1Q51A

Crystal structure of mycobacterium tuberculosis menb in complex with acetoacetyl-coenzyme a, a key enzyme in vitamin k2 biosynthesis
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
271
Chain Sequence
b'NPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDWSPFPRYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords menB
publication title Crystal structure of Mycobacterium tuberculosis MenB, a key enzyme in vitamin K2 biosynthesis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 103
structure length 271
sequence length 297
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2003-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 1q51A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1q51A01
3NJBA 3RRVA 1FC9A 3HRXA 3SWXA 4WCZA 3P85A 2NP9A 4IZCA 4LK5A 3TDCA 2FW2A 2IEXA 2VREA 2F9IA 3MOYA 4ASIA 4HC8A 3PEAA 4OMRA 2FBMA 4GHNA 3RSTA 3T89A 1UYVA 2J5SA 1YG8A 5G1QA 4NEKA 1FC6A 4FN8A 2ZL4A 1O8UA 5DZKA 4FZWA 1WDKA 4JWVA 3L3SA 2ZL0A 1OD4A 4F47A 4L6WA 4JYJA 3TLFA 5DUFA 4ELSA 2F6QA 2VSUF 3OT6A 5KJPA 3STAA 3T3WA 5DTWA 2DUBA 1XO6A 2J5II 3MFMA 4FN7A 4DI1A 5DKPA 4OG1A 4K2NA 1XNWA 3DJAA 4QIJA 1JXZA 5INIA 5E0SH 4Q0GA 2WTBA 3M6NA 3ZW9A 1WZ8A 4EMLA 1ON3A 2F9IB 2EJ5A 3PZKA 5INFA 3PE8A 4FJWD 1EY3A 4JSBA 4RYFH 3I47A 3U9SB 1HZDA 4JCQA 4KWBA 1SG4A 4JCSA 1PJHA 1EF8A 3KQFA 1VRGA 4U0GH 3TV5A 3ZW8A 4U18A 4K29A 3H0SA 1DUBA 2F9YA 4JCRA 5E0SA 1SZOA 5C90A 2VSUE 3K50A 4ZDFA 4JFCA 3ZWAA 1MJ3A 3QK8A 3HP0A 4ZDBA 3TT6A 4U0HA 4GM2A 3GMAA 2VSSA 4RYFA 2FZSA 5E0NX 4EMMA 2W3PA 4MXIA 4B3HA 3LKEA 3T88A 3NJDA 4IZBA 5CTBA 2BZRA 2ZL2A 3TRRA 4B3JA 3P2LA 3ZWCA 4EMPA 3IBBA 3OC7A 4ELXA 3T8AA 4YLHA 4L8KA 3Q0JA 3M6MA 3OMEA 1J7XA 4ZU2A 4Q1IA 5KDRA 2PBPA 4K3WA 3BEZA 5C9GA 3GF3A 2F9YB 4JJTA 3PGQA 4U1AA 3HLN1 3MYBA 2J5IA 1EF9A 2CE3A 1UYRA 5JBXA 1N6EA 3QYRA 4JCTA 1N6FA 3QKAA 1X0UA 3MT6A 2VX2A 3DORA 3Q0GA 4ZDEA 5DU6A 2VSSF 1XNYA 4Z0MA 4JVTA 3Q7HA 5FUSA 5MGBA 3QREA 3GLMA 3JU1A 2X24A 1TYFA 4WZ8B 2Q34A 4QFEA 1K32A 1FC7A 4OLQA 4MI2A 4I52A 5IKLB 3H81A 1XX4A 3VIVA 1PIXA 1NZYA 4G2RA 1HNOA 1Q51A 5KDRB 2Q2XA 5DTPA 1RJNA 3QMJA 3R9SA 1ON9A 5DU4A 5G1SA 3TT7A 2J5IB 2J5GD 2PPYA 1RJMA 3P5MA 4NNQA 2VSSE 1FCFA 1UYSA 1TG6A 4FB8A 3H0UA 2CBYA 5DU8A 3KTGA 2J5GA 2GTRA 3TVWA 4U0GA 2QQ3A 3KTIA 4FNDA 3V5EA 3IB9A 3IAVA 1WDLA 3GF7A 1XNVA 4JYLA 3RSIA 2A7SA 1YG6A 3QXIA 3U9RB 4IZDA 3N6RB 4RCNA 3HINA 1NZYB 4FNBA 4ELWA 1HNUA 4MOUA 2C8TA 3HE2A 4KPKA 3SLLA 2VSUC 3Q1TA 3R0OA 3H02A 1Q52A 3QXZA 1UYTA 4B3IA 3ST9A 1WDMA 3QWDA 2A7KA 4QIIA 2DEOA 3LAOA 3BF0A 4U19A 3TVUA 1W2XA 5DL1A 3GKBA 2A81A 3TZ3A 1N6DA 1Y7OA 5INGA 4I4ZA 2ZQQA 1DCIA 2PG8A 3T8BA 3FF6A 2F6IA 3H0QA 3BPPA 5G1RA 2HW5A 5JBWA 3ZWBA 2ZL3A 4ZDDA 3R9TA 3K8XA 4HNKA 3KTHA 5FIFA 1K39A 4KNPA 5CTCA 4ZDCA 3R9QA 3U9TB 2Q35A 2X58A 1OD2A 3KTKA 3WG5A 3FDUA 2ZQRA 4FZWC 4I42A 3V5IA 2UZFA 1UIYA 3KTJA 3R6HA 2D3TA 3H0JA 4KD6A 4JOTA 2VSUA 3ISAA 3G64A 5DUCA 4WYOB 5DZKH
chains in the Genus database with same CATH superfamily
3NJBA 3RRVA 1FC9A 3A4MA 3HRXA 3SWXA 4WCZA 3P85A 2NP9A 4IZCA 4LK5A 3TDCA 2FW2A 2IEXA 2VREA 2F9IA 3ADDA 3MOYA 4ASIA 4HC8A 3PEAA 1Y64B 4OMRA 2FBMA 4GHNA 3RSTA 3T89A 1UYVA 2J5SA 1YG8A 5G1QA 4FN8A 3L8JA 4NEKA 1FC6A 2ZL4A 1O8UA 5DZKA 4FZWA 1WDKA 4JWVA 3L3SA 1UX5A 2ZL0A 3L8IA 1OD4A 4F47A 4L6WA 4JYJA 3TLFA 5DUFA 4ELSA 2F6QA 2VSUF 2P63A 3OT6A 5KJPA 3STAA 3T3WA 5DTWA 2DUBA 1XO6A 2J5II 3MFMA 4FN7A 4DI1A 5DKPA 4OG1A 4K2NA 1XNWA 3DJAA 4QIJA 1JXZA 5INIA 5E0SH 4Q0GA 2WTBA 3M6NA 3ZW9A 1WZ8A 4EMLA 1ON3A 2F9IB 2EJ5A 3PZKA 5INFA 3PE8A 4FJWD 1EY3A 4JSBA 4RYFH 3I47A 3U9SB 3IRBA 1HZDA 4JCQA 1UX4A 4KWBA 1SG4A 4JCSA 1PJHA 1EF8A 3KQFA 1VRGA 4U0GH 3TV5A 3ZW8A 4U18A 4K29A 3H0SA 1DUBA 2F9YA 4JCRA 5E0SA 1SZOA 5C90A 2VSUE 3K50A 3W8IB 4ZDFA 4JFCA 3ZWAA 1MJ3A 3QK8A 3HP0A 4ZDBA 3TT6A 4U0HA 4GM2A 3GMAA 4GEHB 2VSSA 4RYFA 2FZSA 5E0NX 4EMMA 2W3PA 4MXIA 4B3HA 3LKEA 4NARA 3T88A 3RQEA 3NJDA 4IZBA 5CTBA 2BZRA 2ZL2A 3TRRA 4B3JA 3P2LA 3ZWCA 4EMPA 3IBBA 3OC7A 4ELXA 3T8AA 4YLHA 4L8KA 3Q0JA 3M6MA 3OMEA 1J7XA 4ZU2A 4Q1IA 5KDRA 2PBPA 4K3WA 3BEZA 5C9GA 3RQGA 3GF3A 2F9YB 4JJTA 4J2UA 3PGQA 4U1AA 3HLN1 3MYBA 2J5IA 1EF9A 2CE3A 1UYRA 5JBXA 1N6EA 3QYRA 4JCTA 1N6FA 3QKAA 1X0UA 3MT6A 3AJMA 2VX2A 3ADCA 3DORA 3Q0GA 4ZDEA 5DU6A 2VSSF 3A4LA 1XNYA 4Z0MA 4JVTA 3Q7HA 5FUSA 5MGBA 3BPTA 3QREA 3GLMA 3JU1A 2X24A 1TYFA 4WZ8B 2Q34A 4QFEA 1K32A 1FC7A 4OLQA 4MI2A 4I52A 5IKLB 3H81A 1XX4A 3VIVA 1PIXA 1NZYA 4G2RA 3AM1A 1HNOA 1Q51A 5KDRB 2Q2XA 5DTPA 1RJNA 3QMJA 3R9SA 1ON9A 5DU4A 5G1SA 3TT7A 2J5IB 2J5GD 2PPYA 1RJMA 3P5MA 4NNQA 3RQFA 1FCFA 1UYSA 2VSSE 1TG6A 4FB8A 3H0UA 2CBYA 5DU8A 3KTGA 2J5GA 2GTRA 3TVWA 4U0GA 2QQ3A 3KTIA 4FNDA 3V5EA 3IB9A 3IAVA 1WDLA 3GF7A 1XNVA 4JYLA 3RSIA 2A7SA 1YG6A 3QXIA 3U9RB 4IZDA 3A4NA 3N6RB 4RCNA 3HINA 1NZYB 4FNBA 4ELWA 1HNUA 4MOUA 2C8TA 2YJGA 3HE2A 4KPKA 3SLLA 2VSUC 3Q1TA 3R0OA 3H02A 1Q52A 3QXZA 1UYTA 4B3IA 3ST9A 1WDMA 3QWDA 2A7KA 4QIIA 2DEOA 3LAOA 3BF0A 4U19A 3TVUA 1W2XA 5DL1A 3ADBA 3GKBA 2A81A 3O4XE 3TZ3A 1N6DA 1Y7OA 5INGA 4I4ZA 2ZQQA 1DCIA 2PG8A 3T8BA 3FF6A 2F6IA 3H0QA 3BPPA 3W8HB 5G1RA 2HW5A 5JBWA 3ZWBA 2ZL3A 4ZDDA 3R9TA 3K8XA 4HNKA 3KTHA 5FIFA 1K39A 4KNPA 5CTCA 4ZDCA 3R9QA 3U9TB 2Q35A 2X58A 1OD2A 3KTKA 3WG5A 3FDUA 2ZQRA 4FZWC 4I42A 3V5IA 2UZFA 1UIYA 3KTJA 4HDTA 3R6HA 2D3TA 3H0JA 4KD6A 4JOTA 2VSUA 3ISAA 5HUQA 3G64A 5DUCA 4WYOB 5DZKH
chains in the Genus database with same CATH topology
3NJBA 3RRVA 1FC9A 3HRXA 3SWXA 4WCZA 3P85A 2NP9A 4IZCA 4LK5A 3TDCA 2FW2A 2IEXA 2VREA 2F9IA 3MOYA 4ASIA 4HC8A 3PEAA 4OMRA 2FBMA 4GHNA 3RSTA 3T89A 1UYVA 2J5SA 1YG8A 5G1QA 4NEKA 1FC6A 4FN8A 2ZL4A 1O8UA 5DZKA 4FZWA 1WDKA 4JWVA 3L3SA 2ZL0A 1OD4A 4F47A 4L6WA 4JYJA 3TLFA 5DUFA 4ELSA 2F6QA 2VSUF 3OT6A 5KJPA 3STAA 3T3WA 5DTWA 2DUBA 1XO6A 2J5II 3MFMA 4FN7A 4DI1A 5DKPA 4OG1A 4K2NA 1XNWA 3DJAA 4QIJA 1JXZA 5INIA 5E0SH 4Q0GA 2WTBA 3M6NA 3ZW9A 1WZ8A 4EMLA 1ON3A 2F9IB 2EJ5A 3PZKA 5INFA 3PE8A 4FJWD 1EY3A 4JSBA 4RYFH 3I47A 3U9SB 1HZDA 4JCQA 4KWBA 1SG4A 4JCSA 1PJHA 1EF8A 3KQFA 1VRGA 4U0GH 3TV5A 3ZW8A 4U18A 4K29A 3H0SA 1DUBA 2F9YA 4JCRA 5E0SA 1SZOA 5C90A 2VSUE 3K50A 4ZDFA 4JFCA 3ZWAA 1MJ3A 3QK8A 3HP0A 4ZDBA 3TT6A 4U0HA 4GM2A 3GMAA 2VSSA 4RYFA 2FZSA 5E0NX 4EMMA 2W3PA 4MXIA 4B3HA 3LKEA 4NARA 3T88A 3NJDA 4IZBA 5CTBA 2BZRA 2ZL2A 3TRRA 4B3JA 3P2LA 3ZWCA 4EMPA 3IBBA 3OC7A 4ELXA 3T8AA 4YLHA 4L8KA 3Q0JA 3M6MA 3OMEA 1J7XA 4ZU2A 4Q1IA 5KDRA 2PBPA 4K3WA 3BEZA 5C9GA 3GF3A 2F9YB 4JJTA 4J2UA 3PGQA 4U1AA 3HLN1 3MYBA 2J5IA 1EF9A 2CE3A 1UYRA 5JBXA 1N6EA 3QYRA 4JCTA 1N6FA 3QKAA 1X0UA 3MT6A 2VX2A 3DORA 3Q0GA 4ZDEA 5DU6A 2VSSF 1XNYA 4Z0MA 4JVTA 3Q7HA 5FUSA 5MGBA 3BPTA 3QREA 3GLMA 3JU1A 2X24A 1TYFA 4WZ8B 2Q34A 4QFEA 1K32A 1FC7A 4OLQA 4MI2A 4I52A 5IKLB 3H81A 1XX4A 3VIVA 1PIXA 1NZYA 4G2RA 1HNOA 1Q51A 5KDRB 2Q2XA 5DTPA 1RJNA 3QMJA 3R9SA 1ON9A 5DU4A 5G1SA 3TT7A 2J5IB 2J5GD 2PPYA 1RJMA 3P5MA 4NNQA 2VSSE 1FCFA 1UYSA 1TG6A 4FB8A 3H0UA 2CBYA 5DU8A 3KTGA 2J5GA 2GTRA 3TVWA 4U0GA 2QQ3A 3KTIA 4FNDA 3V5EA 3IB9A 3IAVA 1WDLA 3GF7A 1XNVA 4JYLA 3RSIA 2A7SA 1YG6A 3QXIA 3U9RB 4IZDA 3N6RB 4RCNA 3HINA 1NZYB 4FNBA 4ELWA 1HNUA 4MOUA 2C8TA 2YJGA 3HE2A 4KPKA 3SLLA 2VSUC 3Q1TA 3R0OA 3H02A 1Q52A 3QXZA 1UYTA 4B3IA 3ST9A 1WDMA 3QWDA 2A7KA 4QIIA 2DEOA 3LAOA 3BF0A 4U19A 3TVUA 1W2XA 5DL1A 3GKBA 2A81A 3TZ3A 1N6DA 1Y7OA 5INGA 4I4ZA 2ZQQA 1DCIA 2PG8A 3T8BA 3FF6A 2F6IA 3H0QA 3BPPA 5G1RA 2HW5A 5JBWA 3ZWBA 2ZL3A 4ZDDA 3R9TA 3K8XA 4HNKA 3KTHA 5FIFA 1K39A 4KNPA 5CTCA 4ZDCA 3R9QA 3U9TB 2Q35A 2X58A 1OD2A 3KTKA 3WG5A 3FDUA 2ZQRA 4FZWC 4I42A 3V5IA 2UZFA 1UIYA 3KTJA 4HDTA 3R6HA 2D3TA 3H0JA 4KD6A 4JOTA 2VSUA 3ISAA 5HUQA 3G64A 5DUCA 4WYOB 5DZKH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NJB A;  3RRV A;  1FC9 A;  3HRX A;  3SWX A;  4WCZ A;  3P85 A;  2NP9 A;  4IZC A;  4LK5 A;  3TDC A;  2FW2 A;  2IEX A;  2VRE A;  2F9I A;  3MOY A;  4ASI A;  4HC8 A;  3PEA A;  4OMR A;  2FBM A;  4GHN A;  3RST A;  3T89 A;  1UYV A;  2J5S A;  1YG8 A;  5G1Q A;  4NEK A;  1FC6 A;  4FN8 A;  2ZL4 A;  1O8U A;  5DZK A;  4FZW A;  1WDK A;  4JWV A;  3L3S A;  2ZL0 A;  1OD4 A;  4F47 A;  4L6W A;  4JYJ A;  3TLF A;  5DUF A;  4ELS A;  2F6Q A;  2VSU F;  3OT6 A;  5KJP A;  3STA A;  3T3W A;  5DTW A;  2DUB A;  1XO6 A;  2J5I I;  3MFM A;  4FN7 A;  4DI1 A;  5DKP A;  4OG1 A;  4K2N A;  1XNW A;  3DJA A;  4QIJ A;  1JXZ A;  5INI A;  5E0S H;  4Q0G A;  2WTB A;  3M6N A;  3ZW9 A;  1WZ8 A;  4EML A;  1ON3 A;  2F9I B;  2EJ5 A;  3PZK A;  5INF A;  3PE8 A;  4FJW D;  1EY3 A;  4JSB A;  4RYF H;  3I47 A;  3U9S B;  1HZD A;  4JCQ A;  4KWB A;  1SG4 A;  4JCS A;  1PJH A;  1EF8 A;  3KQF A;  1VRG A;  4U0G H;  3TV5 A;  3ZW8 A;  4U18 A;  4K29 A;  3H0S A;  1DUB A;  2F9Y A;  4JCR A;  5E0S A;  1SZO A;  5C90 A;  2VSU E;  3K50 A;  4ZDF A;  4JFC A;  3ZWA A;  1MJ3 A;  3QK8 A;  3HP0 A;  4ZDB A;  3TT6 A;  4U0H A;  4GM2 A;  3GMA A;  2VSS A;  4RYF A;  2FZS A;  5E0N X;  4EMM A;  2W3P A;  4MXI A;  4B3H A;  3LKE A;  3T88 A;  3NJD A;  4IZB A;  5CTB A;  2BZR A;  2ZL2 A;  3TRR A;  4B3J A;  3P2L A;  3ZWC A;  4EMP A;  3IBB A;  3OC7 A;  4ELX A;  3T8A A;  4YLH A;  4L8K A;  3Q0J A;  3M6M A;  3OME A;  1J7X A;  4ZU2 A;  4Q1I A;  5KDR A;  2PBP A;  4K3W A;  3BEZ A;  5C9G A;  3GF3 A;  2F9Y B;  4JJT A;  3PGQ A;  4U1A A;  3HLN 1;  3MYB A;  2J5I A;  1EF9 A;  2CE3 A;  1UYR A;  5JBX A;  1N6E A;  3QYR A;  4JCT A;  1N6F A;  3QKA A;  1X0U A;  3MT6 A;  2VX2 A;  3DOR A;  3Q0G A;  4ZDE A;  5DU6 A;  2VSS F;  1XNY A;  4Z0M A;  4JVT A;  3Q7H A;  5FUS A;  5MGB A;  3QRE A;  3GLM A;  3JU1 A;  2X24 A;  1TYF A;  4WZ8 B;  2Q34 A;  4QFE A;  1K32 A;  1FC7 A;  4OLQ A;  4MI2 A;  4I52 A;  5IKL B;  3H81 A;  1XX4 A;  3VIV A;  1PIX A;  1NZY A;  4G2R A;  1HNO A;  1Q51 A;  5KDR B;  2Q2X A;  5DTP A;  1RJN A;  3QMJ A;  3R9S A;  1ON9 A;  5DU4 A;  5G1S A;  3TT7 A;  2J5I B;  2J5G D;  2PPY A;  1RJM A;  3P5M A;  4NNQ A;  2VSS E;  1FCF A;  1UYS A;  1TG6 A;  4FB8 A;  3H0U A;  2CBY A;  5DU8 A;  3KTG A;  2J5G A;  2GTR A;  3TVW A;  4U0G A;  2QQ3 A;  3KTI A;  4FND A;  3V5E A;  3IB9 A;  3IAV A;  1WDL A;  3GF7 A;  1XNV A;  4JYL A;  3RSI A;  2A7S A;  1YG6 A;  3QXI A;  3U9R B;  4IZD A;  3N6R B;  4RCN A;  3HIN A;  1NZY B;  4FNB A;  4ELW A;  1HNU A;  4MOU A;  2C8T A;  3HE2 A;  4KPK A;  3SLL A;  2VSU C;  3Q1T A;  3R0O A;  3H02 A;  1Q52 A;  3QXZ A;  1UYT A;  4B3I A;  3ST9 A;  1WDM A;  3QWD A;  2A7K A;  4QII A;  2DEO A;  3LAO A;  3BF0 A;  4U19 A;  3TVU A;  1W2X A;  5DL1 A;  3GKB A;  2A81 A;  3TZ3 A;  1N6D A;  1Y7O A;  5ING A;  4I4Z A;  2ZQQ A;  1DCI A;  2PG8 A;  3T8B A;  3FF6 A;  2F6I A;  3H0Q A;  3BPP A;  5G1R A;  2HW5 A;  5JBW A;  3ZWB A;  2ZL3 A;  4ZDD A;  3R9T A;  3K8X A;  4HNK A;  3KTH A;  5FIF A;  1K39 A;  4KNP A;  5CTC A;  4ZDC A;  3R9Q A;  3U9T B;  2Q35 A;  2X58 A;  1OD2 A;  3KTK A;  3WG5 A;  3FDU A;  2ZQR A;  4FZW C;  4I42 A;  3V5I A;  2UZF A;  1UIY A;  3KTJ A;  3R6H A;  2D3T A;  3H0J A;  4KD6 A;  4JOT A;  2VSU A;  3ISA A;  3G64 A;  5DUC A;  4WYO B;  5DZK H; 
#chains in the Genus database with same CATH topology
 3NJB A;  3RRV A;  1FC9 A;  3A4M A;  3HRX A;  3SWX A;  4WCZ A;  3P85 A;  2NP9 A;  4IZC A;  4LK5 A;  3TDC A;  2FW2 A;  2IEX A;  2VRE A;  2F9I A;  3ADD A;  3MOY A;  4ASI A;  4HC8 A;  3PEA A;  1Y64 B;  4OMR A;  2FBM A;  4GHN A;  3RST A;  3T89 A;  1UYV A;  2J5S A;  1YG8 A;  5G1Q A;  4FN8 A;  3L8J A;  4NEK A;  1FC6 A;  2ZL4 A;  1O8U A;  5DZK A;  4FZW A;  1WDK A;  4JWV A;  3L3S A;  1UX5 A;  2ZL0 A;  3L8I A;  1OD4 A;  4F47 A;  4L6W A;  4JYJ A;  3TLF A;  5DUF A;  4ELS A;  2F6Q A;  2VSU F;  2P63 A;  3OT6 A;  5KJP A;  3STA A;  3T3W A;  5DTW A;  2DUB A;  1XO6 A;  2J5I I;  3MFM A;  4FN7 A;  4DI1 A;  5DKP A;  4OG1 A;  4K2N A;  1XNW A;  3DJA A;  4QIJ A;  1JXZ A;  5INI A;  5E0S H;  4Q0G A;  2WTB A;  3M6N A;  3ZW9 A;  1WZ8 A;  4EML A;  1ON3 A;  2F9I B;  2EJ5 A;  3PZK A;  5INF A;  3PE8 A;  4FJW D;  1EY3 A;  4JSB A;  4RYF H;  3I47 A;  3U9S B;  3IRB A;  1HZD A;  4JCQ A;  1UX4 A;  4KWB A;  1SG4 A;  4JCS A;  1PJH A;  1EF8 A;  3KQF A;  1VRG A;  4U0G H;  3TV5 A;  3ZW8 A;  4U18 A;  4K29 A;  3H0S A;  1DUB A;  2F9Y A;  4JCR A;  5E0S A;  1SZO A;  5C90 A;  2VSU E;  3K50 A;  3W8I B;  4ZDF A;  4JFC A;  3ZWA A;  1MJ3 A;  3QK8 A;  3HP0 A;  4ZDB A;  3TT6 A;  4U0H A;  4GM2 A;  3GMA A;  4GEH B;  2VSS A;  4RYF A;  2FZS A;  5E0N X;  4EMM A;  2W3P A;  4MXI A;  4B3H A;  3LKE A;  4NAR A;  3T88 A;  3RQE A;  3NJD A;  4IZB A;  5CTB A;  2BZR A;  2ZL2 A;  3TRR A;  4B3J A;  3P2L A;  3ZWC A;  4EMP A;  3IBB A;  3OC7 A;  4ELX A;  3T8A A;  4YLH A;  4L8K A;  3Q0J A;  3M6M A;  3OME A;  1J7X A;  4ZU2 A;  4Q1I A;  5KDR A;  2PBP A;  4K3W A;  3BEZ A;  5C9G A;  3RQG A;  3GF3 A;  2F9Y B;  4JJT A;  4J2U A;  3PGQ A;  4U1A A;  3HLN 1;  3MYB A;  2J5I A;  1EF9 A;  2CE3 A;  1UYR A;  5JBX A;  1N6E A;  3QYR A;  4JCT A;  1N6F A;  3QKA A;  1X0U A;  3MT6 A;  3AJM A;  2VX2 A;  3ADC A;  3DOR A;  3Q0G A;  4ZDE A;  5DU6 A;  2VSS F;  3A4L A;  1XNY A;  4Z0M A;  4JVT A;  3Q7H A;  5FUS A;  5MGB A;  3BPT A;  3QRE A;  3GLM A;  3JU1 A;  2X24 A;  1TYF A;  4WZ8 B;  2Q34 A;  4QFE A;  1K32 A;  1FC7 A;  4OLQ A;  4MI2 A;  4I52 A;  5IKL B;  3H81 A;  1XX4 A;  3VIV A;  1PIX A;  1NZY A;  4G2R A;  3AM1 A;  1HNO A;  1Q51 A;  5KDR B;  2Q2X A;  5DTP A;  1RJN A;  3QMJ A;  3R9S A;  1ON9 A;  5DU4 A;  5G1S A;  3TT7 A;  2J5I B;  2J5G D;  2PPY A;  1RJM A;  3P5M A;  4NNQ A;  3RQF A;  1FCF A;  1UYS A;  2VSS E;  1TG6 A;  4FB8 A;  3H0U A;  2CBY A;  5DU8 A;  3KTG A;  2J5G A;  2GTR A;  3TVW A;  4U0G A;  2QQ3 A;  3KTI A;  4FND A;  3V5E A;  3IB9 A;  3IAV A;  1WDL A;  3GF7 A;  1XNV A;  4JYL A;  3RSI A;  2A7S A;  1YG6 A;  3QXI A;  3U9R B;  4IZD A;  3A4N A;  3N6R B;  4RCN A;  3HIN A;  1NZY B;  4FNB A;  4ELW A;  1HNU A;  4MOU A;  2C8T A;  2YJG A;  3HE2 A;  4KPK A;  3SLL A;  2VSU C;  3Q1T A;  3R0O A;  3H02 A;  1Q52 A;  3QXZ A;  1UYT A;  4B3I A;  3ST9 A;  1WDM A;  3QWD A;  2A7K A;  4QII A;  2DEO A;  3LAO A;  3BF0 A;  4U19 A;  3TVU A;  1W2X A;  5DL1 A;  3ADB A;  3GKB A;  2A81 A;  3O4X E;  3TZ3 A;  1N6D A;  1Y7O A;  5ING A;  4I4Z A;  2ZQQ A;  1DCI A;  2PG8 A;  3T8B A;  3FF6 A;  2F6I A;  3H0Q A;  3BPP A;  3W8H B;  5G1R A;  2HW5 A;  5JBW A;  3ZWB A;  2ZL3 A;  4ZDD A;  3R9T A;  3K8X A;  4HNK A;  3KTH A;  5FIF A;  1K39 A;  4KNP A;  5CTC A;  4ZDC A;  3R9Q A;  3U9T B;  2Q35 A;  2X58 A;  1OD2 A;  3KTK A;  3WG5 A;  3FDU A;  2ZQR A;  4FZW C;  4I42 A;  3V5I A;  2UZF A;  1UIY A;  3KTJ A;  4HDT A;  3R6H A;  2D3T A;  3H0J A;  4KD6 A;  4JOT A;  2VSU A;  3ISA A;  5HUQ A;  3G64 A;  5DUC A;  4WYO B;  5DZK H; 
#chains in the Genus database with same CATH homology
 3NJB A;  3RRV A;  1FC9 A;  3HRX A;  3SWX A;  4WCZ A;  3P85 A;  2NP9 A;  4IZC A;  4LK5 A;  3TDC A;  2FW2 A;  2IEX A;  2VRE A;  2F9I A;  3MOY A;  4ASI A;  4HC8 A;  3PEA A;  4OMR A;  2FBM A;  4GHN A;  3RST A;  3T89 A;  1UYV A;  2J5S A;  1YG8 A;  5G1Q A;  4NEK A;  1FC6 A;  4FN8 A;  2ZL4 A;  1O8U A;  5DZK A;  4FZW A;  1WDK A;  4JWV A;  3L3S A;  2ZL0 A;  1OD4 A;  4F47 A;  4L6W A;  4JYJ A;  3TLF A;  5DUF A;  4ELS A;  2F6Q A;  2VSU F;  3OT6 A;  5KJP A;  3STA A;  3T3W A;  5DTW A;  2DUB A;  1XO6 A;  2J5I I;  3MFM A;  4FN7 A;  4DI1 A;  5DKP A;  4OG1 A;  4K2N A;  1XNW A;  3DJA A;  4QIJ A;  1JXZ A;  5INI A;  5E0S H;  4Q0G A;  2WTB A;  3M6N A;  3ZW9 A;  1WZ8 A;  4EML A;  1ON3 A;  2F9I B;  2EJ5 A;  3PZK A;  5INF A;  3PE8 A;  4FJW D;  1EY3 A;  4JSB A;  4RYF H;  3I47 A;  3U9S B;  1HZD A;  4JCQ A;  4KWB A;  1SG4 A;  4JCS A;  1PJH A;  1EF8 A;  3KQF A;  1VRG A;  4U0G H;  3TV5 A;  3ZW8 A;  4U18 A;  4K29 A;  3H0S A;  1DUB A;  2F9Y A;  4JCR A;  5E0S A;  1SZO A;  5C90 A;  2VSU E;  3K50 A;  4ZDF A;  4JFC A;  3ZWA A;  1MJ3 A;  3QK8 A;  3HP0 A;  4ZDB A;  3TT6 A;  4U0H A;  4GM2 A;  3GMA A;  2VSS A;  4RYF A;  2FZS A;  5E0N X;  4EMM A;  2W3P A;  4MXI A;  4B3H A;  3LKE A;  4NAR A;  3T88 A;  3NJD A;  4IZB A;  5CTB A;  2BZR A;  2ZL2 A;  3TRR A;  4B3J A;  3P2L A;  3ZWC A;  4EMP A;  3IBB A;  3OC7 A;  4ELX A;  3T8A A;  4YLH A;  4L8K A;  3Q0J A;  3M6M A;  3OME A;  1J7X A;  4ZU2 A;  4Q1I A;  5KDR A;  2PBP A;  4K3W A;  3BEZ A;  5C9G A;  3GF3 A;  2F9Y B;  4JJT A;  4J2U A;  3PGQ A;  4U1A A;  3HLN 1;  3MYB A;  2J5I A;  1EF9 A;  2CE3 A;  1UYR A;  5JBX A;  1N6E A;  3QYR A;  4JCT A;  1N6F A;  3QKA A;  1X0U A;  3MT6 A;  2VX2 A;  3DOR A;  3Q0G A;  4ZDE A;  5DU6 A;  2VSS F;  1XNY A;  4Z0M A;  4JVT A;  3Q7H A;  5FUS A;  5MGB A;  3BPT A;  3QRE A;  3GLM A;  3JU1 A;  2X24 A;  1TYF A;  4WZ8 B;  2Q34 A;  4QFE A;  1K32 A;  1FC7 A;  4OLQ A;  4MI2 A;  4I52 A;  5IKL B;  3H81 A;  1XX4 A;  3VIV A;  1PIX A;  1NZY A;  4G2R A;  1HNO A;  1Q51 A;  5KDR B;  2Q2X A;  5DTP A;  1RJN A;  3QMJ A;  3R9S A;  1ON9 A;  5DU4 A;  5G1S A;  3TT7 A;  2J5I B;  2J5G D;  2PPY A;  1RJM A;  3P5M A;  4NNQ A;  2VSS E;  1FCF A;  1UYS A;  1TG6 A;  4FB8 A;  3H0U A;  2CBY A;  5DU8 A;  3KTG A;  2J5G A;  2GTR A;  3TVW A;  4U0G A;  2QQ3 A;  3KTI A;  4FND A;  3V5E A;  3IB9 A;  3IAV A;  1WDL A;  3GF7 A;  1XNV A;  4JYL A;  3RSI A;  2A7S A;  1YG6 A;  3QXI A;  3U9R B;  4IZD A;  3N6R B;  4RCN A;  3HIN A;  1NZY B;  4FNB A;  4ELW A;  1HNU A;  4MOU A;  2C8T A;  2YJG A;  3HE2 A;  4KPK A;  3SLL A;  2VSU C;  3Q1T A;  3R0O A;  3H02 A;  1Q52 A;  3QXZ A;  1UYT A;  4B3I A;  3ST9 A;  1WDM A;  3QWD A;  2A7K A;  4QII A;  2DEO A;  3LAO A;  3BF0 A;  4U19 A;  3TVU A;  1W2X A;  5DL1 A;  3GKB A;  2A81 A;  3TZ3 A;  1N6D A;  1Y7O A;  5ING A;  4I4Z A;  2ZQQ A;  1DCI A;  2PG8 A;  3T8B A;  3FF6 A;  2F6I A;  3H0Q A;  3BPP A;  5G1R A;  2HW5 A;  5JBW A;  3ZWB A;  2ZL3 A;  4ZDD A;  3R9T A;  3K8X A;  4HNK A;  3KTH A;  5FIF A;  1K39 A;  4KNP A;  5CTC A;  4ZDC A;  3R9Q A;  3U9T B;  2Q35 A;  2X58 A;  1OD2 A;  3KTK A;  3WG5 A;  3FDU A;  2ZQR A;  4FZW C;  4I42 A;  3V5I A;  2UZF A;  1UIY A;  3KTJ A;  4HDT A;  3R6H A;  2D3T A;  3H0J A;  4KD6 A;  4JOT A;  2VSU A;  3ISA A;  5HUQ A;  3G64 A;  5DUC A;  4WYO B;  5DZK H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...