1Q4GA

2.0 angstrom crystal structure of ovine prostaglandin h2 synthase-1, in complex with alpha-methyl-4-biphenylacetic acid
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
553
structure length
553
Chain Sequence
PVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The 2.0A Resolution Crystal Structure of Prostaglandin H(2) Synthase-1: Structural Insights into an Unusual Peroxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Prostaglandin G/H synthase 1
total genus 197
structure length 553
sequence length 553
chains with identical sequence B
ec nomenclature ec 1.14.99.1: Prostaglandin-endoperoxide synthase.
pdb deposition date 2003-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
A PF03098 An_peroxidase Animal haem peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.640.10 Mainly Alpha Orthogonal Bundle Myeloperoxidase, subunit C Haem peroxidase domain superfamily, animal type 1q4gA02
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1q4gA01
2QPKA 4LMFA 1UZPA 3N8XA 2J38B 2GD4A 4ZXXL 3NYHA 1EPHA 5FIWC 3TK6B 2UWOB 5L2YL 4RS0A 1DX5I 3R4XA 3HO4A 3KCGL 1IOXA 2NQXA 1TOZA 3LN0A 3OLUA 1ATAA 4TGFA 2P3FN 3ZS0C 4CUEA 4OEKA 1IGXA 5GLSA 5JVZA 1IQEL 1IGZA 3F1SB 2Y7XB 1EMNA 2K2TA 1OB1C 2P93L 5EGMB 1DDXA 2BOUA 3GCKA 2BQ7A 4HHSA 5JB9E 1IOEL 2W3KB 4Y6DB 4YZUB 4AQTA 1HZ8A 2PUQL 3SOQA 2UWPB 3KRQA 1ZAQA 2VWOL 3P5BL 1MOXC 1G1TA 2H9EL 1I0UA 3IJEB 4NT3A 5FF1A 2FLBL 2ADXA 2FZZL 2M74A 1IQFL 1HAEA 1EPIA 2VWLL 1FE2A 2J95B 5GH0A 4BTIA 6COXA 3BT2A 3HO5A 3V64C 3N8YA 1PTHA 1CEJA 3HS6A 3C9AC 2MGRA 1F7EA 4NGAL 4C1MC 1ATEA 1CVWL 1HRFA 2W2QE 1FAKL 4KVJA 4NA9L 1RFNB 2Y5HL 1LQDA 5JBAE 1FSBA 2VVUL 1EMOA 1IQKL 2WPHE 2XC0L 2KL7A 1G1QA 2P3UA 1G2LB 4GN6A 1XKAL 4D90A 1DQBA 3GCLA 3FFGL 1EAIC 2WG3C 4XL1A 3TGYA 1PFXL 4RRWA 4CUDA 4CSYA 1KLJL 1IQGL 4CUFA 1F0RB 3FAQA 2NPRA 2WG4B 4O1ZA 4XLWA 1G1RA 1APQA 2PT3A 4PNXA 2WFTA 2Y7ZB 1URKA 4Z0LA 1GK5A 1KLOA 2MHPA 2UWLB 1K36A 4MSFA 2D1JB 4FM5A 4PH9A 4Y7BB 1LPGA 3SW2A 3TH3L 1FF7A 3LTGD 2DDUA 1UZJA 1IQML 3LN1A 4X8VL 1EBVA 2Y38A 3V6QA 3PY4A 4ZXYL 4Y55A 2I9AA 4M10A 4MMXB 3QMOA 4X8TL 3KRKA 2Y81B 2BOXA 4A7IA 1O5DL 4JZDL 1MYPC 1Q4GA 1IQHL 4KVKA 1MQ5L 1A3PA 3CENL 3KK6A 5F1AA 1PXXA 1AUTL 1NPEB 2Y5GL 1F0SB 3BT1A 1D2VC 5IKRA 4X8UL 2EI7B 4RRXA 3BXIA 3ZS1C 4IG5A 2PR3B 1M1XB 4DL1C 2Y82B 3ZYGA 5IKTA 1IQLL 1Z6EL 3BPSE 1YO8A 1W7XL 1TPGA 3QCWA 1JBUL 4E1GA 3S4FA 4Y7AB 1LPZA 1DIYA 3NAKA 3K9XA 1MQ6L 2R5LA 2XBYL 3ERHA 5CKMA 5KIRA 1DNWC 3N8WA 1LPKA 4G1MB 4D0EA 4ISHL 1CX2A 2W2PE 1ADXA 2WPLE 1G1SA 2W26B 2PUMA 1UZQA 2BMGA 1CQEA 5L2ZL 4YT6L 1NQLB 5JBBE 3N8YB 1JV2B 3NTGA 3TBDA 3HS7A 1HT8A 2VWNL 3PGHA 2IKCA 1KLIL 1YUKB 3KQCL 2BOKL 1BF9A 3HO3A 4RUTA 4NG9L 1V3XB 1G2MB 2PHBB 2Q1JB 5CKQA 1NFWB 1DNUC 4JYVL 1KSNB 2B7DL 2P3TA 4KVLA 4D0FA 3HPTA 3H5CB 3NJPC 3N8WB 4NJBA 2W2NE 1FJSL 4YT7L 2Z5ZA 2RNLA 2OYEP 2BOHA 2EHAA 2J34B 2WPJE 2W3IB 1MHLC 3V65B 1EPJA 2XBXL 3NTBA 3R55A 2P26A 1YUGA 4MMZB 4QYQA 2J4IB 1P0SL 4BTTA 4OTYA 1D5LC 4BDXA 1ATBA 1IP0A 4BTUA 1W8BL 2XBWL 1CCVA 1DVAL 1IQNL 1HAFA 1NZIA 1HJ7A 3M37L 3R5OA 5K0HB 3IITB 5HPWA 2Y80B 5B72A 4COXA 1EPGA 4HHRA 2XC5L 4JZEL 3FBYA 4ZAEB 3MQEA 4GM7A 2WYJB 3CA7A 2XC4L 3NIUA 3Q9KA 1IQJL 1N1IA 4JZFL 2MGPA 3ASIA 1APOA 4Y76B 2P28B 4C16A 5L30L 3CS7L 1NT0A 1ATDA 3Q7DA 3FNLA 2CJIB 1NFUB 1NFYB 1X7AL 1YGCL 4RRYA 5E8DA 3F6UL 2JKHL 5I46L 1PGEA 2OJVA 1HT5A 2VVVL 4BDWA 2VJ3A 4BXSA 3F9PC 3KQEL 2EFBA 3GCXE 1EZQB 2W86A 1U67A 2E9EA 4Z6AL 3EGFA 2Y5FL 2WPKE 1IJQA 1WHEA 1WHFA 2RA0L 5JB8E 5IKQA 2YGOA 3SOVA 4MMYB 3RR3A 3RKEA 3ERIA 1KIGL 2K2SB 2P16L 2WYGB 3LC3B 1WU1B 3ZYIB 1HREA 1IVOC 3QH0A 3HS5A 5CKNA 2QQTA 1EGFA 4OTJA 1EQGA 2P94L 3KQBL 2KB9A 5CISA 4Y71B 1TLEA 3OGWA 3QF1A 3LAQA 3GCJA 3I6NA 3ELAL 4ZHAB 5COXA 2W2ME 3SOBB 3U73A 4LJJA 1F7MA 3MDLA 4Y79B 3LC5B 2TGFA 1HCGB 2FLRL 3TK5B 3U7UG 2BO2A 1K37A 4ZH8B 1NFXB 1L5GB 3NT1A 2YGPA 2F9BL 1B9WA 2I9BA 1XDTR 2EI6B 2WPME 1FAXL 3QL6A 2W2OE 1C5MF 3GC1A 3OLTA 4QJQA 3CFWA 4X8SL 5KN5C 1N7DA 2FLGA 1EQHA 1L3YA 1IQIL 2WFXB 3DEMA 2EI8B 3N8FA 2QRBA 3N8VA 3R05A 1CCFA 2J94B 3KL6B 2VH0B 4Z0KB 2VVCK 4RRZA 3N8ZA 5FDQA 3ENSA 3KQDL 1CXPC 1U8CB 2VWMK 2FD6A 4ISIL 4M11A 1J9CL 3FCSB 2IPSA 1PRHA 2BQWA 3Q3KB 2P3FL 4N7AA 1YUFA 4BXWA 3ZYJB 1XFEA 1Z6CA 1QFKL 3GISX 2OYUP 4O02B 1LMJA 4XBMA 1JL9A 2VH6B 5F19A 1XKBA 3TZIA 1SZBA 2J2UB 3LTFB 2KV4A 1D7WC 1P9JA 2BQ6A 2WPIE 1COUA 5JVYA 2O86A 2AYLA 3R5QA 2BZ6L 3SXVA 2P95L 1UZKA 1FFMA 3GCWE 4JYUL 3UBAA 2G00L 5JW1A 3POYA 4LORA 2RHPA 3M36L 1HX2A 2GJMA 3TGFA 1CVUA 4KSZA 5IKVA 2XBVL 5JBCE 3LIWB
chains in the Genus database with same CATH superfamily
2QPKA 4LMFA 1UZPA 3N8XA 2J38B 2BT8A 2GD4A 4ZXXL 3NYHA 1EPHA 5FIWC 3TK6B 2UWOB 5L2YL 4RS0A 1DX5I 3R4XA 3HO4A 3KCGL 1IOXA 2NQXA 1TOZA 3LN0A 3OLUA 1ATAA 4TGFA 2HORA 2P3FN 3ZS0C 4GU4A 4CUEA 4OEKA 1IGXA 5GLSA 5JVZA 1IQEL 1IGZA 3F1SB 2Y7XB 1EMNA 2K2TA 1OB1C 2P93L 5EGMB 1DDXA 2BOUA 3GCKA 2BQ7A 4HHSA 5JB9E 1IOEL 2W3KB 4Y6DB 4YZUB 4AQTA 1HZ8A 2PUQL 3SOQA 2UWPB 3KRQA 1ZAQA 2VWOL 3P5BL 1MOXC 1G1TA 2H9EL 1I0UA 3IJEB 4NT3A 5FF1A 2FLBL 2ADXA 2FZZL 2M74A 1IQFL 1HAEA 1EPIA 2VWLL 1FE2A 2J95B 5GH0A 4BTIA 6COXA 3BT2A 3HO5A 3V64C 3N8YA 1PTHA 1CEJA 3HS6A 3C9AC 2MGRA 1F7EA 4NGAL 4C1MC 1ATEA 1CVWL 1HRFA 2W2QE 1FAKL 4KVJA 1LMMA 4NA9L 1RFNB 2Y5HL 1LQDA 5JBAE 1FSBA 1V1IA 2VVUL 1EMOA 1IQKL 2WPHE 2XC0L 2KL7A 1G1QA 2P3UA 1G2LB 4GN6A 1XKAL 4D90A 1DQBA 3GCLA 3FFGL 1EAIC 2WG3C 4XL1A 3TGYA 1PFXL 4RRWA 4CUDA 4CSYA 1KLJL 2H9EC 1IQGL 4CUFA 1F0RB 3FAQA 2NPRA 2WG4B 4O1ZA 2YGQA 4XLWA 1G1RA 1LK9A 1APQA 2PT3A 4PNXA 2WFTA 2Y7ZB 1URKA 4Z0LA 1GK5A 1KLOA 2MHPA 2UWLB 1K36A 4MSFA 2D1JB 4FM5A 4PH9A 4Y7BB 1LPGA 3SW2A 3TH3L 1FF7A 3LTGD 2DDUA 1UZJA 1IQML 3LN1A 4X8VL 1EBVA 2Y38A 3V6QA 3PY4A 4ZXYL 4Y55A 2I9AA 4M10A 4MMXB 3QMOA 4X8TL 3KRKA 2Y81B 2BOXA 4A7IA 1O5DL 4JZDL 1MYPC 1Q4GA 1IQHL 4KVKA 1MQ5L 1A3PA 3CENL 3KK6A 5F1AA 1PXXA 1AUTL 1NPEB 2Y5GL 1F0SB 3BT1A 1D2VC 5IKRA 4X8UL 2EI7B 4RRXA 3BXIA 3ZS1C 4IG5A 2PR3B 1M1XB 4DL1C 2Y82B 3ZYGA 5IKTA 1IQLL 1Z6EL 3BPSE 1YO8A 1W7XL 1TPGA 3QCWA 1JBUL 4E1GA 3S4FA 4Y7AB 1LPZA 1DIYA 3NAKA 3K9XA 1MQ6L 2R5LA 2XBYL 3ERHA 5CKMA 5KIRA 1KKEA 1DNWC 3N8WA 1LPKA 4G1MB 4D0EA 4ISHL 1CX2A 2W2PE 1ADXA 2WPLE 1G1SA 2W26B 2PUMA 1UZQA 2BMGA 1CQEA 5L2ZL 4YT6L 1NQLB 5JBBE 3N8YB 1JV2B 3NTGA 3TBDA 3HS7A 1HT8A 2VWNL 3PGHA 2IKCA 1KLIL 1YUKB 3KQCL 2BOKL 1BF9A 3HO3A 4RUTA 4NG9L 1V3XB 1G2MB 2PHBB 2Q1JB 5CKQA 1NFWB 1DNUC 4JYVL 1KSNB 2B7DL 2P3TA 4KVLA 4D0FA 3HPTA 3H5CB 3NJPC 3N8WB 4NJBA 2W2NE 1FJSL 4YT7L 2Z5ZA 2RNLA 2OYEP 2BOHA 2EHAA 2J34B 2WPJE 2W3IB 1MHLC 3V65B 1EPJA 2XBXL 3NTBA 3R55A 2P26A 1YUGA 4MMZB 4QYQA 2J4IB 1P0SL 4BTTA 4OTYA 1D5LC 4BDXA 1ATBA 1IP0A 4BTUA 1W8BL 2XBWL 3S6XA 1DVAL 1CCVA 1IQNL 1HAFA 1NZIA 1HJ7A 3M37L 3R5OA 5K0HB 3IITB 5HPWA 2Y80B 5B72A 4COXA 1EPGA 4HHRA 2XC5L 4JZEL 3FBYA 4ZAEB 3MQEA 4GM7A 2WYJB 3CA7A 2XC4L 3NIUA 3Q9KA 1IQJL 1N1IA 4JZFL 2MGPA 3ASIA 1APOA 4Y76B 2P28B 4C16A 5L30L 3CS7L 1NT0A 1ATDA 3Q7DA 3FNLA 2CJIB 1NFUB 1NFYB 1X7AL 1YGCL 4RRYA 5E8DA 3F6UL 2JKHL 5I46L 1PGEA 2OJVA 2BT7A 1HT5A 2VVVL 4BDWA 2VJ3A 4BXSA 3F9PC 3KQEL 2EFBA 3GCXE 1EZQB 2W86A 1U67A 2E9EA 4Z6AL 3EGFA 2Y5FL 2WPKE 1IJQA 1WHEA 1WHFA 2RA0L 5JB8E 5IKQA 2YGOA 3SOVA 4MMYB 3RR3A 3RKEA 2WZPP 3ERIA 1KIGL 2K2SB 2P16L 2WYGB 2VRSA 3LC3B 1WU1B 3ZYIB 1HREA 1IVOC 3QH0A 1V1HA 3HS5A 2KNIA 5CKNA 2QQTA 1EGFA 4A94C 4OTJA 1EQGA 2P94L 3KQBL 2KB9A 5CISA 4Y71B 1TLEA 3OGWA 3QF1A 2HOXA 3LAQA 3GCJA 3I6NA 3ELAL 1QIUA 4ZHAB 5COXA 2W2ME 3SOBB 3U73A 4LJJA 1F7MA 3MDLA 4Y79B 3LC5B 2TGFA 1HCGB 2FLRL 3TK5B 3U7UG 2BO2A 1K37A 4ZH8B 1NFXB 1L5GB 3NT1A 2YGPA 2F9BL 1B9WA 2I9BA 1XDTR 2EI6B 2WPME 1FAXL 3QL6A 2W2OE 1C5MF 3GC1A 3OLTA 4QJQA 3CFWA 4X8SL 5KN5C 1N7DA 2FLGA 1EQHA 1L3YA 1IQIL 2WFXB 3DEMA 2EI8B 3N8FA 2QRBA 3N8VA 3R05A 1CCFA 2J94B 3KL6B 2VH0B 4Z0KB 2VVCK 4RRZA 3N8ZA 5FDQA 3ENSA 3KQDL 1CXPC 1U8CB 2VWMK 2FD6A 4ISIL 4M11A 1J9CL 3FCSB 2IPSA 1PRHA 2BQWA 3Q3KB 2P3FL 4N7AA 1YUFA 4BXWA 3ZYJB 2BSFA 1XFEA 1Z6CA 1QFKL 3GISX 2OYUP 4O02B 1LMJA 4XBMA 1JL9A 2VH6B 5F19A 1XKBA 3TZIA 1SZBA 2J2UB 3LTFB 2KV4A 1D7WC 1P9JA 2BQ6A 2JJLA 2WPIE 1COUA 5JVYA 2O86A 2AYLA 3R5QA 2BZ6L 3SXVA 2P95L 1UZKA 4GU3A 1FFMA 3GCWE 4JYUL 3UBAA 2G00L 5JW1A 3POYA 4LORA 2RHPA 3M36L 1HX2A 2GJMA 3TGFA 1CVUA 4KSZA 5IKVA 2XBVL 5JBCE 3LIWB
chains in the Genus database with same CATH topology
2QPKA 4LMFA 1UZPA 3N8XA 2J38B 2GD4A 4ZXXL 3NYHA 1EPHA 5FIWC 3TK6B 2UWOB 5L2YL 4RS0A 1DX5I 3R4XA 3HO4A 3KCGL 1IOXA 2NQXA 1TOZA 3LN0A 3OLUA 1ATAA 4TGFA 2P3FN 3ZS0C 4CUEA 4OEKA 1IGXA 5GLSA 5JVZA 1IQEL 1IGZA 3F1SB 2Y7XB 1EMNA 2K2TA 1OB1C 2P93L 5EGMB 1DDXA 2BOUA 3GCKA 2BQ7A 4HHSA 5JB9E 1IOEL 2W3KB 4Y6DB 4YZUB 4AQTA 1HZ8A 2PUQL 3SOQA 2UWPB 3KRQA 1ZAQA 2VWOL 3P5BL 1MOXC 1G1TA 2H9EL 1I0UA 3IJEB 4NT3A 5FF1A 2FLBL 2ADXA 2FZZL 2M74A 1IQFL 1HAEA 1EPIA 2VWLL 1FE2A 2J95B 5GH0A 4BTIA 6COXA 3BT2A 3HO5A 3V64C 3N8YA 1PTHA 1CEJA 3HS6A 3C9AC 2MGRA 1F7EA 4NGAL 4C1MC 1ATEA 1CVWL 1HRFA 2W2QE 1FAKL 4KVJA 1LMMA 4NA9L 1RFNB 2Y5HL 1LQDA 5JBAE 1FSBA 2VVUL 1EMOA 1IQKL 2WPHE 2XC0L 2KL7A 1G1QA 2P3UA 1G2LB 4GN6A 1XKAL 4D90A 1DQBA 3GCLA 3FFGL 1EAIC 2WG3C 4XL1A 3TGYA 1PFXL 4RRWA 4CUDA 4CSYA 1KLJL 2H9EC 1IQGL 4CUFA 1F0RB 3FAQA 2NPRA 2WG4B 4O1ZA 2YGQA 4XLWA 1G1RA 1APQA 2PT3A 4PNXA 2WFTA 2Y7ZB 1URKA 4Z0LA 1GK5A 1KLOA 2MHPA 2UWLB 1K36A 4MSFA 2D1JB 4FM5A 4PH9A 4Y7BB 1LPGA 3SW2A 3TH3L 1FF7A 3LTGD 2DDUA 1UZJA 1IQML 3LN1A 4X8VL 1EBVA 2Y38A 3V6QA 3PY4A 4ZXYL 4Y55A 2I9AA 4M10A 4MMXB 3QMOA 4X8TL 3KRKA 2Y81B 2BOXA 4A7IA 1O5DL 4JZDL 1MYPC 1Q4GA 1IQHL 4KVKA 1MQ5L 1A3PA 3CENL 3KK6A 5F1AA 1PXXA 1AUTL 1NPEB 2Y5GL 1F0SB 3BT1A 1D2VC 5IKRA 4X8UL 2EI7B 4RRXA 3BXIA 3ZS1C 4IG5A 2PR3B 1M1XB 4DL1C 2Y82B 3ZYGA 5IKTA 1IQLL 1Z6EL 3BPSE 1YO8A 1W7XL 1TPGA 3QCWA 1JBUL 4E1GA 3S4FA 4Y7AB 1LPZA 1DIYA 3NAKA 3K9XA 1MQ6L 2R5LA 2XBYL 3ERHA 5CKMA 5KIRA 1DNWC 3N8WA 1LPKA 4G1MB 4D0EA 4ISHL 1CX2A 2W2PE 1ADXA 2WPLE 1G1SA 2W26B 2PUMA 1UZQA 2BMGA 1CQEA 5L2ZL 4YT6L 1NQLB 5JBBE 3N8YB 1JV2B 3NTGA 3TBDA 3HS7A 1HT8A 2VWNL 3PGHA 2IKCA 1KLIL 1YUKB 3KQCL 2BOKL 1BF9A 3HO3A 4RUTA 4NG9L 1V3XB 1G2MB 2PHBB 2Q1JB 5CKQA 1NFWB 1DNUC 4JYVL 1KSNB 2B7DL 2P3TA 4KVLA 4D0FA 3HPTA 3H5CB 3NJPC 3N8WB 4NJBA 2W2NE 1FJSL 4YT7L 2Z5ZA 2RNLA 2OYEP 2BOHA 2EHAA 2J34B 2WPJE 2W3IB 1MHLC 3V65B 1EPJA 2XBXL 3NTBA 3R55A 2P26A 1YUGA 4MMZB 4QYQA 2J4IB 1P0SL 4BTTA 4OTYA 1D5LC 4BDXA 1ATBA 1IP0A 4BTUA 1W8BL 2XBWL 3S6XA 1DVAL 1CCVA 1IQNL 1HAFA 1NZIA 1HJ7A 3M37L 3R5OA 5K0HB 3IITB 5HPWA 2Y80B 5B72A 4COXA 1EPGA 4HHRA 2XC5L 4JZEL 3FBYA 4ZAEB 3MQEA 4GM7A 2WYJB 3CA7A 2XC4L 3NIUA 3Q9KA 1IQJL 1N1IA 4JZFL 2MGPA 3ASIA 1APOA 4Y76B 2P28B 4C16A 5L30L 3CS7L 1NT0A 1ATDA 3Q7DA 3FNLA 2CJIB 1NFUB 1NFYB 1X7AL 1YGCL 4RRYA 5E8DA 3F6UL 2JKHL 5I46L 1PGEA 2OJVA 1HT5A 2VVVL 4BDWA 2VJ3A 4BXSA 3F9PC 3KQEL 2EFBA 3GCXE 1EZQB 2W86A 1U67A 2E9EA 4Z6AL 3EGFA 2Y5FL 2WPKE 1IJQA 1WHEA 1WHFA 2RA0L 5JB8E 5IKQA 2YGOA 3SOVA 4MMYB 3RR3A 3RKEA 2WZPP 3ERIA 1KIGL 2K2SB 2P16L 2WYGB 3LC3B 1WU1B 3ZYIB 1HREA 1IVOC 3QH0A 3HS5A 2KNIA 5CKNA 2QQTA 1EGFA 4A94C 4OTJA 1EQGA 2P94L 3KQBL 2KB9A 5CISA 4Y71B 1TLEA 3OGWA 3QF1A 3LAQA 3GCJA 3I6NA 3ELAL 4ZHAB 5COXA 2W2ME 3SOBB 3U73A 4LJJA 1F7MA 3MDLA 4Y79B 3LC5B 2TGFA 1HCGB 2FLRL 3TK5B 3U7UG 2BO2A 1K37A 4ZH8B 1NFXB 1L5GB 3NT1A 2YGPA 2F9BL 1B9WA 2I9BA 1XDTR 2EI6B 2WPME 1FAXL 3QL6A 2W2OE 1C5MF 3GC1A 3OLTA 4QJQA 3CFWA 4X8SL 5KN5C 1N7DA 2FLGA 1EQHA 1L3YA 1IQIL 2WFXB 3DEMA 2EI8B 3N8FA 2QRBA 3N8VA 3R05A 1CCFA 2J94B 3KL6B 2VH0B 4Z0KB 2VVCK 4RRZA 3N8ZA 5FDQA 3ENSA 3KQDL 1CXPC 1U8CB 2VWMK 2FD6A 4ISIL 4M11A 1J9CL 3FCSB 2IPSA 1PRHA 2BQWA 3Q3KB 2P3FL 4N7AA 1YUFA 4BXWA 3ZYJB 1XFEA 1Z6CA 1QFKL 3GISX 2OYUP 4O02B 1LMJA 4XBMA 1JL9A 2VH6B 5F19A 1XKBA 3TZIA 1SZBA 2J2UB 3LTFB 2KV4A 1D7WC 1P9JA 2BQ6A 2WPIE 1COUA 5JVYA 2O86A 2AYLA 3R5QA 2BZ6L 3SXVA 2P95L 1UZKA 1FFMA 3GCWE 4JYUL 3UBAA 2G00L 5JW1A 3POYA 4LORA 2RHPA 3M36L 1HX2A 2GJMA 3TGFA 1CVUA 4KSZA 5IKVA 2XBVL 5JBCE 3LIWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QPK A;  4LMF A;  1UZP A;  3N8X A;  2J38 B;  2GD4 A;  4ZXX L;  3NYH A;  1EPH A;  5FIW C;  3TK6 B;  2UWO B;  5L2Y L;  4RS0 A;  1DX5 I;  3R4X A;  3HO4 A;  3KCG L;  1IOX A;  2NQX A;  1TOZ A;  3LN0 A;  3OLU A;  1ATA A;  4TGF A;  2P3F N;  3ZS0 C;  4CUE A;  4OEK A;  1IGX A;  5GLS A;  5JVZ A;  1IQE L;  1IGZ A;  3F1S B;  2Y7X B;  1EMN A;  2K2T A;  1OB1 C;  2P93 L;  5EGM B;  1DDX A;  2BOU A;  3GCK A;  2BQ7 A;  4HHS A;  5JB9 E;  1IOE L;  2W3K B;  4Y6D B;  4YZU B;  4AQT A;  1HZ8 A;  2PUQ L;  3SOQ A;  2UWP B;  3KRQ A;  1ZAQ A;  2VWO L;  3P5B L;  1MOX C;  1G1T A;  2H9E L;  1I0U A;  3IJE B;  4NT3 A;  5FF1 A;  2FLB L;  2ADX A;  2FZZ L;  2M74 A;  1IQF L;  1HAE A;  1EPI A;  2VWL L;  1FE2 A;  2J95 B;  5GH0 A;  4BTI A;  6COX A;  3BT2 A;  3HO5 A;  3V64 C;  3N8Y A;  1PTH A;  1CEJ A;  3HS6 A;  3C9A C;  2MGR A;  1F7E A;  4NGA L;  4C1M C;  1ATE A;  1CVW L;  1HRF A;  2W2Q E;  1FAK L;  4KVJ A;  4NA9 L;  1RFN B;  2Y5H L;  1LQD A;  5JBA E;  1FSB A;  2VVU L;  1EMO A;  1IQK L;  2WPH E;  2XC0 L;  2KL7 A;  1G1Q A;  2P3U A;  1G2L B;  4GN6 A;  1XKA L;  4D90 A;  1DQB A;  3GCL A;  3FFG L;  1EAI C;  2WG3 C;  4XL1 A;  3TGY A;  1PFX L;  4RRW A;  4CUD A;  4CSY A;  1KLJ L;  1IQG L;  4CUF A;  1F0R B;  3FAQ A;  2NPR A;  2WG4 B;  4O1Z A;  4XLW A;  1G1R A;  1APQ A;  2PT3 A;  4PNX A;  2WFT A;  2Y7Z B;  1URK A;  4Z0L A;  1GK5 A;  1KLO A;  2MHP A;  2UWL B;  1K36 A;  4MSF A;  2D1J B;  4FM5 A;  4PH9 A;  4Y7B B;  1LPG A;  3SW2 A;  3TH3 L;  1FF7 A;  3LTG D;  2DDU A;  1UZJ A;  1IQM L;  3LN1 A;  4X8V L;  1EBV A;  2Y38 A;  3V6Q A;  3PY4 A;  4ZXY L;  4Y55 A;  2I9A A;  4M10 A;  4MMX B;  3QMO A;  4X8T L;  3KRK A;  2Y81 B;  2BOX A;  4A7I A;  1O5D L;  4JZD L;  1MYP C;  1Q4G A;  1IQH L;  4KVK A;  1MQ5 L;  1A3P A;  3CEN L;  3KK6 A;  5F1A A;  1PXX A;  1AUT L;  1NPE B;  2Y5G L;  1F0S B;  3BT1 A;  1D2V C;  5IKR A;  4X8U L;  2EI7 B;  4RRX A;  3BXI A;  3ZS1 C;  4IG5 A;  2PR3 B;  1M1X B;  4DL1 C;  2Y82 B;  3ZYG A;  5IKT A;  1IQL L;  1Z6E L;  3BPS E;  1YO8 A;  1W7X L;  1TPG A;  3QCW A;  1JBU L;  4E1G A;  3S4F A;  4Y7A B;  1LPZ A;  1DIY A;  3NAK A;  3K9X A;  1MQ6 L;  2R5L A;  2XBY L;  3ERH A;  5CKM A;  5KIR A;  1DNW C;  3N8W A;  1LPK A;  4G1M B;  4D0E A;  4ISH L;  1CX2 A;  2W2P E;  1ADX A;  2WPL E;  1G1S A;  2W26 B;  2PUM A;  1UZQ A;  2BMG A;  1CQE A;  5L2Z L;  4YT6 L;  1NQL B;  5JBB E;  3N8Y B;  1JV2 B;  3NTG A;  3TBD A;  3HS7 A;  1HT8 A;  2VWN L;  3PGH A;  2IKC A;  1KLI L;  1YUK B;  3KQC L;  2BOK L;  1BF9 A;  3HO3 A;  4RUT A;  4NG9 L;  1V3X B;  1G2M B;  2PHB B;  2Q1J B;  5CKQ A;  1NFW B;  1DNU C;  4JYV L;  1KSN B;  2B7D L;  2P3T A;  4KVL A;  4D0F A;  3HPT A;  3H5C B;  3NJP C;  3N8W B;  4NJB A;  2W2N E;  1FJS L;  4YT7 L;  2Z5Z A;  2RNL A;  2OYE P;  2BOH A;  2EHA A;  2J34 B;  2WPJ E;  2W3I B;  1MHL C;  3V65 B;  1EPJ A;  2XBX L;  3NTB A;  3R55 A;  2P26 A;  1YUG A;  4MMZ B;  4QYQ A;  2J4I B;  1P0S L;  4BTT A;  4OTY A;  1D5L C;  4BDX A;  1ATB A;  1IP0 A;  4BTU A;  1W8B L;  2XBW L;  1CCV A;  1DVA L;  1IQN L;  1HAF A;  1NZI A;  1HJ7 A;  3M37 L;  3R5O A;  5K0H B;  3IIT B;  5HPW A;  2Y80 B;  5B72 A;  4COX A;  1EPG A;  4HHR A;  2XC5 L;  4JZE L;  3FBY A;  4ZAE B;  3MQE A;  4GM7 A;  2WYJ B;  3CA7 A;  2XC4 L;  3NIU A;  3Q9K A;  1IQJ L;  1N1I A;  4JZF L;  2MGP A;  3ASI A;  1APO A;  4Y76 B;  2P28 B;  4C16 A;  5L30 L;  3CS7 L;  1NT0 A;  1ATD A;  3Q7D A;  3FNL A;  2CJI B;  1NFU B;  1NFY B;  1X7A L;  1YGC L;  4RRY A;  5E8D A;  3F6U L;  2JKH L;  5I46 L;  1PGE A;  2OJV A;  1HT5 A;  2VVV L;  4BDW A;  2VJ3 A;  4BXS A;  3F9P C;  3KQE L;  2EFB A;  3GCX E;  1EZQ B;  2W86 A;  1U67 A;  2E9E A;  4Z6A L;  3EGF A;  2Y5F L;  2WPK E;  1IJQ A;  1WHE A;  1WHF A;  2RA0 L;  5JB8 E;  5IKQ A;  2YGO A;  3SOV A;  4MMY B;  3RR3 A;  3RKE A;  3ERI A;  1KIG L;  2K2S B;  2P16 L;  2WYG B;  3LC3 B;  1WU1 B;  3ZYI B;  1HRE A;  1IVO C;  3QH0 A;  3HS5 A;  5CKN A;  2QQT A;  1EGF A;  4OTJ A;  1EQG A;  2P94 L;  3KQB L;  2KB9 A;  5CIS A;  4Y71 B;  1TLE A;  3OGW A;  3QF1 A;  3LAQ A;  3GCJ A;  3I6N A;  3ELA L;  4ZHA B;  5COX A;  2W2M E;  3SOB B;  3U73 A;  4LJJ A;  1F7M A;  3MDL A;  4Y79 B;  3LC5 B;  2TGF A;  1HCG B;  2FLR L;  3TK5 B;  3U7U G;  2BO2 A;  1K37 A;  4ZH8 B;  1NFX B;  1L5G B;  3NT1 A;  2YGP A;  2F9B L;  1B9W A;  2I9B A;  1XDT R;  2EI6 B;  2WPM E;  1FAX L;  3QL6 A;  2W2O E;  1C5M F;  3GC1 A;  3OLT A;  4QJQ A;  3CFW A;  4X8S L;  5KN5 C;  1N7D A;  2FLG A;  1EQH A;  1L3Y A;  1IQI L;  2WFX B;  3DEM A;  2EI8 B;  3N8F A;  2QRB A;  3N8V A;  3R05 A;  1CCF A;  2J94 B;  3KL6 B;  2VH0 B;  4Z0K B;  2VVC K;  4RRZ A;  3N8Z A;  5FDQ A;  3ENS A;  3KQD L;  1CXP C;  1U8C B;  2VWM K;  2FD6 A;  4ISI L;  4M11 A;  1J9C L;  3FCS B;  2IPS A;  1PRH A;  2BQW A;  3Q3K B;  2P3F L;  4N7A A;  1YUF A;  4BXW A;  3ZYJ B;  1XFE A;  1Z6C A;  1QFK L;  3GIS X;  2OYU P;  4O02 B;  1LMJ A;  4XBM A;  1JL9 A;  2VH6 B;  5F19 A;  1XKB A;  3TZI A;  1SZB A;  2J2U B;  3LTF B;  2KV4 A;  1D7W C;  1P9J A;  2BQ6 A;  2WPI E;  1COU A;  5JVY A;  2O86 A;  2AYL A;  3R5Q A;  2BZ6 L;  3SXV A;  2P95 L;  1UZK A;  1FFM A;  3GCW E;  4JYU L;  3UBA A;  2G00 L;  5JW1 A;  3POY A;  4LOR A;  2RHP A;  3M36 L;  1HX2 A;  2GJM A;  3TGF A;  1CVU A;  4KSZ A;  5IKV A;  2XBV L;  5JBC E;  3LIW B; 
#chains in the Genus database with same CATH topology
 2QPK A;  4LMF A;  1UZP A;  3N8X A;  2J38 B;  2BT8 A;  2GD4 A;  4ZXX L;  3NYH A;  1EPH A;  5FIW C;  3TK6 B;  2UWO B;  5L2Y L;  4RS0 A;  1DX5 I;  3R4X A;  3HO4 A;  3KCG L;  1IOX A;  2NQX A;  1TOZ A;  3LN0 A;  3OLU A;  1ATA A;  4TGF A;  2HOR A;  2P3F N;  3ZS0 C;  4GU4 A;  4CUE A;  4OEK A;  1IGX A;  5GLS A;  5JVZ A;  1IQE L;  1IGZ A;  3F1S B;  2Y7X B;  1EMN A;  2K2T A;  1OB1 C;  2P93 L;  5EGM B;  1DDX A;  2BOU A;  3GCK A;  2BQ7 A;  4HHS A;  5JB9 E;  1IOE L;  2W3K B;  4Y6D B;  4YZU B;  4AQT A;  1HZ8 A;  2PUQ L;  3SOQ A;  2UWP B;  3KRQ A;  1ZAQ A;  2VWO L;  3P5B L;  1MOX C;  1G1T A;  2H9E L;  1I0U A;  3IJE B;  4NT3 A;  5FF1 A;  2FLB L;  2ADX A;  2FZZ L;  2M74 A;  1IQF L;  1HAE A;  1EPI A;  2VWL L;  1FE2 A;  2J95 B;  5GH0 A;  4BTI A;  6COX A;  3BT2 A;  3HO5 A;  3V64 C;  3N8Y A;  1PTH A;  1CEJ A;  3HS6 A;  3C9A C;  2MGR A;  1F7E A;  4NGA L;  4C1M C;  1ATE A;  1CVW L;  1HRF A;  2W2Q E;  1FAK L;  4KVJ A;  1LMM A;  4NA9 L;  1RFN B;  2Y5H L;  1LQD A;  5JBA E;  1FSB A;  1V1I A;  2VVU L;  1EMO A;  1IQK L;  2WPH E;  2XC0 L;  2KL7 A;  1G1Q A;  2P3U A;  1G2L B;  4GN6 A;  1XKA L;  4D90 A;  1DQB A;  3GCL A;  3FFG L;  1EAI C;  2WG3 C;  4XL1 A;  3TGY A;  1PFX L;  4RRW A;  4CUD A;  4CSY A;  1KLJ L;  2H9E C;  1IQG L;  4CUF A;  1F0R B;  3FAQ A;  2NPR A;  2WG4 B;  4O1Z A;  2YGQ A;  4XLW A;  1G1R A;  1LK9 A;  1APQ A;  2PT3 A;  4PNX A;  2WFT A;  2Y7Z B;  1URK A;  4Z0L A;  1GK5 A;  1KLO A;  2MHP A;  2UWL B;  1K36 A;  4MSF A;  2D1J B;  4FM5 A;  4PH9 A;  4Y7B B;  1LPG A;  3SW2 A;  3TH3 L;  1FF7 A;  3LTG D;  2DDU A;  1UZJ A;  1IQM L;  3LN1 A;  4X8V L;  1EBV A;  2Y38 A;  3V6Q A;  3PY4 A;  4ZXY L;  4Y55 A;  2I9A A;  4M10 A;  4MMX B;  3QMO A;  4X8T L;  3KRK A;  2Y81 B;  2BOX A;  4A7I A;  1O5D L;  4JZD L;  1MYP C;  1Q4G A;  1IQH L;  4KVK A;  1MQ5 L;  1A3P A;  3CEN L;  3KK6 A;  5F1A A;  1PXX A;  1AUT L;  1NPE B;  2Y5G L;  1F0S B;  3BT1 A;  1D2V C;  5IKR A;  4X8U L;  2EI7 B;  4RRX A;  3BXI A;  3ZS1 C;  4IG5 A;  2PR3 B;  1M1X B;  4DL1 C;  2Y82 B;  3ZYG A;  5IKT A;  1IQL L;  1Z6E L;  3BPS E;  1YO8 A;  1W7X L;  1TPG A;  3QCW A;  1JBU L;  4E1G A;  3S4F A;  4Y7A B;  1LPZ A;  1DIY A;  3NAK A;  3K9X A;  1MQ6 L;  2R5L A;  2XBY L;  3ERH A;  5CKM A;  5KIR A;  1KKE A;  1DNW C;  3N8W A;  1LPK A;  4G1M B;  4D0E A;  4ISH L;  1CX2 A;  2W2P E;  1ADX A;  2WPL E;  1G1S A;  2W26 B;  2PUM A;  1UZQ A;  2BMG A;  1CQE A;  5L2Z L;  4YT6 L;  1NQL B;  5JBB E;  3N8Y B;  1JV2 B;  3NTG A;  3TBD A;  3HS7 A;  1HT8 A;  2VWN L;  3PGH A;  2IKC A;  1KLI L;  1YUK B;  3KQC L;  2BOK L;  1BF9 A;  3HO3 A;  4RUT A;  4NG9 L;  1V3X B;  1G2M B;  2PHB B;  2Q1J B;  5CKQ A;  1NFW B;  1DNU C;  4JYV L;  1KSN B;  2B7D L;  2P3T A;  4KVL A;  4D0F A;  3HPT A;  3H5C B;  3NJP C;  3N8W B;  4NJB A;  2W2N E;  1FJS L;  4YT7 L;  2Z5Z A;  2RNL A;  2OYE P;  2BOH A;  2EHA A;  2J34 B;  2WPJ E;  2W3I B;  1MHL C;  3V65 B;  1EPJ A;  2XBX L;  3NTB A;  3R55 A;  2P26 A;  1YUG A;  4MMZ B;  4QYQ A;  2J4I B;  1P0S L;  4BTT A;  4OTY A;  1D5L C;  4BDX A;  1ATB A;  1IP0 A;  4BTU A;  1W8B L;  2XBW L;  3S6X A;  1DVA L;  1CCV A;  1IQN L;  1HAF A;  1NZI A;  1HJ7 A;  3M37 L;  3R5O A;  5K0H B;  3IIT B;  5HPW A;  2Y80 B;  5B72 A;  4COX A;  1EPG A;  4HHR A;  2XC5 L;  4JZE L;  3FBY A;  4ZAE B;  3MQE A;  4GM7 A;  2WYJ B;  3CA7 A;  2XC4 L;  3NIU A;  3Q9K A;  1IQJ L;  1N1I A;  4JZF L;  2MGP A;  3ASI A;  1APO A;  4Y76 B;  2P28 B;  4C16 A;  5L30 L;  3CS7 L;  1NT0 A;  1ATD A;  3Q7D A;  3FNL A;  2CJI B;  1NFU B;  1NFY B;  1X7A L;  1YGC L;  4RRY A;  5E8D A;  3F6U L;  2JKH L;  5I46 L;  1PGE A;  2OJV A;  2BT7 A;  1HT5 A;  2VVV L;  4BDW A;  2VJ3 A;  4BXS A;  3F9P C;  3KQE L;  2EFB A;  3GCX E;  1EZQ B;  2W86 A;  1U67 A;  2E9E A;  4Z6A L;  3EGF A;  2Y5F L;  2WPK E;  1IJQ A;  1WHE A;  1WHF A;  2RA0 L;  5JB8 E;  5IKQ A;  2YGO A;  3SOV A;  4MMY B;  3RR3 A;  3RKE A;  2WZP P;  3ERI A;  1KIG L;  2K2S B;  2P16 L;  2WYG B;  2VRS A;  3LC3 B;  1WU1 B;  3ZYI B;  1HRE A;  1IVO C;  3QH0 A;  1V1H A;  3HS5 A;  2KNI A;  5CKN A;  2QQT A;  1EGF A;  4A94 C;  4OTJ A;  1EQG A;  2P94 L;  3KQB L;  2KB9 A;  5CIS A;  4Y71 B;  1TLE A;  3OGW A;  3QF1 A;  2HOX A;  3LAQ A;  3GCJ A;  3I6N A;  3ELA L;  1QIU A;  4ZHA B;  5COX A;  2W2M E;  3SOB B;  3U73 A;  4LJJ A;  1F7M A;  3MDL A;  4Y79 B;  3LC5 B;  2TGF A;  1HCG B;  2FLR L;  3TK5 B;  3U7U G;  2BO2 A;  1K37 A;  4ZH8 B;  1NFX B;  1L5G B;  3NT1 A;  2YGP A;  2F9B L;  1B9W A;  2I9B A;  1XDT R;  2EI6 B;  2WPM E;  1FAX L;  3QL6 A;  2W2O E;  1C5M F;  3GC1 A;  3OLT A;  4QJQ A;  3CFW A;  4X8S L;  5KN5 C;  1N7D A;  2FLG A;  1EQH A;  1L3Y A;  1IQI L;  2WFX B;  3DEM A;  2EI8 B;  3N8F A;  2QRB A;  3N8V A;  3R05 A;  1CCF A;  2J94 B;  3KL6 B;  2VH0 B;  4Z0K B;  2VVC K;  4RRZ A;  3N8Z A;  5FDQ A;  3ENS A;  3KQD L;  1CXP C;  1U8C B;  2VWM K;  2FD6 A;  4ISI L;  4M11 A;  1J9C L;  3FCS B;  2IPS A;  1PRH A;  2BQW A;  3Q3K B;  2P3F L;  4N7A A;  1YUF A;  4BXW A;  3ZYJ B;  2BSF A;  1XFE A;  1Z6C A;  1QFK L;  3GIS X;  2OYU P;  4O02 B;  1LMJ A;  4XBM A;  1JL9 A;  2VH6 B;  5F19 A;  1XKB A;  3TZI A;  1SZB A;  2J2U B;  3LTF B;  2KV4 A;  1D7W C;  1P9J A;  2BQ6 A;  2JJL A;  2WPI E;  1COU A;  5JVY A;  2O86 A;  2AYL A;  3R5Q A;  2BZ6 L;  3SXV A;  2P95 L;  1UZK A;  4GU3 A;  1FFM A;  3GCW E;  4JYU L;  3UBA A;  2G00 L;  5JW1 A;  3POY A;  4LOR A;  2RHP A;  3M36 L;  1HX2 A;  2GJM A;  3TGF A;  1CVU A;  4KSZ A;  5IKV A;  2XBV L;  5JBC E;  3LIW B; 
#chains in the Genus database with same CATH homology
 2QPK A;  4LMF A;  1UZP A;  3N8X A;  2J38 B;  2GD4 A;  4ZXX L;  3NYH A;  1EPH A;  5FIW C;  3TK6 B;  2UWO B;  5L2Y L;  4RS0 A;  1DX5 I;  3R4X A;  3HO4 A;  3KCG L;  1IOX A;  2NQX A;  1TOZ A;  3LN0 A;  3OLU A;  1ATA A;  4TGF A;  2P3F N;  3ZS0 C;  4CUE A;  4OEK A;  1IGX A;  5GLS A;  5JVZ A;  1IQE L;  1IGZ A;  3F1S B;  2Y7X B;  1EMN A;  2K2T A;  1OB1 C;  2P93 L;  5EGM B;  1DDX A;  2BOU A;  3GCK A;  2BQ7 A;  4HHS A;  5JB9 E;  1IOE L;  2W3K B;  4Y6D B;  4YZU B;  4AQT A;  1HZ8 A;  2PUQ L;  3SOQ A;  2UWP B;  3KRQ A;  1ZAQ A;  2VWO L;  3P5B L;  1MOX C;  1G1T A;  2H9E L;  1I0U A;  3IJE B;  4NT3 A;  5FF1 A;  2FLB L;  2ADX A;  2FZZ L;  2M74 A;  1IQF L;  1HAE A;  1EPI A;  2VWL L;  1FE2 A;  2J95 B;  5GH0 A;  4BTI A;  6COX A;  3BT2 A;  3HO5 A;  3V64 C;  3N8Y A;  1PTH A;  1CEJ A;  3HS6 A;  3C9A C;  2MGR A;  1F7E A;  4NGA L;  4C1M C;  1ATE A;  1CVW L;  1HRF A;  2W2Q E;  1FAK L;  4KVJ A;  1LMM A;  4NA9 L;  1RFN B;  2Y5H L;  1LQD A;  5JBA E;  1FSB A;  2VVU L;  1EMO A;  1IQK L;  2WPH E;  2XC0 L;  2KL7 A;  1G1Q A;  2P3U A;  1G2L B;  4GN6 A;  1XKA L;  4D90 A;  1DQB A;  3GCL A;  3FFG L;  1EAI C;  2WG3 C;  4XL1 A;  3TGY A;  1PFX L;  4RRW A;  4CUD A;  4CSY A;  1KLJ L;  2H9E C;  1IQG L;  4CUF A;  1F0R B;  3FAQ A;  2NPR A;  2WG4 B;  4O1Z A;  2YGQ A;  4XLW A;  1G1R A;  1APQ A;  2PT3 A;  4PNX A;  2WFT A;  2Y7Z B;  1URK A;  4Z0L A;  1GK5 A;  1KLO A;  2MHP A;  2UWL B;  1K36 A;  4MSF A;  2D1J B;  4FM5 A;  4PH9 A;  4Y7B B;  1LPG A;  3SW2 A;  3TH3 L;  1FF7 A;  3LTG D;  2DDU A;  1UZJ A;  1IQM L;  3LN1 A;  4X8V L;  1EBV A;  2Y38 A;  3V6Q A;  3PY4 A;  4ZXY L;  4Y55 A;  2I9A A;  4M10 A;  4MMX B;  3QMO A;  4X8T L;  3KRK A;  2Y81 B;  2BOX A;  4A7I A;  1O5D L;  4JZD L;  1MYP C;  1Q4G A;  1IQH L;  4KVK A;  1MQ5 L;  1A3P A;  3CEN L;  3KK6 A;  5F1A A;  1PXX A;  1AUT L;  1NPE B;  2Y5G L;  1F0S B;  3BT1 A;  1D2V C;  5IKR A;  4X8U L;  2EI7 B;  4RRX A;  3BXI A;  3ZS1 C;  4IG5 A;  2PR3 B;  1M1X B;  4DL1 C;  2Y82 B;  3ZYG A;  5IKT A;  1IQL L;  1Z6E L;  3BPS E;  1YO8 A;  1W7X L;  1TPG A;  3QCW A;  1JBU L;  4E1G A;  3S4F A;  4Y7A B;  1LPZ A;  1DIY A;  3NAK A;  3K9X A;  1MQ6 L;  2R5L A;  2XBY L;  3ERH A;  5CKM A;  5KIR A;  1DNW C;  3N8W A;  1LPK A;  4G1M B;  4D0E A;  4ISH L;  1CX2 A;  2W2P E;  1ADX A;  2WPL E;  1G1S A;  2W26 B;  2PUM A;  1UZQ A;  2BMG A;  1CQE A;  5L2Z L;  4YT6 L;  1NQL B;  5JBB E;  3N8Y B;  1JV2 B;  3NTG A;  3TBD A;  3HS7 A;  1HT8 A;  2VWN L;  3PGH A;  2IKC A;  1KLI L;  1YUK B;  3KQC L;  2BOK L;  1BF9 A;  3HO3 A;  4RUT A;  4NG9 L;  1V3X B;  1G2M B;  2PHB B;  2Q1J B;  5CKQ A;  1NFW B;  1DNU C;  4JYV L;  1KSN B;  2B7D L;  2P3T A;  4KVL A;  4D0F A;  3HPT A;  3H5C B;  3NJP C;  3N8W B;  4NJB A;  2W2N E;  1FJS L;  4YT7 L;  2Z5Z A;  2RNL A;  2OYE P;  2BOH A;  2EHA A;  2J34 B;  2WPJ E;  2W3I B;  1MHL C;  3V65 B;  1EPJ A;  2XBX L;  3NTB A;  3R55 A;  2P26 A;  1YUG A;  4MMZ B;  4QYQ A;  2J4I B;  1P0S L;  4BTT A;  4OTY A;  1D5L C;  4BDX A;  1ATB A;  1IP0 A;  4BTU A;  1W8B L;  2XBW L;  3S6X A;  1DVA L;  1CCV A;  1IQN L;  1HAF A;  1NZI A;  1HJ7 A;  3M37 L;  3R5O A;  5K0H B;  3IIT B;  5HPW A;  2Y80 B;  5B72 A;  4COX A;  1EPG A;  4HHR A;  2XC5 L;  4JZE L;  3FBY A;  4ZAE B;  3MQE A;  4GM7 A;  2WYJ B;  3CA7 A;  2XC4 L;  3NIU A;  3Q9K A;  1IQJ L;  1N1I A;  4JZF L;  2MGP A;  3ASI A;  1APO A;  4Y76 B;  2P28 B;  4C16 A;  5L30 L;  3CS7 L;  1NT0 A;  1ATD A;  3Q7D A;  3FNL A;  2CJI B;  1NFU B;  1NFY B;  1X7A L;  1YGC L;  4RRY A;  5E8D A;  3F6U L;  2JKH L;  5I46 L;  1PGE A;  2OJV A;  1HT5 A;  2VVV L;  4BDW A;  2VJ3 A;  4BXS A;  3F9P C;  3KQE L;  2EFB A;  3GCX E;  1EZQ B;  2W86 A;  1U67 A;  2E9E A;  4Z6A L;  3EGF A;  2Y5F L;  2WPK E;  1IJQ A;  1WHE A;  1WHF A;  2RA0 L;  5JB8 E;  5IKQ A;  2YGO A;  3SOV A;  4MMY B;  3RR3 A;  3RKE A;  2WZP P;  3ERI A;  1KIG L;  2K2S B;  2P16 L;  2WYG B;  3LC3 B;  1WU1 B;  3ZYI B;  1HRE A;  1IVO C;  3QH0 A;  3HS5 A;  2KNI A;  5CKN A;  2QQT A;  1EGF A;  4A94 C;  4OTJ A;  1EQG A;  2P94 L;  3KQB L;  2KB9 A;  5CIS A;  4Y71 B;  1TLE A;  3OGW A;  3QF1 A;  3LAQ A;  3GCJ A;  3I6N A;  3ELA L;  4ZHA B;  5COX A;  2W2M E;  3SOB B;  3U73 A;  4LJJ A;  1F7M A;  3MDL A;  4Y79 B;  3LC5 B;  2TGF A;  1HCG B;  2FLR L;  3TK5 B;  3U7U G;  2BO2 A;  1K37 A;  4ZH8 B;  1NFX B;  1L5G B;  3NT1 A;  2YGP A;  2F9B L;  1B9W A;  2I9B A;  1XDT R;  2EI6 B;  2WPM E;  1FAX L;  3QL6 A;  2W2O E;  1C5M F;  3GC1 A;  3OLT A;  4QJQ A;  3CFW A;  4X8S L;  5KN5 C;  1N7D A;  2FLG A;  1EQH A;  1L3Y A;  1IQI L;  2WFX B;  3DEM A;  2EI8 B;  3N8F A;  2QRB A;  3N8V A;  3R05 A;  1CCF A;  2J94 B;  3KL6 B;  2VH0 B;  4Z0K B;  2VVC K;  4RRZ A;  3N8Z A;  5FDQ A;  3ENS A;  3KQD L;  1CXP C;  1U8C B;  2VWM K;  2FD6 A;  4ISI L;  4M11 A;  1J9C L;  3FCS B;  2IPS A;  1PRH A;  2BQW A;  3Q3K B;  2P3F L;  4N7A A;  1YUF A;  4BXW A;  3ZYJ B;  1XFE A;  1Z6C A;  1QFK L;  3GIS X;  2OYU P;  4O02 B;  1LMJ A;  4XBM A;  1JL9 A;  2VH6 B;  5F19 A;  1XKB A;  3TZI A;  1SZB A;  2J2U B;  3LTF B;  2KV4 A;  1D7W C;  1P9J A;  2BQ6 A;  2WPI E;  1COU A;  5JVY A;  2O86 A;  2AYL A;  3R5Q A;  2BZ6 L;  3SXV A;  2P95 L;  1UZK A;  1FFM A;  3GCW E;  4JYU L;  3UBA A;  2G00 L;  5JW1 A;  3POY A;  4LOR A;  2RHP A;  3M36 L;  1HX2 A;  2GJM A;  3TGF A;  1CVU A;  4KSZ A;  5IKV A;  2XBV L;  5JBC E;  3LIW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...