1Q51A

Crystal structure of mycobacterium tuberculosis menb in complex with acetoacetyl-coenzyme a, a key enzyme in vitamin k2 biosynthesis
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
271
Chain Sequence
NPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDWSPFPRYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Mycobacterium tuberculosis MenB, a key enzyme in vitamin K2 biosynthesis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
molecule keywords menB
total genus 103
structure length 271
sequence length 297
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2003-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 1q51A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1q51A01
4F47A 1TG6A 4JYJA 4KNPA 1FCFA 1OD4A 2VSUF 3Q0GA 2EJ5A 3QXIA 1X0UA 4JCQA 2QQ3A 3ISAA 3BF0A 3QK8A 5INFA 4GM2A 3ZWCA 2HW5A 5DUFA 4K2NA 3MT6A 1WZ8A 2A81A 3ZWBA 3PZKA 3R6HA 3FF6A 4U0GA 4EMMA 4MOUA 5CTCA 2PPYA 3TLFA 4IZDA 4QIJA 5G1SA 4DI1A 3BEZA 2CE3A 4WZ8B 4ZDDA 3HP0A 3VIVA 3H02A 3GMAA 3SLLA 4G2RA 4JFCA 2VSUE 1NZYB 3GKBA 2DUBA 4U0HA 5DTWA 5DU6A 3P2LA 4RYFH 4ZDBA 3SWXA 2FBMA 1PIXA 1Q52A 3STAA 5DZKH 3WG5A 3RSIA 5CTBA 1WDKA 4NNQA 3NJDA 4JCRA 2VX2A 2VSSE 3HRXA 2VSSA 1UYTA 3KTJA 2VSUA 3LKEA 4ZDEA 5INGA 3OT6A 4FZWA 5INIA 1XNWA 4B3JA 2J5IB 4U1AA 1RJNA 4OMRA 3H81A 3KTGA 4JCSA 1N6EA 2J5GD 4B3HA 1EF8A 3R9QA 4ELXA 1UYSA 3PEAA 4L6WA 4FZWC 3TT7A 2X24A 5JBXA 1DCIA 3IBBA 1VRGA 4I4ZA 2ZL4A 2F9IB 4OG1A 5FIFA 4EMLA 5DL1A 5C90A 1Y7OA 4Q0GA 3MOYA 3T8AA 1JXZA 3QMJA 3T8BA 5FUSA 4JVTA 1YG6A 4JOTA 4KPKA 1DUBA 2VSUC 2Q35A 4ELSA 4Q1IA 2ZQRA 4KWBA 5KDRB 4ZDCA 3KTKA 4JSBA 1RJMA 3HE2A 2DEOA 4KD6A 3R0OA 3H0SA 4LK5A 2D3TA 4I42A 2J5II 3GF3A 4QFEA 3IAVA 4WYOB 3TVWA 1UIYA 1WDMA 5DU4A 4FB8A 3K8XA 3ST9A 5E0SH 3JU1A 1UYRA 4FN7A 4JYLA 3TRRA 3R9SA 5KJPA 5G1RA 4U19A 3P5MA 1TYFA 1EF9A 3I47A 3QXZA 3Q7HA 3K50A 1FC7A 4ZU2A 2F9IA 4QIIA 2IEXA 3Q0JA 3HINA 1K39A 2J5SA 3T89A 3RRVA 4K29A 3L3SA 2A7SA 5E0SA 5KDRA 1OD2A 2ZQQA 2PBPA 4HC8A 1N6FA 4WCZA 1YG8A 1UYVA 4U0GH 3H0QA 3V5IA 4ZDFA 3PE8A 2CBYA 3RSTA 4ASIA 2Q2XA 1PJHA 2ZL0A 3ZW9A 1FC9A 3R9TA 3TV5A 3QYRA 3OMEA 4JCTA 4I52A 4FNBA 2C8TA 5MGBA 3IB9A 3KQFA 3H0UA 5JBWA 2UZFA 4OLQA 1K32A 1Q51A 3NJBA 4B3IA 3BPPA 2W3PA 2J5IA 3MYBA 2NP9A 2F9YA 2F6QA 4MI2A 3KTIA 3DJAA 1HNOA 4GHNA 3N6RB 1HZDA 1N6DA 2J5GA 4FN8A 1ON3A 3M6NA 2FW2A 2F6IA 3G64A 5IKLB 5C9GA 2Q34A 3QREA 4RCNA 4RYFA 1MJ3A 3QWDA 2X58A 1XX4A 3KTHA 4EMPA 3HLN1 4ELWA 5G1QA 3TT6A 3GF7A 1ON9A 1EY3A 3U9RB 3U9TB 3ZW8A 1W2XA 4HNKA 3P85A 4IZCA 2A7KA 2VREA 1XO6A 4U18A 4MXIA 4K3WA 2GTRA 1J7XA 3DORA 5DZKA 3TVUA 3T3WA 4JJTA 3MFMA 1XNVA 5DU8A 3LAOA 4NEKA 5E0NX 3H0JA 1NZYA 1XNYA 4IZBA 3FDUA 4Z0MA 3QKAA 5DUCA 2PG8A 1SG4A 3V5EA 2ZL2A 3U9SB 1FC6A 3T88A 3TZ3A 3ZWAA 1SZOA 1WDLA 3TDCA 1HNUA 5DKPA 5DTPA 1O8UA 2FZSA 3M6MA 4L8KA 2VSSF 3Q1TA 2BZRA 2WTBA 2ZL3A 3GLMA 4FJWD 4JWVA 3OC7A 2F9YB 3PGQA 4FNDA 4YLHA
chains in the Genus database with same CATH superfamily
4F47A 1TG6A 4JYJA 4KNPA 1FCFA 1OD4A 2VSUF 3Q0GA 3RQFA 2EJ5A 3QXIA 1X0UA 4JCQA 2QQ3A 3ISAA 3BF0A 3QK8A 5INFA 4GM2A 3ZWCA 2HW5A 5DUFA 4K2NA 3MT6A 3AJMA 1WZ8A 2A81A 3ZWBA 3PZKA 3R6HA 3FF6A 4U0GA 4EMMA 4MOUA 5CTCA 2PPYA 3TLFA 4IZDA 4QIJA 5G1SA 4DI1A 3BEZA 2CE3A 4WZ8B 4ZDDA 3HP0A 3VIVA 3H02A 3GMAA 3SLLA 4G2RA 4JFCA 3ADCA 2VSUE 1NZYB 3GKBA 2DUBA 4U0HA 5DTWA 5DU6A 3P2LA 4RYFH 4ZDBA 3SWXA 2FBMA 1PIXA 1Q52A 3STAA 5DZKH 3WG5A 3RSIA 4NNQA 1WDKA 5CTBA 3A4MA 3W8IB 3NJDA 4JCRA 2VX2A 3IRBA 3HRXA 2VSSE 2VSSA 1UYTA 3KTJA 2VSUA 3LKEA 4ZDEA 5INGA 3RQGA 3OT6A 4FZWA 5INIA 1XNWA 4B3JA 2J5IB 4U1AA 1RJNA 4OMRA 3H81A 2YJGA 4JCSA 3KTGA 1N6EA 2J5GD 4B3HA 1EF8A 3R9QA 4ELXA 1UYSA 3PEAA 4L6WA 4FZWC 3TT7A 2X24A 5JBXA 3ADDA 1DCIA 3IBBA 1VRGA 4I4ZA 2ZL4A 2F9IB 4OG1A 5FIFA 4EMLA 5DL1A 5C90A 1Y7OA 4Q0GA 3MOYA 3W8HB 3T8AA 3RQEA 3A4LA 1JXZA 3QMJA 3T8BA 5FUSA 4JVTA 1YG6A 4JOTA 4KPKA 1DUBA 2VSUC 2Q35A 4ELSA 4Q1IA 2ZQRA 4KWBA 5KDRB 4ZDCA 3KTKA 4JSBA 1RJMA 3HE2A 2DEOA 4KD6A 1UX5A 3R0OA 3H0SA 4LK5A 2D3TA 4QFEA 4I42A 2J5II 3GF3A 3IAVA 4WYOB 3TVWA 3AM1A 1UIYA 1WDMA 5DU4A 4FB8A 4GEHB 3K8XA 3ST9A 5E0SH 3JU1A 1UYRA 4FN7A 4NARA 4JYLA 3TRRA 3R9SA 5KJPA 5G1RA 4U19A 3P5MA 1TYFA 1EF9A 3I47A 3QXZA 3Q7HA 3K50A 4J2UA 1FC7A 4ZU2A 2F9IA 4QIIA 2IEXA 2P63A 3Q0JA 3HINA 1K39A 2J5SA 3T89A 3RRVA 4K29A 3L3SA 2A7SA 5E0SA 5KDRA 1OD2A 2ZQQA 2PBPA 4HC8A 1N6FA 4WCZA 1YG8A 1UYVA 4U0GH 3H0QA 3V5IA 4ZDFA 3PE8A 2CBYA 3RSTA 2Q2XA 4ASIA 1PJHA 2ZL0A 3ZW9A 1FC9A 3R9TA 3TV5A 3BPTA 3QYRA 3OMEA 4JCTA 4I52A 4FNBA 2C8TA 5MGBA 3IB9A 3KQFA 3H0UA 4HDTA 5JBWA 2UZFA 4OLQA 1K32A 1Q51A 3NJBA 4B3IA 3BPPA 2W3PA 2J5IA 3MYBA 2NP9A 2F9YA 2F6QA 4MI2A 3KTIA 3DJAA 1HNOA 4GHNA 3N6RB 1HZDA 1N6DA 2J5GA 4FN8A 1ON3A 1UX4A 3M6NA 2FW2A 2F6IA 3G64A 5IKLB 5C9GA 2Q34A 3QREA 4RCNA 4RYFA 1MJ3A 1Y64B 3QWDA 2X58A 1XX4A 3KTHA 4EMPA 3HLN1 4ELWA 5G1QA 3TT6A 3GF7A 1ON9A 1EY3A 3U9RB 3U9TB 3ZW8A 1W2XA 4HNKA 3P85A 4IZCA 2A7KA 2VREA 1XO6A 4U18A 4MXIA 4K3WA 2GTRA 1J7XA 3A4NA 3DORA 5DZKA 3TVUA 3T3WA 4JJTA 3MFMA 1XNVA 5DU8A 3LAOA 4NEKA 5E0NX 3H0JA 3ADBA 1NZYA 1XNYA 4IZBA 3FDUA 4Z0MA 3QKAA 5DUCA 2PG8A 1SG4A 3V5EA 2ZL2A 3U9SB 1FC6A 3T88A 3TZ3A 3ZWAA 1SZOA 1WDLA 3TDCA 1HNUA 5DKPA 5DTPA 3L8JA 3L8IA 1O8UA 2FZSA 3M6MA 4L8KA 2VSSF 3Q1TA 2BZRA 2WTBA 2ZL3A 3GLMA 3O4XE 4FJWD 4JWVA 3OC7A 2F9YB 3PGQA 4FNDA 5HUQA 4YLHA
chains in the Genus database with same CATH topology
4F47A 1TG6A 4JYJA 4KNPA 1FCFA 1OD4A 2VSUF 3Q0GA 2EJ5A 3QXIA 1X0UA 4JCQA 2QQ3A 3ISAA 3BF0A 3QK8A 5INFA 4GM2A 3ZWCA 2HW5A 5DUFA 4K2NA 3MT6A 1WZ8A 2A81A 3ZWBA 3PZKA 3R6HA 3FF6A 4U0GA 4EMMA 4MOUA 5CTCA 2PPYA 3TLFA 4IZDA 4QIJA 5G1SA 4DI1A 3BEZA 2CE3A 4WZ8B 4ZDDA 3HP0A 3VIVA 3H02A 3GMAA 3SLLA 4G2RA 4JFCA 2VSUE 1NZYB 3GKBA 2DUBA 4U0HA 5DTWA 5DU6A 3P2LA 4RYFH 4ZDBA 3SWXA 2FBMA 1PIXA 1Q52A 3STAA 5DZKH 3WG5A 3RSIA 5CTBA 1WDKA 4NNQA 3NJDA 4JCRA 2VX2A 2VSSE 3HRXA 2VSSA 1UYTA 3KTJA 2VSUA 3LKEA 4ZDEA 5INGA 3OT6A 4FZWA 5INIA 1XNWA 4B3JA 2J5IB 4U1AA 1RJNA 4OMRA 3H81A 2YJGA 4JCSA 3KTGA 1N6EA 2J5GD 4B3HA 1EF8A 3R9QA 4ELXA 1UYSA 3PEAA 4L6WA 4FZWC 3TT7A 2X24A 5JBXA 1DCIA 3IBBA 1VRGA 4I4ZA 2ZL4A 2F9IB 4OG1A 5FIFA 4EMLA 5DL1A 5C90A 1Y7OA 4Q0GA 3MOYA 3T8AA 1JXZA 3QMJA 3T8BA 5FUSA 4JVTA 1YG6A 4JOTA 4KPKA 1DUBA 2VSUC 2Q35A 4ELSA 4Q1IA 2ZQRA 4KWBA 5KDRB 4ZDCA 3KTKA 4JSBA 1RJMA 3HE2A 2DEOA 4KD6A 3R0OA 3H0SA 4LK5A 2D3TA 4I42A 2J5II 3GF3A 4QFEA 3IAVA 4WYOB 3TVWA 1UIYA 1WDMA 5DU4A 4FB8A 3K8XA 3ST9A 5E0SH 3JU1A 1UYRA 4FN7A 4NARA 4JYLA 3TRRA 3R9SA 5KJPA 5G1RA 4U19A 3P5MA 1TYFA 1EF9A 3I47A 3QXZA 3Q7HA 3K50A 4J2UA 1FC7A 4ZU2A 2F9IA 4QIIA 2IEXA 3Q0JA 3HINA 1K39A 2J5SA 3T89A 3RRVA 4K29A 3L3SA 2A7SA 5E0SA 5KDRA 1OD2A 2ZQQA 2PBPA 4HC8A 1N6FA 4WCZA 1YG8A 1UYVA 4U0GH 3H0QA 3V5IA 4ZDFA 3PE8A 2CBYA 3RSTA 4ASIA 2Q2XA 1PJHA 2ZL0A 3ZW9A 1FC9A 3R9TA 3TV5A 3BPTA 3QYRA 3OMEA 4JCTA 4I52A 4FNBA 2C8TA 5MGBA 3IB9A 3KQFA 3H0UA 4HDTA 5JBWA 2UZFA 4OLQA 1K32A 1Q51A 3NJBA 4B3IA 3BPPA 2W3PA 2J5IA 3MYBA 2NP9A 2F9YA 2F6QA 4MI2A 3KTIA 3DJAA 1HNOA 4GHNA 3N6RB 1HZDA 1N6DA 2J5GA 4FN8A 1ON3A 3M6NA 2FW2A 2F6IA 3G64A 5IKLB 5C9GA 2Q34A 3QREA 4RCNA 4RYFA 1MJ3A 3QWDA 2X58A 1XX4A 3KTHA 4EMPA 3HLN1 4ELWA 5G1QA 3TT6A 3GF7A 1ON9A 1EY3A 3U9RB 3U9TB 3ZW8A 1W2XA 4HNKA 3P85A 4IZCA 2A7KA 2VREA 1XO6A 4U18A 4MXIA 4K3WA 2GTRA 1J7XA 3DORA 5DZKA 3TVUA 3T3WA 4JJTA 3MFMA 1XNVA 5DU8A 3LAOA 4NEKA 5E0NX 3H0JA 1NZYA 1XNYA 4IZBA 3FDUA 4Z0MA 3QKAA 5DUCA 2PG8A 1SG4A 3V5EA 2ZL2A 3U9SB 1FC6A 3T88A 3TZ3A 3ZWAA 1SZOA 1WDLA 3TDCA 1HNUA 5DKPA 5DTPA 1O8UA 2FZSA 3M6MA 4L8KA 2VSSF 3Q1TA 2BZRA 2WTBA 2ZL3A 3GLMA 4FJWD 4JWVA 3OC7A 2F9YB 3PGQA 4FNDA 5HUQA 4YLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F47 A;  1TG6 A;  4JYJ A;  4KNP A;  1FCF A;  1OD4 A;  2VSU F;  3Q0G A;  2EJ5 A;  3QXI A;  1X0U A;  4JCQ A;  2QQ3 A;  3ISA A;  3BF0 A;  3QK8 A;  5INF A;  4GM2 A;  3ZWC A;  2HW5 A;  5DUF A;  4K2N A;  3MT6 A;  1WZ8 A;  2A81 A;  3ZWB A;  3PZK A;  3R6H A;  3FF6 A;  4U0G A;  4EMM A;  4MOU A;  5CTC A;  2PPY A;  3TLF A;  4IZD A;  4QIJ A;  5G1S A;  4DI1 A;  3BEZ A;  2CE3 A;  4WZ8 B;  4ZDD A;  3HP0 A;  3VIV A;  3H02 A;  3GMA A;  3SLL A;  4G2R A;  4JFC A;  2VSU E;  1NZY B;  3GKB A;  2DUB A;  4U0H A;  5DTW A;  5DU6 A;  3P2L A;  4RYF H;  4ZDB A;  3SWX A;  2FBM A;  1PIX A;  1Q52 A;  3STA A;  5DZK H;  3WG5 A;  3RSI A;  5CTB A;  1WDK A;  4NNQ A;  3NJD A;  4JCR A;  2VX2 A;  2VSS E;  3HRX A;  2VSS A;  1UYT A;  3KTJ A;  2VSU A;  3LKE A;  4ZDE A;  5ING A;  3OT6 A;  4FZW A;  5INI A;  1XNW A;  4B3J A;  2J5I B;  4U1A A;  1RJN A;  4OMR A;  3H81 A;  3KTG A;  4JCS A;  1N6E A;  2J5G D;  4B3H A;  1EF8 A;  3R9Q A;  4ELX A;  1UYS A;  3PEA A;  4L6W A;  4FZW C;  3TT7 A;  2X24 A;  5JBX A;  1DCI A;  3IBB A;  1VRG A;  4I4Z A;  2ZL4 A;  2F9I B;  4OG1 A;  5FIF A;  4EML A;  5DL1 A;  5C90 A;  1Y7O A;  4Q0G A;  3MOY A;  3T8A A;  1JXZ A;  3QMJ A;  3T8B A;  5FUS A;  4JVT A;  1YG6 A;  4JOT A;  4KPK A;  1DUB A;  2VSU C;  2Q35 A;  4ELS A;  4Q1I A;  2ZQR A;  4KWB A;  5KDR B;  4ZDC A;  3KTK A;  4JSB A;  1RJM A;  3HE2 A;  2DEO A;  4KD6 A;  3R0O A;  3H0S A;  4LK5 A;  2D3T A;  4I42 A;  2J5I I;  3GF3 A;  4QFE A;  3IAV A;  4WYO B;  3TVW A;  1UIY A;  1WDM A;  5DU4 A;  4FB8 A;  3K8X A;  3ST9 A;  5E0S H;  3JU1 A;  1UYR A;  4FN7 A;  4JYL A;  3TRR A;  3R9S A;  5KJP A;  5G1R A;  4U19 A;  3P5M A;  1TYF A;  1EF9 A;  3I47 A;  3QXZ A;  3Q7H A;  3K50 A;  1FC7 A;  4ZU2 A;  2F9I A;  4QII A;  2IEX A;  3Q0J A;  3HIN A;  1K39 A;  2J5S A;  3T89 A;  3RRV A;  4K29 A;  3L3S A;  2A7S A;  5E0S A;  5KDR A;  1OD2 A;  2ZQQ A;  2PBP A;  4HC8 A;  1N6F A;  4WCZ A;  1YG8 A;  1UYV A;  4U0G H;  3H0Q A;  3V5I A;  4ZDF A;  3PE8 A;  2CBY A;  3RST A;  4ASI A;  2Q2X A;  1PJH A;  2ZL0 A;  3ZW9 A;  1FC9 A;  3R9T A;  3TV5 A;  3QYR A;  3OME A;  4JCT A;  4I52 A;  4FNB A;  2C8T A;  5MGB A;  3IB9 A;  3KQF A;  3H0U A;  5JBW A;  2UZF A;  4OLQ A;  1K32 A;  1Q51 A;  3NJB A;  4B3I A;  3BPP A;  2W3P A;  2J5I A;  3MYB A;  2NP9 A;  2F9Y A;  2F6Q A;  4MI2 A;  3KTI A;  3DJA A;  1HNO A;  4GHN A;  3N6R B;  1HZD A;  1N6D A;  2J5G A;  4FN8 A;  1ON3 A;  3M6N A;  2FW2 A;  2F6I A;  3G64 A;  5IKL B;  5C9G A;  2Q34 A;  3QRE A;  4RCN A;  4RYF A;  1MJ3 A;  3QWD A;  2X58 A;  1XX4 A;  3KTH A;  4EMP A;  3HLN 1;  4ELW A;  5G1Q A;  3TT6 A;  3GF7 A;  1ON9 A;  1EY3 A;  3U9R B;  3U9T B;  3ZW8 A;  1W2X A;  4HNK A;  3P85 A;  4IZC A;  2A7K A;  2VRE A;  1XO6 A;  4U18 A;  4MXI A;  4K3W A;  2GTR A;  1J7X A;  3DOR A;  5DZK A;  3TVU A;  3T3W A;  4JJT A;  3MFM A;  1XNV A;  5DU8 A;  3LAO A;  4NEK A;  5E0N X;  3H0J A;  1NZY A;  1XNY A;  4IZB A;  3FDU A;  4Z0M A;  3QKA A;  5DUC A;  2PG8 A;  1SG4 A;  3V5E A;  2ZL2 A;  3U9S B;  1FC6 A;  3T88 A;  3TZ3 A;  3ZWA A;  1SZO A;  1WDL A;  3TDC A;  1HNU A;  5DKP A;  5DTP A;  1O8U A;  2FZS A;  3M6M A;  4L8K A;  2VSS F;  3Q1T A;  2BZR A;  2WTB A;  2ZL3 A;  3GLM A;  4FJW D;  4JWV A;  3OC7 A;  2F9Y B;  3PGQ A;  4FND A;  4YLH A; 
#chains in the Genus database with same CATH topology
 4F47 A;  1TG6 A;  4JYJ A;  4KNP A;  1FCF A;  1OD4 A;  2VSU F;  3Q0G A;  3RQF A;  2EJ5 A;  3QXI A;  1X0U A;  4JCQ A;  2QQ3 A;  3ISA A;  3BF0 A;  3QK8 A;  5INF A;  4GM2 A;  3ZWC A;  2HW5 A;  5DUF A;  4K2N A;  3MT6 A;  3AJM A;  1WZ8 A;  2A81 A;  3ZWB A;  3PZK A;  3R6H A;  3FF6 A;  4U0G A;  4EMM A;  4MOU A;  5CTC A;  2PPY A;  3TLF A;  4IZD A;  4QIJ A;  5G1S A;  4DI1 A;  3BEZ A;  2CE3 A;  4WZ8 B;  4ZDD A;  3HP0 A;  3VIV A;  3H02 A;  3GMA A;  3SLL A;  4G2R A;  4JFC A;  3ADC A;  2VSU E;  1NZY B;  3GKB A;  2DUB A;  4U0H A;  5DTW A;  5DU6 A;  3P2L A;  4RYF H;  4ZDB A;  3SWX A;  2FBM A;  1PIX A;  1Q52 A;  3STA A;  5DZK H;  3WG5 A;  3RSI A;  4NNQ A;  1WDK A;  5CTB A;  3A4M A;  3W8I B;  3NJD A;  4JCR A;  2VX2 A;  3IRB A;  3HRX A;  2VSS E;  2VSS A;  1UYT A;  3KTJ A;  2VSU A;  3LKE A;  4ZDE A;  5ING A;  3RQG A;  3OT6 A;  4FZW A;  5INI A;  1XNW A;  4B3J A;  2J5I B;  4U1A A;  1RJN A;  4OMR A;  3H81 A;  2YJG A;  4JCS A;  3KTG A;  1N6E A;  2J5G D;  4B3H A;  1EF8 A;  3R9Q A;  4ELX A;  1UYS A;  3PEA A;  4L6W A;  4FZW C;  3TT7 A;  2X24 A;  5JBX A;  3ADD A;  1DCI A;  3IBB A;  1VRG A;  4I4Z A;  2ZL4 A;  2F9I B;  4OG1 A;  5FIF A;  4EML A;  5DL1 A;  5C90 A;  1Y7O A;  4Q0G A;  3MOY A;  3W8H B;  3T8A A;  3RQE A;  3A4L A;  1JXZ A;  3QMJ A;  3T8B A;  5FUS A;  4JVT A;  1YG6 A;  4JOT A;  4KPK A;  1DUB A;  2VSU C;  2Q35 A;  4ELS A;  4Q1I A;  2ZQR A;  4KWB A;  5KDR B;  4ZDC A;  3KTK A;  4JSB A;  1RJM A;  3HE2 A;  2DEO A;  4KD6 A;  1UX5 A;  3R0O A;  3H0S A;  4LK5 A;  2D3T A;  4QFE A;  4I42 A;  2J5I I;  3GF3 A;  3IAV A;  4WYO B;  3TVW A;  3AM1 A;  1UIY A;  1WDM A;  5DU4 A;  4FB8 A;  4GEH B;  3K8X A;  3ST9 A;  5E0S H;  3JU1 A;  1UYR A;  4FN7 A;  4NAR A;  4JYL A;  3TRR A;  3R9S A;  5KJP A;  5G1R A;  4U19 A;  3P5M A;  1TYF A;  1EF9 A;  3I47 A;  3QXZ A;  3Q7H A;  3K50 A;  4J2U A;  1FC7 A;  4ZU2 A;  2F9I A;  4QII A;  2IEX A;  2P63 A;  3Q0J A;  3HIN A;  1K39 A;  2J5S A;  3T89 A;  3RRV A;  4K29 A;  3L3S A;  2A7S A;  5E0S A;  5KDR A;  1OD2 A;  2ZQQ A;  2PBP A;  4HC8 A;  1N6F A;  4WCZ A;  1YG8 A;  1UYV A;  4U0G H;  3H0Q A;  3V5I A;  4ZDF A;  3PE8 A;  2CBY A;  3RST A;  2Q2X A;  4ASI A;  1PJH A;  2ZL0 A;  3ZW9 A;  1FC9 A;  3R9T A;  3TV5 A;  3BPT A;  3QYR A;  3OME A;  4JCT A;  4I52 A;  4FNB A;  2C8T A;  5MGB A;  3IB9 A;  3KQF A;  3H0U A;  4HDT A;  5JBW A;  2UZF A;  4OLQ A;  1K32 A;  1Q51 A;  3NJB A;  4B3I A;  3BPP A;  2W3P A;  2J5I A;  3MYB A;  2NP9 A;  2F9Y A;  2F6Q A;  4MI2 A;  3KTI A;  3DJA A;  1HNO A;  4GHN A;  3N6R B;  1HZD A;  1N6D A;  2J5G A;  4FN8 A;  1ON3 A;  1UX4 A;  3M6N A;  2FW2 A;  2F6I A;  3G64 A;  5IKL B;  5C9G A;  2Q34 A;  3QRE A;  4RCN A;  4RYF A;  1MJ3 A;  1Y64 B;  3QWD A;  2X58 A;  1XX4 A;  3KTH A;  4EMP A;  3HLN 1;  4ELW A;  5G1Q A;  3TT6 A;  3GF7 A;  1ON9 A;  1EY3 A;  3U9R B;  3U9T B;  3ZW8 A;  1W2X A;  4HNK A;  3P85 A;  4IZC A;  2A7K A;  2VRE A;  1XO6 A;  4U18 A;  4MXI A;  4K3W A;  2GTR A;  1J7X A;  3A4N A;  3DOR A;  5DZK A;  3TVU A;  3T3W A;  4JJT A;  3MFM A;  1XNV A;  5DU8 A;  3LAO A;  4NEK A;  5E0N X;  3H0J A;  3ADB A;  1NZY A;  1XNY A;  4IZB A;  3FDU A;  4Z0M A;  3QKA A;  5DUC A;  2PG8 A;  1SG4 A;  3V5E A;  2ZL2 A;  3U9S B;  1FC6 A;  3T88 A;  3TZ3 A;  3ZWA A;  1SZO A;  1WDL A;  3TDC A;  1HNU A;  5DKP A;  5DTP A;  3L8J A;  3L8I A;  1O8U A;  2FZS A;  3M6M A;  4L8K A;  2VSS F;  3Q1T A;  2BZR A;  2WTB A;  2ZL3 A;  3GLM A;  3O4X E;  4FJW D;  4JWV A;  3OC7 A;  2F9Y B;  3PGQ A;  4FND A;  5HUQ A;  4YLH A; 
#chains in the Genus database with same CATH homology
 4F47 A;  1TG6 A;  4JYJ A;  4KNP A;  1FCF A;  1OD4 A;  2VSU F;  3Q0G A;  2EJ5 A;  3QXI A;  1X0U A;  4JCQ A;  2QQ3 A;  3ISA A;  3BF0 A;  3QK8 A;  5INF A;  4GM2 A;  3ZWC A;  2HW5 A;  5DUF A;  4K2N A;  3MT6 A;  1WZ8 A;  2A81 A;  3ZWB A;  3PZK A;  3R6H A;  3FF6 A;  4U0G A;  4EMM A;  4MOU A;  5CTC A;  2PPY A;  3TLF A;  4IZD A;  4QIJ A;  5G1S A;  4DI1 A;  3BEZ A;  2CE3 A;  4WZ8 B;  4ZDD A;  3HP0 A;  3VIV A;  3H02 A;  3GMA A;  3SLL A;  4G2R A;  4JFC A;  2VSU E;  1NZY B;  3GKB A;  2DUB A;  4U0H A;  5DTW A;  5DU6 A;  3P2L A;  4RYF H;  4ZDB A;  3SWX A;  2FBM A;  1PIX A;  1Q52 A;  3STA A;  5DZK H;  3WG5 A;  3RSI A;  5CTB A;  1WDK A;  4NNQ A;  3NJD A;  4JCR A;  2VX2 A;  2VSS E;  3HRX A;  2VSS A;  1UYT A;  3KTJ A;  2VSU A;  3LKE A;  4ZDE A;  5ING A;  3OT6 A;  4FZW A;  5INI A;  1XNW A;  4B3J A;  2J5I B;  4U1A A;  1RJN A;  4OMR A;  3H81 A;  2YJG A;  4JCS A;  3KTG A;  1N6E A;  2J5G D;  4B3H A;  1EF8 A;  3R9Q A;  4ELX A;  1UYS A;  3PEA A;  4L6W A;  4FZW C;  3TT7 A;  2X24 A;  5JBX A;  1DCI A;  3IBB A;  1VRG A;  4I4Z A;  2ZL4 A;  2F9I B;  4OG1 A;  5FIF A;  4EML A;  5DL1 A;  5C90 A;  1Y7O A;  4Q0G A;  3MOY A;  3T8A A;  1JXZ A;  3QMJ A;  3T8B A;  5FUS A;  4JVT A;  1YG6 A;  4JOT A;  4KPK A;  1DUB A;  2VSU C;  2Q35 A;  4ELS A;  4Q1I A;  2ZQR A;  4KWB A;  5KDR B;  4ZDC A;  3KTK A;  4JSB A;  1RJM A;  3HE2 A;  2DEO A;  4KD6 A;  3R0O A;  3H0S A;  4LK5 A;  2D3T A;  4I42 A;  2J5I I;  3GF3 A;  4QFE A;  3IAV A;  4WYO B;  3TVW A;  1UIY A;  1WDM A;  5DU4 A;  4FB8 A;  3K8X A;  3ST9 A;  5E0S H;  3JU1 A;  1UYR A;  4FN7 A;  4NAR A;  4JYL A;  3TRR A;  3R9S A;  5KJP A;  5G1R A;  4U19 A;  3P5M A;  1TYF A;  1EF9 A;  3I47 A;  3QXZ A;  3Q7H A;  3K50 A;  4J2U A;  1FC7 A;  4ZU2 A;  2F9I A;  4QII A;  2IEX A;  3Q0J A;  3HIN A;  1K39 A;  2J5S A;  3T89 A;  3RRV A;  4K29 A;  3L3S A;  2A7S A;  5E0S A;  5KDR A;  1OD2 A;  2ZQQ A;  2PBP A;  4HC8 A;  1N6F A;  4WCZ A;  1YG8 A;  1UYV A;  4U0G H;  3H0Q A;  3V5I A;  4ZDF A;  3PE8 A;  2CBY A;  3RST A;  4ASI A;  2Q2X A;  1PJH A;  2ZL0 A;  3ZW9 A;  1FC9 A;  3R9T A;  3TV5 A;  3BPT A;  3QYR A;  3OME A;  4JCT A;  4I52 A;  4FNB A;  2C8T A;  5MGB A;  3IB9 A;  3KQF A;  3H0U A;  4HDT A;  5JBW A;  2UZF A;  4OLQ A;  1K32 A;  1Q51 A;  3NJB A;  4B3I A;  3BPP A;  2W3P A;  2J5I A;  3MYB A;  2NP9 A;  2F9Y A;  2F6Q A;  4MI2 A;  3KTI A;  3DJA A;  1HNO A;  4GHN A;  3N6R B;  1HZD A;  1N6D A;  2J5G A;  4FN8 A;  1ON3 A;  3M6N A;  2FW2 A;  2F6I A;  3G64 A;  5IKL B;  5C9G A;  2Q34 A;  3QRE A;  4RCN A;  4RYF A;  1MJ3 A;  3QWD A;  2X58 A;  1XX4 A;  3KTH A;  4EMP A;  3HLN 1;  4ELW A;  5G1Q A;  3TT6 A;  3GF7 A;  1ON9 A;  1EY3 A;  3U9R B;  3U9T B;  3ZW8 A;  1W2X A;  4HNK A;  3P85 A;  4IZC A;  2A7K A;  2VRE A;  1XO6 A;  4U18 A;  4MXI A;  4K3W A;  2GTR A;  1J7X A;  3DOR A;  5DZK A;  3TVU A;  3T3W A;  4JJT A;  3MFM A;  1XNV A;  5DU8 A;  3LAO A;  4NEK A;  5E0N X;  3H0J A;  1NZY A;  1XNY A;  4IZB A;  3FDU A;  4Z0M A;  3QKA A;  5DUC A;  2PG8 A;  1SG4 A;  3V5E A;  2ZL2 A;  3U9S B;  1FC6 A;  3T88 A;  3TZ3 A;  3ZWA A;  1SZO A;  1WDL A;  3TDC A;  1HNU A;  5DKP A;  5DTP A;  1O8U A;  2FZS A;  3M6M A;  4L8K A;  2VSS F;  3Q1T A;  2BZR A;  2WTB A;  2ZL3 A;  3GLM A;  4FJW D;  4JWV A;  3OC7 A;  2F9Y B;  3PGQ A;  4FND A;  5HUQ A;  4YLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...