1Q45A

12-0xo-phytodienoate reductase isoform 3
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
380
structure length
365
Chain Sequence
b'SNETLFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEYYAQRTTPGGFLISEGTMVSPGSAGFPHVPGIYSDEQVEAWKQVVEAVHAKGGFIFCQLWHVGRASHAVYQPNGGSPISSTNKPISENRWRVLLPDGSHVKYPKPRALEASEIPRVVEDYCLSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQYGGSIANRCRFLKQVVEGVVSAIGASKVGVRVSPAIDHLDATDSDPLSLGLAVVGMLNKLQGVNGSKLAYLHVTQPREEEAKLMKSLRMAYNGTFMSSGGFNKELGMQAVQQGDADLVSYGRLFIANPDLVSRFKIDGELNKYNRKTFYTQDPVVGYTDYPFLAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12-oxophytodienoate-10,11-reductase
publication title X-ray structure of Arabidopsis At2g06050, 12-oxophytodienoate reductase isoform 3
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 132
structure length 365
sequence length 380
chains with identical sequence B
ec nomenclature ec 1.3.1.42: 12-oxophytodienoate reductase.
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1q45A00
5D05A 2W0UA 4GE8A 3NM3A 3S8HA 1V7YA 1IGSA 1H7NA 3NAVA 2O7QA 5DELA 4Q33A 3W85A 5J5DA 1VHCA 3NDOA 2C13A 1Z42A 2QCEA 3HO8A 3MUXA 3QPYA 4ZZ9A 3PSVA 2ALDA 6ALDA 4A29A 1W31A 4JIQA 4GNJA 4ONVA 4JTHA 3B8DA 2E6AA 4K7YA 3TKFA 5DXYA 2HTMA 3M7WA 2OMAA 3EX2A 1QMLA 3U8GA 4DF0A 4XUGA 4YMZA 4CQAA 3TXVA 1S3HA 1IIGA 1AW2A 2FIQA 1ICSA 1C29A 3PUOA 3G0UA 3W7GA 3O6DA 4C1KA 4LC6A 4GBUA 2PRMA 4XBSA 4QNWA 4WQ6A 3W7HA 5LGZA 1KTBA 1TTIA 2YDAA 1NFBA 3G1VA 3WK3A 3EWXA 4CCEA 3EXTA 1C8VA 4NJJA 4HKPA 5F1VA 4QAIA 2ISSA 1K7XA 3SZ8A 4CNNA 3KXQA 5CSSA 1M5WA 3P8IA 3PB2A 4XWUA 1LBFA 2V8ZA 3NG3A 3NQ2A 4M19A 1G4PA 1M7OA 2DZSA 4IX0A 3T78A 1L9WA 1KV5A 1ALDA 3KRSA 3HPZA 4QNEA 5KZDA 3F03K 2Y70A 1DOSA 5CPMA 1MEIA 1GYNA 2WOQA 4FNSA 3MI3A 2QR6A 3OVRA 2ZA2A 3OVQA 1V5XA 1NF0A 2CLFA 3W2LA 5BRBA 1P4CA 4LRSA 4S2BA 4MKNA 4LWWA 5CZTA 3B0UX 4O4WA 2E6DA 4E2BA 1B9BA 1BWLA 2EPHA 3TK7A 4AF0A 3TW6A 3EX4A 4JS3A 4IX2A 4LS2A 4MFDA 3S9YA 3PVFA 2ISWA 3EXSA 1PL9A 3KRZA 3H55A 3NO5A 3DHDA 1EWDA 3IGUA 1FXPA 3HPXA 3P67A 4ZQCA 3CC1A 2V5LA 1G4EA 1NF7A 1JCYA 3N14A 2OT1A 1K02A 2G95A 3RLUA 3S1XA 5E93A 3GDTA 2QCMA 3C6CA 2QF7A 4PL2A 4MY8A 5F2LA 4UFMA 2V0TA 3GK0A 2ZZ2A 1QDSA 1EP3A 2CLKA 1QOPA 1I2OA 2A1YA 3W7IA 2E6FA 2VKZG 3JR2A 3P62A 3C56A 1QCWA 3B03A 5FEPA 4DPQA 3T55A 1F6PA 4NJIA 2WNZA 3A21A 1YYAA 3LHVA 5G2HA 3LHTA 1WBHA 4CNPA 4JNMA 4FEZA 4ML9A 3OBKA 3W1TA 2A6NA 2B7OA 5H91A 1FCUA 4JY9A 1RQHA 3TR2A 3W84A 3LM7A 4IMEA 1XDMA 2CLOA 1U83A 4MY9A 4ADSA 1H7RA 4P61A 1OFAA 3P5ZA 1ML1A 1GVSA 1GYLA 4UFHA 1ICPA 4TR9A 1TPDA 4LS1A 1IF2A 4UCGA 3U6WA 4TMCA 1RR2A 4WZHA 5D2VA 2WNNA 4W9TA 1DJNA 2AAMA 3UZJA 1CX9A 4FXRA 3RF9A 3DBPA 5D2TA 5LNUA 4AVFA 1EP2A 1SZFA 3T40A 3NOEA 3TU9A 4MYAA 5EL1A 2BLEA 2JK2A 4HSOA 1OVDA 4GUIA 4PC8A 1O4UA 2R94A 5CPLA 1TPUA 2TPSA 1FUYA 5EBUA 3EWWA 5C54A 4OWGA 4RZ5A 3A22A 3PUDA 5BMXA 3P81A 3PBVA 1W3NA 3L0GA 5KMYA 3EX3A 4UTIA 3CWNA 3MP4A 5D33A 3EWUA 1CI1A 4O57A 3W1AA 1A5BA 1XM3A 2ATMA 1JCNA 2VENA 5HWNA 5F4WA 2NUXA 4EWND 2OCZA 4HNNA 1SPQA 3TSDA 3P82A 3L67A 2VFDA 3BG9A 4MPQA 2XFWA 3F4NA 1Q6OA 4MZ8A 2FQIA 1GPWA 3LTYA 2KZHA 1B4KA 3A5FA 1TV8A 1ZAJA 1X1OA 4O1BA 1KFLA 3GR7A 1TREA 2H90A 4YL2A 4WXYA 1P0KA 5LHEA 3W2JA 1GT8A 5U4NA 4DPPA 1T8XA 2P1FA 4RX0A 4LC8A 4MY1A 5AC6A 2DZVA 1O5XA 3LXBA 2YYUA 4Y90A 3QW4B 2B7NA 5EKYA 3GR8A 2JKAA 3NQ8A 1AL7A 1AMKA 3T44A 1KLZA 4DQWA 1ZFJA 4HPXA 2FDSA 2NV1A 4O4VA 4UR7A 3USBA 3W9ZA 5G4WA 1ICQA 1F7BA 3W7EA 2NUYA 3L5MA 2CLLA 1ZJIA 3PBYA 3LCXA 2C14A 3QF0A 4P2VA 3W1NA 3TCEA 5BNKA 2QCCA 2GQAA 3R12A 4DBEA 5KZEA 3TV8A 1H63A 3GXTA 5HR7A 3FS2A 4UNLA 3SFKA 5CG7A 3DU0A 4JYEA 3HMJG 4RV8A 1EB3A 2OT0A 4QQ3A 1AW1A 5FEXA 2BX7A 3M47A 3CHVA 3TE9A 2IQTA 3C2VA 4DF1A 4NJKA 3DGRA 3SR7A 5IM51 5D09A 2LLEA 3I6RA 3TA6A 2JGYA 1I45A 1VC4A 3G22A 3SJ3A 3PC0A 3W72A 5FEZA 4C1LA 4JTKA 3DI0A 3KAOA 4DF2A 3IVSA 4MFEA 4IXHA 3TQ0A 1TPC1 3W7KA 3AO0A 3W22A 3G1YA 1A53A 1VHNA 3VE7A 2JKPA 2YCEA 1XC4A 1X7FA 5DLCA 4KKXA 1ME9A 3WJSA 4XZ9A 3L65A 3KFTA 3HGOA 1IXNA 2HSAA 1W5MA 1YPIA 5CZSA 2VEMA 3NL6A 4Z0SA 2VOMA 4QISA 1SR9A 2VEIA 1HUVA 3MP5A 1I2NA 1KFCA 3NPUA 4CLMA 4CCCA 1FDYA 1SZGA 1JCXA 4ADTA 1R47A 1LBLA 1YTKA 5KZMA 3W7LA 4WXZA 4IGHA 2VEKA 1TJPA 5HR6A 3W2MA 1GG0A 3THQA 4N02A 3BG3A 2QCGA 2VC6A 4AAJA 4DO4A 3FJLA 2QAFA 4FO4A 3HBLA 4UUIA 1EIXA 2FTPA 4POCA 4KWWA 3PWAA 3TSMA 3HG4A 3LRKA 1O5KA 3GVGA 1QWGA 1K8ZA 2X1TA 1VCGA 4JIPA 1TPH1 2B4GA 1KLYA 5GVJA 1H60A 3RU6A 1O95A 3O16A 4LS0A 4LUIA 5FEWA 1TPWA 1NAL1 1H7XA 1LRTA 3Q94A 4NQ1A 3GXNA 1GWJA 2GQ8A 4RXFA 3LDVA 5K4ZA 1PHWA 4Z1AA 2ZRYA 4HT3A 3QFEA 2FLIA 2XN1A 3HB9A 4O8RA 1HFBA 5DY3A 5LNSA 3LBMA 4O18A 3I7QA 2V30A 1RZMA 3H54A 2WSQA 3G8EA 2WKJA 1OK6A 1W56A 2YFOA 2Z6JA 3TMLA 5EPDA 1OX4B 1LOLA 4IOTA 5LNVA 3S1VA 2QJGA 3TSBA 8TIMA 1G67A 3M5XA 3EX6A 1KFEA 4A3UA 4MZYA 4O11A 5TBOA 4FXSA 3AJXA 1VRDA 4O17A 4OE7A 1P0NA 2ZTJA 4L4MA 3M41A 6TIMA 1SU5A 1TV5A 4N2YA 3LTSA 1BEUA 3TNOA 1IXPA 2GJLA 4PFMA 1F6KA 1NEYA 3H53A 2C0AA 1SZEA 1TPEA 4JTUA 5D30A 1ZAIA 2RHGA 3L66A 3B05A 5K9CA 3GB6A 3MJYA 4RXGA 2ZYFA 1SW3A 4FB7A 1WQ5A 2QUVA 2D73A 2H6RA 1TQXA 3NQAA 3HIJA 1RVGA 1Q45A 5EMUA 3NR0A 3BGGA 3HJZA 1LP6A 1YDNA 4LRTA 1F76A 2J24A 1ME8A 1RV8A 1I2RA 2Q3RA 3W1QA 1JCJA 3MYOA 3LCWA 4LT9A 1L2UA 3TJLA 3TDFA 2PC4A 3GZ3A 3LCHA 4JTJA 1OF8A 2P10A 1DL3A 3W1UA 3R5EA 3PBWA 3G1HA 4UTKA 2YX0A 3KRUA 1GTHA 3W1PA 4OHQA 2WPBA 3NA8A 3STFA 2QCHA 1H5YA 3TUUA 3TROA 3G1FA 5HWMA 3CWOX 2A2IA 3VKJA 4FNRA 1YDOA 4GC4A 3ZWSA 3M1ZA 2RDTA 4WY0B 4FF7A 3WJZA 3W1RA 7TIMA 1SO5A 3N3MA 3W7DA 3HPSA 4UC5A 2Y61A 4RKAA 3CLMA 3UD6A 3D0CA 4N4PA 4MOZA 4U28A 5AYYA 2GPTA 2ZZ7A 2ZFAA 4PH6A 5K4XA 4Q32A 1QPOA 2NX1A 4RK8A 4EVZA 1YADA 3GAYA 1N8FA 2ZZ1A 3BLFA 4AHPA 5HMSA 4NXSA 2GVLA 1VS1A 1VZWA 5DY2A 4YCOA 3P8JA 3P7YA 5LHFA 2VXNA 2E09A 3M5VA 4O0ZA 4JY8A 4Z0JA 3IVUA 4NXKA 2TMDA 2RDWA 1K8YA 2VFFA 5HJLA 5D32A 2JGQA 5F4XA 3DHFA 2G5WA 2VFGA 4DO6A 3W7OA 4XBKA 3I65A 2Y7EA 2DZTA 1LDCA 4H4IA 1TSIA 1WA3A 2ZZ5A 4LUJA 1FXQA 2YZRA 1TIMA 1X6UA 3CIXA 4JEQA 4UR8A 4XTIA 4WOZA 4NJGA 2ZRXA 5G2WA 2O7SA 1B4EA 1LYXA 4YWIA 3IGSA 1FCBA 1DBTA 5AFDA 1QR7A 4UMBA 1KA9F 1XBZA 3UYCA 1PV8A 5A8GA 3LB0A 5C2XA 1OFBA 1PHQA 3LV5A 4ADUA 3N9SA 3P80A 1H62A 4Q4KA 1F73A 1PCKA 4K37A 2ZA1A 3WFAA 4CCDA 1VLWA 4GUGA 1KTCA 2BWGA 3EWYA 2WO5A 5HULA 2YR1A 1XUZA 4PODA 4EF8A 5DBUA 4O15A 3LV6A 1I4NA 3EX1A 2C6QA 5AN7A 3PSWA 1VJIA 5KITA 4N9CA 3PAJA 3N2MA 1KV8A 3NVTA 4IUOA 2GOUA 1QO5A 3S1WA 3G0SA 1JCMP 3QQ1A 3GXPA 4DELA 3R2GA 3NZRA 5K9DA 2W79A 4G1KA 3CU2A 4JR5A 4NNBA 5G4EA 4FIRA 1TJRA 3M9YA 4O16A 2XN2A 3C61A 1TRIA 4WJEA 4MJMA 1FBAA 4FNQA 3STGA 4EIVA 1RQEA 3QSRA 1U5JA 4JICA 2QKFA 3MW7A 4R33A 4K8EA 3DFPA 1SQ7A 1SO3A 1G7UA 4QSHA 5LKYA 1WXJA 1JUKA 3IIXA 4FX7A 2X1UA 3L0NA 1LRNA 2J6XA 3GLCA 5H2ZA 1SZNA 5I3KA 1TTPA 4TIMA 3W71A 3VE9A 3WJYA 1J4EA 4K38A 5I3GA 5K3VA 4TMBA 3QSTA 2CU0A 1R30A 4NX0A 4O14A 3BLEA 1GJPA 5K9XA 1ONRA 4JTTA 1WDWA 2Y7FA 4BFAA 3ZFHA 4M6VA 3W23A 1BWKA 1A5SA 3SSJA 1TQJA 3SI9A 2Z6IA 1VYSX 3I68A 3S5OA 1Q6LA 4BF9A 3W76A 3HGRA 3PR2A 2OX1A 3NQMA 1ZENA 5HINA 3W1MA 3BW4A 1GTEA 1EPXA 1TPB1 4HHPA 3FKRA 1B57A 1VCVA 2EF9A 4Z1BA 3DFTA 1AL8A 3BLIA 4K39A 3HGSA 1M7PA 3C4UA 1OJXA 1J5TA 2QCDB 4OGZA 2V2HA 3B06A 3JRKA 1KM2A 4XTDA 3DFSA 1LLWA 4O54A 4IPJA 3IEBA 1EP1A 1VGAA 2NXIA 2FFCA 3B04A 1EUAA 1HTIA 1R46A 3TQKA 4ZL1A 4O53A 2ZZ3A 1KM5A 2X30A 1TV7A 4ZQPA 2WV8A 1KFBA 5EYWA 3GX9A 2UV8G 4D2JA 4MVAA 5F4SA 1TRDA 2RFGA 3BV4A 4J9JA 3TMQA 2CLIA 4QM1A 1ME7A 1T0OA 3PB0A 4IMFA 3WJXA 1WBJA 4MLRA 5LSMA 4AB4A 4GUHA 3W07A 3M44A 2HS6A 3FOKA 4DEFA 4H3DA 3DH7A 2RKXA 3LOTA 3O07A 4AHOA 1FWSA 3OIXA 4ZQRA 2Q8LA 1UASA 5F1UA 5A5WA 4AHQA 5CZJA 2B7PA 1DQXA 3MO7A 4OU1A 1YTEA 3S5NA 3E12A 4JTGA 3A24A 3DKJA 2FJKA 4HN4A 4Z08A 3LRMA 5AC7A 5E0KA 3FLUA 4GUFA 5U7SA 1BTMA 5KINA 3S5YA 3MYPA 3LHUA 3A5VA 3G24A 3HG5A 1FCVA 4WD0A 2ATSA 3UZ5A 1KW1A 3WK0A 2ISVA 5AHMA 3O05A 3T7VA 4L4LA 4O1DA 2PRHA 2YSWA 2CLMA 2Z0IA 3P74A 1FCQA 3BW2A 2R8WA 3PF3A 3OEXA 2I9EA 5TQLA 3UWWA 3DFNA 3G1SA 3W7QA 4PA8A 1JQXA 5IBXA 2V82A 4ZVJA 1OFQA 1PE1A 3N9RA 1H61A 2EHHA 5G2IA 1FWNA 3QM3A 3EWBX 4O1CA 1K8XA 1IIHA 1MEHA 2QJHA 2X1RA 3DENA 3LBCA 1RD5A 1OFRA 1D9EA 4LVDA 1OX4A 1T99A 1WX0A 2H8ZA 5CPOA 4UFJA 1I8JA 3FJ6A 4ZQMA 1FWRA 2WSYA 3GYEA 3QYQA 2WSRA 1N7KA 1MO0A 1OF6A 4JGDA 1T96A 3SGZA 2OJPA 5HUPA 3L2IA 1GVRA 1ZNNA 1OYCA 3EWZA 1VR6A 3NPWA 2ZA3A 3MHGA 3NL3A 5KSWA 2E5BA 1KBJA 3NQVA 1LORA 2GQ9A 4NZFA 4H6KA 3NM1A 5TIMA 3DFQA 4NNAA 3W86A 4MLJA 3BGJA 2CWNA 4JTSA 4M7SA 5L9FA 2A85A 2W6RA 3MWAA 3PG8A 3MHFA 1EEPA 4LNYA 3QJAA 4O10A 2QDGA 3INPA 3V1PA 4IWWA 4I7VA 1SSDA 1H51A 2RH9A 2ZRZA 3CT7A 3PUEA 3M0ZA 4N9BA 4LY8A 2DZPA 1OFEA 3FFSA 5AYXA 3NEVA 3DXIA 5ABTA 1HO1A 1AK5A 2AGKA 4NU7A 2QUUA 1S5WA 3CTLA 1LOSA 1OYBA 3G8RA 3STEA 3G1XA 4WY0A 1FWTA 3W7PA 3TJXA 4GXMA 1KM3A 3E9AA 3G18A 3NQ6A 1EWEA 2ABBA 4Y8FA 4I9AA 3SIZA 3T4CA 3GDMA 4DO5A 3P61A 1KM6A 3B4UA 3DI1A 3TXZA 3UWZA 5AHEA 2I14A 5MHBA 4NJHA 4O52A 5DCEA 5D02A 2JBMA 2QJIA 4GFSA 1N55A 1Z44A 2PRLA 3W1XA 3UWQA 3PBUA 1YPFA 1Z41A 4ICNA 1VYPX 3FYPA 4MUZA 5L6UA 4IPIA 2CZDA 1LRQA 5AHIA 5D38A 4AWUA 1VLIA 4NUWA 2HMCA 2DZUA 3L5AA 1DHPA 3E0IA 4Y96A 1P1XA 1MXSA 2Y7GA 5G5IA 2CZ5A 1WYIA 2VELA 2QCLA 3PG9A 4MYXA 2CLEA 1ZAHA 5SWUA 1UBSA 3ELFA 4UFKA 1KFKA 1W54A 3IIPA 3M16A 4CNOA 1H1YA 4AMAA 3TC6A 3DAQA 1EA0A 5BOOA 3GDRA 2AQWA 3BO9A 4LVBA 2H3BA 3G3DA 1CW2A 1DORA 1OK4A 3GKAA 4UIOA 1S5VA 1SO4A 1SFLA 1VQTA 1K03A 3HOJA 3K30A 1AW5A 3OHIA 3BG5A 3HG2A 3M5ZA 3RK8A 5FF0A 4NT0A 2X2GA 3LI0A 3W7NA 1LBMA 2GJNA 1QPRA 1IXOA 1F2JA 5LZLA 3OVPA 4X3ZA 3C52A 2TRSA 4CQ9A 4GRSA 3IV3A 5J5RA 2DZWA 1IXQA 4UXDA 3GDKA 3ANYA 3LHYA 1UB3A 4IXXA 2A4AA 3M6YA 1VYRA 4LV4A 2C19A 3R8RA 4ZMGA 4UTMA 1K3UA 1D3GA 2BSLA 3C8FA 3QC3A 3UY8A 1VCFA 2FB2A 4LU0A 1GVOA 2VEPA 3ATYA 3C2FA 1W3TA 3LERA 3OA3A 3P5YA 3TH6A 2YGYA 3O06A 3W3OA 2C15A 3FA5A 2DJLA 5DN1A 1F74A 4K6AA 3FYOA 1TTJA 4JX6A 3MP3A 4I7WA 2EGZA 4IMGA 3O1NA 2NX3A 3QMSA 3C2RA 4UTWC 1JRCA 2YW3A 2ZRWA 4JD4A 5AHNA 3PS7A 1RQBA 5C6MA 3W7RA 5IBXC 4ORMA 1K7FA 1VPXA 5FI8A 4AEOA 4DXVA 1Q3NA 4O0KA 1DV7A 4BK9A 1NVMA 3NL5A 4BI5A 3L68A 4ORIA 2ZBTA 1GZGA 4RR4A 4M5PA 3SW6A 1FDJA 3R89A 1TYGA 4M6QA 1W5OA 3YPIA 3VNDA 3NXFA 1UUOA 1W3IA 3LTPA 3THAA 5CGQA 3RNDA 3FKKA 1LTDA 3TW7A 4A2RA 3CIWA 1H50A 1H7PA 4RZ4A 2E5DA 5D2YA 3LI1A 1R2TA 3CPRA 2X1SA 1EUNA 4IQLA 5AOUA 1HG3A 2NXHA 3LHZA 3ZR4A 3GKFA 2A6LA 3LCGA 1A5AA 4M6PA 2V2DA 1HO4A 3NQEA 4JTIA 4JDYA 1PVNA 4JXCA 4UMCA 3PY2A 4K7VA 3E49A 4MJZA 3JS3A 3MBDA 3CEPA 3N2XA 4OQVA 3GDLA 4ZQOA 3ABOA 3UY7A 4ZQNA 5I3HA 2EAWA 2QUTA 3IIVA 5AB3A 3CEUA 3C3NA 2NUWA 2QCFA 3W7MA 2RDUA 2DU2A 3TFCA 1ZALA 3LLFA 3DFOA 1W37A 4BI7A 3QW3A 4LV9A 3Q2DA 4QJ1A 1J2WA 3WK2A 4JX4A 3QZEA 5C5YA 1WOBA 2ZRVA 4GWEA 3TIMA 3MHUA 4RLIA 2CLHA 4O1AA 2G97A 2A0NA 3O15A 4BI6A 3GNNA 3O63A 1MEWA 1A5CA 5FF4A 1FQ0A 4R34A 3N34A 1L6SA 3F1QA 2QCDA 5EY5A 5FF2A 3UQNA 3G1DA 3I7RA 4CQ8A 1JUEA 3STCA 2Q8ZA 4KFPA 3CB8A 1R2SA 2A5HA 4FHAA 5K2ZA 3QEZA 4UFIA 2ZCGA 1FX6A 5KTLA 4N4QA 1XCFA 2E68A 3C2EA 2J9ZA 3LXCA 5FF3A 4N9EA 3TX9A 4IMDA 3C2OA 1OG0A 1YXDA 1EX5A 5AC8A 2WQPA 1KM4A 1LM1A 2A7RA 1GG1A 2CFFA 4UTTC 1JVNA 1JUBA 3BK0A 4O13A 3P84A 2ZDRA 4WX2A 3LGEA 2Z1BA 3NGJA 3UNDA 3Q37A 1XBVA 4RJEA 3DZ1A 3MI2A 4AWSA 4N6EA 2C3ZA 2E5CA 2QCNA 3VCRA 2TSYA 4R53A 1UUMA 1TMHA 2HS8A 2F7FA 1QFEA 3BARA 5CZ0A 2YPIA 1FY6A 3PM6A 4BWLA 1X1ZA 3NNTA 3L5LA 4UTUA 1THFD 3HG3A 2NWSA 4A22A 4FNTA 2VFHA 3HQ1A 1O94A 3I7SA 5LGXA 4JTFA 1LROA 3LCFA 4AWTA 3LXAA 2OZ0A 2I1OA 1LLZA 4UTHA 2QDHA 3NQCA 1R2RA 1F05A 1P5BA 4Y6GA 4HSNA 5D37A 1TTQA 1A50A 1W5PA 5D2WA 1PIIA 3C0JA 4N9DA 3LCLA 3G0XA 5HNRA 1LCOA 2Y88A 4NVTA 4JTEA 4KFOA 4N6FA 3GAKA 1OX5A 1C9DA 4TO8A 4HNUA 4JN6A 2J9XA 3W70A 2C1HA 3MMTA 1DJQA 4YLWA 2ZQ0A 5FESA 1SFJA 3W1LA 2G96A 4O50A 1DVJA 3M43A 2Y63A 4HIBA 2VFEA 4OV9A 1OFDA 4A21A 2VFIA 5F2GA 2CW6A 4HNTA 5CPNA 5CKSA 4QITA 4WY0F 5DBTA 1MZHA 3ABSA 3F4WA 3Q58A 1JULA 4X2RA 2P0OA 3TQVA 1QOQA 3NQFA 2NWRA 3IIZA 2ZRUA 3O8AA 4LOCA 1GVQA 1G6CA 1G69A 4O12A 3U2OA 2PCQA 5HQEA 2E1DA 3KVKA 3KVMA 1VH7A 3W83A 5CSRA 1TO3A 1SW7A 4Z1CA 1AG1O 1ZY9A 3IRDA 2B7QA 2H3DA 4UTLA 4K8HA 4AF0B 4QIUA 1X8FA 4JYFA 3ABQA 1ADOA 1BKSA 3KHJA 3TC7A 1XKYA 2J9YA 2DP3A 4I7UA 3W87A 1NSJA 5G1TA 5HWJA 1JRBA 1S5TA 4NX5A 3GNDA 2X16A 1RPXA 5G1YA 3E96A 3BVJA 3NPXA 1YLVA 5DCBA 3NQGA 5D2XA 4XQ6A 3M5YA 1JJKA 1W5NA 1TCDA 1SSGA 1GOXA 1JCLA 2V2CA 5LNWA 5FF7A 1TPFA 3NL2A 3N73A 3P60A 3N19B 3HF3A 3RMJA 3RFAA 1FWWA 1GQNA 4MIMA 1K7EA 4UTWA 1FDZA 1W0MA 1XXXA 2CZEA 1ZHAA 4E2DA 5K7JA 2R91A 1TPVA 3MBFA 2Y62A 2FB3A 2JKEA 3UWYA 2ABAA 4BR1A 1YXCA 4JYDA 4PEKA 3QMTA 3W75A 1G7VA 3NQDA 1B3OA 3NYZA 4RZ6A 3ZWTA 3B0PA 4IJBA 1H7WA 2GVGA 2ZZ6A 3FEMA 3W2KA 3FIGA 3UWVA 1I2PA 2YXGA 4TU1A 4XKYA 1OHLA 4E0CA 3DKLA 2V9DA 4JX5A 4Z1DA 1UCWA 1W5QA 4FX6M 3NPVA 4NNCA 2YW4A 2BTMA 3LLDA 1Y0EA 4KWVA 1QPNA 2WJZA 3V75A 1QNVA 1PCWA 4JTLA 2E6YA 1G4SA 4RCXA 4EOUA 2NV2A 4GUJA 3W7JA 4UNKA 2Y6ZA 3W88A 2A7PA 3MI6A 3ATZA 1W8SA 5AHLA 2NLIA 5AYZA 3LRLA 5F2IA 1L6YA 4EF9A 3EXRA 3EB2A 1SUXA 1KBIA 1OFOA 3L9CA 2BZNA 3CQ0A 3LX9A 1SO6A 3GIYA 4AH7A 2CZFA 3BPWA 4B5NA 5I3FA 3SY5A 2Y7DA 3S6DA 5EA9A 4X9SA 2TYSA 3QRHA 1KTNA 4S2CA 2Q3OA 3S0CA 4PTNA 4HPJA 1Q6QA 1MSSA 2PE4A 1XL9A 2V81A 3TAOA 2E77A 3S1UA 4IMCA 3KX6A 3L21A 5D04C 2ZZ4A 3OG3A 1WV2A 3KVJA 1LZOA 3UPWA 3VI2A 3W2NA 2H8XA 3W2UA 3L0KA 2NXGA 3W6YA 1XBXA 4TX9A 3E02A 4YCPA 4OV4A 4BWLC 1JQVA 1W1ZA 1TB3A 2DJXA 4JDBA 4X22A 3TAKA 5T26A 3A9IA 1KFJA 1XFBA 1WOAA 3W7CA 5BW6A 4O19A 5F2MA 2B0MA 5E1QA 2ZTKA 4DBDA 4GJ1A 4WUIA 1QO2A 3O6CA 1OYAA 4UTTA 4M7TA 3WJWA 3ZS4A 2BXVA 4A2SA 3SGUA 4E38A 3W74A 4O28A 2WNQA 1O60A 2Y85A 1SW0A 1YTDA 3BW3A 2F84A 3EKZA 5AHFA 4LVGA 4MZ1A 3UXDA 1QPQA 3O6YX 1I2QA 3SECA 4XKYB 1KM1A 4OBTA 4Y9AA 1WAUA 1HL2A 3LHWA 4R7JA 3QMRA 3UWUA 1G4TA 4AXKA 2YFNA 3NQ7A 2A21A 4UTJA 2C18A 3KVLA 3QH2A 3EKLA 4YXGA 2GUUA 2FPVA 3LCIA 1QAPA 1GEQA 3RLVA 3G1AA 1JR1A 3UPBA 4ALDA 1F5ZA 4WOQA 1DKWA 4NZJA 2FPYA 4FIQA 3B0VC 3IIOA 2NX9A 2R14A 1H7OA 3ABRA 3UXAA 4KFNA 5C55A 3PULA 3HGJA 1ZCOA 3R13A 2A7NA 4HNVA 4FX8A 4PL1A 4UFLA 2QAPA 4OT7A 1XBYA 2EKCA 4S1FA 3IVTA 5I3JA 5DXXA 1XUUA 1XDLA 1H1ZA 3CM4A 2J88A 4LW7A 2QEZA 4FNUA 3WK1A 5LNRA 4U4MA 5BMWA 1YDVA 1PS9A 3W73A 3S42A 4UMAA 3QQ0A 4PCFA 2DORA 1D3HA 3G3MA 4LVFA 3IGXA 3VFLA 3KOFA 4LVAA 2Y89A 1E51A 2FPTA 2XN0A 1KM0A 2PURA 5HUOA 1Z48A 2V5BA 5I3IA 4K36A 5D03A 2DZXA 1XI3A 1Q6RA 1L6WA 3A23A 1OFPA 1DQWA 3QPZA 3S5ZA 3NZ1A 2J27A 2C16A 2NZLA 2Z2UA 1OX6A 1LOQA 1M6JA 4LTSA 1YXYA 2YYTA 3TFXA 1GVFA 2GVJA 4FNPA 1OABA 5DCDA 1UJPA 3EEGA
chains in the Genus database with same CATH superfamily
1PBGA 3NAVA 1B1YA 3BICA 5IFTA 3DERA 1LT8A 2C13A 2QCEA 1TIWA 5REQB 1D7FA 3S2JA 4AIOA 4QAWA 2ALDA 1KXHA 2E6AA 2PTWA 5DXYA 4LYKA 1ONEA 4QROA 1UG6A 2VL4A 3R58A 3UR5A 3PJTA 4GG9A 4DF0A 4XUGA 3SDOA 2UY4A 3B8SA 4XG1A 2HZGA 4FSAA 5BROA 1C29A 1Y65A 1W2PA 1Y5VA 3PUOA 4PUMA 3G0UA 3U2CA 1XLMA 4INFA 3S2MA 4GBUA 3SQSA 4WQ6A 2VR2A 3MS8A 1KTBA 2YDAA 3WK3A 1ZSXA 4NJJA 1BTCA 3WQCA 3L2MA 5F1VA 2ISSA 1K7XA 3I3DA 3A4AA 3BLPX 1M5WA 3P8IA 3NQ2A 3NG3A 1P6CA 2F38A 3VAVA 3AMCA 3WCZA 2HVOA 3AALA 4YU1A 4HZ7A 3F03K 2Y70A 1DOSA 2PTZA 1M7JA 3OVQA 2CLFA 1DIKA 1P4CA 1PKMA 1HP4A 3R8HA 4TXEA 4UQBA 2EPHA 4AF0A 3TW6A 3H6OA 3NOYA 3QTPA 1XLHA 3H55A 3C3UA 4QE4A 4G7FA 2WMFA 3HPXA 3V16A 1A5LC 3CC1A 2VGIA 3G6MA 1LF1A 1EJ7L 5JUVA 1NF7A 1JCYA 3N14A 2OT1A 2QXWA 1QUMA 1K02A 1TWDA 3AIEA 1ELSA 3GDTA 4RW5A 3QKZA 5A6BD 4AZ6A 3PPCA 2QF7A 3R8GA 1NARA 4RPPA 2V0TA 2E0PA 2XZ7A 3VINA 5E6ZA 3BQ5A 1QOPA 1I2OA 2A79A 1QCWA 5BOFA 1DJIA 2J79A 1F6PA 3S2NA 1E1CB 4C5YA 1FFQA 5G2HA 4JTQA 1R7OA 2IQ0A 4YVVA 4PMRA 2Q02A 5H91A 3H7VA 2FVLA 3CUGA 3WUFA 5AC4A 3TR2A 2EG7A 4F40A 1XDMA 5HK4A 3WNKA 2OLSA 1LUCB 3OLGA 4ADSA 3VILA 1WNOA 3CHEA 1GYLA 1TPDA 3N1AA 4UCGA 1GYMA 1XPGA 5T91A 4UB9A 4WZHA 2WNNA 2PZ0A 4KEVA 5FL0A 3WDQA 1TCMA 4Y9NA 1R3WA 4FXRA 1OC5A 1UD2A 1ISWA 3RGTA 1K6WA 1EP2A 1SZFA 1V02E 2EPOA 2BVTA 2OZ8A 3T40A 4AZ5A 1J5SA 3TU9A 2MNRA 1OT2A 3UESA 5EL1A 2Q09A 1LL7A 3TZFA 2QQ6A 1O4UA 3LMZA 1TPUA 2TPSA 1JYWA 4IPPA 4AG0A 3PBVA 4QS6A 2W9MA 3L0GA 4RE4A 5B80A 3MP4A 2ZKMX 1WKYA 1ZJBA 1A5BA 1XM3A 2J4GA 2VENA 1VRXA 4EWND 3TSDA 3P82A 3WMBA 3BG9A 3QGKC 1EKOA 2E9LA 1EZ2A 3IUHA 4O1BA 1KFLA 3GR7A 5CLWA 2PDJA 5CGTA 2H90A 3DHUA 4WXYA 4IGSA 4N7QA 3VIMA 4DPPA 4G8TA 1HXJA 4RX0A 1UWIA 1UWAA 3SGGA 4H00A 3JUGA 5EKYA 2PLKA 1YE4A 3GR8A 1AL7A 1UROA 2YJQA 4DQWA 1ZFJA 4I8YA 1IZJA 2FDSA 2E7FA 3VKBA 5AKQA 3USBA 2VZTA 3W9ZA 3VDGA 3KP0A 3W7EA 1F7BA 1XYBA 4MWAC 3REQA 3L5MA 3WQGA 4JIIX 1U2YA 1JYVA 3W1NA 1GUVA 2GQAA 2ZXQA 2DVXA 3RX4A 3TV8A 2C1IA 5HR7A 1C3FA 1M3UA 4GLEA 3CXOA 3G5EA 1SR0A 3T0TA 2AL2A 3FAWA 4GD0A 5CG7A 3LZ5A 4RV8A 5FJJA 5MKGB 2IXUA 3L23A 3R6IA 1QBAA 2XTKA 1L2QA 2F2KA 1QHZA 2VMFA 4NJKA 3I4KA 3VYLA 3GTIA 2C7FA 3TTEA 1ZBVA 5BWAA 1CNVA 1RY8A 4CN1A 1JFXA 2EJAA 4DF2A 2HNHA 4IXHA 3TQ0A 1IWBA 4S3CA 1TPC1 3ANUA 3W22A 2VD9A 3G1YA 3N11A 3VE7A 1JGMA 3MU7A 4IMAA 3WJSA 1H3GA 3GFXA 3HGOA 2I9UA 3PZOA 4QE5A 3MMWA 3DFHA 4F3HA 2O55A 3H2MA 1T5AA 3N2CA 2VEIA 4DRSA 1VFUA 1NWRA 1RH9A 1FDYA 2BGNE 4NAFB 4ADTA 4ATLA 1MQPA 2VDIA 4Q8MA 3GXIA 3WQ5A 2QCGA 2OG9A 4AAJA 3PWIA 2WB5A 3CIVA 2QF8A 1EJXC 3WF3A 1KRAC 4UUIA 1EIXA 3SCQA 7ODCA 2R1MA 4KWWA 4POCA 3BAIA 3TSMA 3LRKA 3LNMA 1TVPA 2GGJA 4JIPA 5CSYA 5HA7A 3RU6A 1O95A 4YTSA 1YX1A 4LS0A 1TPWA 1O7AA 1H7XA 1LRTA 4NQ1A 1GWJA 4H6EA 5CJMA 4GPNA 1S1RA 3BDKA 1Z7AA 3A3WA 3GHTA 4AD0A 1UR0A 1IV8A 3BTNA 1YRRA 1RPKA 2UY2A 1BPLB 5FJRA 1EHAA 3D3FA 3H54A 4G6CA 3G8EA 1OK6A 2Z6JA 4B5SA 2GGIA 3WFLA 2BHUA 3ARRA 3CZLA 1J0HA 3TSBA 3AMDA 1CEOA 3H2EA 3ISIX 4A3UA 4MZYA 5GPRA 4O11A 5TBOA 4FXSA 3AJXA 4JN8A 1C91A 2EKGA 3VIKA 1P0NA 3GU1A 3VNIA 3M41A 2G8ZA 6TIMA 1TV5A 3VCNA 3HV9A 3TNOA 3PBMA 1NEYA 3MWCA 3H7RA 7REQB 1XH2A 1W8GA 2RHGA 3B05A 3GB6A 9RUBA 2WMKA 4RXGA 3VKCA 1SW3A 2QUVA 4H83A 1RVGA 1Q45A 4S3FA 5EMUA 3H2AA 1LP6A 3KCJA 3HQNA 4DY1A 1UKQA 3B9OA 4LRTA 1ZJHA 3ZLFA 3W1QA 2OOFA 4H9XA 4L7ZA 2PTYA 1V77A 2P10A 2WANA 3QFWA 4DLMA 2BY1A 4OHQA 3OHMB 3NA8A 1R9XA 3STFA 3WDJA 1EXPA 1WDSA 4AUBA 1B9ZA 3TUUA 1A4LA 4GC4A 4E3VA 5I2UA 3IUDA 2VURA 4Y2WA 4CN6A 3WNNA 1DJZA 4PUDA 2RDTA 3GVWA 4J3TA 3WJZA 3W1RA 3WQFA 4MF4A 3W7DA 3FA4A 3UD6A 4PRRA 5AYYA 2GPTA 2W5FA 4AFYA 3BLOA 4JIRA 1QPOA 5FOOA 2F6XA 3VZYA 2DVTA 4NZCA 5A8MA 4DAFA 3WDPP 3BLFA 4Q3MA 5HMSA 3QGVA 2OSXA 2ZVIA 3WLQA 2DQWA 3B0XA 5LHFA 4XX6A 4AZGA 3M5VA 4IPLA 2VZVA 1AH0A 4KT2A 4NXKA 5F4XA 1E1CA 3R79A 5IDIA 3AXHA 5I77A 1PEZA 4DO6A 3CQKA 3DC8A 4F9JA 3I65A 2EG6A 3MSRA 5XIAA 3LGDA 1LDCA 3RLHA 3BJTA 1YDYA 2E25A 4H4IA 1GKPA 1FXQA 4A35A 2YZRA 1YIXA 1LUCA 3AWNA 2G0WA 1OADA 2PP3A 1C7TA 1UZ1A 2ZX8A 3LYEA 4M56A 3CZJA 1GZ1A 2ZRXA 4PUJA 5HXMA 1LQAA 3MT1A 4DBSA 4GH3A 1F8IA 3BE7A 3UYCA 5A8GA 4ERIA 1A3XA 1E3ZA 2BY3A 5C2XA 3RR4A 4ADUA 1H62A 4Q4KA 1ZB5A 1A3WA 4HGXA 4K37A 3VKDA 4CCDA 1VLWA 3ECQA 4HNLA 5DMMA 3DN5A 2BWGA 3EWYA 4W7WA 5HULA 4P8UA 2YR1A 4EF8A 2GK1B 5DBUA 2IUZA 1I4NA 2DSZA 2VWTA 3PSWA 2X0YA 1VJIA 3EGJA 2FJUB 2YLAA 4MKSA 3NVTA 2GOUA 4JTRA 4B92A 3BAJA 1M9HA 4DELA 3R2GA 3NZRA 1TX0A 3CU2A 3TVAA 2PDYA 4B9ZA 5ABFB 4C6LA 3ZR5A 3C61A 4WJEA 4WHBA 2ASHA 2Z2BA 4MJMA 1O66A 3VOIA 1ZCCA 1AMYA 3W25A 1V6WA 2YB4A 1DWHM 1V0NA 5LIWX 1FKXA 3IJIA 1LWJA 2X1UA 3L0NA 4Q8OA 4L6HA 2DIEA 1RLCL 1G0CA 3VE9A 3APYA 3CV1A 1QNPA 3AIWA 5K3VA 1E73M 2CU0A 3BL3A 1UKSA 2JIWA 2L5HA 3UCDA 2BS9A 2Y7FA 1BXNA 3A3XA 4Y8EA 4DWSC 1BWKA 4JTAA 3SSJA 4FF5A 1H5VA 1MDLA 3SI9A 2I17A 1PIFA 2OX1A 4BKNA 1QVBA 4H8VA 3KBVA 1TPB1 3IGHX 4W5ZA 1POJA 3FKRA 5MKGA 4Z1BA 3A4WA 4L6OA 1Q2SA 4Q6XA 1AQFA 4AQLA 1NWTA 5CJNA 2ZC1A 3HGSA 3I6TA 1RJRA 1Q6FA 1NOFA 2O9RA 4OGZA 4ZOEA 3B8VA 4WDWA 3DFSA 3IEBA 3COTA 1VGAA 3VU2A 3WKZA 4K68A 4GJJA 3TQKA 3O9NA 1V7AA 4LH8A 3EOSA 4GVHA 2DSWA 4ZQPA 5EYWA 1E0XA 2UV8G 4QQUA 3S83A 2OODA 4TVDA 3TMQA 4QM1A 3JZEA 1ME7A 1T0OA 4H01A 4IMFA 3ZOAA 4F0KA 4QCFA 4JL1A 3MVIA 1E72M 4GUHA 4Z1YA 1ITXA 3VOCA 4L1WA 3M44A 4PSRA 5H1WA 1V6VA 3LOTA 5A6AA 4NAFA 3AHXA 4ZQRA 2W92A 1UASA 4P7QA 5F1UA 4X9YA 4LGXA 5A5WA 1IWAA 3MO7A 1F3XA 4EPBC 1XLCA 4FR1A 3E12A 4G56A 4Z2LA 4JTGA 2YXXA 4C1NB 2FJKA 3LRMA 4PULA 5ABHA 4YTTA 3TTSA 5U7SA 3PZUA 3EB4A 1OCBA 4HVXA 3TJ4A 5AHMA 3O05A 3T7VA 4L4LA 1UKPA 2YSWA 3P74A 1SM9A 2R8WA 1ZLPA 1O5QA 7A3HA 4ZODA 3VGBA 3OEXA 3UWWA 1XW8A 5FJPA 1KXQA 1ZU8A 4E5TA 3CBWA 2OEJA 1GHRA 1OFQA 4A3HA 1PE1A 1H61A 3ZSSA 3GFZA 3NSMA 3SCPA 4DZ5A 1YPXA 2BGSA 2QJHA 3LBCA 1RD5A 3VD4A 1WX0A 4B91A 3FJ6A 1B3WA 3QQWA 4RL3A 3GYEA 1UW9A 3QYQA 3CJPA 1PIGA 4JGDA 2HDJA 7REQA 3CAVA 1I1XA 3L2IA 3IS4A 4IICA 2G3MA 3RU8X 3NPWA 1MVYA 1IR2A 2E5BA 4ICCX 2QJMA 4LB3A 3ME3A 4AVNA 1PSCA 3GYCA 5TIMA 3H23A 3GM8A 1W9BM 4MLJA 2ADAA 2CWNA 5M5DA 4M7SA 2D0FA 4I5XA 1KR1A 2POZA 3VGGA 3VGFA 2FTYA 1J6OA 3UGVA 3H4WA 5JIWA 2HNEA 3QJAA 2OPJA 4UOQA 4RNFA 3AS2A 3ZZ1A 3D5HA 2E9MA 2PF0A 3W81A 3V0UA 4IG2B 3NTYA 3NEVA 1D8CA 1HO1A 5GNYA 2O56A 4NU7A 4BHYA 3G8RA 3G1XA 1B3VA 3HFYA 1EC7A 1R5YA 3HV8A 2RJHA 1I0DA 1VFFA 3RM8A 1F9CA 3B9DA 2OKOA 3T4CA 1XIMA 2SFPA 3BCFA 3P61A 4W8AA 3AUJA 5AVHA 3DI1A 3UWZA 3WY1A 3N29A 2I14A 2PU0A 3I4EA 3TN6A 1Z44A 3WLMA 3PBUA 2WMJA 7ENLA 2FHBA 4AIEA 1VYPX 5J04A 1SYTA 2CZDA 3U7BA 1VLIA 4NUWA 3WQVA 1P1XA 1PTDA 3VNKA 2AQVA 2ACSA 5E5CA 3P3BA 5T9CE 4QTGA 3CQHA 4PCPA 2ZICA 4ZO8A 1ZAHA 1UBSA 3BV7A 1IEVA 1W54A 1MUCA 3AYRA 3IIPA 1S5MA 1H1YA 4AMAA 3TC6A 5BOOA 3GDRA 2AQWA 3BO9A 1AW5A 3QY7A 4X0VA 1XV8A 1EO5A 2XGIA 3M5ZA 4ZB2A 4NT0A 3GXDA 3LI0A 1M01A 4LCRA 4C6NA 3AAMA 1IXOA 3OVPA 4X3ZA 3C52A 4G1NA 1RVKA 4UXDA 5C2CA 1UB3A 4TUFA 2BY0A 1VYRA 1K1DA 2WSPA 4ZMGA 1K3UA 1D3GA 2IMRA 3NYDA 4GY1A 4GYPA 3QC3A 2OR2A 1RK5A 1VCFA 2FB2A 2VEPA 2GK1A 3OA3A 2YGYA 3O06A 3SUWA 1PX3A 4S3JA 1GHSA 2C15A 2ZADA 5XINA 1XSIA 1QW7A 2DJLA 4K6AA 1A0DA 5IHRA 2EGZA 4IMGA 3O1NA 2UWFA 4MMWA 3UR8A 1FKWA 2I57A 1AJ2A 1MUMA 4LYQA 3URNA 5ABFA 2VWSA 4JD4A 5AHNA 1LQ2A 2YLLA 2IKIA 3CUZA 3WLPA 1FWJC 5J8LA 5IBXC 5DRCA 3VABA 1US2A 3QOKA 1N82A 4DXVA 4HZMA 1J0JA 3UEQA 4B3ZA 3DUGA 1GZGA 4RR4A 5D8ZA 4YTQA 5JVLA 1NU5A 2WZIA 2J8TA 1BHGA 4Q7IA 5HJYA 3FKKA 1KR0A 4Y9PA 1H7PA 5D2YA 3PJXA 5JBDA 2AKZA 3CPRA 5JBFA 2X1SA 3UWEA 4IQLA 1XCXA 1HG3A 2Y4SA 1RCQA 1V6XA 4KPLA 3IPWA 5A2AA 3UJFA 4DN1A 1T6MA 2V2DA 4WSHA 1Q65A 3EDEA 3N15A 4JDYA 3PY2A 4MJZA 3N2XA 4OQVA 2D2HA 3D6NA 1VBJA 2Z28A 3ABOA 5I3HA 5AB3A 3CEUA 3C3NA 2RDUA 2DU2A 4AY1A 1ZALA 3LLFA 3KZSA 3MCMA 3DFOA 1W37A 1GJUA 3PHAA 4BI7A 4V33A 3H70A 4QJ1A 1CB7B 3ARUA 3AS0A 4JX4A 2ZRVA 2EJ1A 1B3XA 2X0HA 3MHUA 4RLIA 3TIMA 2A0NA 4BI6A 1MEWA 3OLDA 3VNJA 3F1QA 1EL3A 4IIEA 4B3LA 3STCA 2Q8ZA 1JL8A 3E5PA 4KFPA 1R2SA 2A5HA 4FHAA 4UFIA 3PBGA 1WO2A 1FX6A 4ASTA 4N4QA 3UZWA 1V79A 4NILA 2XIOA 1CYGA 1ZGDA 2GGEA 1E40A 4GZIA 2XISA 1UWUA 4KBXA 4M1BA 4B2DA 2V6AA 4B5UA 1FWFC 1LL6A 1GG1A 2ZVRA 1JVNA 3BK0A 4ZTYA 5BXRA 5H8UA 4AEEA 3P84A 2ONEA 4WX2A 1I6NA 4JFUA 3CZKA 3U7VA 4RJEA 3DZ1A 3R25A 2XFFA 4N6EA 3GIQA 8CGTA 4UWMA 2E5CA 2TSYA 2GOKA 4QP0A 5CZKA 3BARA 1FY6A 3PM6A 1X1ZA 3NNTA 4YS1A 3L5LA 4C1NA 3RYSA 2GFTA 2R1PA 1E4NA 4UTUA 1XICA 3HG3A 4XD6A 2NWSA 4A22A 4FNTA 3HQ1A 3LLXA 1BF2A 1VFTA 4MDOA 2OYLA 5EFFA 1R38A 1E0WA 4GKLA 4X2PA 1NM9A 3W26A 1TVLA 1F05A 1NJJA 1P5BA 5IFPA 4B4FA 3HURA 5D37A 4R7OA 1W5PA 5D2WA 4RNIA 3C0JA 3LCLA 4MWAB 2XH7A 2HQAA 4KFOA 1WZMA 2VCAA 4NP7A 4HNUA 3KS5A 4H2HA 4F8XA 2ZQ0A 3H2CA 1DVJA 1IHIA 3M43A 4HIBA 2VFEA 2G3FA 5JXQA 3CAQA 5CPNA 4F79A 3QLDA 1MZHA 1JULA 3KE0A 1YMYA 4S3BA 3TQVA 3K1GA 1ZPTA 4GQGA 2PDQA 3O8AA 1GVQA 3AICA 1ISYA 3U2OA 1E6QM 5HQEA 1PZ2A 1HKJA 2E1DA 2EPLX 2DH3A 3KVMA 4PEEA 3CMGA 3TYBA 1WXYA 2OOGA 1TO3A 3UR7A 3WEZA 1GOMA 3T0AA 1AQMA 4KGLA 1BKSA 4XAZA 3KHJA 1OD0A 2J9YA 3GRIA 2Y24A 5D9NA 2DIKA 2DUZA 4OTKA 1C8XA 1S5TA 4HNOA 3PNZA 3LZ3A 5G1YA 3E96A 3BVJA 4AC1X 3RITA 5DCBA 3GXMA 3NQGA 5D2XA 4MTVA 1BLIA 2XWDA 1W5NA 2UZ9A 1YE6A 4MJ2A 1GOXA 1UZ4A 4AISA 3T42A 4IG2A 1IT8A 2ZUVA 4HHMA 2Z29A 2AOSA 3RMJA 3AIVA 6XIMA 3AI0A 4B5TA 4UTWA 2YL9A 1XXXA 2CZEA 1E1FA 2VVSA 5K7JA 1US0A 3N6HA 3QV9A 3MBFA 4E4PA 2JKEA 4BY3A 1K8CA 4J40A 4BR1A 3W75A 2HK1A 1G7VA 3KBJA 4NRSA 3NYZA 1M03A 1P7TB 5CAKA 3W2KA 3FIGA 1I2PA 2YXGA 1VFLA 2ACQA 2V9DA 4JX5A 4U2YA 4C6OA 3JZUA 2VUNA 4J3XA 3FA3A 3NPVA 1ZP4A 1JF6A 2I7GA 2VRJA 1KD0A 3LLDA 1QPNA 4TX8A 4JTLA 2ODOA 2E6YA 4XIAA 3WF0A 1VF8A 2NV2A 3TN4A 3W7JA 3W88A 4REQB 1W8SA 3SCUA 5AHLA 3VVGA 4GHRA 2NLIA 2CHNA 1JZ4A 4EF9A 1RLDA 1JCTA 2BB0A 4M6UA 2I56A 3UZYA 4QEHA 3KLKA 3WLOA 2CZFA 3BPWA 3RO6A 2BOFX 4QHRA 4E8CA 5I3FA 5C9RA 3SY5A 2Y7DA 4C65A 1E6NA 2NQJA 1GW9A 1E6PA 4YVXA 1EO7A 3QRHA 1HW6A 5HNTA 4HYVA 2PE4A 4MB5A 2XINA 2E77A 4UTFA 3S1UA 3EAUA 3FNDA 3KX6A 1JNDA 1TWIA 1MNSA 1WV2A 3VI2A 2H8XA 2XIQA 2NXGA 3L0KA 2HWGA 2VR4A 3W6YA 2PU1A 2DT0A 3ITCA 4OV4A 3TOPA 4BWLC 4RDWA 4XZBA 4PUWA 4JDBA 1R9YA 4P5UA 4HU4A 5FKYA 3W7CA 5BW6A 4O19A 4QXIA 5E1QA 4GJ1A 2QS8A 2QPXA 4PMQA 4IIHA 4UTTA 3KWXA 1E5JA 4PB4A 4QDMA 5C7VA 3WN6A 1J12A 1CPUA 4O28A 1O60A 1VFMA 3WBXA 2Y85A 2IXVA 2IPWA 1KKOA 3EKZA 2VZSA 3VGEA 4NZ4A 1LG1A 1WAUA 4AYSA 2RGMA 1BYAA 4US5A 3KVLA 3QH2A 1KCXA 3OODA 2GUUA 2FPVA 1V03A 4GI4A 4IP7A 2GJRA 1QAPA 2JF6A 3SN1A 3LUTA 4Q8WA 4WOQA 4FIQA 2FZ9A 3N12A 1VPYA 1H7OA 1WKEA 3N4AA 4DNHA 2PWUA 3ABRA 5M1TA 3OJGA 3KTCA 5C55A 3FDGA 6REQB 1LG2A 1Q7ZA 3R13A 4U5KA 5KEZA 3QPEA 4BS0A 1JDAA 4Q4OA 4OT7A 1NDVA 4QLKA 1F4AA 5EMLA 4J3SA 2QJJA 4I8DA 4RW3A 2HV5A 1XDLA 1UR3M 1CGVA 4B3KA 1UR9A 2QEZA 5LNRA 3DYPA 1G01A 3WNLA 1CLVA 1PS9A 1YDVA 3S42A 1TV3A 2OWXA 4HB7A 1JZ2A 3G3MA 2NVDA 2G41A 4LVFA 3IGXA 1H2JA 4GNKB 1E51A 2PURA 2W91A 5I3IA 5CBJA 3W00A 1XI3A 1QBBA 1Q6RA 4KIEA 1XINA 3E5BA 4DJED 1Q8JA 2PLMA 1L6WA 4A05A 1DQWA 5DMYA 3AZSA 3WF1A 2NZLA 3BOXA 2BBFA 4E3TA 1YXYA 4XVEA 3H8AA 3TFXA 4LBUA 2GVJA 2W27A 2OWWA 5D05A 2W0UA 1GOKA 3EZ4A 3S8HA 1UMLA 3VC5A 5DEZA 5M03A 5DELA 1QK2A 3HN3A 3V5OA 1BGGA 3HO8A 4Q8TA 3QPYA 2CKRA 5HOSA 4AW7A 3LPGA 3DHPA 1V3JA 4HMCA 4YMZA 3TXVA 1AW2A 4BQ5A 2ZE3A 3CQJA 4MWAA 1ICSA 2X05A 5HMEA 3IJQA 3W7GA 4LC6A 4WRHA 4DWSB 3PPGA 2REQB 1TTIA 1NFBA 1UD6A 5H6HA 3ARWA 1IEQA 3EWXA 3EXTA 4DM1A 3T9PA 2WM1A 1DJXA 4QAIA 1HNYA 1A49A 3SZ8A 4CNNA 3KXQA 4KWUA 1LBFA 2V8ZA 1M7OA 3GFYA 4HCLA 2HK0A 3T78A 1GVEA 1QPKA 1EX1A 1ALDA 1XPYA 3BMWA 2ACRA 5EMKA 2F9RA 1QT1A 3HPZA 5KZDA 1UH4A 3CHFA 3GVRA 2Q01A 4YIWA 4BJHA 3MI3A 2QR6A 4Q4SA 1GGOA 4TTUA 2PLJA 4LXFA 4LRSA 4S2BA 2J8GA 4MKNA 4DUWA 1DEDA 3B0UX 1WE5A 4O4WA 2E6DA 2WHMA 1B9BA 2XH2A 1BWLA 1UP0A 3TK7A 3WLIA 1HVXA 3EX4A 4LS2A 3EXSA 1J96A 1PL9A 3NO5A 1FXPA 1PAMA 2KAUC 1JPHA 3KOZA 4ZQCA 4GIRA 1VAHA 2YL5A 5FAJA 4QGCA 3KW3A 1XLBA 5E93A 3UPMA 4XB3A 4LQ1A 4MY8A 3MCOA 2ZZ2A 1QDSA 1SZRA 4J27A 4L80A 2YCKX 2CLKA 2AGTA 3MZ2A 4KW2A 2VKZG 1KQZA 2QUMA 3ALFA 1E9LA 3B03A 5FEPA 4DPQA 4NJIA 2WNZA 4CD7A 1IEWA 4CNPA 4K8GA 1DWFM 4I9TA 1LL4A 4JY9A 4IM4A 3D47A 3UVIA 3MMDA 4P61A 3C86A 1P7TA 1UHVA 1TJ2A 1WP6A 3P5ZA 1GVSA 2ZX5A 4LS1A 1IF2A 4DO7A 3ZLGA 4HNCA 5D2VA 3KLLA 3NWRA 3NDZA 2XGZA 2GWNA 1CXFA 4PCNA 3A4JA 3RF9A 1UOZA 5LNUA 4GQRA 3SURA 3E2RA 1UC5A 3AROA 1W9UA 4MYAA 4REQA 2ZUUA 3S5SA 2BLEA 2XHYA 1EGZA 2JK2A 2ZC8A 3SCRA 3OA5A 3UGRA 4OWGA 3XIMA 3EPOA 4RZ5A 5BRQA 3A22A 3PUDA 5BMXA 2J8FA 4ZA0A 1W3NA 3EX3A 3CWNA 1X6LA 3BOLA 2JIEA 2YBTA 4JHOA 1AJZA 4FA3A 1JCNA 5HWNA 4YTRA 2NUXA 4HNNA 4EE9A 2C91A 1HJWA 2XFWA 1V08A 4MZ8A 1E4IA 2FQIA 1X1OA 1O6IA 2ZX7A 4U31A 3N17A 4TX6A 4YL2A 2CPUA 2FGLA 5AC5A 3QOMA 3KDNA 3WLHA 2P1FA 4LC8A 4MY1A 5AC6A 4JZ5A 1NIUA 3WUGA 4Y90A 2B7NA 5EU9A 1AD1A 1K77A 3NQ8A 4GQBA 1KLZA 4LAKA 2ZXDA 4YN5A 2OO6A 1I1WA 3VTRA 2NUYA 1HN1A 1ZJIA 1V6YA 3SRKA 4WGHA 1OCJA 2C14A 1A5OC 4P2VA 4DBEA 1O68A 3H2OA 1H63A 2CYGA 1EJUC 3TLQA 3SFKA 2WZMA 4JYEA 3HMJG 1EB3A 2E67A 4M24A 3VMOA 2XSXA 3L2LA 4QQ3A 5FEXA 4F2BA 4ENLA 5LA1A 4PUEA 4XAGA 5DRIA 5DF0A 1NH6A 4DJDC 1XGEA 4ZGYA 3DGRA 3MSDA 3SR7A 5D09A 2LLEA 3TA6A 4IUGA 3PC0A 3SJ3A 3OGSA 2INFA 4GO8A 6REQA 3DI0A 3KAOA 5IHSA 4FOKA 4O8AA 4MFEA 4MSSA 3WLSA 1WAWA 3N18A 1H4PA 2CWXA 2YCEA 1CGUA 1F3WA 1ME9A 2V5JA 1IZCA 4XZ9A 3L65A 4Q7BA 4CEXC 3OZMA 4FK9A 2HSAA 2PDUA 1YPIA 2VEMA 3NL6A 2V63A 4Z0SA 1SR9A 3MP5A 4X61A 1UMYA 1KFCA 4XZWA 4CLMA 1YTKA 5FJTA 3W7LA 5HR6A 3W2MA 4UOZA 3BG3A 1QNSA 2CCRA 4DO4A 3FJLA 4LCQA 4IIBA 3APTA 3HG4A 1QWGA 2B4GA 1KLYA 3SIMA 4LUIA 1DXFA 3ES8A 2WNWA 3GXNA 2W3ZA 3VMNA 4Q8PA 1PHWA 1E0VA 2ALRA 3QFEA 5H8MA 2XN1A 3GNXA 4CD5A 1HFBA 5LNSA 4O18A 3TN5A 2BV9A 4B16A 4H9UA 3PZIA 3D46A 1XRFA 2BODX 5A6TC 2GGHA 3KEHA 2WKJA 4A3YA 5D9PA 5EPDA 1LOLA 2X1IA 5LNVA 3NZPA 3M5XA 3EX6A 1FWDC 1TUFA 4OVXA 1VRDA 3GTFA 4OE7A 4B5XA 2PDGA 1DWAM 4L4MA 3T05A 3HPAA 1SU5A 3T09A 3LTSA 2PDWA 4PFMA 4GI6A 3H53A 4DWSA 1JYNA 1SZEA 1OD8A 1A5NC 5D30A 3LK6A 1ZAIA 2REQA 5K9CA 4PUKA 4X0NA 1DIDA 4GMEA 2ACUA 1PKYA 1OY0A 2XFRA 1TQXA 3NQAA 4GINA 1F76A 1RV8A 1I2RA 2Q3RA 2D1ZA 3ZT7A 1JCJA 3ARYA 4BQ2A 2X41A 1L2UA 2YL8A 3TDFA 4JTJA 1DL3A 1S2UA 4J3WA 3PBWA 4UTKA 3B97A 4C91A 2QIWA 4KETA 1HKVA 3GHUA 1XRVA 1JD7A 3CWOX 4UQEA 4FNRA 1S39A 2IPFA 3IANA 3CNYA 4ACZB 3UT0A 7TIMA 1MFUA 4Q6JA 3N3MA 2VRKA 5HMDA 5I07A 4UC5A 2Y61A 3H26A 4RKAA 2E8ZA 3R7MA 4N4PA 4MOZA 4PH6A 4Q32A 1GONA 2OXNA 1K9FA 4RK8A 4RDZA 1YADA 1D7KA 3TYEA 4GYJA 1TWWA 1JD9A 3ABXA 4AHPA 5I23A 4BEUA 4NXSA 4KH2A 2E3ZA 4YCOA 1E6SM 4I6KA 1MYRA 2DQXA 1EF2A 4JY8A 2DW6A 1W9VA 2RDWA 3QZAA 5D32A 2JGQA 1CGTA 1DJGA 7CGTA 3KWSA 4XBKA 2Y7EA 4NKCA 1BF6A 1CWYA 4IIGA 3RCYA 1TIMA 3WQOA 1TX2A 1HX0A 3RDKA 4GZEA 3GO2A 4UR8A 5I78A 1J10A 3FVMA 1R3RA 5G2WA 1Z89A 3SADA 2O7SA 4F0RA 4NAEB 1XLFA 4YWIA 1H1NA 2V3EA 7XIMA 6A3HA 2PDBA 5DQPA 1QR7A 3SQMA 3LPOA 2WKLA 1KA9F 2FH6A 1BVWA 1XBZA 3LB0A 2YZ5A 1PHQA 3LV5A 1UIPA 1ZRQA 3E38A 3STPA 4GUGA 4YJ5A 1KRMA 4PODA 3QXBA 1RJQA 3POCA 5C9XA 4O15A 1CGXA 2VOTA 2C6QA 2CXEA 2YDSA 4U10A 3IUIA 5KITA 3PAJA 4E4UA 2GVEA 1E55A 2OU4A 3GXPA 4L1GA 3UCQA 3PPFA 1ITQA 1EC8A 4AC7C 4O16A 3CWHA 4HYRA 3CK5A 2PGRA 3TP4A 1FBAA 2JE8A 4JHMA 4BEQA 3STGA 1W9XA 3QSRA 4JICA 3H4XA 2PDMA 4K8EA 2A3AA 1ECQA 3QV8A 1SQ7A 1SO3A 2FVKA 1G7UA 1OG6A 1E5NA 5CC5A 4QBXA 5LKYA 2J7CA 1RBAA 4FX7A 2J7EA 1OT1A 5RUBA 3WD4A 1LRNA 2A3BA 5I3KA 4ICMA 3RILA 3EKGA 2MUCA 3ZT5A 3VNMA 5A8PA 4K38A 4HMDA 2XG9A 4OOZA 2XVPA 2P76A 3LY0A 3WELA 4KERA 1R30A 4NX0A 4O14A 2POTA 2HXUA 1ZP3A 3BLEA 3WO8A 1EJTC 3ZFHA 6ENLA 3W23A 4EXAA 4OUEA 2ZWZA 4JNZA 1VYSX 3S5OA 3MUY1 3R0DA 3W76A 3PR2A 3ENLA 3NQMA 5HINA 4HHPA 3M0IA 1MFVA 2Q6ZA 5BCAA 5I02A 4FAMA 1AL8A 4LF1A 4QG8A 4K39A 1M7PA 3C4UA 1J5TA 3BAWA 3AXMA 2V2HA 3JRKA 1BWVA 3GW0A 3VKAA 1EXBA 1DTNA 1LLWA 4O54A 3P93A 1UR4A 2FFCA 3VUPA 1GNXA 1HTIA 2FZMA 3FN9A 2ESCA 5FAGA 4O53A 4ZXOA 1R6WA 4GIEA 1J8VA 1KFBA 4RE3A 3GX9A 1G9HA 4MVAA 1ZBCA 1TRDA 2RFGA 4CD6A 4J9JA 4DNMA 2DSKA 3WLLA 1FA2A 2NLYA 4S23A 2ZUWA 3PTDA 2J77A 3AU2A 3GHRA 4I90A 5LXEA 2FMNA 3V5FA 1U30A 3DFYA 4H3DA 3DH7A 2RKXA 3OIXA 2NSXA 2Q8LA 1Z3NA 3IK2A 5I0DA 1B90A 1GKRA 2VT0A 4GCAA 4KGJA 4L61A 3S5NA 3AFBA 3Q45A 2WSKA 4HN4A 5JBEA 5E0KA 2OEMA 1JZ5A 4GUFA 4NIRA 1BTMA 4XISA 3G24A 3VDHA 4WD0A 3UZ5A 1KW1A 3WK0A 1OBAA 2ISVA 2YB1A 3THUA 3AMGA 4O1DA 2PRHA 3MPGA 2Z0IA 1FCQA 3VDCA 5TQLA 3L4WA 3G1SA 4V2XA 3SEPA 1UZHA 4PA8A 3AYSA 4KRTA 5IBXA 1FH9A 3GQYA 1Q4WA 4PRWA 4HOZA 1ZBWA 3TCSA 3QC0A 2YA0A 4H7CA 1Q13A 4LF2A 1VJSA 1L6FA 3SCNA 1L8NA 3DENA 4N42A 5CQ1A 1OFRA 4ACYA 4PBGA 4XAPA 3VNZA 1T99A 4E8GA 4CGTA 2HVMA 4D1IA 4JBRA 2WSYA 4W7UA 2WSRA 1EZWA 1OF6A 2HPIA 1PDYA 3TNBA 4Q8VA 1T96A 1MWOA 3NEHA 3U9IA 1GVRA 1ZNNA 2Y1HA 1U22A 3NL3A 4HTBA 2VJXA 3NQVA 1LORA 1QNQA 4X60A 3OP2A 4AD1A 1D3CA 3NM1A 5CAHA 4AVOA 3W86A 1Z9AA 3DIPA 3BGJA 3WENA 1W6TA 3BQ6A 4W93A 3CV6A 4L9XA 4GX9A 3SSZA 3UG4A 3ZJ6A 2QDGA 2CHOA 4IWWA 4EAYA 3BCDA 1UYQA 1DTUA 5ABEA 3M0ZA 4LY8A 5AYXA 1Q63A 4ACZA 1KCZA 3VGDA 5GQBA 3CTLA 3WQ8A 1OYBA 4AY8A 3UZZA 1EJSC 1FWTA 3W7PA 1OZQA 4ES4A 3TJXA 4GXMA 1KM3A 2R82A 3VOFA 4F2TA 4GVGA 2XIJA 3VOJA 2ABBA 1O1HA 5CPTA 2CESA 3C8NA 4DO5A 3B9AA 3WLRA 3RCMA 1EGVA 3TXZA 5AHEA 1XDJA 1UR1A 4W7VA 1C8YA 3WL0A 3AS1A 3OQEA 4I9MA 1YPFA 3T81A 1WDDA 3W53A 1P6BA 4HPNA 1LRQA 2Y5JA 3L5AA 3E0IA 1HJUA 2CZ5A 4A4AA 3MUCA 1Q2RA 5HATA 3GUWA 5A8NA 2QCLA 2GUYA 3K8LA 4F9DA 3RJXA 4HP5A 2UBPC 3I6EA 3UBPC 3M16A 3LMYA 4GQ0A 4IIFA 4ZO7A 3WLTA 3H7UA 1C93A 1EA0A 3WLKX 3VXGA 3CUIA 4LVBA 4XD4A 1CW2A 2JQXA 2R1KA 2D22A 2XVKA 1SO4A 2BVYA 2OEKA 4MNMA 2VGBA 4NAEA 4KCUA 4C7FA 5T9BG 3RK8A 5FF0A 4MAZA 1CECA 1T40A 3A12A 2QYGA 4GRSA 5J5RA 1IXQA 4CQDA 1LQ0A 3ANYA 5JMUA 1MUWA 2A3CA 4GI9A 4LV4A 4J3ZA 3GH5A 2C19A 4LEQA 3TC3A 1JEZA 2D2JA 4S38A 3UY8A 1GVOA 4UQ9A 3AISA 1W3TA 3LERA 3P5YA 5FJOA 1R3SA 3CMJA 4I5RA 3AXIA 3I10A 3TQPA 4JX6A 3MP3A 4I7WA 4W89A 3UG8A 3OG2A 3C2RA 4UTWC 1XIBA 4XD5A 4ZSUA 4HBKA 5C6MA 3W7RA 1S38A 1UH3A 1VPXA 1W1IE 5FI8A 4AEOA 3VIHA 2WVUA 1Q3NA 3B8UA 5A6SA 2O4QA 1NVMA 2XGBA 2YA1A 3AIRA 3BC9A 3NL5A 4BK9A 3L68A 4ORIA 2ZBTA 4CEUC 1FDJA 3GNOA 3R89A 1CLXA 5I00A 1UC4A 2QIIA 3QR1A 4WKHA 3RNDA 4GO9A 3TWBA 3TW7A 4FP1A 4A2RA 1H50A 5HNUA 1XF0A 1R2TA 3SCWA 2VUYA 1EUNA 4U3CA 1MDRA 3LHZA 3ZR4A 4EX4A 2DH2A 3GKFA 2VNCA 1IR1A 1A5AA 3LGGA 3PANA 4M6PA 7PTDA 4JTIA 3RXZA 2WCAA 3K4WA 4K7VA 2XU2A 1EOKA 1RHCA 4PMYA 1W2VA 3CEPA 1EDQA 2YKKA 4JL2A 2DIJA 3MJMA 3MVTA 5I6SA 4ZQNA 2QUTA 3IIVA 1XYCA 3TFCA 4BZYA 2OZTA 4G5DA 3QW3A 3ZYZA 3R0KA 2Y8KA 1KGXA 4O1AA 2CLHA 4HYWA 2FZDA 4C6QA 4RE2A 1FQ0A 1L6SA 3N34A 4EWJA 3UQNA 5EY5A 2QJNA 4TTGA 5C71A 3ZVIA 2VD8A 4HK7A 4ZXLA 3NXLA 3QEZA 1BG9A 1P0BA 1J2BA 2E68A 1H41A 3TX9A 1UD4A 4CQBA 2ANUA 1KXVA 2O9TA 2R1NA 3FHQA 1KBBA 2G50A 3U5UA 2A7RA 3ZQ9A 1ZUAX 3PNUA 4UTTC 1UWTA 3ARSA 3CZEA 4ZENA 3EDFA 1FWCC 2Z1BA 4L1XA 4RV3A 2XYLA 5HQLA 3H21A 3MI2A 3ZJ8A 4NSBA 4AWSA 2Q71A 2C3ZA 2QCNA 3THDA 4QRNA 2P8BA 3LA4A 3VD3A 1QFEA 1Q6CA 3TYDA 5CZ0A 4BWLA 3VD9A 1XLLA 3UCCA 3I7SA 2PS2A 1DWJM 4JTFA 1LROA 3EWDA 3LCFA 3W37A 2H9AB 1LLZA 1J18A 1O5RA 4UTHA 2GJXB 2QDHA 3NQCA 2CETA 4V1XA 3T2QA 3M07A 1PYMA 2X42A 1TTQA 4J3VA 1FWHC 1LCOA 4UQDA 4C6JA 5C8BB 3PJUA 1TZ9A 1XC6A 4JTEA 3MDUA 1OX5A 3CYVA 2WWDA 2WVVB 4TV6A 2J9XA 3MMTA 3TEVA 1TJ1A 4YLWA 3IJ6A 4XBJA 4PUNA 4A8NA 1EFZA 3PTMA 3T07A 4XK2A 2G37A 3PP7A 2Y63A 8XIMA 4OV9A 4A21A 1CGYA 5F2GA 4HNTA 3CHCA 4H6RA 4WY0F 1T41A 4IJCA 5CXPA 5DBTA 1R8LA 2VQUA 3FEQA 4CU8A 3WG6A 3RCNA 2P0OA 4E4FA 1TUXA 4DBWA 2PCEA 1YW1A 1AQHA 4E2OA 1VBRA 1G6CA 4O12A 2I5GA 1UWQA 4IL2A 3W83A 3FSTA 2DUXA 3IRDA 2B7QA 2VVNA 4QIUA 4CNUA 4W8BA 2AKMA 3M0LA 4I7UA 3W87A 1NSJA 5HWJA 1JRBA 4B4HA 1XSKA 3GNDA 1S2VA 2X16A 4JCLA 2ZOXA 3GU9A 3P0WA 2XVLA 3NSNA 3ABZA 3RPTA 4IT1A 1VFHA 2VCCA 4XQ6A 3M5YA 1SSGA 1JCLA 3A47A 3KCLA 4FOUA 5GJPA 2ISDA 3EPNA 2ZIDA 2DSVA 5HANA 3NL2A 3THCA 1ZTVA 3N19B 3HF3A 3RFAA 4D8LA 3VIIA 1FDZA 7TAAA 2WZEA 4R27A 1IEIA 3CQIA 5EBAA 4R3UA 1NY1A 3PZGA 3UFYA 2Y62A 2NT0A 3K5XA 2FB3A 1Q6DA 4LYPA 3WQ6A 2ABAA 1OGGA 3BWWA 1YXCA 4JYDA 4PEKA 3QMTA 1GVYA 2E8YA 1QI3A 4MHBA 3ZWTA 5JH2A 4DXKA 3B0PA 4IJBA 1NELA 4ZOCA 6XIAA 1W9PA 4JHZA 5I09A 3K8KA 4Z1DA 1W5QA 4FX6M 5JQ9A 2YW4A 1I0BA 4LUTB 1X8CA 1QATA 3AYVA 4P8XA 2V38A 1VENA 1G4SA 1EHNA 2A7PA 3B9EA 3ATZA 1KQYA 5AYZA 3PZMA 3SRDA 5F2IA 3WD2A 1OGBA 3CL8A 4QE1A 3EB2A 1KBIA 4S3KA 3CQ0A 3VZXA 1SO6A 4R88A 4S3EA 3NGFA 4GX8A 2WBKA 4Q4MA 1G94A 1QW8A 3BH4A 3MQTA 3S6DA 3M4HA 5FA5A 2OSWA 4NYUA 4S2CA 1MI3A 4PTNA 4HPJA 1Q6QA 2P3ZA 1MSSA 5B7YA 2VZOA 3TAOA 4UOJA 3VC6A 1PXGA 4IMCA 3L21A 4JQ3A 1W3LA 2TAAA 3EEZA 2ZZ4A 3L4TA 3OG3A 3UPWA 3W2NA 4IQEA 1G1YA 4GA8A 3UETA 2QGHA 1B31A 1HP5A 1W1ZA 1TB3A 1X1NA 3TAKA 4KCWA 4X22A 5T26A 3WQ4A 3WD1A 3W29A 3EDJA 3R43A 1DE5A 4YTUA 1ONWA 2B0MA 2ZTKA 3F7JA 1HKMA 1OYAA 2XH0A 2BXVA 4ZTXA 1QW9A 4A2SA 5FCZA 1C8QA 4E38A 4MB3A 1TFVA 2WNQA 4PTMA 4HOWA 3SECA 1I9CB 4XKYB 1NDWA 2Z1KA 1U1UA 2OFJA 1SJCA 3QMRA 2A21A 2R24A 4TOQA 2GQ3A 3LENA 4YXGA 5CH9A 5REQA 3L12A 2PDFA 4V27A 1JF5A 1GEQA 3AZTA 2GUBA 1JR1A 3UPBA 4ALDA 4DB7A 4KS0A 1DKWA 3NO3A 2NX9A 5A6JA 3L4ZA 3UXAA 4XZHA 2I16A 3HGJA 1ZCOA 4FX8A 2OLHA 4L5ZA 2OQYA 3BMVA 4PL1A 2IKHA 5E09A 1M68A 2GDQA 5A8OA 3NDYA 1CCWB 3I3EA 3OO2A 1FP8A 4FNUA 3WK1A 3V0SA 1F8MA 3W73A 4P8WA 3CZ8A 3QQ0A 4PCFA 2DORA 2IKJA 1A0EA 3UXLA 2PDIA 3VFLA 5EMMA 4LVAA 3VUSA 4M51A 2Y89A 1XIIA 2FPTA 2VX4A 1KM0A 4Z17A 5BU9A 4IFOA 5D03A 1CBGA 4LUSB 2PTDA 4FS9A 4RNHA 3V7PA 4EAMA 3UNTA 4WF7A 3A23A 2BHYA 1VIZA 3MKVA 4FALA 1E0UA 3S5ZA 2J27A 1NDZA 1U5VA 4E8DA 2PLCA 3CTTA 4DAIA 3A9BA 1EYEA 1VKFA 5PTDA 2YYTA 4WSJA 1PKLA 3FSUA 1HT6A 2G3JA 4FNPA 3EPMA 4US6A 4PCTA 1UJPA 2O4MA 3ITXA 3ARPA 3NM3A 1H7NA 3B0YA 1A5KC 4XZLX 4IGMA 4F48A 4Q33A 2NSOA 1KNWA 5J5DA 3CAKA 1VHCA 3K4DA 3NDOA 3AMKA 1Z42A 2OLAA 4IH3A 3RN6A 2PTXA 4A29A 1W31A 1KFWA 1EGMA 2OGYA 4KRUA 4ONVA 2H9AA 3B8DA 3NCOA 2GJXA 4GCXA 2HTMA 4HA1A 2FHFA 2OMAA 1QMLA 3U8GA 4R7WA 2GGGA 4RDVA 3VX0A 4KIRA 2FIQA 2VQTA 5G4HC 5CLTA 1AUSL 2VGFA 3O6DA 2J62A 4C1KA 2PRMA 2WVVA 1JDEA 4QNWA 3OOQA 3W7HA 1XIFA 3ICJA 2FYMA 3G1VA 4CCEA 3RM9A 1RBOB 2PF8A 1POKA 3PB2A 3W24A 1QI2A 2PWVA 1G4PA 1E15A 3CO8A 2DZSA 4IX0A 1KV5A 2P8CA 3KRSA 1XKJA 3E3HA 4H9TA 4DJDA 3JVAA 4V28A 3S3GA 3EA1A 2Z00A 1QJWA 5CPMA 3LQLA 1J0ZA 3T08A 1UH2A 3OVRA 1NF0A 1XYMA 3W2LA 3QHOA 4ML4A 3L4VA 3RO8A 5HPCA 3L7RA 1XRSA 3WFZA 4KCVA 1R3VA 4DBUA 4OOUA 4ZE4A 4JS3A 2ISWA 3PUGA 2XM2A 3N4FA 3KRZA 1R9ZA 3VCCA 3CUJA 1EWDA 1W1A1 1KBLA 5DMNA 4M8UA 5DT5A 1G4EA 4JN7A 3C2YA 5I5RA 3EMZA 3B8IA 3RLUA 3S1XA 3ZO9A 4H7ZA 4DJFC 5CCZA 1RJPA 4JIEA 4FZIA 1J01A 3EMCA 4WSKA 5F2LA 4UFMA 3WQEA 3F5LA 3U5YA 3OU8A 3KOYA 3B40A 1H11A 4NZ5A 3W7IA 5D9OA 2E6FA 3WNMA 3JR2A 3H4GA 3WH5A 3C56A 3KUMA 2OO0A 1E9YB 4TQTA 3T55A 2IPJA 1Q6EA 1YYAA 1V02A 1WBHA 4D72A 4JNMA 3DDMA 4FEZA 3OBKA 3W1TA 2A6NA 1B54A 4AZCB 2Z24A 3LM7A 1A5UA 2CLOA 4A8LA 1MXGA 2OQHA 1S2WA 2OGJA 1OFAA 1ML1A 1OC7A 4QDWA 4B90A 4UFHA 5LIYX 3VDBA 1ICPA 2OTDA 4WEVX 3U6WA 1GPFA 4KEMA 1DJNA 1IE7C 4YWSA 1OGSA 2AAMA 3TTQA 3UZJA 4LUTA 3UF9A 3DBPA 5CC6A 4AVFA 1GK8A 2P5NA 4L56A 3LNPA 2A3HA 1XYLA 4D8AA 3MV01 1H09A 3NOEA 2AMXA 4QJ5B 2PWDA 1IGWA 3BZGA 1HJSA 3IRSA 4PC8A 1O1ZA 3TYCA 2YCIX 3EWWA 5C54A 2PODA 1EJVC 2J7GA 4K1GA 3P81A 4UTIA 4UCFA 5D33A 1CI1A 1XISA 2PUZA 3W1AA 2ATMA 1JYXA 5F4WA 2W66A 5LIXX 2OCZA 1SPQA 3ANVA 2VFDA 2VI0A 4HSHA 5AZ0A 1GORA 3GTXA 3F4NA 3ID7A 1Q6OA 1GPWA 5E6YA 4GZJA 4H9YA 3KOXA 4RE0A 5DANA 3A5FA 3KP1A 1JGIA 3U0HA 4PMOA 1JDCA 4JFWA 1P0KA 2J7FA 3GDBA 1GT8A 1T8XA 4HZ8A 1JZ8A 3WZ0E 2HPMA 4F0LA 1O5XA 3LXBA 1E6RA 2BOEX 3KCOA 2QZRA 2JKAA 1AMKA 3AZRA 3S2LA 4HPXA 4WJ8A 5EMJA 2NV1A 4O4VA 4UR7A 1JAKA 1ICQA 1EYWA 3PBYA 3LCXA 3QF0A 3TCEA 5BNKA 2QCCA 4W87A 3GXTA 1BXCA 4NRRA 4ROQA 4A8IA 3ONBA 4M29A 3FS2A 4UNLA 2WHLA 4L65A 3MA8A 2Z4GA 2WZHA 1A3HA 3DU0A 2B31A 1Q4NX 5XIMA 4N0RA 1TR1A 3F4DA 3M0HA 4H6QA 3GBEA 5GNZA 3A6OA 1OZMA 1PJ9A 2YXOA 3H12A 3TR9A 2IQTA 3C2VA 4DF1A 1AZ2A 4GFIA 5IM51 3S2CA 4IIDA 1RALA 4MB4A 1VC4A 5HNNA 3W72A 1SMDA 5FEZA 4C1LA 3KBSA 4JTKA 1ESWA 1K6AA 2FDMA 4AZBA 3BJSA 2F2HA 2JKPA 1XC4A 5DLCA 2NW0A 2VDGA 3KFTA 4AD3A 3O3RA 1BXBA 1W5MA 5CZSA 4KWSA 2VOMA 4QISA 1HUVA 5C2GA 5LIKX 1UKTA 4CCCA 1SZGA 2QV5A 1JCXA 2ZE0A 1LBLA 5KZMA 4IGHA 3WH8A 1TJPA 4JFTA 2NT1A 1GG0A 3THQA 4EANA 1PPIA 3SO7A 3F2BA 4DXXA 1VP5A 2VC6A 4LUSA 3K4AA 1SJDA 3HBLA 2VEGA 4M3PA 2YCJA 4ZB0A 3GG0A 3PWAA 1O5KA 2P0IA 3GVGA 3GXFA 1K8ZA 4WVXA 1JDFA 2QGYA 1J0IA 3CL7A 3RUBL 2V69A 5FEWA 2E40A 3WBWA 4NASA 2GQ8A 3FJ4A 3SB0A 1IWPA 4RXFA 2PDPA 2YCLB 4HOXA 2XSAA 5FJUA 2FLIA 2WMHA 2RJGA 2AL2B 5DY3A 3LSBA 2BMBA 3AJ7A 1TA3B 2V30A 4GACA 3E6EA 3F5KA 1FHVA 3MKCA 3KL5A 3KRBA 3MSGA 3TMLA 2YFOA 3QGAC 1OX4B 4JOMA 4IOTA 2WC7A 8TIMA 4P7RA 2X7VA 4WKAA 4O1EA 3I3BA 4O17A 4CUCA 4QCEA 3WDHA 3PZNA 1BEUA 1X39A 2J6VA 4JTUA 1K4HA 3MANA 3UA4A 6CGTA 3L66A 2CBJA 1FHDA 2WBGA 4FB7A 2D73A 2UY3A 3K13A 3BGGA 1YDNA 4F4RA 3RAOA 2FVMA 1LLOA 1VEOA 4DLFA 3LCWA 3RMEA 4MKVA 4MM1A 3LCHA 3GZ3A 2V5KA 1XQLA 1OF8A 3W1UA 1KRCC 2YX0A 3K1DA 1BSLA 4IFRA 2QCHA 2PDNA 1H5YA 4AIUA 4HMNA 2FH8A 3BGAA 4PMNA 2A2IA 3WDRA 4AEFA 4D6FA 3VKJA 2Y2WA 1YDOA 3FVDA 3ZWSA 1WUFA 1JPMA 4WY0B 4FF7A 3TONA 1SO5A 2ISFA 4Z2GA 2XM1A 3II1A 3HPSA 3CLMA 2WJDA 2ZZ7A 2ZFAA 2GVYA 2C8NA 4Y7EA 4GYKA 1FWGC 4EVZA 4L9ZA 3QHNA 1NP2A 3WMSA 2V5CA 1NQKA 1VZWA 3P8JA 3UJRA 2VXNA 2NVAA 2XVGA 2G4JA 1ECEA 2GSEA 2TMDA 1BQCA 3VD5A 5GJMA 2VFGA 4GY0A 3W6LA 3W7OA 1XYZA 3NFUA 1Y5XA 1S2TA 4AZCA 1WA3A 3FYYA 1EH9A 2ZZ5A 4CNSA 4MNKA 1X6UA 3CH0A 3CIXA 1ITCA 1CGWA 4JEQA 4XTIA 1EDGA 4OECA 4WOZA 3EOLA 4NJGA 3GTHA 1B4EA 1LYXA 5KETA 3CGTA 3M7SA 4YNGA 1FCBA 1DBTA 4MDPA 5AFDA 4MGGA 4ATDA 3BSHA 4F2UA 3VZZA 4AX6A 4EPEC 1IQ8A 1VEMA 1PV8A 1OFBA 3AOFA 1XLDA 3N9SA 4LPCA 4A3QA 1PCKA 4QSFA 4GK8A 4OKDA 2ZA1A 1KTCA 4Z42C 2WO5A 1DQUA 1XUZA 2PDXA 4OBRA 3LV6A 3EX1A 4FXJA 3KTXA 3ZJ7A 3H24A 1QO5A 3WBYA 3G0SA 3QQ1A 5DFAA 1B0IA 2PGEA 3Q4DA 1V3HA 2W79A 4DZIA 3OW1A 5G4EA 4FIRA 1TJRA 1UQZA 1QI4A 3U48A 2XN2A 1TRIA 3B8WA 5HQMA 1F07A 3ITYA 3UXIA 4MG4A 3WQWA 1NWUA 2F6KA 2QT3A 1ZQ5A 1RQEA 1Z32X 1M41A 1SFSA 2AL1A 4R33A 2W63A 4DHGA 3DFPA 1AA1B 5D9MA 4IL0A 1JUKA 4AZIA 4C6PA 3IIXA 3WNOA 2J6XA 4NZ3A 3GLCA 4R9XA 5A1AA 2X40A 3SAZA 1RCXB 1TTPA 3W71A 3WJYA 2O9PA 3TLLA 1K70A 3QSTA 4PTVA 4JTCA 1AZ1A 4BFAA 2HBVA 3RPMA 1A5SA 1E0TA 1TQJA 4KCTA 4Z2KA 4AIBA 2Z6IA 3I68A 4PCSA 1Q6LA 1UD3A 4PMJA 3QYSA 3F4CA 4PMXA 2GWGA 1GTEA 2P3EA 5CPQA 2EF9A 4A6GA 1UD8A 1EDTA 3C0QA 4CVWA 4EKJA 1NTHA 3SCSA 2CHRA 4KWOA 1OJXA 5FIPA 4WK9A 3B06A 1YBQB 1KM2A 3W0KA 3AYTA 1P43A 2X0SA 4PGLA 1EP1A 4DUOA 2NXIA 1W9DM 4HHHA 3EA3A 1JG9A 2YIHA 3MY9A 3Q65A 3B04A 4ZL1A 1DJWA 2CZVA 1KM5A 2EXOA 2X30A 1S5NA 1TV7A 3KOWA 3CV2A 1XGZA 2WV8A 1Q66A 4QR6A 2CLIA 3PB0A 3V5CA 3ERPA 3WJXA 6PTDA 1ITUA 1J6PA 5LSMA 4BQ4A 2WMGA 2J7DA 4AB4A 4PN2A 1TJ0A 5CBBA 3W07A 3FOKA 5BXPA 3T2OA 1FWSA 4C7DA 2WW5A 1DIEA 5DMLA 5TAOA 4AHQA 5CZJA 2B7PA 1GJWA