5AC4A 4QP0A 2CLPA 5IBXC 3RX2A 3GXFA 1QFEA 2PU0A 3S46A 3AJXA 5D2VA 3RLUA 1XIJA 2R9RA 3K13A 3N29A 3H2OA 1V3HA 5CZTA 1R38A 1P0NA 1RY8A 3UNDA 5BW6A 1SJDA 4N7QA 1YXYA 3NQ8A 3SY8A 4O1CA 1VGAA 1OFDA 3JZEA 3LQGA 2JGQA 2X7VA 3MJMA 4IMAA 2FDMA 1ONXA 1PYMA 3NQMA 1AQHA 4GXMA 4QITA 3OZPA 1MUMA 1VRDA 1UZHA 4FXJA 3QR3A 2AOSA 5KETA 2HSAA 1NWSA 4QE1A 1XHGA 2G4FA 3N1AA 3GU9A 3DI0A 3BW3A 4IGNA 2G3FA 3LU2A 2NT1A 4Y90A 2E8YA 3CV6A 1ICPA 2WPGA 2J9XA 4X60A 3ARZA 3EBVA 1SW7A 4L1WA 1VPXA 3APTA 1SUXA 4LVAA 3TR9A 1G4EA 3A4WA 1NM9A 1WB0A 2O4MA 1H51A 1EEXA 4N4QA 2FYMA 2BODX 1FCQA 3MMTA 4K2SA 4NIRA 3W1QA 3CH0A 2OGYA 1EA9C 2V5BA 1E15A 1W3IA 4M24A 3N73A 4B15A 2PWFA 4ZSUA 4PGLA 3KHJA 1KBIA 1BG9A 4D6EA 3A9IA 2PTZA 4KETA 1W3HA 2FGLA 1NY1A 3BMVA 5BMXA 3ERPA 4N4PA 1P43A 1X6UA 2QF8A 1L8NA 4PH6A 4K7YA 3GKAA 2VWTA 4ACYA 1AW2A 4HJWA 5HQMA 2P53A 1NSJA 1XG3A 3GDKA 1SFJA 1T7LA 1QNRA 4MADA 1UWQA 4RE2A 4GGBA 1IEVA 3B03A 3CUHA 4H2CA 3HN3A 1RBOB 3DYMA 5CC6A 3NAVA 4MYAA 4ES4A 2JFEX 5C6MA 3PS7A 4FPSA 1D8CA 5IBXA 1ZJBA 3RM9A 3VUPA 3FVMA 1R46A 1NTHA 1EUNA 1JD7A 3GZAA 3FKKA 4HCLA 3E3HA 1P0DA 1W2PA 4MJZA 4ZVJA 2ISVA 3BO9A 2BFGA 4AEFA 4LBUA 3KCLA 3PAOA 1JDEA 3WMLA 1P0EA 3MQTA 5EL1A 3CUFA 1UC5A 4PRRA 4BEQA 4M29A 3SQLA 4TTGA 1GYMA 4YTQA 5I23A 1QNSA 3BLDA 1QHOA 4J3VA 3UJEA 3TYCA 5A8QA 2G3NA 2XN2A 1KM3A 2ZZ7A 4B16A 1SFTA 3W71A 4DBDA 1XFBA 1XLGA 3M0IA 3C8NA 2PDBA 1W5OA 4H9XA 3QM3A 2Y5SA 4MY9A 5HMDA 4FHAA 2I5IA 1A47A 4UFKA 3AIEA 4A3UA 4AY8A 1YNYA 4LRTA 3J7HA 1ZU8A 3UCCA 3ZR6A 1FHDA 1HX0A 4GUIA 3LLFA 1PIIA 1TZ7A 2OB3A 3GDRA 1CIUA 1LL6A 3AZTA 2Z2AA 4ORMA 1WAUA 4UR8A 3B9DA 4PTMA 3LDVA 4O8AA 3OP2A 1XICA 2FZNA 1JFXA 1H7RA 1HQTA 2NUYA 2ABAA 4ENLA 4NJJA 1B3ZA 1FWNA 2J78A 1OQFA 3YPIA 1KRMA 4IMFA 5EMYA 1XKJA 3GG8A 1K8XA 1DPMA 4MNJA 4US5A 3GIPA 3C2FA 3MSYA 1ZY9A 3L9CA 4W8LA 5CPTA 1G7UA 1LBMA 2NQZA 5EFDA 4W7VA 4UOZA 3EXRA 2UY2A 1PL9A 4S3AA 2NV9A 1R2TA 3NURA 3L5MA 1E4LA 2EGZA 3P0WA 6A3HA 1B3YA 2TSYA 3IJ6A 3UGVA 3GLCA 2ZZ3A 2CLMA 3TXVA 3FFSA 2PCEA 3ITCA 3IEBA 1NH6A 4PTXA 1CGVA 1XSKA 4K38A 3NIYA 4QS6A 2BV9A 5A5WA 4YMZA 1SFSA 4DBUA 3W2LA 3R6IA 3NDOA 2TRSA 3HJEA 1NDWA 3DHPA 4ZE5A 3N6HA 2POTA 4D6FA 5I06A 1YEYA 4B3LA 2BGNE 5KTLA 3WNOA 4F0KA 2V2DA 1AZ1A 3U0HA 2CLIA 1E6XM 4C6FA 1W0MA 3BJFA 4IICA 4FNUA 2VQUA 4HK6A 2KX9A 4GPNA 4ZOBA 4MNMA 2OGJA 3VKBA 2D73A 3W7IA 3BL3A 1YBQA 3LZ3A 4RCXA 2PZ0A 3M5YA 3RUBL 3CZKA 4A8IA 3GRIA 1GZGA 4BWLC 3C4UA 2CXGA 2Y85A 4GIAA 3G1XA 1NVMA 3QW3A 4R7OA 2DW7A 1B4EA 1RPXA 3AROA 2C71A 1ITCA 1DP0A 1KTBA 3ZLGA 4FALA 3V7PA 3IGUA 1FWTA 5AB3A 2VUNA 4JKKA 4KCWA 3S0CA 1QI3A 2X30A 1J79A 2ZADA 3WH6A 2DQXA 4QLJA 5CCZA 4WOZA 2WNZA 4AZGA 4RDYA 4FF5A 5A6BD 4UQ9A 3N2TA 2J25A 3DECA 3EWXA 1FWSA 3NOYA 3TE9A 3MMUA 1GOIA 1B31A 1YYAA 3P81A 2OCZA 3WL0A 2PLKA 4ICMA 3CQIA 3I68A 4XO6A 1MQPA 1YPFA 3RF9A 5CBBA 2OFJA 5HA7A 2A0NA 2XN1A 3ITYA 2PBOA 3ARUA 2IQ0A 3RCMA 4WY0F 4WVXA 1PZ0A 4PC8A 2JEPA 1AH4A 4Z2IA 1OX4A 3N9SA 3ABZA 4GQQA 4Z1DA 4C6LA 3IVSA 3W85A 2QIIA 4D1IA 4IQEA 1BHGA 2Q6ZA 4CKQA 4H6RA 2IXUA 3GNXA 3S1GA 1UBPC 4U3CA 3HG5A 1P1XA 1DJXA 1ZGDA 1F61A 4HCHA 1OZQA 1A5SA 1TA3A 3IIXA 3NYZA 3GXIA 5CC7A 3AS3A 3T55A 2PDPA 3NO3A 1IGWA 4RR4A 2FIQA 3URQA 1X7IA 3EPNA 1A5OC 1LRNA 1E1FA 1REQA 1NELA 4MF4A 1IEXA 5K3VA 3MMWA 1D3CA 4LNYA 3THAA 1UR0A 3M0ZA 3T1GA 3WF2A 1ZHAA 4XX6A 1TE1A 3G1RA 5SWUA 3EAUA 2IKGA 4QRNA 4KF1A 3G1DA 3BGAA 5M03A 1R0MA 3FHQA 1DIDA 2GDUA 1Q6DA 4PEEA 3AYTA 4YCPA 2PTXA 2WWDA 3PBWA 1TPC1 3NM3A 3IK4A 4JFTA 4QXIA 1JDCA 4O4WA 5H2ZA 2VRKA 1XS2A 4PYSA 3VNJA 3WD3A 2AMXA 4B5NA 2QCMA 2TPSA 4JIEA 4FNPA 4I6KA 1RA0A 3QV6A 4JN8A 1LRQA 3GC4A 3M9YA 3KUMA 4KWUA 3CHFA 3PN8A 4HD5A 3K4DA 5FCZA 1C8VA 4K36A 1QOXA 1SFLA 3ATYA 4E4FA 1LRTA 1Y5XA 2XVNA 3M0KA 1ADOA 2PFHA 5JBFA 3EWWA 2PF8A 3AO0A 2XISA 1RBAA 2BDQA 1CXLA 3DYPA 4R7WA 2PDGA 4Y9OA 3FLUA 1UKQA 2Z00A 3VK5A 3IJIA 2JIEA 2G3IA 4XTIA 1E73M 1H0GA 1Q4WA 3S4TA 5CGTA 5F4XA 1SR9A 1SO3A 1Q6FA 1DL3A 2ZE0A 3G24A 5J5DA 1DV7A 1EJWC 2DW6A 2VGBA 3GHRA 2J75A 4GNVA 4FR6A 2ATMA 1W5PA 5C55A 5DT7A 3W23A 2I57A 2CLOA 3ME3A 2HDJA 4Z2JA 3C52A 3EKGA 5ABFB 3STGA 3URBA 4I9JA 4AH7A 4GNJA 3FJNA 3ZXWA 2OZ3A 1RXOB 5C9XA 3POHA 3IRDA 3WLKX 1TWWA 3WFZA 3KRSA 3M4HA 3TCSA 3D3FA 1BD0A 3RDKA 3QR0A 5DN1A 5JXQA 1LZOA 3T6CA 2QCNA 5DX7A 1V7AA 1Q2RA 3NGFA 3AHXA 2GVLA 2BASA 3VGBA 4JIRA 2WZMA 3WJSA 1GZJA 4GVGA 4B5XA 2G5WA 3K5XA 1QJWA 4FP1A 1IGSA 3PF3A 1JCLA 3EMZA 4GI6A 3FYOA 4G8TA 2BMBA 1BVNP 1TPFA 8XIMA 3LCXA 3NO1A 3SUUA 1DIKA 4WDTA 2Z6JA 3WD1A 3CL7A 1XIFA 3NA8A 2MNRA 1JF5A 3KRBA 4DZAA 3B8IA 4ZO8A 2OO6A 4FX8A 1BWLA 1T40A 4IISA 2EPHA 1JCMP 1PKLA 1WA3A 5C2GA 1DWJM 1AODA 3PB2A 4TTUA 1CDGA 1A50A 2VTFA 2P3EA 3QC3A 3NQBA 1VCGA 1EDTA 2IQDA 4QNWA 3SRHA 3LTSA 1SMAA 2DVXA 3GR8A 2VFGA 3PZTA 4Q4SA 2WJDA 4BFAA 5G1TA 4JFUA 3PPHA 1RJQA 1I4NA 1M9HA 3GM8A 2GLKA 1QR7A 2D3LA 2GSJA 1JPMA 3WK1A 2WVUA 1FUYA 1U1HA 5E0CA 4PMUA 3M41A 2Y88A 4KCVA 2PDCA 1UC4A 5JQ9A 4S3FA 2ANUA 3TLQA 5CSYA 1M6JA 5CSRA 3P84A 4L4PA 1ZP3A 3H2EA 3N12A 3T0TA 3GNDA 3QN3A 1XDJA 4H8UA 4AY7A 1TRIA 1D8WA 1CI1A 4K7VA 1TJ1A 3HPFA 4W7UA 4CNSA 3DC8A 5B7ZA 5DMYA 4FNRA 2VXNA 2E5DA 2Y1HA 4B9YA 2FHFA 3DFYA 5LGZA 4L6HA 2E28A 3PPCA 3M16A 3W7RA 4IGSA 3WQDA 2W91A 4PCPA 4G7EB 2BWGA 1CXKA 3E0LA 1K70A 3GUGA 4HA0A 1CTNA 1HGYA 4JY9A 1US0A 3MCNA 3WLPA 1S5TA 2PWDA 2Y5EA 3EWCA 2GUUA 2VWSA 2Z2UA 2EPLX 3D46A 1EQCA 3TNOA 5D9NA 5D32A 4ZXOA 1FCUA 4BQ2A 3OGVA 3CAKA 3CTLA 1L2UA 1CENA 3TTQA 1Q6EA 4GBUA 1XDLA 2PPGA 1OCBA 1ZS2A 3W7EA 3CXOA 1D2KA 1JJKA 1PSCA 2FVLA 1OSEA 4C7DA 4ZMGA 1H41A 3ARRA 2IKHA 3VNKA 4UTUA 4NUWA 2CNCA 1N7KA 4PUEA 2REQA 2VVSA 5AYIA 3SCNA 4ZBCA 2GJXB 1Q7QA 4QFUA 1QTWA 3IK2A 5EMLA 2FGBA 2OJPA 3HGSA 4U2ZA 4PB3A 3O2LA 4GJIA 5FL0A 5C9UA 1TB3A 2ESCA 2NQJA 3AQUA 5I77A 5IM51 4CD7A 4FNQA 3QY7A 2ZDSA 5BXSA 1IYXA 4TOQA 4AQLA 1OCJA 3WLNA 1X38A 4GNKB 3NR0A 3DI1A 3SCOA 3IGHX 2HXUA 3KW3A 3V75A 3I7QA 3N9RA 4JKLA 4XVEA 3SRKA 2DZXA 2I16A 2XDFA 1QHZA 1FCVA 1DIEA 3M6DA 4QS5A 2RFGA 4Z1CA 4V1XA 1RJRA 4AW7A 1HG3A 3DFOA 3GVRA 3O6AA 3FA5A 1OGBA 1RCOB 3UPWA 1H4PA 3FA3A 3S9IA 2VHLA 1YMYA 5J5RA 1R5YA 5DMMA 4KWSA 2O0TA 4M6QA 4L6OA 1Q8JA 3MANA 4EX4A 1NWRA 3TSMA 2F7FA 3C2OA 4P7RA 4JNMA 1PDZA 2OODA 3THUA 1EF3A 2HQAA 3TC7A 1TV3A 3UW6A 1B30A 4E2BA 2VZUA 1Q8AA 3LSBA 4HBKA 4QJ3B 2VO5A 3ZWTA 4CQAA 1QI2A 4DHGA 3CJPA 4AZCB 4L4MA 1RAKA 1OYBA 1XLBA 4DF2A 4PUUA 4GZ7A 1Z44A 4YTRA 4FLQA 3TA9A 2DIKA 4M0XA 2A5HA 2UY5A 4O53A 2NQ5A 1W3LA 2PURA 1UUMA 2XUCA 4LSBA 1KM5A 3WCZA 4Q8OA 1SZGA 4EP8C 3R4IA 3W75A 2VI0A 5I3JA 4E4PA 1UWUA 1QW7A 2E25A 4S38A 4C6QA 3TFXA 5DCDA 1MQQA 1R9XA 4JTCA 4JY8A 2QMJA 1S2AA 2YSWA 4LTSA 4KPLA 4UBPC 3WLRA 1JPIA 2DVUA 3HQ1A 1OFRA 1E9YB 3REQB 1IT0A 1XLCA 3AIRA 2E4TA 2XHYA 3M43A 3JW7A 1DQWA 2NWSA 4YJ5A 3DKJA 2C16A 4K1GA 3VD7A 3VNDA 3L21A 6PTDA 2DZPA 5FKYA 2CLLA 2QYGA 3TUUA 2DZSA 1BYBA 1REQB 3W1TA 3OOQA 3HG2A 4UUIA 2JGYA 3W1UA 1TPUA 3CMJA 3WH8A 1A3WA 2VD8A 2WBGA 2DDXA 3SUVA 1VJSA 4N02A 3CLWA 3O3RA 1D7FA 3KFTA 4JTRA 3R7MA 4C60A 4HPNA 3HFYA 4YTSA 1MEIA 2VJXA 4KGJA 1P7TB 4MTVA 4US5D 3AUOA 1RJPA 2XIBA 4QEHA 4JXCA 5A8NA 4PUKA 1W1PA 1A3HA 5FJRA 1V6YA 1H62A 4U4MA 3TJIA 3U9IA 3TCEA 1YTDA 3CMFA 2OWWA 4QJ5B 4O11A 1FWBC 1LYXA 3VM7A 4PCFA 4O4VA 1AA1B 3CYJA 3AHTA 3UD6A 2FFIA 1PX4A 3TNBA 5D38A 1JZ4A 2DZWA 1XLJA 3R0UA 2J8GA 2GOUA 2CZ5A 2YL6A 3QV7A 3VFCA 1A3XA 4WSKA 1UJPA 3CU2A 3OU8A 4JTJA 2J74A 1Q63A 4D71A 1PVNA 1W3KA 1QWKA 1LWJA 1Q6GA 3DN5A 1KBKA 2J7GA 5D2TA 4B4FA 1WZLA 4DM2A 3BGJA 2EPOA 1CPUA 3EOUA 4X0NA 2Z1KA 3QKZA 2V9DA 1M7JA 1F05A 2ZKMX 1E1CA 3U2EA 3GXNA 2ISSA 3CT7A 5I78A 1THFD 4WZHA 3CHCA 3TVAA 2NXIA 1UR4A 1EF2A 2OO0A 2C13A 1OFPA 1I1XA 3S6OA 5B80A 4EXBA 5DLCA 1EOMA 2HCVA 4G1NA 5HMEA 5AYZA 3M0YA 2B4GA 1XW8A 1SZFA 2VX4A 4O57A 2VM8A 2RH9A 3I3EA 3CQKA 1OCQA 3ONBA 1QDSA 3GVQA 1O60A 2GGIA 1XXXA 3EOEA 1H5YA 2G95A 3MV01 1J2WA 4XAGA 4A22A 3B97A 5JU6A 3LK6A 1EC9A 5HINA 4TIMA 4Q4OA 2J7DA 3FEMA 4Q7IA 3E2QA 5AZ1A 3T0DA 4MOZA 3GNRA 3S9YA 5J04A 3I3BA 3G0SA 3AMDA 3ZIZA 4U5KA 4UTTC 1O95A 4GLEA 3TH6A 4NYUA 3A5FA 3S5ZA 1ZCOA 2Z6IA 1U5HA 3DHFA 4LCRA 3VAVA 5D2YA 4D6HA 4XKMA 3A23A 4HNLA 3AHYA 4QHRA 3UERA 5LNSA 4JNYA 1EP2A 4GKTA 3PUEA 3URNA 4EAYA 4AHOA 4CCZA 2X1TA 2ZXQA 2P0IA 4QLLA 4JIHA 4Y96A 3BW2A 3SCVA 3LQLA 2ZZ5A 4UFLA 4JFSA 1Q13A 4OE7A 1WXZA 3CQJA 5DRIA 3WYZA 4WHBA 4AFYA 3PZUA 2WYSA 3OTRA 4IPLA 2JALA 4IMEA 3VD5A 5I09A 4PFMA 1QBBA 1KNWA 2Z0IA 3B0UX 2C7FA 3UYCA 4B9ZA 4NZFA 4DQWA 1M5WA 2YCLB 4KFNA 2I7GA 3AICA 1PHQA 3S3GA 1WKEA 1EXBA 1NDYA 1VPYA 1R2RA 3G0UA 1ITUA 4LS0A 4BF7A 3EEGA 2ZRXA 1AFSA 3IV8A 3WG6A 1LUCB 2H6RA 1CLKA 4ALDA 4M6PA 2E68A 1V0NA 2WCGA 4FK9A 3LTPA 1FTXA 1EEPA 5D9PA 4CU6A 3CBWA 1X1NA 2VDIA 5CLWA 1EJRC 4HA3A 4HA1A 2Z26A 3N4FA 4C6MA 2EAWA 4C1LA 1E9LA 4I7UA 2WVVA 4AMAA 4HZMA 1KC7A 4OUEA 4UTHA 3NZPA 2RKXA 1KA9F 3D6NA 2J8FA 4IL0A 2I17A 3HM7A 4E8CA 3LS9A 2CHNA 3L68A 5A94A 1AZ2A 5ABEA 4ERGA 4E8GA 4GY7A 1UWAA 4HHLA 2GJRA 4Y9MA 1ZBKA 3EA2A 1GW9A 1AD1A 3MS8A 2IS7A 2OSXA 3FKRA 3NZQA 1HJXA 4MSSA 5HDRA 1WUEA 1UMLA 2YFNA 3L65A 1OX4B 4QDPA 3MB9A 3AMKA 1HVQA 4IP4A 4M6VA 1W9VA 5C71A 3UJ2A 3L2MA 3W6MA 4LYQA 4JTFA 1MFUA 2CBVA 4V2XA 4N9DA 3TV8A 3UZXA 1EP3A 2P3ZA 1BF6A 1P4CA 1C93A 2WZHA 4O1FA 2D23A 1GHSA 4MJMA 1VCVA 3G6LA 4UC5A 4GACA 5CBJA 1EIBA 3DC0A 2R1LA 1DWFM 4F4RA 3R5EA 3WBYA 5GVJA 3VNYA 1EB3A 2WMJA 3WDRA 3S9ZA 2FGZA 4MGGA 2FZ8A 3CZJA 3NJ3A 4NHVA 1E70M 4DZ5A 4JICA 3TN6A 3OG3A 1KKOA 4HMEA 2ISDA 1XD0A 1MNZA 3SAZA 2X0SA 2WSYA 4OIFA 4DAIA 2OOGA 3BJSA 2Y7FA 4S3EA 3W7CA 3B40A 1PKYA 2VZVA 2XIJA 3LPGA 4QE4A 5CPOA 1CBGA 4HNOA 3M47A 2H8ZA 1B3VA 2A3LA 1JR1A 3R8HA 1J96A 1R6WA 4M56A 2QEZA 1ZJHA 3WF3A 4GJJA 4L9XA 4CQ9A 3FY1A 3BOLA 5BRQA 3A3WA 4UQAA 3SCTA 3QQ0A 4W85A 1G1YA 2XSXA 3MC5A 4RKAA 3O1NA 4H9VA 3REQA 1FWDC 4H7ZA 4EWND 5ABHA 1C8QA 4HGXA 1KM4A 3M64A 2Y4SA 5A8GA 1XLKA 5G4WA 4GH1A 2PGRA 2ZUWA 3O16A 5KZ6A 4C6DA 1G67A 3DIPA 3N4AA 4WCJA 3CWNA 1JFHA 2ZCGA 1I0DA 5AY7A 4LV4A 4BR1A 3C0QA 1ZBWA 2DT2A 3JR2A 3ANUA 1OM0A 1W1IE 2OEJA 1VYPX 3GZ3A 2J4GA 3HQNA 3NSMA 4GCAA 3W7KA 3ARSA 2R1PA 7A3HA 1UG6A 3GW3A 1XPGA 1KR0A 3ECQA 4EK7A 4DUVA 4LUTA 3TYAA 1KFLA 3M44A 2PRHA 4MUPA 2QUNA 2JKPA 4ACZA 3AYRA 9CGTA 2V68A 5FF2A 2W67A 3LUTA 4HK7A 1GTEA 2A21A 4BQ3A 4E0CA 4Q3MA 1X6LA 1H60A 2QZRA 3TW9A 3VC6A 2QCDA 1F3XA 8A3HA 1V6UA 1E4IA 2PTYA 2I9EA 2PP3A 4LVFA 2ISFA 2CW6A 1WDDA 3B8TA 3BE7A 3LNMA 4NXKA 3H6OA 3VOGA 2OQYA 1LTDA 1C29A 3MZ2A 2QGYA 2A7PA 4DLFA 1JYVA 1X7FA 1XIHA 4WJXA 4XZWA 1EYWA 3EMQA 2JKEA 1F73A 1SU5A 3CO4A 2YXOA 3GFXA 3R10A 3NQGA 3W7QA 3CHDA 2PWEA 1GT8A 4HIBA 1TR9A 3OB8A 2CC0A 2DZVA 5JMUA 3KOZA 1XH2A 2ODOA 4YTUA 3ICJA 4EKJA 1U1UA 3UP8A 5BOEA 1W9XA 1UZ1A 2PDYA 1FH9A 3ZYZA 1CLXA 5K9DA 2EG7A 3UG4A 5DF0A 3R11A 4FAMA 3TJXA 2BVYA 3JZUA 2BOEX 1LBLA 1VF8A 2PF0A 3I7SA 1WPCA 2WPBA 3QQ1A 3QEZA 1X98A 4AWEA 4F0SA 3VU2A 5G4HC 4RDWA 1PIFA 1KFBA 3H4XA 1DJIA 1ZTVA 2X1RA 2ZRYA 3AIWA 3H24A 2J8TA 1IE7C 3VGHA 2P76A 1G01A 1UW9A 1GVRA 1CNVA 2VURA 2AGTA 3II1A 2ZTJA 2C1IA 1QT1A 1JPHA 1ZSXA 3RIKA 3ARVA 5CJNA 4BJHA 2YGYA 2IXVA 4M6UA 1TJPA 1CXHA 2OWXA 3WNMA 2ZC1A 1PTAA 1NDZA 3IS4A 1YRRA 3H2MA 3D3AA 4KMQA 3BH4A 3RMJA 3G1VA 1YTKA 5IRPA 3WDJA 1SO4A 3VE7A 3URAA 1E55A 1QPKA 2B7NA 4WSHA 2EO7A 2X1SA 1QU4A 4O17A 4INFA 3WF4A 4C6CA 1XCXA 4DBSA 2XWDA 5HR6A 3OO2A 4LPCA 3V0SA 3IUHA 2FJUB 4JHZA 3RN6A 3LPPA 5HWMA 1B3WA 4LANA 4KW2A 1L6SA 4KWWA 4BQ4A 2GVEA 5HQEA 5C0QA 4XBJA 3QPZA 2BY1A 3GBEA 6REQB 3H55A 3PBGA 4EPKA 3CS2A 2CETA 5H8MA 3ZR4A 5A6KA 2E09A 3PC0A 3C86A 3SRFA 1T0OA 1E6QM 1XP3A 2YB1A 2P50A 3KBWA 4ONVA 5FJJA 3BAIA 2X05A 1RLCL 5HMFA 5AYXA 3B9OA 4HN4A 2HK0A 1K6AA 3ABQA 3HFTA 4DUWA 5DY3A 4IUOA 1QW8A 4IX2A 2BBFA 1R3VA 4UQCA 3MSDA 5J8LA 1ZZMA 4Y2WA 4KWVA 3WMSA 4ZQOA 3UZ5A 1GKPA 3STEA 1A0DA 2B7QA 3OZYA 1W9UA 3IIZA 4J27A 1AQFA 3WD0A 1U33A 1SQ7A 1CGTA 1XCFA 4MZ8A 2BHZA 3WQFA 1UR1A 2G4JA 2OKTA 3NOEA 2QAFA 5BXTA 2XM1A 3RJYA 5I24A 3UZWA 1EC7A 1H09A 2ZICA 2ZZ6A 5LA1A 1SZEA 3QSTA 2EKGA 5LSMA 3RX4A 5HWJA 4P8XA 1A5KC 2PDNA 4MWAE 4ROQA 2QCHA 5DELA 4EF9A 3Q58A 3WQPA 1DJYA 4XK2A 2FZBA 1WNOA 3Q45A 4OZOA 3R12A 3W27A 1RQEA 2Y24A 4GZIA 5G2IA 1K7FA 3LZ5A 2VFIA 3C3UA 1RUSA 1YXCA 2DZAA 2BS9A 1VFHA 4LUTB 4CN4A 4NX5A 3ZM8A 3TROA 1GOQA 4DJED 1B3OA 2OT1A 4LAZA 2VFFA 3NZRA 4J4KA 2J79A 4YS1A 4J28A 5D8WA 2VZTA 2NWRA 2E5BA 3NDZA 4IMDA 3PZIA 2E6FA 3W72A 1KCLA 3ZQ9A 4W4QA 2RUSA 2YBVA 4H6EA 3MUY1 1MW0A 1YW1A 4M82A 3FS2A 1PTDA 1ZB5A 4PMZA 1UHVA 1YDYA 3KCOA 3B8SA 1S39A 3SGGA 4OOUA 4GQBA 3WMBA 1XQKA 2QIWA 4YCOA 2XU2A 3OVGA 4X63A 1TSIA 1L9WA 2ZTKA 4C91A 2PRLA 1H0IA 2PSNA 4A8RA 3GH5A 4AD1A 5REQA 4LX4A 2XIMA 3VDCA 1GVIA 5CAKA 1CXIA 1LF1A 4TV5A 4BCEA 2ZVIA 3B8VA 3W22A 3H53A 1V4YA 3P61A 1SW3A 3H4WA 3ALGA 4MWAD 3K1DA 2OSYA 5FL1A 2EEXA 3O9NA 3HURA 3ZFHA 4K1WA 4AZ6A 3KDNA 2H90A 1BPLB 4JYDA 5D9MA 5DFAA 1TJRA 3PNUA 1CT5A 4RZBA 5BXPA 3AXKA 3KTXA 4Y9AA 2IQTA 1G6CA 3OBAA 4S3BA 3KVLA 1K9FA 4KRUA 3SSZA 5A6AA 3P7YA 1VFUA 3VO0A 1L0PA 1AW1A 1AVAA 4F66A 1XYCA 3GXPA 3MSRA 3Q2DA 4PMOA 4K6AA 1OY0A 3NG3A 1DQUA 3TW7A 4WUIA 2JIWA 4NASA 4TXEA 4P7LA 4J3UA 2ZIDA 5G2WA 4ZGYA 3ZSTA 3C0LA 3GR4A 3SN0A 1KFKA 1XSJA 3AFBA 3T7VA 1M7OA 1TCDA 1H1YA 3VCNA 1MWOA 3R1ZA 1A49A 3EDEA 1US2A 1HP5A 2V2CA 4GE8A 4RV3A 4MNKA 1N8WA 1GG1A 5M2FX 4LUJA 3ZO9A 5FOOA 1P0KA 3NQ7A 2WMFA 4TU1A 4YWSA 4HYVA 1XIDA 3EX3A 3NZGA 2WQPA 1PKMA 3NDYA 3VM5A 4D2JA 1LLOA 4Q32A 4WXZA 3VX0A 5ABTA 2XIIA 1S1RA 5HWNA 5BU6A 1VQTA 4GBDA 4ASTA 1PJ9A 4MKVA 1BLIA 1Y65A 2F9RA 1JEZA 4IFKA 4IZGA 1C9WA 4Z2GA 2PDFA 2YXXA 1PX8A 3C61A 4Q4PA 5C2CA 2VR4A 4LGXA 3VNZA 1U1JA 4RPQA 3G77A 1SSDA 4JGDA 1XM3A 2Y61A 4M51A 3GDMA 3H54A 3H21A 4XIAA 3UFYA 3ALFA 4LVDA 1X39A 2WNQA 1W91A 1JF6A 2OMAA 4O0ZA 4GYJA 2W66A 1GQLA 3MPGA 1D7KA 1EFZA 4KKXA 3N15A 4PFHA 3TK7A 4C6IA 3BG3A 1XBXA 1PAMA 3W1MA 3EMCA 4IOTA 5CH9A 3RILA 2PWVA 4LVBA 3NCOA 1YBQB 3ANVA 4Q7BA 5I3KA 2HBVA 2Q3OA 4A3QA 2ZZ4A 2W9MA 3OLEA 2J7HA 1IZKA 5BOOA 4UZSA 3PR2A 3CQ0A 1VKFA 1S1PA 2QUUA 1XRSA 4L1XA 1V3LA 4AAJA 5D30A 4RNJA 3PUGA 3PZVA 3ABOA 2FZ9A 3QY8A 2FMNA 2VVNA 3VGFA 2BOGX 4AMCA 1GEHA 3GXTA 3SDOA 2HROA 3CZ8A 3MU7A 3SO7A 2V8ZA 1VJIA 4M5PA 3UZZA 1OWQA 3F4VA 5FF0A 3NEHA 3HMCA 1AQMA 3DOPA 2WC7A 1GOMA 3G18A 3WUEA 4E2OA 1XGDA 1I0BA 2ATSA 3SIZA 2V38A 1K9DA 1F74A 4LAKA 2FTWA 4OQVA 4TR9A 2E9BA 4N2YA 1TV7A 3V1HA 5GNZA 2BX7A 2XG9A 1VEOA 2V3DA 1KWGA 3WDIA 4IJRA 3NSNA 1FH8A 4X2PA 1DEDA 3WDPP 3LSCA 4DO7A 5HJLA 4WXYA 1JPDX 1O5RA 3TMQA 3RO6A 2DVTA 5BCAA 3G1FA 4LYPA 4NAFB 4QM1A 1D3GA 5HJYA 1BQCA 2WO5A 5K7JA 5LIWX 4MY1A 5A6LA 5JVLA 4IQJA 3VC5A 3RAOA 3PZNA 3THDA 3JU2A 3TA6A 2YA2A 3QV8A 3I10A 4EWJA 3EA1A 4F0LA 2NLYA 1EZWA 2PGEA 4GVHA 1G94A 4YL2A 3EGJA 4ZQPA 1FH7A 1YDNA 2Z1WA 5AHIA 1JXKA 3DYOA 4XUYA 1U2YA 3F7JA 5HBFA 4GQ0A 2WHKA 2Y8UA 4OU1A 3RLHA 3DHUA 3BAJA 2ZVRA 4LB4A 1VD6A 2ZQ0A 2D3NA 1A5AA 1P6BA 5MKGA 3UG5A 1PKNA 3TN3A 1OYCA 4OECA 2DEPA 2OZ0A 4RNFA 4NXSA 1YDVA 1NAL1 1IHIA 1UWTA 3R0KA 3L4UA 1ZUAX 1OX6A 1KFCA 4N9EA 2ZFAA 4AC7C 4MZ1A 1ZENA 4GY1A 1AG1O 3H2CA 3P6LA 2O92A 1QBAA 3STFA 5AVHA 2PS2A 3TFCA 3PTKA 2O55A 4ZQCA 3L0GA 5ECUA 2Y0FA 1U5VA 3MHGA 3ARXA 2PLCA 1E1CB 1FBAA 1UIOA 1I2RA 4GYPC 1GK8A 4I7VA 4RW5A 3KHDA 1LORA 3TMLA 3DEQA 4UFJA 1I2QA 1OFEA 1AMKA 1ZAHA 2CLHA 2H3DA 2ZWZA 2Y8KA 4R27A 1NIUA 5EA9A 3TSDA 3T4CA 2J9YA 1S2CA 4EXAA 3QR1A 4GX8A 4V15A 4YXGA 1UA7A 1C8YA 3ZVIA 3OPSA 1NFPA