1Q4OA

The structure of the polo box domain of human plk1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
222
structure length
207
Chain Sequence
CHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK
publication title The crystal structure of the human polo-like kinase-1 polo box domain and its phospho-peptide complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 207
sequence length 222
chains with identical sequence B
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2003-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 1q4oA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 1q4oA01
3P35A 2N19A 4WHHA 1Q4OA 4WHLA 3P2WA 1UMWA 3FVHA 4E9DA 2OJXA 3HIHA 4YYPA 3Q1IA 3P37A 3P2ZA 5DMSA 5DMVC 4X9VA 3BZIA 4O9WA 1Q4KA 5J19A 3C5LA 3HIKA 3P34A 4H71A 4J7BB 4DFWA 4XB0A 4HY2A 5DNJA 4RCPA 5LHZA 3RQ7A 3P36A 4H5XA 4RS6A 4X9RA 4E67A 4LKLA 4X9WA 4WHKA 4O6WA 4E9CA 4HABA 4O56A 4LKMA 2OGQA 4HCOA
chains in the Genus database with same CATH superfamily
3GYWA 1N2KA 4N7ZA 1Q4OA 4WHLA 4FDIA 4N9JA 2OJXA 4YYPA 3ED4A 3Q1IA 1AUKA 4FDJA 3HIKA 3P34A 1P49A 4CXKA 4G7NA 4H5XA 4RS6A 4LKLA 1HDHA 4WHKA 5DAYA 1E1ZP 1E33P 1E2TA 3P2WA 1E3CP 3HFDA 3HIHA 2QZUA 3P37A 5DMVC 3BZIA 2E50A 1Q4KA 5J19A 1F32A 4NKBA 1N2LA 4J7BB 4HY2A 5DNJA 2I9XA 4NK7A 4E9CA 4HABA 4CXUA 4HCOA 3KDRA 3P35A 2N19A 4WHHA 1FSUA 1E2SP 3FVHA 4E9DA 4CYSA 3GYVA 4N7VA 3P2ZA 5DMSA 4CXSA 3HMJG 3C5LA 4H71A 4XB0A 3RQ7A 3LM3A 3P36A 3FS3A 4X9RA 4X9WA 4O56A 4LKMA 2OGQA 1A87A 2VKZG 2IA9A 5AJ9A 1UMWA 2I9ZA 4CYRA 2UV8G 1F34B 4X9VA 4O9WA 4DFWA 4RCPA 5LHZA 4E67A 4O6WA 3LXQA
chains in the Genus database with same CATH topology
3P35A 2N19A 4WHHA 1Q4OA 4WHLA 3P2WA 1UMWA 3FVHA 4E9DA 2OJXA 3HIHA 4YYPA 3Q1IA 3P37A 3P2ZA 5DMSA 5DMVC 4X9VA 3BZIA 4O9WA 1Q4KA 5J19A 3C5LA 3HIKA 3P34A 4H71A 4J7BB 4DFWA 4XB0A 4HY2A 5DNJA 4RCPA 5LHZA 3RQ7A 3P36A 4H5XA 4RS6A 4X9RA 4E67A 4LKLA 4X9WA 4WHKA 4O6WA 4E9CA 4HABA 4O56A 4LKMA 2OGQA 4HCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P35 A;  2N19 A;  4WHH A;  1Q4O A;  4WHL A;  3P2W A;  1UMW A;  3FVH A;  4E9D A;  2OJX A;  3HIH A;  4YYP A;  3Q1I A;  3P37 A;  3P2Z A;  5DMS A;  5DMV C;  4X9V A;  3BZI A;  4O9W A;  1Q4K A;  5J19 A;  3C5L A;  3HIK A;  3P34 A;  4H71 A;  4J7B B;  4DFW A;  4XB0 A;  4HY2 A;  5DNJ A;  4RCP A;  5LHZ A;  3RQ7 A;  3P36 A;  4H5X A;  4RS6 A;  4X9R A;  4E67 A;  4LKL A;  4X9W A;  4WHK A;  4O6W A;  4E9C A;  4HAB A;  4O56 A;  4LKM A;  2OGQ A;  4HCO A; 
#chains in the Genus database with same CATH topology
 3GYW A;  1N2K A;  4N7Z A;  1Q4O A;  4WHL A;  4FDI A;  4N9J A;  2OJX A;  4YYP A;  3ED4 A;  3Q1I A;  1AUK A;  4FDJ A;  3HIK A;  3P34 A;  1P49 A;  4CXK A;  4G7N A;  4H5X A;  4RS6 A;  4LKL A;  1HDH A;  4WHK A;  5DAY A;  1E1Z P;  1E33 P;  1E2T A;  3P2W A;  1E3C P;  3HFD A;  3HIH A;  2QZU A;  3P37 A;  5DMV C;  3BZI A;  2E50 A;  1Q4K A;  5J19 A;  1F32 A;  4NKB A;  1N2L A;  4J7B B;  4HY2 A;  5DNJ A;  2I9X A;  4NK7 A;  4E9C A;  4HAB A;  4CXU A;  4HCO A;  3KDR A;  3P35 A;  2N19 A;  4WHH A;  1FSU A;  1E2S P;  3FVH A;  4E9D A;  4CYS A;  3GYV A;  4N7V A;  3P2Z A;  5DMS A;  4CXS A;  3HMJ G;  3C5L A;  4H71 A;  4XB0 A;  3RQ7 A;  3LM3 A;  3P36 A;  3FS3 A;  4X9R A;  4X9W A;  4O56 A;  4LKM A;  2OGQ A;  1A87 A;  2VKZ G;  2IA9 A;  5AJ9 A;  1UMW A;  2I9Z A;  4CYR A;  2UV8 G;  1F34 B;  4X9V A;  4O9W A;  4DFW A;  4RCP A;  5LHZ A;  4E67 A;  4O6W A;  3LXQ A; 
#chains in the Genus database with same CATH homology
 3P35 A;  2N19 A;  4WHH A;  1Q4O A;  4WHL A;  3P2W A;  1UMW A;  3FVH A;  4E9D A;  2OJX A;  3HIH A;  4YYP A;  3Q1I A;  3P37 A;  3P2Z A;  5DMS A;  5DMV C;  4X9V A;  3BZI A;  4O9W A;  1Q4K A;  5J19 A;  3C5L A;  3HIK A;  3P34 A;  4H71 A;  4J7B B;  4DFW A;  4XB0 A;  4HY2 A;  5DNJ A;  4RCP A;  5LHZ A;  3RQ7 A;  3P36 A;  4H5X A;  4RS6 A;  4X9R A;  4E67 A;  4LKL A;  4X9W A;  4WHK A;  4O6W A;  4E9C A;  4HAB A;  4O56 A;  4LKM A;  2OGQ A;  4HCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...