1Q5VA

Apo-nikr
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
132
structure length
115
Chain Sequence
MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQHGTQGFAVLSYVYEHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Nickel-Responsive Transcription Factor NikR
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Nickel responsive regulator
total genus 26
structure length 115
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 1q5vA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 1q5vA02
4D8JA 2AY0A 1BDTA 1PARA 2K6LA 3FMTA 2BJ8A 2BA3A 3LGHA 2BJ9A 2CADA 1X93A 3VEAA 2CAXA 2HZVA 2NZCA 2KELA 2WVCA 2K29A 1MYKA 1BDVA 2JXIA 2F1FA 2PC6A 1MYLA 1Q5YA 3QOQA 1NLAA 3OD2A 2JXGA 3BKUA 3FT7A 1P94A 2K9IA 2BJ1A 2FGCA 2Y3YA 3GXQA 2HZAA 2BSQE 2WVBA 4ME7E 3BKTA 1ARRA 2CAJA 1B28A 4FXEA 3VEBA 3BKFA 2BJ7A 1IRQA 1QTGA 2JXHA 3H87C 2RBFA 2GPEA 2H1OE 1EA4A 1MNTA 2WVDA 2K1OA 2BNZA 1Q5VA 4HV0A 2WVEA 1U9PA 2WVFA 2BJ3A 1B01A 2BNWA 1BAZA 2K5JA 3VW4A 2CPGA 2CA9A 1ARQA 3PHTA 3QSIA
chains in the Genus database with same CATH superfamily
2Y1RI 3I4HX 2OJ3A 1NO8A 3UFCX 4ZIWA 4WYLA 2YPYA 4ZDNA 2L41A 2RQMA 2BJ8A 3BH7B 3FBEA 1YGYA 3ILIA 2ZZTA 3C16A 3DLGB 3CTRA 2VC1A 3PKYA 1WG5A 3IA0A 5IS2A 3Q0AA 3H5SA 1HWLA 2G0CA 5EWGA 3HJFA 3OL6A 1FTCA 2MMYA 1DARA 2P9CA 3PYDA 4K4TA 5DM7Q 6FDRA 4DL5A 4FYWB 4X4SA 1JKHA 4WE1A 2O01C 3PIPQ 3HHLC 1HFEL 1KVKA 2AGOA 3M8YA 1HQEB 3MPUB 4IDKA 4O0NA 3R5BA 4FYVB 1URRA 2GPEA 1S6OA 3MM5B 4DDFA 2KH9A 2IM3A 4K4YA 3G5OA 1KWMA 1QM9A 1S5ZA 1YX2A 3QIPA 1LFPA 2J6SA 4B9TA 4FF1A 5IQ6A 1VQ6S 5FJ4A 2KT3A 4GO7X 3MUTP 3U1NA 3LGHA 3FSXA 1C4AA 4KO0A 2JVRA 4AXIA 4HHUA 3C46A 3EICA 4IO9Q 4LR8A 4A8KA 3J7AN 2B9EA 4TLRA 4ZKAA 2W9BA 5IV4A 4F50A 1NPKA 1VR6A 4ILRA 1Q8BA 1JWWA 5CYQA 1D9AA 1RT5A 2VBWA 4B08A 1GH8A 1FRIA 2RU9A 3I96A 2FUG9 1OYEA 4DS4A 2KHDA 3ENAA 4KC5A 1OY6A 4EU0A 1PYOB 4F26A 2EC0A 2Z2LA 2X1GA 3A3NB 3NNCA 1AUSL 2FJDB 3RUBL 1UAWA 3CDEA 2KXNB 3LP0B 2JEIA 1OG7A 4PCQA 3PR5B 2QIFA 4OHVA 3CCJS 2VBZA 4ED2A 1OHNA 4U9RA 3HVTA 1N36F 4QR2A 2VC0A 2VV5A 1B0TA 4NZ7A 4JI1J 4I2PA 2MSSA 3FRYA 3ZZPA 2AZ3A 2BJEA 4LR7A 5AE3A 1IKXA 1AXQA 2BRKA 3D28A 3A4TA 3KJVA 4C8YA 4PEOA 1MROB 2ZH2A 1P1LA 1GQEA 1I1GA 2AN7A 4Y28C 1D3WA 3SZ2A 2CG8A 4ATNA 3FFIA 3ZXWA 3TJ9A 3P45B 5HL7Q 1NSPA 4F3OA 5SUHA 5F9LA 2AU0A 1YWXA 2YNIA 5IV3A 5C2GA 1I94J 3OUYA 2M52A 1FRJA 4PKDB 4DCJB 4NLUA 2ZDPA 1GXLA 4RUBA 3VEBA 1Q78A 3DN9A 3C16B 3DLGA 3Q8PB 2GQQA 2RBFA 3BDEA 1AFIA 1NB2A 1RTIA 1Q5YA 2HBQB 3CDWA 2W01A 3SQOP 4J9VA 3QJLA 1CG2A 3CD0A 4MTPA 5CZVA 4DV1J 4U8YA 3LAMA 1NK7A 1NJIT 1KLMA 2QL7B 2E7VA 3CIZA 5HMZA 3H25A 2KKEA 3ENVA 2HIQA 4B9MA 4OX7A 1FJGJ 2I6WA 3KYLA 3JYTA 1OJ4A 3RRHA 2RS2A 1DURA 4GO5X 4BWJA 4KYZA 2VJVA 1OS5A 1HMVA 1NLAA 1C0UB 2QMWA 4J9KA 1G3OA 2I9SA 2QRRA 4OYIA 3TZZA 1WHYA 4AQYF 4ZJOA 5C25A 3KMSA 4DFJA 5HANA 4MKBA 4L73A 2KXHA 1RT4B 3UNYA 2B0GA 4QU6A 3RW7A 3FQLA 2FY8A 2YWKA 4FPIA 2OPSB 3ZZUA 1RT2B 4CH0S 1S9EB 3C14B 3K8WA 3THTA 3WC2A 4EEYA 3QAUA 4KH1B 4A8SA 2QEXS 1XR6A 1C0UA 4DPOA 3NP5A 1Z2ZA 3ETMA 1FNMA 1VYAA 2DHAA 4FYYB 3MPYA 4ZVTB 3TI0A 2YWEA 2EFPA 1N5TA 4F36A 2DGXA 2DNOA 2R2RA 1EHWA 2FJVA 2V9KA 4TN2A 4UZCA 2ZHAA 3UI3A 1IBLF 4B3MJ 1CJUA 1LW2B 1TL7A 2ILZA 1RTDB 1XNQJ 4K4UA 3QGHA 4YB5A 2KT2A 3ULHA 4ICLB 2YPZA 2HMIB 3DM2A 2XI2A 2GVZB 4X62F 1F1BB 2Z4PA 4NLOA 1HR0F 2MKKA 1FFGB 4OL8A 3KK3B 4RW4B 2AWZA 1K44A 2QLFB 3BBBA 3LQVA 2W9BB 1EIYB 2H4WB 1RAAB 2IA6A 3J7Z5 2XMKA 4E98A 2VD3A 1PC4A 3FFIB 4X65J 1MN9A 3J7ZT 4DV6F 1V5IB 2HHHJ 3MM8A 4I64A 4Q5VA 1QVFR 2DXDA 3M9OB 2CQ4A 2P2CB 4A4JA 4DV0J 1N33J 4U95A 2BJ9A 2A0FB 2MHEA 2YKPA 1VQOS 1FEHA 2GNKA 3OFHA 1T9VA 3JSMB 2ZH5A 5F8LA 4DL3A 4JI6J 4O4GA 4WXOA 4M95A 2CQ1A 1U1RA 1ZA1B 3QNWB 4CTAB 4F0HA 3CJ2A 1B7YB 4KGVB 5IWAJ 1IM4A 1KNZA 1M1GA 2MQNA 3MCSA 3OSNA 1OWXA 3HZEA 4RKUC 4U67Q 5A2QY 4BBYA 3D0IE 3BS9A 5K14B 1RZMA 1WC4A 5B0CA 4YR2A 3QZ7A 1SXLA 1NJYA 2RUSA 2J9DE 2CNNB 1U1MA 2HNDA 1HA1A 2BJ3A 2W7OA 1U1LA 4PWDA 5KFQA 2AW0A 2XO6A 4JI2J 3QLHB 1U6FA 2CPYA 1VMBA 1WHVA 5D0GA 2FHOB 4NA3A 1ZETA 2HYIB 4HKQA 5HBMA 3T1AA 4C97A 1JJ2R 2CJKA 1YJWS 3DDKA 5D3GA 2PC6A 3NNEA 2QLJB 3H5UA 2JSXA 1VRTA 1XK8A 2XLKA 4A8MP 1CS4A 3FVYA 4WZQA 3F44A 2U1AA 2R7UA 1FFSB 1SL2A 3H4BA 5KT5A 2EK6A 1GMWA 3IAM9 3NCRA 1WDTA 2MPUA 1UPMB 3CCVS 3TAQA 1N32J 1ARRA 2FZKB 2LYVA 4PQAA 3SCKE 1FNOA 3K8VA 5KFUA 4AL5A 2EK1A 4LREA 2ZE2B 4Y0FA 4PQUB 2W7AA 2GCFA 4U7UK 5I4MA 1ZTWA 1RWMB 2CJYB 3C6TB 1XMOJ 1NSAA 8AT1B 1VQ4S 1IQTA 3G8TA 5KOWA 2SXLA 1XR5A 4D8JA 2KL8A 1NJXA 2DISA 4NLRA 5E2QA 2L9DA 4ILLA 1VRQC 4I1TA 4DSKA 4JI4F 1A9NB 3MURP 1F0XA 1O6XA 2J6UA 3FBCA 1S4EA 2ZE2A 2Q1LA 4M5JA 4NEYA 3CJ4A 4V19X 1GEHA 1X4EA 3FC9A 1MMLA 1RYRA 4CI0B 1VIXA 4USHA 4AAIA 3V4MA 3N6LA 1QAXA 2KT5A 4QWBA 2NPFA 3OHAA 3QZ8A 3GFXA 1ULRA 1RTIB 1ZPWX 1X5SA 2CXEA 1H98A 2NYIA 2BANA 2RNEA 2W2OP 4MIBA 4MYUA 5BYRA 2EPIA 9ATCB 1IBLJ 3N79A 3GCWP 3GJRB 2MGZB 3EGZA 4NYOA 3QATA 1FWPA 3BR8A 4DCPB 3OTOF 1YVFA 1G1XA 1M5SA 1FKOB 2QMUB 2WW8A 3KJNB 2QYCA 4C3KA 1S6QA 2GHPA 5IFMA 2YKOA 1FDDA 5FLXY 2AZ1A 3KKFA 1S99A 4Y65A 3I0SA 1LNQA 4N5SA 3CC2S 2V69A 2VFUA 2ZD1A 3FBFA 3DLEA 2I5JB 4DU7A 1SJ3P 2HHVA 2G2ZA 2J9EA 2Y0BB 4C8LA 2LEPA 3FUYA 5F8IA 3MOJB 2B9WA 1IR2A 1EKRA 1TKTB 1DTTA 5DQHA 1M5PC 1RBLA 2B3TB 4ELVA 2LU2A 2MLYA 3VGSA 1I3OB 3Q8YA 4MFBA 1J5EJ 5KT6A 2R42A 3UE2A 3AOAA 3BH6B 4ZPTR 4DI6A 4DR2J 2CAJA 1RU2A 2MKYA 5T7LA 1YZ6A 3TA2A 3V6HA 2FIUA 2BW7A 3M2RA 3QFHA 2BMBA 5L1KA 1IXKA 4NLSA 1RWUA 3OTOJ 3PW2A 4CNYA 1HYSB 3DRXA 3HI9A 1HBMB 1U8WA 1PSDA 3AB4B 2QV6A 3OR2A 1IVZA 3L9ZA 2OEKA 4HACB 2AJQA 4C0BA 4PWWA 1FE4A 4OQJA 2ROEA 2V63A 3EJMA 3GTYX 4MAKA 2CQGA 3TO8A 5C42B 3K5OA 2MYFA 2AHOB 3EGNA 4HYKA 3TUIC 3TUPA 1R27B 4ED7A 3H7HB 4W90B 1GNKA 2H5JB 2W1BA 2VFTA 3JTPA 3OD2A 4ES1A 2PMZD 1JLEA 3LUYA 1GFWB 4M1KA 4DFPA 3NO7A 4AYBD 5DG8A 4HVZA 1S7HA 4YP3A 1R8PA 2BQUA 4NX9A 3HSZA 4R5PA 1NKBA 3IAS9 4K8RA 4MK7A 2VH7A 2PA8D 3KHRA 3HFKA 4H4OB 3TX0A 4F2SA 1FDNA 3H2LA 3CMAS 3IG1B 1ARQA 3AAWB 1NKEA 1BHNA 2W8LA 2A6OA 1NXIA 5CD4H 3NNHA 1UVLA 4DL0C 2HWTA 2M70A 5KFAA 3UR0A 2R7SA 2DHXA 3KK1B 2R7TA 1LQ9A 2PMWA 3TEHB 2MQPA 4TU9A 4GKJF 1P1TA 4IYQA 1JKHB 3RB3A 3UVJA 1S0OA 2R7QA 1FI4A 1SIZA 2QA4S 3FEZA 1W26A 1IBMF 4ERDA 4RLEA 2YWHA 3NEKA 3IP0A 3W2WA 2B6AB 1FD8A 3GV7B 2MXYA 1HPZB 2A1BA 2M88A 2AGQA 2LQBA 2GV1A 3W66A 5D4PA 2J0WA 2HZAA 4ME7E 1DHMA 1OSCA 2BOAA 2XSFA 1JLGB 2Y8YA 3OVSA 4OZ3A 3DOLA 2IM1A 2DCLA 3N28A 4F4XA 2ILYA 1HHTP 4DG1B 2D74B 5D8HB 4URGA 2HFUA 2Q6CA 2W2NP 3N5BA 1P8GA 3HSDA 4IRCA 3CJTA 4ZPCA 5B0AA 3TZYA 5JMNA 1F60B 3FNNA 3QO9A 3WIUA 4ZVPB 2C2KB 1TR0A 3HKWA 1X5TA 2KJWA 1KHWA 3D6MB 1Y5NB 2IAJA 4ZP8A 5KFTA 4D3HA 3M8ZA 5FD1A 3KMQA 4J9MA 4FF3A 1HBNB 1WEYA 3R7BB 4N56A 3AD8C 3MCMA 3CSKA 3BSNA 4Z2XA 1E6YA 1RXOB 2V4JA 3M8PA 5KG2A 4UW2A 2BDPA 1HWUA 1R89A 1RTZA 2ZH6A 3FT7A 2B5JA 4KFBB 1HPZA 5A76A 1RT2A 5ETRA 3MM6A 5ETNA 5KT7A 1F9FA 3KXDA 2P6TA 4KTQA 1EKSA 1QSYA 4DR7J 1IRQA 2ZH9A 2O66A 3FMBA 3OLBA 7FDRA 2K1OA 3IBWA 3H90A 3D9BA 4NZ0A 5AJ3J 2LA4A 3GIRA 3SEOA 2XHWA 1AT1B 2X3DA 3NGUA 1Y4ZB 1DJ0A 3NWGA 4JOUA 3POTA 4Z7CA 3T1YJ 1HBNA 3PDNA 4LUBA 3TQ1A 1HI1A 2F65A 4MIWA 3IBFB 2YVSA 2HZVA 5HLFB 4DU8A 3OV7A 1O0PA 4DR2F 2K7KA 3QO9B 4ZN3A 5DDPC 2ROGA 1S1TA 1HBUB 2E5LJ 2LDYA 2F4VF 2GGPA 2W4PA 3D5MA 3OBIA 3GYXB 4B17A 3I87A 3CCQS 4KV8A 2HK3A 3DRRA 3MMCA 5E3CA 1S1XB 5KFYA 4M5HA 3RW6A 1TL1B 1K1QA 1QSLA 4LFAF 1C0TB 5LJ5Y 1YJVA 1U25A 1ZM9A 3ENWA 5EHHA 2CPHA 1S9GA 4FNHA 3DGVA 1TKZB 3CGIA 3ONQA 4LRAA 2RQ4A 1Y00A 4Y3CA 4HH1A 2VJUA 2R8JA 2YH0A 4S0MA 1IJEB 3M30B 2DXFA 3ADAC 1WDDA 1RP5A 4TQSA 3FSYA 1RT7A 3H8YA 5KT4A 3T3FA 2MZJA 3LANA 1HW9A 5J2QB 1SBRA 1LWXA 1N5YA 4ZIVA 5ETOA 1NPRA 3RYLA 4EYHB 2BM0A 5EDWA 2PEHA 3D68A 3CB4A 2IPOB 3AJDA 2E9TA 5E41A 5D4LA 1FK9B 1U6ZA 3MM7B 3OLAA 2C28A 2BEFA 1ELOA 2IRUA 2HFSA 3DXSX 4B3OA 4X4NA 3BKFA 3VV2B 2QE5A 2AYEA 4P9SA 1A0OB 2H1OE 3M2VA 4JB8B 2J8SA 3AJ1A 3MPDA 2XY5A 3FEXB 4G1QB 3EUNA 1CC7A 2BBEA 2EFNA 1ZA2B 5KG4A 2VG6A 4ZCMA 2CDQA 5A8WB 4YDDB 1B4SA 1N8RT 1NHUA 3H20A 1S76D 3FDSA 2ACMA 4YHHJ 3RAQA 1TKZA 3PY8A 2HLTA 1R43A 1RT1B 1UVKA 3HJVA 4UQTA 5DS7A 1F5AA 1X4AA 2XYHB 3P4UB 2KG0A 1SKWA 2UUCF 1TELA 2GO9A 3KK3A 3A3OB 1HNWJ 2WBRA 4RJVA 5GAHU 3BSOA 3PYEA 5IT0A 1SIWA 2FHKA 4USUA 1D0EA 4F4KA 4OJ3A 2C2OB 3ET6A 2AQ4A 4ZLLA 1S7IA 4UF4A 2VQEF 2AYGA 1G7CB 1S9EA 4OJGA 4M5MA 5J1PA 1WC6A 2AT1B 4DMZA 3AJ2A 4FVMA 2F63A 1V3RA 2XMUA 2CFXA 1UVMA 1Z2LA 2RQCA 3PTWA 4PG7A 1E6VB 4LSLB 3CEDA 2ZJPQ 1FX4A 5KTQA 3AQPA 5J2NB 4QZVB 2V4JB 3M8PB 1UTAA 1Q53A 3GG0A 4Y00A 5K20B 3VAIA 3G86A 2IM2A 2CG4A 2OELA 4OMFG 4DR6F 4C0HA 4F0KA 2LEAA 4ETZA 4J9PA 4DUZF 2ZWPA 1JXVA 2HNYB 2UVRA 3V6DA 1UWBB 1DTQB 1WELA 1DRZA 3W2VA 4K2JA 1T95A 4ED6A 4JV5J 5L8RC 2RRNA 3EZOA 4JI7F 3AXMA 4DL2A 2AEFA 3HHLB 4NLTA 1ZM2A 2PI5A 2DO0A 1R8AA 2XCAA 1DTQA 3ENQA 4I0WA 5KT2A 1YTYA 4LRCA 1VQNS 3KDNA 1LKZA 2VBXA 4UUWA 1R0AB 3PM9A 2HVDA 3BYRA 2DGSA 2N82B 4F8RA 4K50A 2LP4A 2BE9B 2E1RA 3HFZB 1N0UA 3OL8A 2CPDA 4Y6IA 1QD1A 3DOLB 1Y3JA 1PIEA 2RVJA 4JYAJ 3GIJA 4DSLA 2WB4A 1NKCA 3DOKB 2CNLB 2DNYA 2XTJP 4CLLA 1XWLA 3C19A 1M1KT 2QJ3A 1TTHB 3GIIA 1U1QA 4GMKA 3NLCA 2E29A 2MSTA 3AHPA 4ITSA 2B56A 5L39A 2PIIA 3CWJA 2V4RA 3V6JA 2I2YA 2IM0A 4ZCKA 3ZO7A 2FLLA 2RF2A 2E9ZA 2NCKL 4PAAA 3WBZA 3WQPA 2GQCA 4NA1A 2F4FA 1G4CA 2JFKA 1RBAA 3RRGA 5KFOA 2IBKA 4QPTA 4M5LA 3T19A 3KLGB 1GK8A 1UA1A 1U1OA 3VZHA 2YH1A 2K5JA 2QGFB 1SKSA 2C2RA 1R7IA 2XZWA 3DDIA 4P73A 5AE2A 5I3UA 4LF8J 1VBXA 2ZC3A 4TYBA 3QT5A 1ZTTA 1X4CA 2IRXA 1VQYA 2AJFE 3LP0A 2WVCA 2IVMA 4HTIA 4RWXA 5J1NA 4G6VB 2CNOB 5JVHQ 5BJRA 1V3ZA 1SQEA 1TVRB 2KJVA 3FEYB 5THWA 4AL6A 3DRSA 2HHQA 3HSJA 1CC8A 4FDFA 5C24B 1S6PB 1P9QC 1KSPA 4A8FA 3FRZA 4DV3J 2ZBPA 1FHTA 3M4XA 1HNVB 3DRRB 3MDFA 4A8WA 1S1VB 4P7TA 2RD5C 3H59A 3QJPA 4CLPA 2BKOA 2OPPA 2QO3A 3SSSA 1YBTA 4U7CA 2XMTA 2RF2B 4DX7A 5CH7B 4RNNA 2IIHA 3QSIA 1LEOA 3D6HB 1MMNA 2QZ8A 2VFRA 4GC7A 2OKQA 1VQ9S 2VZ9A 4O3NA 5H9FJ 3MPWA 1G2EA 1F2GA 5EN1A 3HMJG 2EW9A 1SJQA 4DPYA 5IT4A 4DSEA 2WW4A 4IUFA 4IDKB 3G87A 2V4QA 3VAJA 3FSIA 2LLZA 4O44A 3MM8B 2HS4A 3CW2C 4HL9A 2V8VA 4IRKA 2RAQA 3IR5B 3NWRA 3MECA 3JSYA 3QGPA 3EE3A 4OJ1A 4P2MA 4OLPA 3C8YA 1B99A 3V81B 1RYSA 1S97A 4WFZA 4JV5F 2DPJA 1AYEA 3EXYA 2OPQA 2Y3YA 3GYGA 4IG0A 1RHJB 2J76E 4HI2A 5T41A 4O23A 2VG5B 1T9YA 3W7BA 3H40A 1VQSA 4ECQA 1HBOA 1FWLA 3R2DJ 2K3IA 2ASLA 4NL5A 3GILA 4OZ5A 2ZITA 2C2ZB 1J2VA 2Z2MA 2MQMA 2HBZB 4EI2A 1S6QB 2C42A 3CPWR 5A6WA 3H4DA 2YX4A 3PX4A 2F8MA 1FRLA 2KO1A 3QQCD 3WC0A 3KLHA 5F8HA 3HHLA 2FJXA 2UXBF 3Q2SC 3I0RB 4ZVOB 3W5XA 1D9DA 5F8NA 2MQ8A 1KP6A 2FZCB 5DDOC 1Z4UA 2C3MA 1VHFA 2QYGA 3QT7A 4ZN1A 1TFYA 3GMGA 5A0YB 4QYZK 1DFDA 2DY9A 2FDNA 1RDRA 4PG8A 1NH8A 2HGMA 4UOGA 3WDOA 2ZH1A 3PW7A 4FPRA 4P71A 1L3UA 2GC8A 2B6AA 5B09A 1EETA 1H6KX 2YNIB 4B02A 2MZ1A 2VQEJ 4PXDA 4ZVUB 3RBEA 3MEGA 5DGBA 3V81A 1UVIA 4LR9A 3PJ9A 2B7BB 4L3NA 4P6QA 4ZK7M 1QLNA 2BJ7A 3Q2TC 4DV7J 4NI2A 1IBKJ 4OX6A 4RX6A 5KG3A 2XY6A 3NMAA 1PKUA 2HNZB 4IQMA 5HVFA 1IN0A 4EO8A 3GONA 4DX5A 1F5BA 2JLGA 2ZJRQ 3OXLA 5IC6B 4XK8C 5KFCA 3V6KA 4PQUA 2HEKA 1XQIA 1NLKL 2M9KA 4KIAA 3JTOA 5CA5A 4YHHF 1DAXA 2HS3A 3CJ3A 4RBTA 3HVTB 4DPUA 2W9AA 3GIKA 3RR8A 1LK5A 4NE9C 1SB6A 1FXRA 5B0FA 1N32F 1DQ9A 1XR7A 4LFCJ 3C3LA 4GVLA 1WD6A 1NK4A 1K73T 4O3PA 2DGVA 3MR2A 1X5PA 5KFIA 3QRPA 4OYOA 4TLQA 4ECSA 4IG3A 1TUWA 1RABB 4LSNA 3J7A1 3HVWA 3WX4A 5ETQA 4BC9A 2HLUA 2MZRA 2VU5A 1FVQA 1S1UA 3UPFA 2V8GA 3L7UA 2HGNA 4WFYA 2AEMA 1RE1B 3OUYB 3MM7A 1OPIA 1ACMB 2B9YA 2I0XA 2K8GA 4C8NA 1S79A 1V9OA 3MECB 4ECVA 3L7PA 1RK8A 4RUCA 4PUOB 1REVA 1TL4A 5E0OA 1RLDA 3RAMA 4CTAA 1RAOA 3NXZA 4YDXA 1FJ7A 3V5RA 1YG0A 3SSRA 5KAKA 2RUGA 1N0VC 2R2UA 1NK0A 2FVPA 1BDVA 2KG1A 4JI6F 2DR9A 1RHMB 3MTKA 3TAMB 4QW8A 4DR5J 4UOHA 5ITHA 5GADU 2QTWA 3HO1A 2OD6A 4PPDA 3K5NA 1S1WA 4X65F 1H38A 3ICLA 4FXWA 1U24A 3B4MA 4LFAJ 2OTLS 3W9IA 2B9XA 1LWEA 4RW7B 1M5KC 4KHPJ 2EVZA 2V8DA 1F5CA 2WOMB 2GHWA 3DLEB 3PRDA 4P2FA 1UW9A 4OI1A 4BC7A 4DL6A 1GXUA 2V0NA 3UCUP 2E5LF 4ICLA 2J0SD 2EFGA 1UJ6A 2ACYA 5KFLA 1C1CA 2RKIA 1BQXA 1CBKA 3A8EA 3I82A 3IS9A 3L7OA 4QJVA 3WZ0A 4J9NA 4O3RA 1S57A 1EQ0A 4K59A 4CO2A 2ZKTA 3LALA 2YNFB 3P8BB 4OZNA 5AJ3F 2RSQA 3SYZA 4B3TJ 5GAHI 3W60A 3NS7B 3J81j 3IGNA 3HPOA 2UUCJ 3BGLA 2YQ3A 3VGTA 4WFBQ 1SJ1A 4RO0A 3DYAB 1UFWA 4R0EA 2VL1A 4HI1A 4XIUA 4D3GA 1NZAA 2ASYA 2BKNA 2AGPA 2DR8A 1LW2A 3IN5A 3K2YA 2D9OA 1N6QB 2UUWA 5ETVA 2ROPA 4KJIA 3W64A 2ADLA 2UZAA 2F3JA 3G82A 2ZUGA 1S0MA 2YKQA 1T03B 1HWJA 4L3KA 1SC1B 2CA9A 2IYIA 5KFPA 4DV4F 8ATCB 4V1Ak 3KLVA 1JB0C 3DMJA 4ZITA 2Z8QA 5E3AA 3NBPB 1XJWB 2B8QA 2VPWB 4LBHA 3FMWA 2RRAA 1UWAA 4IH6A 2DIVA 2HIYA 3BSAA 3O8WA 4I7FB 3UD4P 3NY0A 3CCWA 4Y2MA 1JLAB 1RCXB 4QPXA 3FJ2A 4TQRA 4OX9F 3G9CA 4Y2CA 3CUNA 4N41A 2Z0GA 1UZDA 5AXLA 2ZZMA 3TP2A 3DLLQ 3LGNA 4DQRA 1JXEA 4AFFA 1VBZA 2BOPA 4UOFA 4FXEA 2VG5A 3DC2A 3H2UB 5D3GB 1TP7A 4LRVA 2BUNA 2OPQB 4IG0B 1NSKL 3TX8A 3AD7C 2YWGA 3KFWX 3MEKA 5DQIA 4RBUA 5KG5A 3BN4A 4X2BA 4CT8A 1RWXB 3LPYA 1ITPA 4Q2LA 4CLKA 2DBBA 3CVKA 3EVMA 3UVJB 2Q66A 3CCZA 1LOUA 3JQMA 2XC9A 2XLIA 2J7UA 2OAUA 1TZ0A 4H4MB 4URSA 3TEGA 4R8UA 3UN2A 1U0HB 2F9DA 3DCAA 4H54A 4OHWA 1IBKF 1HBOB 1H7XA 2BABA 4ZVSB 4E2FB 2RDJA 3SI8A 2LKZA 3TR5A 5CYJA 2V34A 3NGDA 2LFVA 4YY3J 2HS0A 5GMDA 2H51B 4B3OB 1H72C 1NMEB 3A8IA 2MQQA 2PFFB 2UP1A 2OUGA 3B82A 1RTJB 2ZUAA 3R5JB 4P7VA 3EVOA 4JUZA 3S01A 4ES2A 3EPGA 2PSZA 4WKYA 3Q24A 2ZZNA 1H2UX 1RTHA 2YNHA 4OHZA 4YUDA 5KFNA 3PO4A 1CULB 3UQSA 1B28A 4ZPBA 3HT0A 3CJSA 5L9XA 1S6UA 2EG1A 1WC1A 1VQ5S 1R31A 2BQRA 2GAGC 1R0BG 2AJ1A 2HZCA 4PZVA 3MEDB 2CPGA 1BD6A 1CJKB 3H98A 4QOTA 3NGSA 1VGYA 4PPZA 4ANCA 3M6UA 2PFDA 3PNIA 1Q1KA 2LQJA 2V94A 3Q89A 4DEZA 5LSOA 5GAEU 1KS2A 3NMRA 5CCLA 4JI3F 1BWVA 1F2HA 1Q16A 1S12A 4U7UD 4FYDA 3QAEA 2WBMA 3NS6A 4USWA 3HFVA 2OH2A 1Q8KA 1AA1B 2HNDB 2HVEA 2Y0SD 1J5EF 4IRDA 1VQLS 1KEKA 2IY5B 2WVBA 1PBUA 2P6SA 1U0SA 4EFAC 4LFBJ 1TL3B 1QSSA 4N77A 4RW9A 4QWCA 2RT3A 3LO3A 1HNXF 1AW0A 4NLYA 4CQ1A 3CO9A 4TYAA 4KB7A 4EBEA 2DHHA 5HATA 2VQFF 2RMLA 1BDTA 3D6TB 4AD6A 3QWPA 4CO0A 3J81U 3NS5A 1PGZA 3N6NA 4K0KF 3CXCR 4M63A 4E8UA 7FD1A 4NCAA 2V2VA 4HLBA 1KOOA 4KGZB 4FS2A 3V4IA 4NXNJ 1FERA 1RU1A 1QDUB 3G2XA 4M5DA 1P9YA 4AXJA 2KRBA 1S9FA 4XAKA 2NXCA 1KONA 3W5ZA 1EP4B 3B78A 2A18A 2HK2A 1HI8A 2BKPA 2ZOFA 4HT5A 5BXIA 2XQCA 4RBVA 4WP9A 4C8OA 1KVIA 5F8MA 1UA0A 2HPUA 1RWNB 2KRRA 5DGAA 4NXMF 4O4RA 2ALZA 2IHR1 3BPSP 3CJ0A 2E1MC 2C2EA 2DNKA 1EARA 2IAJB 5DETA 1DQ8A 4MMOA 2A2DA 3W2VB 4K2XA 1H7WA 2XGQA 2BE2B 3M6WA 3SIPB 4ED4A 1R8BA 1VBYA 2J8AA 2OO4A 3SQGA 2BA3A 5L46A 2KVIA 2C1EB 4MKYA 1H0HB 1GT8A 4FZVA 5KFGA 2CWXA 4IR9A 1U6BA 5E7OB 3ZZOA 2AMCB 4CNZA 4DR5F 2F5GA 2ZJQQ 1SJRA 3IFEA 3J80U 2W2QP 2D41A 4OI3A 2BA9A 3CCES 2YX1A 1OY8A 1UCNA 1VQKS 3G82B 2XLJA 4FF4A 1K8AT 1UETA 2VF3A 1U45A 1JLBB 4MJWA 3CT9A 3JQKA 1M90T 5CAAA 2UVUA 2ZH4A 4OX9J 4DFMA 2XCPA 1X4FA 1U1KA 2E5GA 2QFJA 1LK7A 3JSRA 4LVOP 1D1UA 3X1LB 4DQIA 4QR0A 4P75A 4YR0A 4RW8A 1N34F 1CEZA 1RHQB 1T9UA 2FHJA 1VK3A 2JVOA 4CLTA 5G0RB 2DJWA 2J0XA 2KXFA 2DEJA 3BGOP 3ZTOA 4EBDA 2PO4A 4JI8J 4DV5J 4DUTA 4C2MA 1BUXA 2IMWP 4ALZA 2ADBA 3K5PA 1TAUA 2LCWA 2BE2A 4URQU 4OJHA 5A2QU 1BQNB 2EBEA 2J9CA 4G1PA 1F6TA 2FQQB 3GJQB 1SIWB 1M5OC 1BXNA 5IM0B 1WKJA 2YKNA 4ZPWR 2C3OA 1Q8LA 3I5CA 2DNGA 1X31C 3VF0B 3A12A 3D2WA 1JLGA 4DSJA 1NSQA 5M2PA 2RHQB 3C6UB 1UZHA 1ZM3A 4M5IA 3KTQA 2XMVA 2CWKA 3HT3A 4EWTA 1U9PA 2RKIB 3HDSA 3K58A 3D0HE 2VIHA 4UY8T 4QIEA 4NMLA 3O2IA 2WONA 3CJQA 1VFJA 3IR7A 2OFGX 2VG6B 2XMWA 2YWFA 3M8WA 2GW8A 4O44B 5HK4A 5KFSA 3ZZZA 5HMYA 4DV0F 3DFEA 4J91A 4YR3A 1JJ4A 2DR7A 1FA0A 2MJNA 3FZ2A 3GCXP 4RNHA 2HWIA 1TK5A 2MDAA 2D1CA 1TMMA 3L95X 4NLPA 3MM5A 3SCLE 2F1FA 4GVBA 1LWEB 4RW7A 3R5DA 2XY7A 4NMXA 4XPCA 1JJHA 3R8YA 5DRKA 3AXKA 2WONB 2PI4A 4RL1A 2AD9A 1JX4A 1RTJA 5LT5A 3MWBA 3OXFA 4ECZA 2Z2YB 4F25A 3GP9A 4ED8A 2VUGA 1D8ZA 1UFLA 2DHGA 3QSYB 2D69A 2N3LA 3NOCA 4WTYA 5HI7A 3DRPB 4FKYA 5KFXA 1PCAA 3VHQA 3ZZTA 2GVDB 1SQFA 5ETPA 3VGVA 3J7YI 3R1LA 2ZEJA 4WBFA 3KLEB 4NYZA 4LF6J 2FLOA 1NRKA 2AY0A 4MYTA 2ATCB 2D3ZA 1TL7B 4OI2A 1RTDA 2FZGB 2NREA 2DNZA 1VOMA 4CP5A 3RB4A 1T3OA 2DNNA 1RAIB 1MYKA 1YZ7A 1JLFA 5U47A 2HHWA 3QT8A 4HACA 5HN0A 1R6YA 3CCMS 1X9MA 3QIPB 3MMCB 1RUSA 2CPXA 3DM2B 3M7VA 2ZHOA 2RDDA 3MD1A 3KLGA 5KFBA 2QL9B 2DNRA 1R3NA 3VAHA 4EK2A 5EGYA 4X66F 4A8QA 2UUBJ 3GXQA 2HFOA 3TUZC 4RNOA 1WACA 2J6TA 3Q86A 3RAXA 3CJRA 2WVDA 3OFGA 4HV0A 2PE8A 3HHLD 3G6XA 2MLZA 3DRYA 3OTBA 3QBCA 1SVDA 2ZVIA 2HQ3A 5M2RA 5KFJA 3PX0A 5CXTA 4X4UA 4CCHA 2W2MP 1QUPA 1FESA 3AOCA 4FBTA 1TUVA 2QLXA 4DV3F 3AA8A 3E8OA 4GRSA 3MMAA 3BB5A 3MOZA 4Q8FA 3FCVA 4H4KC 3IWNC 3EXCX 3LA0A 1QY7A 4LMZA 1R0CB 4TKTA 1T3NA 3WHIA 1UJ4A 3MFHA 3BZQA 4ZHRB 1KQFB 5FLXU 5ADZA 2DPIA 3EZ5A 3GR0A 2MTLA 3BPDA 3LWMA 2FLPA 2UXDJ 1ZYQA 2Q79A 1NUEA 2LQ9A 2FJWA 2HQFA 2XMMA 3EWGA 4P72A 5F0UA 3PXGa 3ZNUA 4OV6A 3JYTB 4NXMJ 4K4ZA 1PILA 1QTNB 3GQCA 1WC0A 2HQDA 1FRKA 2D3O1 2HQIA 1OPZA 1RKJA 3D7SB 3RBDA 1UVJA 1RI7A 4IFYB 2CYYA 4OI4A 4OYAA 2GX8A 3QLHA 5H9EJ 1GXTA 1T9TA 1NCLA 2DRBA 3PW5A 5AE1A 3HK2A 1NM2A 2EFOA 2KDOA 2EI5A 2KYZA 4OZ1A 2J7WA 2NZCA 3I32A 5KFEA 2BRLA 3G8QA 2ZBCA 2B4VA 4ZJLA 4CRJA 5F41A 5EWFA 3KJVB 3K5LA 1XIQA 2DYAA 4Y2KA 4DV2F 1E6VA 1XNQF 1X60A 2C2NA 1GTHA 2VQFJ 2ADCA 2AYMA 3TQEA 2Z2ZA 4Y2IA 4XO0A 1JQGA 3P5BP 3W5YA 2MJUA 4DR4F 2BSQE 2M5YA 4AT1B 3QJJA 4GVBB 1SH3A 4NYPA 3UD5A 1SPBP 5GVQA 5JVGQ 4K5RA 3MAQA 4HTJA 2V50A 3G4SS 3SSQA 3R3TA 3VQSA 4EGLA 4TU7A 2WSCC 2QL5B 1RT5B 4M94A 4ELUA 5GAEI 3BQ2A 4CH7A 2R7WA 4P2XA 1MU2B 1TVRA 4PG4A 5GAGI 1Y9OA 3BYPA 4H4KA 4LF4F 1IKWA 4Q8EA 4PYAA 3GFZA 3PW0A 1C1CB 2L08A 3IS9B 4JV2A 3ILLA 2CQPA 2ZOMA 4ZMMA 4X4RA 3IRWP 4O3QA 4G1QA 4CT9A 4FXDA 2OSRA 1S1XA 1SL0A 4OV1A 3BF4A 4V19J 2DHSA 4TVAB 4WWSA 1WOOA 4TU8A 2GQ2A 1IKWB 5I42B 2FD2A 3TJAA 1SQGA 3AODA 4DV2J 4DL7A 5EX0A 4EMDA 4RUHA 2KFYA 2DGUA 3QRRA 4F7VA 4IOCQ 2KU7A 1H3DA 1RAFB 3GIMA 1CJKA 3RG6A 3K5MA 1VBKA 2H3EB 1DLOB 1WORA 2LVWA 4KHRA 4C8MA 3LPEA 3OJUA 5K8OA 2RDIA 3P6YC 4NLWA 1RCOB 1XTZA 3W1YC 2ZD1B 2FVRA 2NPIA 5T7LB 3R9LA 4YOEA 3K57A 3D3CJ 2YNHB 5KFVA 3ZZRA 1J5OB 2HW3A 4RW6A 1KHVA 4QR1A 3JB9k 3MR5A 3I5AA 1TV6B 4QWAA 3BO4A 1L3VA 4RNFA 1RBOB 4ECRA 2HBYB 4CYUA 2MKSA 3U02A 3BDPA 1X9SA 1R8CA 3EDQB 3PR4A 3T9NA 3E2EA 2QLBB 1AB8A 2AJ2A 3T41A 3CMES 5A0YA 1OMSA 1VISA 4FKXA 2BZ2A 2VPXB 1M0SA 2DGTA 3BGFA 4ZJQA 3T5LA 1U4BA 1LWFA 2XEXA 3A8KA 1GMWD 1S48A 3IGVA 3IWLA 4W98A 3M8RA 1PC5A 4B9VA 1KLMB 2XNQA 5GAGU 2DIUA 4W4MA 5B7WA 5EWEA 2OD4A 5D0RA 2IFXA 2Y8WA 2M2BA 3H2VE 4ES3A 1X4BA 3LWLA 4FYXB 2NXJA 4BCAA 5G0RA 2PGCA 3QWUA 5F8JA 2P9EA 2HHPA 3LOUA 2UVVA 4P10A 3AOBA 3GG1A 3U1MA 4F02A 3Q83A 1ZZNA 4JI0J 2P9GA 3VVUA 2P8IA 2ZKUA 3A3PB 4X66J 1CJVA 4C8KA 1KQGB 1M5VC 1XEZA 3MTJA 2JBVA 1FFWB 4R0JA 1ZAVA 5BR8J 1VI7A 2W4DA 2LEBA 2JEJA 3ZTSA 4IR1A 4PWUA 2JWNA 4NRTA 2BX6A 3OR1A 4K4XA 5DLFA 3F56A 1CJTB 3Q8VA 1KFDA 1OQ3A 1Q4RA 2M3DA 1NK6A 2CPIA 4LQ3A 4IQXA 1PJ5A 3OTEA 2QA2A 1JIHA 4OYPA 3RB6A 2YNGA 2OLWA 3CCRS 1C1BA 5JJBA 3GWCA 4KGXB 1B64A 2A10A 1C4CA 3MM9A 1PJ6A 4KRWA 4DR3J 1WHXA 1FX2A 5LSLA 5FDLB 3E51A 3M6VA 5I42A 4UY85 3K0JA 2WK4A 1N6QA 1KOHA 4TY8A 2F4VJ 1RT3B 2G9OA 2RRBA 3ZTPA 2XO7A 2XHCA 1OSDA 3BKUA 3LP1A 4N7TA 1LWCB 1JJCB 3DYAA 3FZBA 2Z56B 4FXVA 3G6VA 1VQ8S 4ZPDA 2Y1IA 2JDJA 2FJAB 3C15B 2JHEA 3LP2B 3N5FA 5HAOA 3ZTRA 3G8SA 4B3TF 3B6BA 2ZH3A 1HD1A 1YJUA 3BO2A 4NEZA 3K89A 3M8QA 1VJWA 3GFYA 2MB0B 1W2IA 4AUKA 1HNWF 2C2MB 2A6MA 2NLWA 5A8KB 2W7PA 4ECYA 1T7PA 1XN9A 4X62J 3J80Y 2WVFA 4RW6B 2DH8A 2LQ5A 4N8OA 4QIGA 1YLXA 4DXLA 3O6QA 2KM8C 1IBCB 1KQSR 1Y5LB 2RIJA 4NCBA 1NDKA 5LOQA 5IT9Y 5J2PB 2E7WA 2XYPB 3CD7A 3MUMP 3O1LA 5J2QA 1HHQA 2W25A 2N7YA 1EX8A 3MCNA 4PG6A 4L76A 3PW4A 4O3OA 1MYLA 3M30A 4C3MA 3WX8A 4DS5A 1HQEA 1FK9A 3D3BJ 4JP8A 2N4CA 5E5NA 3VWSA 3VALA 1BGXT 1WOPA 3HHEA 3CC7S 4C4WA 2V8HA 3SCIE 4CO1A 3DU6A 3PYFA 3KHHA 1S4FA 1V5VA 1YI2S 3KHLA 1REGX 4CM2A 3S6EA 3QFWA 4NXNF 1BY9A 2G13A 5BYSA 4X4TA 1QTMA 2H1YA 2H3AA 1Q5VA 4K4SA 1U0HA 4QYRA 2KZMA 2FC8A 3IRXB 2YX7A 3TOQA 3I0SB 4DOZA 4DPWA 2RJZA 2ZDOA 5CD4A 1S59A 2ZH8A 5F8GA 2JJ4D 2GGPB 2K1RB 3TRGA 5B0BA 3K7RA 3MD3A 2MHNA 2UVWA 4FP9A 4ECWA 2DNQA 2K2PA 3EMTA 4USVA 1S1UB 3UDEA 1IWGA 3IWXA 1OY9A 1MU2A 2L3MA 3AY0A 3CD6S 1Q86T 2BM1A 2HKEA 3QGIA 1BMQB 2M4MA 2R2SA 2V2KA 3QGGA 5LMNF 2FVQA 1TKDA 3FQKA 2DR6A 2OMOA 1HQUA 2VG7B 3D0GE 3IM8A 3KG0A 4KV8B 2M8DB 2JZ5A 4ZVHA 3MXHP 2Q2KA 1NEEA 4CLYA 2IJFA 3QIDA 1YIJS 3HP6A 2I8EA 4ZHRA 3PO5A 2XS5A 4EZ9A 1QE1A 2XBPA 4YB7A 1Q81T 2NS1B 4OZJA 4F4WA 5K8NA 2ZM6J 2BNWA 2GZOA 2CUYA 1NAQA 3D67A 4QBUA 4ZLNA 2KM8B 1FNXH 3JAMU 4CDIA 4WK3A 5LM7E 4P74A 4KPYA 3PJWA 1E6YB 3TWZA 1RB0A 1X0FA 3LF0A 2J5AA 4R8UB 4C11A 1KBRA 1KDNA 1WJ9A 2CJQA 4WCEQ 2UXBJ 2KFZA 4J7CA 1CJVB 4DPTA 5LSRA 1WKLA 1XMQF 4XPEA 4DLGA 2CJBA 2Q43A 2B5JB 5IOLA 1N52B 4DR6J 1UKUA 1PYSB 3ISZA 2GS8A 1R6VA 5KT3A 2IRYA 1Y5IB 2ZVSA 2PDAA 3TVKA 1YRUA 3QT6A 5DQGA 3THVA 3CMQA 3VW4A 3OTCA 1KR4A 2MZTA 3IC1A 2LXIA 2CZ4A 4LF1A 4X4QA 2AF6A 1OQ6A 2GMJA 3O5TB 2NXEA 4JI0F 3FK4A 5E33A 3R5GA 4LF5F 1FCAA 2QSFA 5EUHA 4ANEA 2DRDA 4HT7A 4NA2A 4RPFA 4LF4J 1MROA 2EEYA 5BR8F 2CQ2A 3CO0P 5K8MA 2P5VA 2A2CA 3TUJC 3W65A 1TU0B 4PYDA 4LFBF 1X8DA 2MZSA 3HX9A 1QJHA 3W2WB 1T03A 4K7QA 3DLBA 1VCTA 2HRTA 1HNZF 3RJMB 1T05B 2JEGA 1TAQA 2DNPA 2K3KA 4ID5B 3ETOA 4RZRA 4X4PA 1O8BA 2KYXA 4M5KA 3M9MB 3PG9A 1U2CA 1PJ7A 3T1HF 1ZOTA 3KK2A 2MKJA 5D0HA 4IFVB 4A8OA 4O4GB 4JI5F 1UEVA 1Q95G 1ZAXA 1IKVB 1SUQA 4KGKA 1IKXB 1EQMA 1FJGF 4GKJJ 1H2TZ 2L9WA 5DM6Q 2G0IA 1XNRF 1JLFB 1MLAA 5KG7A 3BQ0A 1EB0A 3Q8UA 4RW9B 4DF8A 2VDHA 4EYIB 4ZP6A 4DLEA 3JSBA 3U7JA 3RBZA 4EBCA 1BLUA 2MEWA 4YS2A 2XZTB 5DLGA 1HHSA 2IDLA 2GVDA 1WF1A 6AT1B 1NNDA 3SFGA 3BR9A 3FGVA 4LT6A 4YB1P 2MKIA 1D8YA 4OLOA 1ZBTA 3MPVA 2DTJA 2Z30B 3LGMA 5K9FA 4C9DA 1VJQA 4IFVA 4BWMA 4WF9Q 1IR0A 2C2DA 1EAYC 1JLQB 5FDLA 1OIAA 2CQBA 4DPXA 1T02A 2JFDA 1Q7YT 3P3DA 1RACB 1B3TA 4EZ6A 2WVEA 2OEJA 1NDPA 2GIQA 2JX2A 4B9LA 4JI1F 4NLVA 2HHTA 2FYXA 1X7VA 1NU4A 1HIYA 2W4CA 3F41A 2OPSA 3I4PA 4ZCIA 3DDNA 4FVCA 1REVB 4J9LA 2EFVA 4TY9A 2QX0A 2ZBQA 4WJBA 4RUAA 5HQ8A 2XG8A 1WG1A 2ALYB 3DNCA 2DRAA 3H0PA 3NCPA 2MZQA 1YSJA 3QPIA 4WTOB 1NB7A 1BC6A 3CJ5A 4KE5A 4JI2F 3FCHA 2BYCA 1K0VA 1BQMA 1KN6A 2F40A 2GFFA 1L5UA 1YJ9S 2HHUA 5HMWA 1NH7A 2QA1A 2GVZA 3EZUA 1HNIB 2R7RA 1Q82T 5KFRA 4CWBA 4DUYF 3MAAA 2DR5A 2HRYA 4GKKJ 2EXUA 1RT6A 3UO0A 1SC4B 4IFYA 1WNEA 3OJSA 5KFDA 2GIRA 2H48B 4G3IA 1TKXA 3FMTA 3LTOA 3R6GB 5D4NA 2CQ0A 2KFNA 1P6TA 1HD0A 3D1QA 2MGZA 4ER8A 4YB6A 1U2FA 2JXIA 2DGWA 2MKHA 1UL3A 1VS3A 2YNGB 4CH1A 2ATLA 2XMJA 2ZWOA 1NJZA 1RHRB 2HHXA 2X1FA 4M5GA 2HGLA 4I4BA 2JL9A 1I6JA 4I6YA 2CQ3A 2VBYA 2ZOGA 1W2BR 4LF9J 2V2QA 1XERA 3DOMA 2DGQA 2RHSB 3OR1B 4TNOA 1RAJA 2R4FA 2NUHA 4NLQA 3V6DB 1YJ7A 3MR7A 2DNHA 3KLIA 1DBDA 1FE0A 1FVSA 1RT4A 2G1DA 4C3LA 1CLFA 2UUTA 4PR6A 4JV0A 4DX6A 2QG9B 4Q44A 1EETB 3GPAA 3CCLS 3E01B 2B4PA 1SC6A 1U1PA 4ZP7A 3TNVA 1NZ8A 5DZ7A 3BGRB 1HQUB 2VG7A 1TMJA 2BV3A 3U1LA 4RR5A 5CABA 4BHQA 2EG2A 2WHOA 3A1YG 3EGWB 3R5AA 3TZWA 3KHGA 1HR0J 4BDPA 4JI4J 3HKZD 1RAHB 3R5CA 3V2UC 2R8HA 1T11A 3NGKA 1T8EA 3Q8RB 5DJBA 4Q7AA 2CPJA 4FF2A 2KB2A 2UV8G 1X9WA 3EVWA 1WSRA 2FGOA 1XMOF 4OI0A 2ZM6F 2ABYA 1LW0A 3H5XA 2CJ9A 1SH0A 4L6V3 4F4YA 3SFUA 1KD1T 2UXDF 4O0IA 2R7VA 1SH2A 1T9XA 4A47A 3MGJA 1Y3KA 3W8PA 5IXUA 4ZPAA 3R6LB 1HI0P 4OYWA 3PFEA 2VKRA 1FJEB 3EX7B 3I6PA 5RUBA 1MNEA 3N4WA 2ZBRA 4LRDA 5AXMA 5IZHA 2OIHA 5LMNJ 1RHUB 3GSDA 2IC3B 1V6HA 4ID8A 2LECA 5AXKA 2DO4A 1U02A 3CF5Q 1KTQA 1WKKA 5DDQC 3PCOB 5LL6d 5C42A 3KLEA 3VAKA 1NJWA 2VOOA 5I3UB 1I5OB 2HFVA 1N48A 4L75A 3JTNA 2XWYA 4Q0BA 1HYSA 3KNGA 3UCZP 4WXWA 2VKZG 3IM9A 3P96A 1IKYA 4WIQA 5ETSA 6FD1A 1X5OA 2V5HG 3HD2A 3OW2R 1DQAA 2O67A 4C98A 4WP8A 1IWAA 2HVZA 3EYZA 1S1WB 4IOBA 2XZDB 1C2PA 1UJ5A 3CCTA 2RB7A 3TARA 2CKWA 3D1OA 4DR1J 2KTQA 2MQOA 3GV8B 4R5PB 5K8PA 1F3FA 2DEIA 2NXUA 2CJXB 2KHCA 3DGPA 3R27A 4K5SA 4EO6A 5HQMA 3K17A 1B0PA 4F04B 1RSCA 2HAIA 2IJNA 3OQ2A 2J9DA 4YQWA 4F67A 1Q79A 2C3YA 5JUMA 3VAGA 4I67A 4DWIA 4YMEA 3R2CJ 1U47A 1U48A 2QMXA 4ECUA 3KDOA 4TY8B 1HBUA 2KVQE 1N33F 2G2OA 1A6LA 4LSZB 2UV8A 4ZVGA 1FKOA 3FBBA 2ZHBA 4QWDA 1I94F 2K7JA 3C6UA 3D66A 4M5NA 4MK9A 3W8GA 1I51B 4A46A 2GAHC 2C3PA 3S8SA 3CDUA 2QLWA 3OFEA 2EC2A 3LP2A 5C2CA 4QIWD 2XYGB 5HVHA 4DQQA 2Y1JA 4Y34A 1QUVA 1FRHA 1RJJA 3AB2B 5IM0A 4IG3B 2YKMA 2F8EX 3M2UB 2DY1A 3I5BA 3KUGA 3D6FB 5A8RA 3CC4S 5J1EA 2CQCA 2HWHA 2KOEA 1CJUB 5D0EA 2G1HA 5I3PA 3OVAA 2X1AA 4MH8A 4PABA 1FXLA 2OFHX 4DR7F 1U26A 2JLEA 2AYBA 3KWMA 3MR6A 3OL9A 1WI8A 4I2QA 1C1BB 3KLFA 4C11B 1FF2A 3HHDA 3RZAA 5KFHA 3VEAA 1S49A 4J90A 3B4DA 4KFBA 4QIVA 5JXSA 3DHXA 3MEEA 1UPPA 2VA3A 3CIMA 1CJTA 1FRXA 5FIIA 4WIIA 4HEA9 1VC0A 4G65A 2G0JA 3W61A 4USTA 1RKIA 2APOA 3KLHB 1SL1A 1MN7A 2DKOB 5LMUF 1QVGR 1N4LA 3QOQA 2M7SA 4KR0B 4A8YA 2NUUG 4Z37A 3W9HA 4OYBA 3PX6A 4F3MA 1K47A 4WU3A 2UUAJ 5A8RB 4YEAA 4LF9F 1Q7LB 2AEJA 1M5HA 4USKA 1HNIA 2G4BA 2N7CA 3JS9A 2XS2A 5H9EK 1R8HA 2BANB 4ZVRB 3I0RA 1BQMB 3HF5A 1K9MT 4DV5F 1KQKA 2ASJA 1TKXB 2DT9A 4WU2A 3GE9A 3W3SA 3ILJA 2BR0A 4NLGA 1WC5A 2CDRB 4GKKF 4DCOB 1H73A 5DDRC 4JYAF 2MQLA 1J5OA 1UEUA 4M5DB 5DG9A 3T5KA 1LWFB 1U7LA 1VQMS 4IKAA 2HHSA 4NASA 4ZVFA 2VPYB 3KK1A 4ED1A 3SDEA 3AQOA 1KC8T 3M2VB 4E0DA 4ZVQB 3DMJB 4DV1F 4ENOA 4HDHA 3KG1A 4WFXA 2PEBA 3CCSS 1SJFA 4NRUA 2UU9J 3NNAA 4LFCF 2V9WA 2BXJA 3BN7A 3JXOA 5HO4A 2X51A 1IBMJ 2NSCA 2DXEA 2BJDA 2WB1D 3IO1A 2ZNZA 3F0NA 3PEJA 1IR1A 3H5YA 3O3LA 4H4OA 4NLDA 2NQPA 5ETLA 3VTIA 1RWOB 2JNJA 3UDLA 4C6AA 2AKWB 2RE1A 1XMBA 1YHQS 4KH0B 1QTGA 2V68A 4JBCA 4WFNQ 3Q22A 4DL4A 4DBQA 1VQ7S 5CHCB 1B01A 3AA9A 4LIRA 2E7XA 4WFAQ 1WEXA 3DLKA 3AFGA 1TFWA 2NSBA 5AXNA 2R8GA 1RWPB 3CDBA 2H65B 3PACA 3SCJE 2KKHA 1MWZA 2AX0A 3D4JA 2YY3A 4AE5A 2CADA 5H1SV 5HP1B 2CVIA 2K1RA 2Y1LB 3IMQJ 3LAKA 3NRBA 4UUXA 3W63A 4DHVA 4UT4A 4F4ZA 5DG7A 4UOCA 4ILMA 4RW4A 4HHJA 3CE8A 3T6JA 3OR2B 1XNRJ 3DU5A 4PWDB 1JLEB 1WF2A 3DRPA 1LFWA 2L48A 4DN0A 3C2PA 2GJIA 2WSEC 1F9EB 4IO1A 2XMAA 1Q16B 4O3SA 3A8JA 1LW0B 2GIFA 3TVZA 3TW0A 5K14A 4JI5J 3KK2B 5D15A 2JH3A 3EGVA 1NK9A 1B70B 2R8IA 3T1HJ 1FXDA 3T5JA 4EUVA 1T05A 3MM9B 5E3PA 5B08A 1ZPVA 2OP5A 1Y10A 3POTB 1KFSA 2OPRB 1VC5A 4RW8B 1IKVA 1SUQB 2VICA 4L72B 4DX8H 4Q0BB 1HWKA 3RBXA 3MF5A 4LF7F 2I1RA 4NOHA 4CLWA 4OZ0A 4X4VA 4NCGB 4QYZJ 4ID5A 1JMTA 4MFBB 4WYWA 3EM1A 2V6AA 3TYTA 5C25B 4OFZA 2HVIA 4KQZA 2N4DA 2M8HA 2K9IA 2HFZA 3PJXA 4DR4J 1XBWA 5LJ3Y 2AP6A 2AIRB 3CJ8A 1FO1A 2W9CA 2DGOA 1SJ4P 4LSNB 2NXNA 3TA0A 1IQZA 5E3QA 5LMUJ 2E44A 2H54B 4DQSA 3VZIA 2BE7D 1YBAA 3PHTA 3PRVA 5EX3A 3AT1B 2QT7A 4UQGA 4J9UE 1BWEA 4F2RA 1KKHA 5C7PA 2XB2D 2JEFA 3MMAB 3OT9A 5IC4B 5HROB 4ZVEA 2BW2A 2VHGA 1YJTA 3NBPA 4Z7YA 4LJMA 1ZM4A 2D3UA 1S0VA 3DI6A 4MT1A 4XDDA 1TUGB 2HAFA 1XMQJ 2VDIA 2VOPA 1P94A 3E01A 2GJ2A 2WTFA 3VAFA 4LRFA 1JLAA 2I38A 3HLUA 2HNYA 2HSEB 2DITA 5HVGA 3BKTA 1H74A 1Q8IA 2IJRA 2D3OR 2QN6B 3MM6B 4FNIA 5HJYA 1KRPA 1EA4A 1MNTA 3IBCB 2NZ4A 2HRUA 2YTCA 4CO3A 1BAZA 1FTRA 2CPFA 2E5HA 1HMVB 2QSWA 3DI6B 7AT1B 1DLOA 3KG4A 1T9WA 2VB6A 3BV8A 3M1VB 4I2PB 1S72S 4ECXA 5HROA 4W92B 3HHNB 3IG1A 2DNMA 2Q3PA 2YNFA 1NPPA 1MW7A 3ITHA 1RWVB 2K29A 1QE1B 3TANA 2JOQA 2UXCF 4HH0A 3SMZA 1N5VA 4Q43A 1WI6A 2B8PA 3R97A 2ASDA 1JK9B 2AX1A 4X64J 1L3SA 4OHYA 2LXFA 3PIOQ 1WTFA 3PYGA 4PG5A 3HSGA 3UN3A 5C5JA 1LV5A 2UUBF 4DV4J 1LXNA 2WSFC 2FHJD 2BVZA 2Z57B 4B3SF 4B3SJ 2XSJB 3J7YU 4ZCLA 4CYUB 3CNQP 2RU3A 1J27A 1X4HA 3UD3P 2LA6A 4DZ6A 4B9UA 3MR3A 4X64F 1D09B 5ETMA 3IR6B 3UN5A 4Q45A 2WAQD 4F4AA 3WIVA 3T5HA 3RR7A 3KNAA 3UNGC 1X4DA 1N5YB 3FCWA 3MEDA 3RU0A 1WF0A 1F9HA 3CJKA 2VONA 2FVSA 2E66A 4B9SA 2R7OA 2KELA 4OZ2A 3GZ7A 4PXBA 2WOMA 4OZLA 4ZOSA 4B3RF 2KI2A 2FHMA 1RWKB 4DUZJ 1IM6A 1RA6A 2XULA 4CLUA 1NHKL 1UMJA 1YQHA 4DV6J 3OXGA 1NDCA 4USJC 1LXJA 2B7CB 2OHDA 1CQMA 2X1BA 1URNA 1TL5A 3MI7X 2OPPB 1MMDA 1GMUA 1WWHA 2DNLA 2JLFA 2RQKA 2ZNYA 1P27B 1YBUA 2BACA 4LVNP 4M8LA 2WRMA 3SBMA 3JSMA 3F73A 3BO3A 1HNVA 4L74A 5L38A 2BNZA 3I55S 4GC6A 3RB0A 3DLHA 3D54A 2GMHA 4X84A 5F3TA 9RUBA 4H4MA 5D6GA 4A48A 3CCUS 2HHHF 1LWCA 3GLJA 3NOGA 2HFNA 3BEGB 3S7RA 1X4GA 3UWTA 3MZIA 1B0VA 3ZTQA 5LXRA 1R0AA 2ZC4A 1WTBA 2YQ0A 3QMQA 2LDIA 1SI9A 3GSIA 5BYQA 1VK8A 2O5DA 4J37A 5AT1B 3X3UA 5HP1A 3M8QB 5L9NA 4DR3F 4OHXA 3I9V9 1GX5A 3ZC4A 1F3VA 4CO5A 3I56S 1TL1A 4OI6A 2HMIA 3M05A 2FC9A 1NDLA 3NKYA 5CZXA 1RWWB 5GMEA 2BJ1A 3C14A 4U6PA 1GTEA 2FJEB 3QYYA 2PD1A 4KKOB 2HQGA 5I3QA 1UP1A 1N54B 4CO4A 3ITHB 4ED0A 2VPZB 2Y9HA 3KLIB 3BREA 3E3XA 1FD2A 3GYNA 4B9NA 3UR3C 1GMVA 1DTTB 1Q0NA 2F8HA 1MG7A 1TKTA 2CPZA 3DOMB 2MY8A 1HARA 2E1PA 4KPCA 3BGRA 3T6BA 5MLCV 4JI8F 1V3SA 1ZAWA 1W7WA 4LSLA 4OX8A 1KTVA 3US5A 3C6TA 2PA3A 4DR1F 2O3DA 1UVNA 4LF7J 1AROP 2DB1A 3LW5C 3HM9A 2E5IA 2F9JA 3AH6A 2FY1A 4R25A 4QU7A 2D9PA 4WP3A 1YDLA 5LXYA 3ZZ0A 2JC0A 2JXGA 1RA7A 4KKOA 4AQYJ 2B43A 1S77D 4OIXA 1EZZB 4DSFA 4RNMA 3M2UA 1O5JA 1FDAA 4PUOA 4ZLPA 2LU1A 2XWXA 3BGUA 2H9ZA 1U09A 4HHHA 4USIA 1SCJB 1N56A 3MMBA 1YJRA 2X3GA 4NZ6A 5KG6A 1SKRA 2L9NA 4MIAA 1ROFA 2VA2A 4Q2MA 1EP4A 1TK8A 2W2PP 2MKCA 3OHBA 2YQ1A 4F3QA 3HCXA 2CJAA 5E3RA 2R8KA 4FS1A 3V4IB 1FWKA 3DKDA 1RHKB 3IRXA 1L3TA 2IDEA 1SV5B 5B0EA 3OFFA 2W9CB 4DV7F 1PAEX 1YK9A 2EKYA 3UW1A 3KJQB 5HSPA 4YY3F 2IMOA 3MEEB 1DZ5A 3M9NB 5GADI 1APSA 3HD1A 5T14A 3LH2S 4CIOA 4LF8F 3B8HA 2EKNA 1JLCA 1FKPB 5CQGA 3N01A 4ZPVR 1AZSB 4N76A 2MLXA 1N36J 5B0GA 1NBEB 4J9RA 3CULA 2J0QD 4FN5A 2XGPA 2EFQA 4IH7A 4MKVA 4XTTA 3I31A 4ELTA 4HR2A 1IKYB 1N5QA 3H42A 2B4OA 2CRLA 2E1AA 3CJKB 4LBIA 3UDVA 1RAEB 1VHIA 5MAOA 2UU9F 1VDHA 4C8ZA 1O51A 4K0KJ 1N5SA 2HBRB 4MKAA 1D9FA 4X4OA 4I6AA 1TK0A 2R7XA 3GV5B 1RT1A 3S1TA 3RGIA 1U49A 3D1HA 1JLQA 1FEEA 1RGVA 1VRUB 2DH7A 3PEHA 1S9GB 3ZZYA 2DCUB 4ZA1A 3OSPA 2YXLA 5KFKA 2NR0A 2B4UA 2V67A 2U2FA 2NYHA 1S1VA 1CSJA 3W62A 3BQ1A 1HNXJ 3GFHA 1JNZB 2OEMA 3C66A 2O1PA 1HBMA 1S6PA 2MY7A 2EWHA 2F7VA 3VR1A 2IBOA 2GJFA 3CD5A 2HG4A 3DRSB 3PVXA 4WPAA 1Y0HA 2R9LA 3P49B 2XI3A 1K1SA 4KT0C 2QFIA 5B0DA 4J9SA 1YKWA 1UEKA 1XC9A 2DVIA 1VRUA 3R7NB 4DSIA 4JI7J 4QCLA 1KVJA 4KAIA 1M1HA 2VODA 4WE1B 4MK8A 4XDCA 4DUYJ 1GAOA 3Q8QB 4NWBA 4PXEA 4ETXA 4J9OA 1FKAF 4JI3J 2H5EA 1HLWA 3DLKB 4YN3B 3SV4A 3TAMA 4Y2AA 3MAHA 4DF4A 1PBAA 3SXLA 3NAIA 2FTRA 2HQCA 1W25A 5DZ6A 4N8NA 3DOKA 4J9QA 3LJPA 3HXMA 2W8KA 5F0WA 1Y7PA 3N9UC 4NLXA 5J2PA 2V8PA 4NI2B 4HDGA 2DK2A 3VQTA 1RTHB 2GHVC 3GB0A 3BJYA 1JXLA 3KUHA 5CCMA 2IC3A 2B51A 2PMHA 4CZCA 3TAPA 3PV8A 1QAIA 1BE4A 3RRKA 5A8KA 5KG0A 1CPZA 2GA7A 2V2ZA 4CLZA 4DZDA 4IOAQ 1PO6A 2OTJS 2C22A 3DLJA 5D78A 3NGRA 1C0TA 1RAGB 2I5JA 3GR1A 3O44A 4RU9A 2IA0A 1T94A 1SV5A 4I56A 3TJ8A 3MUVP 2H5IB 2YKNB 1VC6A 1WEZA 3N6MA 1UFKA 3ZNJ1 1MWQA 4OYZA 2ZH7A 2JC1A 4KY3A 1G6BA 3JAMY 4KHMA 2DH9A 3N0VA 1HW8A 2QC3A 3J81Y 2E1CA 2E9RX 2AJ0A 4KHPF 1WSVA 3NGTA 2K6LA 4I7FA 1NHVA 2RS8A 1RQ0A 2X7IA 5KFMA 4K4VA 3EDRB 3MMBB 1EJ7L 4UTGA 1OO0B 1AFJA 3M1VA 3A13A 2LXUA 2Z58B 1UW4A 3DHWC 3M6XA 3GU0A 4OYMA 3VCDA 5L1IA 5J2NA 5G4DA 2N3OA 1HL6A 5J2MB 3DXBA 5F3ZA 1U1NA 1CVJA 4PXCA 3HVRA 5F9NA 5HQLA 3UDCA 4ED5A 1FT8A 2Q6BA 1RLCL 1WUUA 4TXSA 2IVFB 1YJNS 1JLBA 2WZ1A 3CDAA 3MEGB 1N88A 3NAHA 2XM3A 2ERRA 5J1EB 1RISA 2OMLA 3BM7A 4ANDA 1NK5A 5IT9U 1U2RA 2FVCA 3TA1A 3TVYA 5J2MA 4WZMA 2IVYA 5KOXA 2XS7A 2CQHA 2W24A 1YITS 4DN9A 2COLA 2OGUA 3KUEA 3OPKA 4I2QB 2FJBB 3KLFB 1MSWD 1HNZJ 1X93A 2D7SA 2KN4A 2JRSA 5L1LA 1H2VZ 5KG1A 3G6YA 2BQ3A 1TL3A 2VFVA 4F0MA 1HKAA 2QA4G 3GJSB 2FB0A 2CQDA 3BBFA 1X0PA 3GJTB 1Z1ZA 3NCQA 3PFOA 4DJBA 1L3KA 5GMKa 1WOSA 3MAAB 5K5MA 3M8SA 2UXCJ 5A8WA 4RU2A 1ICEB 4N47A 2UUAF 3L3CA 4UZBA 4LF6F 3KOAA 1QAYA 3NG8A 3PRBA 1VRTB 2CVEA 4IH5A 4KGMA 4LF5J 2AJ4A 5CYQB 1VIOA 3IXQA 3P5TL 3DGPB 4LBPA 5IWAF 3PKMA 1VLYA 5HBMB 1B7FA 3ZFVA 2R3VA 4WKRA 5KFZA 4RWWA 3QRQA 3HULA 4YFUA 2VFSA 3HZGA 3BBCA 3VVTA 4FBUA 4NCGA 4QIFA 2LQ8A 3G71S 2EBGA 2E5JA 1CQNA 5SZTA 2J7KA 1S0NA 4LQ9A 2VASA 2A2BA 4I6WA 1IUJA 2POKA 2OPRA 3OL7A 3M2RB 3G6ES 1YRTA 3ELHA 1VLOA 4P2SA 1PYTA 2HURA 3NL0A 2YKAA 3MMJA 3T1YF 3THPA 4U96A 3IR7B 3VGUA 2CIMA 2ZBIA 1S10A 4G1IA 3I9ZA 2R2TA 2CPEA 4AL7A 1AZSA 3PHEA 3BSCA 1JLCB 1FKPA 3Q8SB 5ETTA 4MJKA 4C7QA 3G96A 5H9FK 3MHYA 2HVHA 1RT7B 3R1HA 1AUDA 2FPHX 4I69A 3SDEB 4CM0A 3PZPA 2K06A 2G2YA 1FRMA 3C15A 5KFWA 4B3MF 5C24A 1HWIA 1PAUB 4B3RJ 1WC3A 1Y11A 3LP1B 3AD9C 3T9ZA 2FLNA 1RT3A 1WHWA 4CLFA 3KJFB 1BQNA 3TZXA 5DO2A 3VAMA 4C0OC 2OSQA 1ZZFA 2XNRA 4KO0B 2CAXA 2CZVC 3U27A 2XSJA 5HLFA 4K4WA 2RH3A 1QAJA 2CNKB 4DFKA 3L09A 4ED3A 1HQ2A 4DQPA 3OVBA 1A7GE 3HVAA 1DY3A 2C3UA 3OTDA 4WK1A 2WCXA 3UCGA 4LIWA 2CZ9A 2RILA 2PT0A 5KFFA 3K59A 2H4YB 3L4BC 5CYMB 2HNZA 5HJXA 2FGCA 1KLNA 1S1TB 3EPIA 1CULA 2CQIA 4LF2A 4OYXA 1MWYA 3H87C 1SKUB 3B54A 3M32B 1JNRB 5ETKA 4CLSA 4ZLJA 2GO8A 1IJFB 2PN6A 3FKBA 1ZS6A 1YRXA 3ISND 1WG4A 2YWWA 4KSEB 4U8VA 3W9JA 4C48A 1N34J 1PARA 2LMIA 4P52A 3R7SB 5D77A 3Q23A 1FDBA 2A3JA 3SV3A 3ISNC 4KBIA 4QQBA 4JV1A 2ZFHA 4I68A 1VQPS 1K0TA 1TQLA 3M32A 4QW9A 4ZP9A 1GX6A 4NPOA 4ECTA 5M2UA 4ZS6A 4BS2A 5HMXA 5CYMA 4QWEA 3RTVA 1U8SA 3ET6B 1RADB 8RUCA 2YKMB 1SC3B 5L1JA 4LRBA 2GMLA 5D4OA 1CS4B 2M0GB 4A8XA 4DG1A 5A6PA 3MCOA 3MFIA 3ILOA 4J5OA 2AV5A 2IYGA 2YBVA 2OI2A 4USMA 1NK8A 2JXHA 3HHKA 1FJCA 1OYDA 4PRFA 1PG5B 3JQJA 3SQGB 2KZZA 4BLGA 1ZH5A 5IQQA 1UWBA 2DD8S 1T0TV 1TV6A 1RT6B
chains in the Genus database with same CATH topology
4D8JA 2AY0A 1BDTA 1PARA 2K6LA 3FMTA 2BJ8A 2BA3A 3LGHA 2BJ9A 2CADA 1X93A 3VEAA 2CAXA 2HZVA 2NZCA 2KELA 2WVCA 2K29A 1MYKA 1BDVA 2JXIA 2F1FA 2PC6A 1MYLA 1Q5YA 3QOQA 1NLAA 3OD2A 2JXGA 3BKUA 3FT7A 1P94A 2K9IA 2BJ1A 2FGCA 2Y3YA 3GXQA 2HZAA 2BSQE 2WVBA 4ME7E 3BKTA 1ARRA 2CAJA 1B28A 4FXEA 3VEBA 3BKFA 2BJ7A 1IRQA 1QTGA 2JXHA 3H87C 2RBFA 2GPEA 2H1OE 1EA4A 1MNTA 2WVDA 2K1OA 2BNZA 1Q5VA 4HV0A 2WVEA 1U9PA 2WVFA 2BJ3A 1B01A 2BNWA 1BAZA 2K5JA 3VW4A 2CPGA 2CA9A 1ARQA 3PHTA 3QSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D8J A;  2AY0 A;  1BDT A;  1PAR A;  2K6L A;  3FMT A;  2BJ8 A;  2BA3 A;  3LGH A;  2BJ9 A;  2CAD A;  1X93 A;  3VEA A;  2CAX A;  2HZV A;  2NZC A;  2KEL A;  2WVC A;  2K29 A;  1MYK A;  1BDV A;  2JXI A;  2F1F A;  2PC6 A;  1MYL A;  1Q5Y A;  3QOQ A;  1NLA A;  3OD2 A;  2JXG A;  3BKU A;  3FT7 A;  1P94 A;  2K9I A;  2BJ1 A;  2FGC A;  2Y3Y A;  3GXQ A;  2HZA A;  2BSQ E;  2WVB A;  4ME7 E;  3BKT A;  1ARR A;  2CAJ A;  1B28 A;  4FXE A;  3VEB A;  3BKF A;  2BJ7 A;  1IRQ A;  1QTG A;  2JXH A;  3H87 C;  2RBF A;  2GPE A;  2H1O E;  1EA4 A;  1MNT A;  2WVD A;  2K1O A;  2BNZ A;  1Q5V A;  4HV0 A;  2WVE A;  1U9P A;  2WVF A;  2BJ3 A;  1B01 A;  2BNW A;  1BAZ A;  2K5J A;  3VW4 A;  2CPG A;  2CA9 A;  1ARQ A;  3PHT A;  3QSI A; 
#chains in the Genus database with same CATH topology
 2Y1R I;  3I4H X;  2OJ3 A;  1NO8 A;  3UFC X;  4ZIW A;  4WYL A;  2YPY A;  4ZDN A;  2L41 A;  2RQM A;  2BJ8 A;  3BH7 B;  3FBE A;  1YGY A;  3ILI A;  2ZZT A;  3C16 A;  3DLG B;  3CTR A;  2VC1 A;  3PKY A;  1WG5 A;  3IA0 A;  5IS2 A;  3Q0A A;  3H5S A;  1HWL A;  2G0C A;  5EWG A;  3HJF A;  3OL6 A;  1FTC A;  2MMY A;  1DAR A;  2P9C A;  3PYD A;  4K4T A;  5DM7 Q;  6FDR A;  4DL5 A;  4FYW B;  4X4S A;  1JKH A;  4WE1 A;  2O01 C;  3PIP Q;  3HHL C;  1HFE L;  1KVK A;  2AGO A;  3M8Y A;  1HQE B;  3MPU B;  4IDK A;  4O0N A;  3R5B A;  4FYV B;  1URR A;  2GPE A;  1S6O A;  3MM5 B;  4DDF A;  2KH9 A;  2IM3 A;  4K4Y A;  3G5O A;  1KWM A;  1QM9 A;  1S5Z A;  1YX2 A;  3QIP A;  1LFP A;  2J6S A;  4B9T A;  4FF1 A;  5IQ6 A;  1VQ6 S;  5FJ4 A;  2KT3 A;  4GO7 X;  3MUT P;  3U1N A;  3LGH A;  3FSX A;  1C4A A;  4KO0 A;  2JVR A;  4AXI A;  4HHU A;  3C46 A;  3EIC A;  4IO9 Q;  4LR8 A;  4A8K A;  3J7A N;  2B9E A;  4TLR A;  4ZKA A;  2W9B A;  5IV4 A;  4F50 A;  1NPK A;  1VR6 A;  4ILR A;  1Q8B A;  1JWW A;  5CYQ A;  1D9A A;  1RT5 A;  2VBW A;  4B08 A;  1GH8 A;  1FRI A;  2RU9 A;  3I96 A;  2FUG 9;  1OYE A;  4DS4 A;  2KHD A;  3ENA A;  4KC5 A;  1OY6 A;  4EU0 A;  1PYO B;  4F26 A;  2EC0 A;  2Z2L A;  2X1G A;  3A3N B;  3NNC A;  1AUS L;  2FJD B;  3RUB L;  1UAW A;  3CDE A;  2KXN B;  3LP0 B;  2JEI A;  1OG7 A;  4PCQ A;  3PR5 B;  2QIF A;  4OHV A;  3CCJ S;  2VBZ A;  4ED2 A;  1OHN A;  4U9R A;  3HVT A;  1N36 F;  4QR2 A;  2VC0 A;  2VV5 A;  1B0T A;  4NZ7 A;  4JI1 J;  4I2P A;  2MSS A;  3FRY A;  3ZZP A;  2AZ3 A;  2BJE A;  4LR7 A;  5AE3 A;  1IKX A;  1AXQ A;  2BRK A;  3D28 A;  3A4T A;  3KJV A;  4C8Y A;  4PEO A;  1MRO B;  2ZH2 A;  1P1L A;  1GQE A;  1I1G A;  2AN7 A;  4Y28 C;  1D3W A;  3SZ2 A;  2CG8 A;  4ATN A;  3FFI A;  3ZXW A;  3TJ9 A;  3P45 B;  5HL7 Q;  1NSP A;  4F3O A;  5SUH A;  5F9L A;  2AU0 A;  1YWX A;  2YNI A;  5IV3 A;  5C2G A;  1I94 J;  3OUY A;  2M52 A;  1FRJ A;  4PKD B;  4DCJ B;  4NLU A;  2ZDP A;  1GXL A;  4RUB A;  3VEB A;  1Q78 A;  3DN9 A;  3C16 B;  3DLG A;  3Q8P B;  2GQQ A;  2RBF A;  3BDE A;  1AFI A;  1NB2 A;  1RTI A;  1Q5Y A;  2HBQ B;  3CDW A;  2W01 A;  3SQO P;  4J9V A;  3QJL A;  1CG2 A;  3CD0 A;  4MTP A;  5CZV A;  4DV1 J;  4U8Y A;  3LAM A;  1NK7 A;  1NJI T;  1KLM A;  2QL7 B;  2E7V A;  3CIZ A;  5HMZ A;  3H25 A;  2KKE A;  3ENV A;  2HIQ A;  4B9M A;  4OX7 A;  1FJG J;  2I6W A;  3KYL A;  3JYT A;  1OJ4 A;  3RRH A;  2RS2 A;  1DUR A;  4GO5 X;  4BWJ A;  4KYZ A;  2VJV A;  1OS5 A;  1HMV A;  1NLA A;  1C0U B;  2QMW A;  4J9K A;  1G3O A;  2I9S A;  2QRR A;  4OYI A;  3TZZ A;  1WHY A;  4AQY F;  4ZJO A;  5C25 A;  3KMS A;  4DFJ A;  5HAN A;  4MKB A;  4L73 A;  2KXH A;  1RT4 B;  3UNY A;  2B0G A;  4QU6 A;  3RW7 A;  3FQL A;  2FY8 A;  2YWK A;  4FPI A;  2OPS B;  3ZZU A;  1RT2 B;  4CH0 S;  1S9E B;  3C14 B;  3K8W A;  3THT A;  3WC2 A;  4EEY A;  3QAU A;  4KH1 B;  4A8S A;  2QEX S;  1XR6 A;  1C0U A;  4DPO A;  3NP5 A;  1Z2Z A;  3ETM A;  1FNM A;  1VYA A;  2DHA A;  4FYY B;  3MPY A;  4ZVT B;  3TI0 A;  2YWE A;  2EFP A;  1N5T A;  4F36 A;  2DGX A;  2DNO A;  2R2R A;  1EHW A;  2FJV A;  2V9K A;  4TN2 A;  4UZC A;  2ZHA A;  3UI3 A;  1IBL F;  4B3M J;  1CJU A;  1LW2 B;  1TL7 A;  2ILZ A;  1RTD B;  1XNQ J;  4K4U A;  3QGH A;  4YB5 A;  2KT2 A;  3ULH A;  4ICL B;  2YPZ A;  2HMI B;  3DM2 A;  2XI2 A;  2GVZ B;  4X62 F;  1F1B B;  2Z4P A;  4NLO A;  1HR0 F;  2MKK A;  1FFG B;  4OL8 A;  3KK3 B;  4RW4 B;  2AWZ A;  1K44 A;  2QLF B;  3BBB A;  3LQV A;  2W9B B;  1EIY B;  2H4W B;  1RAA B;  2IA6 A;  3J7Z 5;  2XMK A;  4E98 A;  2VD3 A;  1PC4 A;  3FFI B;  4X65 J;  1MN9 A;  3J7Z T;  4DV6 F;  1V5I B;  2HHH J;  3MM8 A;  4I64 A;  4Q5V A;  1QVF R;  2DXD A;  3M9O B;  2CQ4 A;  2P2C B;  4A4J A;  4DV0 J;  1N33 J;  4U95 A;  2BJ9 A;  2A0F B;  2MHE A;  2YKP A;  1VQO S;  1FEH A;  2GNK A;  3OFH A;  1T9V A;  3JSM B;  2ZH5 A;  5F8L A;  4DL3 A;  4JI6 J;  4O4G A;  4WXO A;  4M95 A;  2CQ1 A;  1U1R A;  1ZA1 B;  3QNW B;  4CTA B;  4F0H A;  3CJ2 A;  1B7Y B;  4KGV B;  5IWA J;  1IM4 A;  1KNZ A;  1M1G A;  2MQN A;  3MCS A;  3OSN A;  1OWX A;  3HZE A;  4RKU C;  4U67 Q;  5A2Q Y;  4BBY A;  3D0I E;  3BS9 A;  5K14 B;  1RZM A;  1WC4 A;  5B0C A;  4YR2 A;  3QZ7 A;  1SXL A;  1NJY A;  2RUS A;  2J9D E;  2CNN B;  1U1M A;  2HND A;  1HA1 A;  2BJ3 A;  2W7O A;  1U1L A;  4PWD A;  5KFQ A;  2AW0 A;  2XO6 A;  4JI2 J;  3QLH B;  1U6F A;  2CPY A;  1VMB A;  1WHV A;  5D0G A;  2FHO B;  4NA3 A;  1ZET A;  2HYI B;  4HKQ A;  5HBM A;  3T1A A;  4C97 A;  1JJ2 R;  2CJK A;  1YJW S;  3DDK A;  5D3G A;  2PC6 A;  3NNE A;  2QLJ B;  3H5U A;  2JSX A;  1VRT A;  1XK8 A;  2XLK A;  4A8M P;  1CS4 A;  3FVY A;  4WZQ A;  3F44 A;  2U1A A;  2R7U A;  1FFS B;  1SL2 A;  3H4B A;  5KT5 A;  2EK6 A;  1GMW A;  3IAM 9;  3NCR A;  1WDT A;  2MPU A;  1UPM B;  3CCV S;  3TAQ A;  1N32 J;  1ARR A;  2FZK B;  2LYV A;  4PQA A;  3SCK E;  1FNO A;  3K8V A;  5KFU A;  4AL5 A;  2EK1 A;  4LRE A;  2ZE2 B;  4Y0F A;  4PQU B;  2W7A A;  2GCF A;  4U7U K;  5I4M A;  1ZTW A;  1RWM B;  2CJY B;  3C6T B;  1XMO J;  1NSA A;  8AT1 B;  1VQ4 S;  1IQT A;  3G8T A;  5KOW A;  2SXL A;  1XR5 A;  4D8J A;  2KL8 A;  1NJX A;  2DIS A;  4NLR A;  5E2Q A;  2L9D A;  4ILL A;  1VRQ C;  4I1T A;  4DSK A;  4JI4 F;  1A9N B;  3MUR P;  1F0X A;  1O6X A;  2J6U A;  3FBC A;  1S4E A;  2ZE2 A;  2Q1L A;  4M5J A;  4NEY A;  3CJ4 A;  4V19 X;  1GEH A;  1X4E A;  3FC9 A;  1MML A;  1RYR A;  4CI0 B;  1VIX A;  4USH A;  4AAI A;  3V4M A;  3N6L A;  1QAX A;  2KT5 A;  4QWB A;  2NPF A;  3OHA A;  3QZ8 A;  3GFX A;  1ULR A;  1RTI B;  1ZPW X;  1X5S A;  2CXE A;  1H98 A;  2NYI A;  2BAN A;  2RNE A;  2W2O P;  4MIB A;  4MYU A;  5BYR A;  2EPI A;  9ATC B;  1IBL J;  3N79 A;  3GCW P;  3GJR B;  2MGZ B;  3EGZ A;  4NYO A;  3QAT A;  1FWP A;  3BR8 A;  4DCP B;  3OTO F;  1YVF A;  1G1X A;  1M5S A;  1FKO B;  2QMU B;  2WW8 A;  3KJN B;  2QYC A;  4C3K A;  1S6Q A;  2GHP A;  5IFM A;  2YKO A;  1FDD A;  5FLX Y;  2AZ1 A;  3KKF A;  1S99 A;  4Y65 A;  3I0S A;  1LNQ A;  4N5S A;  3CC2 S;  2V69 A;  2VFU A;  2ZD1 A;  3FBF A;  3DLE A;  2I5J B;  4DU7 A;  1SJ3 P;  2HHV A;  2G2Z A;  2J9E A;  2Y0B B;  4C8L A;  2LEP A;  3FUY A;  5F8I A;  3MOJ B;  2B9W A;  1IR2 A;  1EKR A;  1TKT B;  1DTT A;  5DQH A;  1M5P C;  1RBL A;  2B3T B;  4ELV A;  2LU2 A;  2MLY A;  3VGS A;  1I3O B;  3Q8Y A;  4MFB A;  1J5E J;  5KT6 A;  2R42 A;  3UE2 A;  3AOA A;  3BH6 B;  4ZPT R;  4DI6 A;  4DR2 J;  2CAJ A;  1RU2 A;  2MKY A;  5T7L A;  1YZ6 A;  3TA2 A;  3V6H A;  2FIU A;  2BW7 A;  3M2R A;  3QFH A;  2BMB A;  5L1K A;  1IXK A;  4NLS A;  1RWU A;  3OTO J;  3PW2 A;  4CNY A;  1HYS B;  3DRX A;  3HI9 A;  1HBM B;  1U8W A;  1PSD A;  3AB4 B;  2QV6 A;  3OR2 A;  1IVZ A;  3L9Z A;  2OEK A;  4HAC B;  2AJQ A;  4C0B A;  4PWW A;  1FE4 A;  4OQJ A;  2ROE A;  2V63 A;  3EJM A;  3GTY X;  4MAK A;  2CQG A;  3TO8 A;  5C42 B;  3K5O A;  2MYF A;  2AHO B;  3EGN A;  4HYK A;  3TUI C;  3TUP A;  1R27 B;  4ED7 A;  3H7H B;  4W90 B;  1GNK A;  2H5J B;  2W1B A;  2VFT A;  3JTP A;  3OD2 A;  4ES1 A;  2PMZ D;  1JLE A;  3LUY A;  1GFW B;  4M1K A;  4DFP A;  3NO7 A;  4AYB D;  5DG8 A;  4HVZ A;  1S7H A;  4YP3 A;  1R8P A;  2BQU A;  4NX9 A;  3HSZ A;  4R5P A;  1NKB A;  3IAS 9;  4K8R A;  4MK7 A;  2VH7 A;  2PA8 D;  3KHR A;  3HFK A;  4H4O B;  3TX0 A;  4F2S A;  1FDN A;  3H2L A;  3CMA S;  3IG1 B;  1ARQ A;  3AAW B;  1NKE A;  1BHN A;  2W8L A;  2A6O A;  1NXI A;  5CD4 H;  3NNH A;  1UVL A;  4DL0 C;  2HWT A;  2M70 A;  5KFA A;  3UR0 A;  2R7S A;  2DHX A;  3KK1 B;  2R7T A;  1LQ9 A;  2PMW A;  3TEH B;  2MQP A;  4TU9 A;  4GKJ F;  1P1T A;  4IYQ A;  1JKH B;  3RB3 A;  3UVJ A;  1S0O A;  2R7Q A;  1FI4 A;  1SIZ A;  2QA4 S;  3FEZ A;  1W26 A;  1IBM F;  4ERD A;  4RLE A;  2YWH A;  3NEK A;  3IP0 A;  3W2W A;  2B6A B;  1FD8 A;  3GV7 B;  2MXY A;  1HPZ B;  2A1B A;  2M88 A;  2AGQ A;  2LQB A;  2GV1 A;  3W66 A;  5D4P A;  2J0W A;  2HZA A;  4ME7 E;  1DHM A;  1OSC A;  2BOA A;  2XSF A;  1JLG B;  2Y8Y A;  3OVS A;  4OZ3 A;  3DOL A;  2IM1 A;  2DCL A;  3N28 A;  4F4X A;  2ILY A;  1HHT P;  4DG1 B;  2D74 B;  5D8H B;  4URG A;  2HFU A;  2Q6C A;  2W2N P;  3N5B A;  1P8G A;  3HSD A;  4IRC A;  3CJT A;  4ZPC A;  5B0A A;  3TZY A;  5JMN A;  1F60 B;  3FNN A;  3QO9 A;  3WIU A;  4ZVP B;  2C2K B;  1TR0 A;  3HKW A;  1X5T A;  2KJW A;  1KHW A;  3D6M B;  1Y5N B;  2IAJ A;  4ZP8 A;  5KFT A;  4D3H A;  3M8Z A;  5FD1 A;  3KMQ A;  4J9M A;  4FF3 A;  1HBN B;  1WEY A;  3R7B B;  4N56 A;  3AD8 C;  3MCM A;  3CSK A;  3BSN A;  4Z2X A;  1E6Y A;  1RXO B;  2V4J A;  3M8P A;  5KG2 A;  4UW2 A;  2BDP A;  1HWU A;  1R89 A;  1RTZ A;  2ZH6 A;  3FT7 A;  2B5J A;  4KFB B;  1HPZ A;  5A76 A;  1RT2 A;  5ETR A;  3MM6 A;  5ETN A;  5KT7 A;  1F9F A;  3KXD A;  2P6T A;  4KTQ A;  1EKS A;  1QSY A;  4DR7 J;  1IRQ A;  2ZH9 A;  2O66 A;  3FMB A;  3OLB A;  7FDR A;  2K1O A;  3IBW A;  3H90 A;  3D9B A;  4NZ0 A;  5AJ3 J;  2LA4 A;  3GIR A;  3SEO A;  2XHW A;  1AT1 B;  2X3D A;  3NGU A;  1Y4Z B;  1DJ0 A;  3NWG A;  4JOU A;  3POT A;  4Z7C A;  3T1Y J;  1HBN A;  3PDN A;  4LUB A;  3TQ1 A;  1HI1 A;  2F65 A;  4MIW A;  3IBF B;  2YVS A;  2HZV A;  5HLF B;  4DU8 A;  3OV7 A;  1O0P A;  4DR2 F;  2K7K A;  3QO9 B;  4ZN3 A;  5DDP C;  2ROG A;  1S1T A;  1HBU B;  2E5L J;  2LDY A;  2F4V F;  2GGP A;  2W4P A;  3D5M A;  3OBI A;  3GYX B;  4B17 A;  3I87 A;  3CCQ S;  4KV8 A;  2HK3 A;  3DRR A;  3MMC A;  5E3C A;  1S1X B;  5KFY A;  4M5H A;  3RW6 A;  1TL1 B;  1K1Q A;  1QSL A;  4LFA F;  1C0T B;  5LJ5 Y;  1YJV A;  1U25 A;  1ZM9 A;  3ENW A;  5EHH A;  2CPH A;  1S9G A;  4FNH A;  3DGV A;  1TKZ B;  3CGI A;  3ONQ A;  4LRA A;  2RQ4 A;  1Y00 A;  4Y3C A;  4HH1 A;  2VJU A;  2R8J A;  2YH0 A;  4S0M A;  1IJE B;  3M30 B;  2DXF A;  3ADA C;  1WDD A;  1RP5 A;  4TQS A;  3FSY A;  1RT7 A;  3H8Y A;  5KT4 A;  3T3F A;  2MZJ A;  3LAN A;  1HW9 A;  5J2Q B;  1SBR A;  1LWX A;  1N5Y A;  4ZIV A;  5ETO A;  1NPR A;  3RYL A;  4EYH B;  2BM0 A;  5EDW A;  2PEH A;  3D68 A;  3CB4 A;  2IPO B;  3AJD A;  2E9T A;  5E41 A;  5D4L A;  1FK9 B;  1U6Z A;  3MM7 B;  3OLA A;  2C28 A;  2BEF A;  1ELO A;  2IRU A;  2HFS A;  3DXS X;  4B3O A;  4X4N A;  3BKF A;  3VV2 B;  2QE5 A;  2AYE A;  4P9S A;  1A0O B;  2H1O E;  3M2V A;  4JB8 B;  2J8S A;  3AJ1 A;  3MPD A;  2XY5 A;  3FEX B;  4G1Q B;  3EUN A;  1CC7 A;  2BBE A;  2EFN A;  1ZA2 B;  5KG4 A;  2VG6 A;  4ZCM A;  2CDQ A;  5A8W B;  4YDD B;  1B4S A;  1N8R T;  1NHU A;  3H20 A;  1S76 D;  3FDS A;  2ACM A;  4YHH J;  3RAQ A;  1TKZ A;  3PY8 A;  2HLT A;  1R43 A;  1RT1 B;  1UVK A;  3HJV A;  4UQT A;  5DS7 A;  1F5A A;  1X4A A;  2XYH B;  3P4U B;  2KG0 A;  1SKW A;  2UUC F;  1TEL A;  2GO9 A;  3KK3 A;  3A3O B;  1HNW J;  2WBR A;  4RJV A;  5GAH U;  3BSO A;  3PYE A;  5IT0 A;  1SIW A;  2FHK A;  4USU A;  1D0E A;  4F4K A;  4OJ3 A;  2C2O B;  3ET6 A;  2AQ4 A;  4ZLL A;  1S7I A;  4UF4 A;  2VQE F;  2AYG A;  1G7C B;  1S9E A;  4OJG A;  4M5M A;  5J1P A;  1WC6 A;  2AT1 B;  4DMZ A;  3AJ2 A;  4FVM A;  2F63 A;  1V3R A;  2XMU A;  2CFX A;  1UVM A;  1Z2L A;  2RQC A;  3PTW A;  4PG7 A;  1E6V B;  4LSL B;  3CED A;  2ZJP Q;  1FX4 A;  5KTQ A;  3AQP A;  5J2N B;  4QZV B;  2V4J B;  3M8P B;  1UTA A;  1Q53 A;  3GG0 A;  4Y00 A;  5K20 B;  3VAI A;  3G86 A;  2IM2 A;  2CG4 A;  2OEL A;  4OMF G;  4DR6 F;  4C0H A;  4F0K A;  2LEA A;  4ETZ A;  4J9P A;  4DUZ F;  2ZWP A;  1JXV A;  2HNY B;  2UVR A;  3V6D A;  1UWB B;  1DTQ B;  1WEL A;  1DRZ A;  3W2V A;  4K2J A;  1T95 A;  4ED6 A;  4JV5 J;  5L8R C;  2RRN A;  3EZO A;  4JI7 F;  3AXM A;  4DL2 A;  2AEF A;  3HHL B;  4NLT A;  1ZM2 A;  2PI5 A;  2DO0 A;  1R8A A;  2XCA A;  1DTQ A;  3ENQ A;  4I0W A;  5KT2 A;  1YTY A;  4LRC A;  1VQN S;  3KDN A;  1LKZ A;  2VBX A;  4UUW A;  1R0A B;  3PM9 A;  2HVD A;  3BYR A;  2DGS A;  2N82 B;  4F8R A;  4K50 A;  2LP4 A;  2BE9 B;  2E1R A;  3HFZ B;  1N0U A;  3OL8 A;  2CPD A;  4Y6I A;  1QD1 A;  3DOL B;  1Y3J A;  1PIE A;  2RVJ A;  4JYA J;  3GIJ A;  4DSL A;  2WB4 A;  1NKC A;  3DOK B;  2CNL B;  2DNY A;  2XTJ P;  4CLL A;  1XWL A;  3C19 A;  1M1K T;  2QJ3 A;  1TTH B;  3GII A;  1U1Q A;  4GMK A;  3NLC A;  2E29 A;  2MST A;  3AHP A;  4ITS A;  2B56 A;  5L39 A;  2PII A;  3CWJ A;  2V4R A;  3V6J A;  2I2Y A;  2IM0 A;  4ZCK A;  3ZO7 A;  2FLL A;  2RF2 A;  2E9Z A;  2NCK L;  4PAA A;  3WBZ A;  3WQP A;  2GQC A;  4NA1 A;  2F4F A;  1G4C A;  2JFK A;  1RBA A;  3RRG A;  5KFO A;  2IBK A;  4QPT A;  4M5L A;  3T19 A;  3KLG B;  1GK8 A;  1UA1 A;  1U1O A;  3VZH A;  2YH1 A;  2K5J A;  2QGF B;  1SKS A;  2C2R A;  1R7I A;  2XZW A;  3DDI A;  4P73 A;  5AE2 A;  5I3U A;  4LF8 J;  1VBX A;  2ZC3 A;  4TYB A;  3QT5 A;  1ZTT A;  1X4C A;  2IRX A;  1VQY A;  2AJF E;  3LP0 A;  2WVC A;  2IVM A;  4HTI A;  4RWX A;  5J1N A;  4G6V B;  2CNO B;  5JVH Q;  5BJR A;  1V3Z A;  1SQE A;  1TVR B;  2KJV A;  3FEY B;  5THW A;  4AL6 A;  3DRS A;  2HHQ A;  3HSJ A;  1CC8 A;  4FDF A;  5C24 B;  1S6P B;  1P9Q C;  1KSP A;  4A8F A;  3FRZ A;  4DV3 J;  2ZBP A;  1FHT A;  3M4X A;  1HNV B;  3DRR B;  3MDF A;  4A8W A;  1S1V B;  4P7T A;  2RD5 C;  3H59 A;  3QJP A;  4CLP A;  2BKO A;  2OPP A;  2QO3 A;  3SSS A;  1YBT A;  4U7C A;  2XMT A;  2RF2 B;  4DX7 A;  5CH7 B;  4RNN A;  2IIH A;  3QSI A;  1LEO A;  3D6H B;  1MMN A;  2QZ8 A;  2VFR A;  4GC7 A;  2OKQ A;  1VQ9 S;  2VZ9 A;  4O3N A;  5H9F J;  3MPW A;  1G2E A;  1F2G A;  5EN1 A;  3HMJ G;  2EW9 A;  1SJQ A;  4DPY A;  5IT4 A;  4DSE A;  2WW4 A;  4IUF A;  4IDK B;  3G87 A;  2V4Q A;  3VAJ A;  3FSI A;  2LLZ A;  4O44 A;  3MM8 B;  2HS4 A;  3CW2 C;  4HL9 A;  2V8V A;  4IRK A;  2RAQ A;  3IR5 B;  3NWR A;  3MEC A;  3JSY A;  3QGP A;  3EE3 A;  4OJ1 A;  4P2M A;  4OLP A;  3C8Y A;  1B99 A;  3V81 B;  1RYS A;  1S97 A;  4WFZ A;  4JV5 F;  2DPJ A;  1AYE A;  3EXY A;  2OPQ A;  2Y3Y A;  3GYG A;  4IG0 A;  1RHJ B;  2J76 E;  4HI2 A;  5T41 A;  4O23 A;  2VG5 B;  1T9Y A;  3W7B A;  3H40 A;  1VQS A;  4ECQ A;  1HBO A;  1FWL A;  3R2D J;  2K3I A;  2ASL A;  4NL5 A;  3GIL A;  4OZ5 A;  2ZIT A;  2C2Z B;  1J2V A;  2Z2M A;  2MQM A;  2HBZ B;  4EI2 A;  1S6Q B;  2C42 A;  3CPW R;  5A6W A;  3H4D A;  2YX4 A;  3PX4 A;  2F8M A;  1FRL A;  2KO1 A;  3QQC D;  3WC0 A;  3KLH A;  5F8H A;  3HHL A;  2FJX A;  2UXB F;  3Q2S C;  3I0R B;  4ZVO B;  3W5X A;  1D9D A;  5F8N A;  2MQ8 A;  1KP6 A;  2FZC B;  5DDO C;  1Z4U A;  2C3M A;  1VHF A;  2QYG A;  3QT7 A;  4ZN1 A;  1TFY A;  3GMG A;  5A0Y B;  4QYZ K;  1DFD A;  2DY9 A;  2FDN A;  1RDR A;  4PG8 A;  1NH8 A;  2HGM A;  4UOG A;  3WDO A;  2ZH1 A;  3PW7 A;  4FPR A;  4P71 A;  1L3U A;  2GC8 A;  2B6A A;  5B09 A;  1EET A;  1H6K X;  2YNI B;  4B02 A;  2MZ1 A;  2VQE J;  4PXD A;  4ZVU B;  3RBE A;  3MEG A;  5DGB A;  3V81 A;  1UVI A;  4LR9 A;  3PJ9 A;  2B7B B;  4L3N A;  4P6Q A;  4ZK7 M;  1QLN A;  2BJ7 A;  3Q2T C;  4DV7 J;  4NI2 A;  1IBK J;  4OX6 A;  4RX6 A;  5KG3 A;  2XY6 A;  3NMA A;  1PKU A;  2HNZ B;  4IQM A;  5HVF A;  1IN0 A;  4EO8 A;  3GON A;  4DX5 A;  1F5B A;  2JLG A;  2ZJR Q;  3OXL A;  5IC6 B;  4XK8 C;  5KFC A;  3V6K A;  4PQU A;  2HEK A;  1XQI A;  1NLK L;  2M9K A;  4KIA A;  3JTO A;  5CA5 A;  4YHH F;  1DAX A;  2HS3 A;  3CJ3 A;  4RBT A;  3HVT B;  4DPU A;  2W9A A;  3GIK A;  3RR8 A;  1LK5 A;  4NE9 C;  1SB6 A;  1FXR A;  5B0F A;  1N32 F;  1DQ9 A;  1XR7 A;  4LFC J;  3C3L A;  4GVL A;  1WD6 A;  1NK4 A;  1K73 T;  4O3P A;  2DGV A;  3MR2 A;  1X5P A;  5KFI A;  3QRP A;  4OYO A;  4TLQ A;  4ECS A;  4IG3 A;  1TUW A;  1RAB B;  4LSN A;  3J7A 1;  3HVW A;  3WX4 A;  5ETQ A;  4BC9 A;  2HLU A;  2MZR A;  2VU5 A;  1FVQ A;  1S1U A;  3UPF A;  2V8G A;  3L7U A;  2HGN A;  4WFY A;  2AEM A;  1RE1 B;  3OUY B;  3MM7 A;  1OPI A;  1ACM B;  2B9Y A;  2I0X A;  2K8G A;  4C8N A;  1S79 A;  1V9O A;  3MEC B;  4ECV A;  3L7P A;  1RK8 A;  4RUC A;  4PUO B;  1REV A;  1TL4 A;  5E0O A;  1RLD A;  3RAM A;  4CTA A;  1RAO A;  3NXZ A;  4YDX A;  1FJ7 A;  3V5R A;  1YG0 A;  3SSR A;  5KAK A;  2RUG A;  1N0V C;  2R2U A;  1NK0 A;  2FVP A;  1BDV A;  2KG1 A;  4JI6 F;  2DR9 A;  1RHM B;  3MTK A;  3TAM B;  4QW8 A;  4DR5 J;  4UOH A;  5ITH A;  5GAD U;  2QTW A;  3HO1 A;  2OD6 A;  4PPD A;  3K5N A;  1S1W A;  4X65 F;  1H38 A;  3ICL A;  4FXW A;  1U24 A;  3B4M A;  4LFA J;  2OTL S;  3W9I A;  2B9X A;  1LWE A;  4RW7 B;  1M5K C;  4KHP J;  2EVZ A;  2V8D A;  1F5C A;  2WOM B;  2GHW A;  3DLE B;  3PRD A;  4P2F A;  1UW9 A;  4OI1 A;  4BC7 A;  4DL6 A;  1GXU A;  2V0N A;  3UCU P;  2E5L F;  4ICL A;  2J0S D;  2EFG A;  1UJ6 A;  2ACY A;  5KFL A;  1C1C A;  2RKI A;  1BQX A;  1CBK A;  3A8E A;  3I82 A;  3IS9 A;  3L7O A;  4QJV A;  3WZ0 A;  4J9N A;  4O3R A;  1S57 A;  1EQ0 A;  4K59 A;  4CO2 A;  2ZKT A;  3LAL A;  2YNF B;  3P8B B;  4OZN A;  5AJ3 F;  2RSQ A;  3SYZ A;  4B3T J;  5GAH I;  3W60 A;  3NS7 B;  3J81 j;  3IGN A;  3HPO A;  2UUC J;  3BGL A;  2YQ3 A;  3VGT A;  4WFB Q;  1SJ1 A;  4RO0 A;  3DYA B;  1UFW A;  4R0E A;  2VL1 A;  4HI1 A;  4XIU A;  4D3G A;  1NZA A;  2ASY A;  2BKN A;  2AGP A;  2DR8 A;  1LW2 A;  3IN5 A;  3K2Y A;  2D9O A;  1N6Q B;  2UUW A;  5ETV A;  2ROP A;  4KJI A;  3W64 A;  2ADL A;  2UZA A;  2F3J A;  3G82 A;  2ZUG A;  1S0M A;  2YKQ A;  1T03 B;  1HWJ A;  4L3K A;  1SC1 B;  2CA9 A;  2IYI A;  5KFP A;  4DV4 F;  8ATC B;  4V1A k;  3KLV A;  1JB0 C;  3DMJ A;  4ZIT A;  2Z8Q A;  5E3A A;  3NBP B;  1XJW B;  2B8Q A;  2VPW B;  4LBH A;  3FMW A;  2RRA A;  1UWA A;  4IH6 A;  2DIV A;  2HIY A;  3BSA A;  3O8W A;  4I7F B;  3UD4 P;  3NY0 A;  3CCW A;  4Y2M A;  1JLA B;  1RCX B;  4QPX A;  3FJ2 A;  4TQR A;  4OX9 F;  3G9C A;  4Y2C A;  3CUN A;  4N41 A;  2Z0G A;  1UZD A;  5AXL A;  2ZZM A;  3TP2 A;  3DLL Q;  3LGN A;  4DQR A;  1JXE A;  4AFF A;  1VBZ A;  2BOP A;  4UOF A;  4FXE A;  2VG5 A;  3DC2 A;  3H2U B;  5D3G B;  1TP7 A;  4LRV A;  2BUN A;  2OPQ B;  4IG0 B;  1NSK L;  3TX8 A;  3AD7 C;  2YWG A;  3KFW X;  3MEK A;  5DQI A;  4RBU A;  5KG5 A;  3BN4 A;  4X2B A;  4CT8 A;  1RWX B;  3LPY A;  1ITP A;  4Q2L A;  4CLK A;  2DBB A;  3CVK A;  3EVM A;  3UVJ B;  2Q66 A;  3CCZ A;  1LOU A;  3JQM A;  2XC9 A;  2XLI A;  2J7U A;  2OAU A;  1TZ0 A;  4H4M B;  4URS A;  3TEG A;  4R8U A;  3UN2 A;  1U0H B;  2F9D A;  3DCA A;  4H54 A;  4OHW A;  1IBK F;  1HBO B;  1H7X A;  2BAB A;  4ZVS B;  4E2F B;  2RDJ A;  3SI8 A;  2LKZ A;  3TR5 A;  5CYJ A;  2V34 A;  3NGD A;  2LFV A;  4YY3 J;  2HS0 A;  5GMD A;  2H51 B;  4B3O B;  1H72 C;  1NME B;  3A8I A;  2MQQ A;  2PFF B;  2UP1 A;  2OUG A;  3B82 A;  1RTJ B;  2ZUA A;  3R5J B;  4P7V A;  3EVO A;  4JUZ A;  3S01 A;  4ES2 A;  3EPG A;  2PSZ A;  4WKY A;  3Q24 A;  2ZZN A;  1H2U X;  1RTH A;  2YNH A;  4OHZ A;  4YUD A;  5KFN A;  3PO4 A;  1CUL B;  3UQS A;  1B28 A;  4ZPB A;  3HT0 A;  3CJS A;  5L9X A;  1S6U A;  2EG1 A;  1WC1 A;  1VQ5 S;  1R31 A;  2BQR A;  2GAG C;  1R0B G;  2AJ1 A;  2HZC A;  4PZV A;  3MED B;  2CPG A;  1BD6 A;  1CJK B;  3H98 A;  4QOT A;  3NGS A;  1VGY A;  4PPZ A;  4ANC A;  3M6U A;  2PFD A;  3PNI A;  1Q1K A;  2LQJ A;  2V94 A;  3Q89 A;  4DEZ A;  5LSO A;  5GAE U;  1KS2 A;  3NMR A;  5CCL A;  4JI3 F;  1BWV A;  1F2H A;  1Q16 A;  1S12 A;  4U7U D;  4FYD A;  3QAE A;  2WBM A;  3NS6 A;  4USW A;  3HFV A;  2OH2 A;  1Q8K A;  1AA1 B;  2HND B;  2HVE A;  2Y0S D;  1J5E F;  4IRD A;  1VQL S;  1KEK A;  2IY5 B;  2WVB A;  1PBU A;  2P6S A;  1U0S A;  4EFA C;  4LFB J;  1TL3 B;  1QSS A;  4N77 A;  4RW9 A;  4QWC A;  2RT3 A;  3LO3 A;  1HNX F;  1AW0 A;  4NLY A;  4CQ1 A;  3CO9 A;  4TYA A;  4KB7 A;  4EBE A;  2DHH A;  5HAT A;  2VQF F;  2RML A;  1BDT A;  3D6T B;  4AD6 A;  3QWP A;  4CO0 A;  3J81 U;  3NS5 A;  1PGZ A;  3N6N A;  4K0K F;  3CXC R;  4M63 A;  4E8U A;  7FD1 A;  4NCA A;  2V2V A;  4HLB A;  1KOO A;  4KGZ B;  4FS2 A;  3V4I A;  4NXN J;  1FER A;  1RU1 A;  1QDU B;  3G2X A;  4M5D A;  1P9Y A;  4AXJ A;  2KRB A;  1S9F A;  4XAK A;  2NXC A;  1KON A;  3W5Z A;  1EP4 B;  3B78 A;  2A18 A;  2HK2 A;  1HI8 A;  2BKP A;  2ZOF A;  4HT5 A;  5BXI A;  2XQC A;  4RBV A;  4WP9 A;  4C8O A;  1KVI A;  5F8M A;  1UA0 A;  2HPU A;  1RWN B;  2KRR A;  5DGA A;  4NXM F;  4O4R A;  2ALZ A;  2IHR 1;  3BPS P;  3CJ0 A;  2E1M C;  2C2E A;  2DNK A;  1EAR A;  2IAJ B;  5DET A;  1DQ8 A;  4MMO A;  2A2D A;  3W2V B;  4K2X A;  1H7W A;  2XGQ A;  2BE2 B;  3M6W A;  3SIP B;  4ED4 A;  1R8B A;  1VBY A;  2J8A A;  2OO4 A;  3SQG A;  2BA3 A;  5L46 A;  2KVI A;  2C1E B;  4MKY A;  1H0H B;  1GT8 A;  4FZV A;  5KFG A;  2CWX A;  4IR9 A;  1U6B A;  5E7O B;  3ZZO A;  2AMC B;  4CNZ A;  4DR5 F;  2F5G A;  2ZJQ Q;  1SJR A;  3IFE A;  3J80 U;  2W2Q P;  2D41 A;  4OI3 A;  2BA9 A;  3CCE S;  2YX1 A;  1OY8 A;  1UCN A;  1VQK S;  3G82 B;  2XLJ A;  4FF4 A;  1K8A T;  1UET A;  2VF3 A;  1U45 A;  1JLB B;  4MJW A;  3CT9 A;  3JQK A;  1M90 T;  5CAA A;  2UVU A;  2ZH4 A;  4OX9 J;  4DFM A;  2XCP A;  1X4F A;  1U1K A;  2E5G A;  2QFJ A;  1LK7 A;  3JSR A;  4LVO P;  1D1U A;  3X1L B;  4DQI A;  4QR0 A;  4P75 A;  4YR0 A;  4RW8 A;  1N34 F;  1CEZ A;  1RHQ B;  1T9U A;  2FHJ A;  1VK3 A;  2JVO A;  4CLT A;  5G0R B;  2DJW A;  2J0X A;  2KXF A;  2DEJ A;  3BGO P;  3ZTO A;  4EBD A;  2PO4 A;  4JI8 J;  4DV5 J;  4DUT A;  4C2M A;  1BUX A;  2IMW P;  4ALZ A;  2ADB A;  3K5P A;  1TAU A;  2LCW A;  2BE2 A;  4URQ U;  4OJH A;  5A2Q U;  1BQN B;  2EBE A;  2J9C A;  4G1P A;  1F6T A;  2FQQ B;  3GJQ B;  1SIW B;  1M5O C;  1BXN A;  5IM0 B;  1WKJ A;  2YKN A;  4ZPW R;  2C3O A;  1Q8L A;  3I5C A;  2DNG A;  1X31 C;  3VF0 B;  3A12 A;  3D2W A;  1JLG A;  4DSJ A;  1NSQ A;  5M2P A;  2RHQ B;  3C6U B;  1UZH A;  1ZM3 A;  4M5I A;  3KTQ A;  2XMV A;  2CWK A;  3HT3 A;  4EWT A;  1U9P A;  2RKI B;  3HDS A;  3K58 A;  3D0H E;  2VIH A;  4UY8 T;  4QIE A;  4NML A;  3O2I A;  2WON A;  3CJQ A;  1VFJ A;  3IR7 A;  2OFG X;  2VG6 B;  2XMW A;  2YWF A;  3M8W A;  2GW8 A;  4O44 B;  5HK4 A;  5KFS A;  3ZZZ A;  5HMY A;  4DV0 F;  3DFE A;  4J91 A;  4YR3 A;  1JJ4 A;  2DR7 A;  1FA0 A;  2MJN A;  3FZ2 A;  3GCX P;  4RNH A;  2HWI A;  1TK5 A;  2MDA A;  2D1C A;  1TMM A;  3L95 X;  4NLP A;  3MM5 A;  3SCL E;  2F1F A;  4GVB A;  1LWE B;  4RW7 A;  3R5D A;  2XY7 A;  4NMX A;  4XPC A;  1JJH A;  3R8Y A;  5DRK A;  3AXK A;  2WON B;  2PI4 A;  4RL1 A;  2AD9 A;  1JX4 A;  1RTJ A;  5LT5 A;  3MWB A;  3OXF A;  4ECZ A;  2Z2Y B;  4F25 A;  3GP9 A;  4ED8 A;  2VUG A;  1D8Z A;  1UFL A;  2DHG A;  3QSY B;  2D69 A;  2N3L A;  3NOC A;  4WTY A;  5HI7 A;  3DRP B;  4FKY A;  5KFX A;  1PCA A;  3VHQ A;  3ZZT A;  2GVD B;  1SQF A;  5ETP A;  3VGV A;  3J7Y I;  3R1L A;  2ZEJ A;  4WBF A;  3KLE B;  4NYZ A;  4LF6 J;  2FLO A;  1NRK A;  2AY0 A;  4MYT A;  2ATC B;  2D3Z A;  1TL7 B;  4OI2 A;  1RTD A;  2FZG B;  2NRE A;  2DNZ A;  1VOM A;  4CP5 A;  3RB4 A;  1T3O A;  2DNN A;  1RAI B;  1MYK A;  1YZ7 A;  1JLF A;  5U47 A;  2HHW A;  3QT8 A;  4HAC A;  5HN0 A;  1R6Y A;  3CCM S;  1X9M A;  3QIP B;  3MMC B;  1RUS A;  2CPX A;  3DM2 B;  3M7V A;  2ZHO A;  2RDD A;  3MD1 A;  3KLG A;  5KFB A;  2QL9 B;  2DNR A;  1R3N A;  3VAH A;  4EK2 A;  5EGY A;  4X66 F;  4A8Q A;  2UUB J;  3GXQ A;  2HFO A;  3TUZ C;  4RNO A;  1WAC A;  2J6T A;  3Q86 A;  3RAX A;  3CJR A;  2WVD A;  3OFG A;  4HV0 A;  2PE8 A;  3HHL D;  3G6X A;  2MLZ A;  3DRY A;  3OTB A;  3QBC A;  1SVD A;  2ZVI A;  2HQ3 A;  5M2R A;  5KFJ A;  3PX0 A;  5CXT A;  4X4U A;  4CCH A;  2W2M P;  1QUP A;  1FES A;  3AOC A;  4FBT A;  1TUV A;  2QLX A;  4DV3 F;  3AA8 A;  3E8O A;  4GRS A;  3MMA A;  3BB5 A;  3MOZ A;  4Q8F A;  3FCV A;  4H4K C;  3IWN C;  3EXC X;  3LA0 A;  1QY7 A;  4LMZ A;  1R0C B;  4TKT A;  1T3N A;  3WHI A;  1UJ4 A;  3MFH A;  3BZQ A;  4ZHR B;  1KQF B;  5FLX U;  5ADZ A;  2DPI A;  3EZ5 A;  3GR0 A;  2MTL A;  3BPD A;  3LWM A;  2FLP A;  2UXD J;  1ZYQ A;  2Q79 A;  1NUE A;  2LQ9 A;  2FJW A;  2HQF A;  2XMM A;  3EWG A;  4P72 A;  5F0U A;  3PXG a;  3ZNU A;  4OV6 A;  3JYT B;  4NXM J;  4K4Z A;  1PIL A;  1QTN B;  3GQC A;  1WC0 A;  2HQD A;  1FRK A;  2D3O 1;  2HQI A;  1OPZ A;  1RKJ A;  3D7S B;  3RBD A;  1UVJ A;  1RI7 A;  4IFY B;  2CYY A;  4OI4 A;  4OYA A;  2GX8 A;  3QLH A;  5H9E J;  1GXT A;  1T9T A;  1NCL A;  2DRB A;  3PW5 A;  5AE1 A;  3HK2 A;  1NM2 A;  2EFO A;  2KDO A;  2EI5 A;  2KYZ A;  4OZ1 A;  2J7W A;  2NZC A;  3I32 A;  5KFE A;  2BRL A;  3G8Q A;  2ZBC A;  2B4V A;  4ZJL A;  4CRJ A;  5F41 A;  5EWF A;  3KJV B;  3K5L A;  1XIQ A;  2DYA A;  4Y2K A;  4DV2 F;  1E6V A;  1XNQ F;  1X60 A;  2C2N A;  1GTH A;  2VQF J;  2ADC A;  2AYM A;  3TQE A;  2Z2Z A;  4Y2I A;  4XO0 A;  1JQG A;  3P5B P;  3W5Y A;  2MJU A;  4DR4 F;  2BSQ E;  2M5Y A;  4AT1 B;  3QJJ A;  4GVB B;  1SH3 A;  4NYP A;  3UD5 A;  1SPB P;  5GVQ A;  5JVG Q;  4K5R A;  3MAQ A;  4HTJ A;  2V50 A;  3G4S S;  3SSQ A;  3R3T A;  3VQS A;  4EGL A;  4TU7 A;  2WSC C;  2QL5 B;  1RT5 B;  4M94 A;  4ELU A;  5GAE I;  3BQ2 A;  4CH7 A;  2R7W A;  4P2X A;  1MU2 B;  1TVR A;  4PG4 A;  5GAG I;  1Y9O A;  3BYP A;  4H4K A;  4LF4 F;  1IKW A;  4Q8E A;  4PYA A;  3GFZ A;  3PW0 A;  1C1C B;  2L08 A;  3IS9 B;  4JV2 A;  3ILL A;  2CQP A;  2ZOM A;  4ZMM A;  4X4R A;  3IRW P;  4O3Q A;  4G1Q A;  4CT9 A;  4FXD A;  2OSR A;  1S1X A;  1SL0 A;  4OV1 A;  3BF4 A;  4V19 J;  2DHS A;  4TVA B;  4WWS A;  1WOO A;  4TU8 A;  2GQ2 A;  1IKW B;  5I42 B;  2FD2 A;  3TJA A;  1SQG A;  3AOD A;  4DV2 J;  4DL7 A;  5EX0 A;  4EMD A;  4RUH A;  2KFY A;  2DGU A;  3QRR A;  4F7V A;  4IOC Q;  2KU7 A;  1H3D A;  1RAF B;  3GIM A;  1CJK A;  3RG6 A;  3K5M A;  1VBK A;  2H3E B;  1DLO B;  1WOR A;  2LVW A;  4KHR A;  4C8M A;  3LPE A;  3OJU A;  5K8O A;  2RDI A;  3P6Y C;  4NLW A;  1RCO B;  1XTZ A;  3W1Y C;  2ZD1 B;  2FVR A;  2NPI A;  5T7L B;  3R9L A;  4YOE A;  3K57 A;  3D3C J;  2YNH B;  5KFV A;  3ZZR A;  1J5O B;  2HW3 A;  4RW6 A;  1KHV A;  4QR1 A;  3JB9 k;  3MR5 A;  3I5A A;  1TV6 B;  4QWA A;  3BO4 A;  1L3V A;  4RNF A;  1RBO B;  4ECR A;  2HBY B;  4CYU A;  2MKS A;  3U02 A;  3BDP A;  1X9S A;  1R8C A;  3EDQ B;  3PR4 A;  3T9N A;  3E2E A;  2QLB B;  1AB8 A;  2AJ2 A;  3T41 A;  3CME S;  5A0Y A;  1OMS A;  1VIS A;  4FKX A;  2BZ2 A;  2VPX B;  1M0S A;  2DGT A;  3BGF A;  4ZJQ A;  3T5L A;  1U4B A;  1LWF A;  2XEX A;  3A8K A;  1GMW D;  1S48 A;  3IGV A;  3IWL A;  4W98 A;  3M8R A;  1PC5 A;  4B9V A;  1KLM B;  2XNQ A;  5GAG U;  2DIU A;  4W4M A;  5B7W A;  5EWE A;  2OD4 A;  5D0R A;  2IFX A;  2Y8W A;  2M2B A;  3H2V E;  4ES3 A;  1X4B A;  3LWL A;  4FYX B;  2NXJ A;  4BCA A;  5G0R A;  2PGC A;  3QWU A;  5F8J A;  2P9E A;  2HHP A;  3LOU A;  2UVV A;  4P10 A;  3AOB A;  3GG1 A;  3U1M A;  4F02 A;  3Q83 A;  1ZZN A;  4JI0 J;  2P9G A;  3VVU A;  2P8I A;  2ZKU A;  3A3P B;  4X66 J;  1CJV A;  4C8K A;  1KQG B;  1M5V C;  1XEZ A;  3MTJ A;  2JBV A;  1FFW B;  4R0J A;  1ZAV A;  5BR8 J;  1VI7 A;  2W4D A;  2LEB A;  2JEJ A;  3ZTS A;  4IR1 A;  4PWU A;  2JWN A;  4NRT A;  2BX6 A;  3OR1 A;  4K4X A;  5DLF A;  3F56 A;  1CJT B;  3Q8V A;  1KFD A;  1OQ3 A;  1Q4R A;  2M3D A;  1NK6 A;  2CPI A;  4LQ3 A;  4IQX A;  1PJ5 A;  3OTE A;  2QA2 A;  1JIH A;  4OYP A;  3RB6 A;  2YNG A;  2OLW A;  3CCR S;  1C1B A;  5JJB A;  3GWC A;  4KGX B;  1B64 A;  2A10 A;  1C4C A;  3MM9 A;  1PJ6 A;  4KRW A;  4DR3 J;  1WHX A;  1FX2 A;  5LSL A;  5FDL B;  3E51 A;  3M6V A;  5I42 A;  4UY8 5;  3K0J A;  2WK4 A;  1N6Q A;  1KOH A;  4TY8 A;  2F4V J;  1RT3 B;  2G9O A;  2RRB A;  3ZTP A;  2XO7 A;  2XHC A;  1OSD A;  3BKU A;  3LP1 A;  4N7T A;  1LWC B;  1JJC B;  3DYA A;  3FZB A;  2Z56 B;  4FXV A;  3G6V A;  1VQ8 S;  4ZPD A;  2Y1I A;  2JDJ A;  2FJA B;  3C15 B;  2JHE A;  3LP2 B;  3N5F A;  5HAO A;  3ZTR A;  3G8S A;  4B3T F;  3B6B A;  2ZH3 A;  1HD1 A;  1YJU A;  3BO2 A;  4NEZ A;  3K89 A;  3M8Q A;  1VJW A;  3GFY A;  2MB0 B;  1W2I A;  4AUK A;  1HNW F;  2C2M B;  2A6M A;  2NLW A;  5A8K B;  2W7P A;  4ECY A;  1T7P A;  1XN9 A;  4X62 J;  3J80 Y;  2WVF A;  4RW6 B;  2DH8 A;  2LQ5 A;  4N8O A;  4QIG A;  1YLX A;  4DXL A;  3O6Q A;  2KM8 C;  1IBC B;  1KQS R;  1Y5L B;  2RIJ A;  4NCB A;  1NDK A;  5LOQ A;  5IT9 Y;  5J2P B;  2E7W A;  2XYP B;  3CD7 A;  3MUM P;  3O1L A;  5J2Q A;  1HHQ A;  2W25 A;  2N7Y A;  1EX8 A;  3MCN A;  4PG6 A;  4L76 A;  3PW4 A;  4O3O A;  1MYL A;  3M30 A;  4C3M A;  3WX8 A;  4DS5 A;  1HQE A;  1FK9 A;  3D3B J;  4JP8 A;  2N4C A;  5E5N A;  3VWS A;  3VAL A;  1BGX T;  1WOP A;  3HHE A;  3CC7 S;  4C4W A;  2V8H A;  3SCI E;  4CO1 A;  3DU6 A;  3PYF A;  3KHH A;  1S4F A;  1V5V A;  1YI2 S;  3KHL A;  1REG X;  4CM2 A;  3S6E A;  3QFW A;  4NXN F;  1BY9 A;  2G13 A;  5BYS A;  4X4T A;  1QTM A;  2H1Y A;  2H3A A;  1Q5V A;  4K4S A;  1U0H A;  4QYR A;  2KZM A;  2FC8 A;  3IRX B;  2YX7 A;  3TOQ A;  3I0S B;  4DOZ A;  4DPW A;  2RJZ A;  2ZDO A;  5CD4 A;  1S59 A;  2ZH8 A;  5F8G A;  2JJ4 D;  2GGP B;  2K1R B;  3TRG A;  5B0B A;  3K7R A;  3MD3 A;  2MHN A;  2UVW A;  4FP9 A;  4ECW A;  2DNQ A;  2K2P A;  3EMT A;  4USV A;  1S1U B;  3UDE A;  1IWG A;  3IWX A;  1OY9 A;  1MU2 A;  2L3M A;  3AY0 A;  3CD6 S;  1Q86 T;  2BM1 A;  2HKE A;  3QGI A;  1BMQ B;  2M4M A;  2R2S A;  2V2K A;  3QGG A;  5LMN F;  2FVQ A;  1TKD A;  3FQK A;  2DR6 A;  2OMO A;  1HQU A;  2VG7 B;  3D0G E;  3IM8 A;  3KG0 A;  4KV8 B;  2M8D B;  2JZ5 A;  4ZVH A;  3MXH P;  2Q2K A;  1NEE A;  4CLY A;  2IJF A;  3QID A;  1YIJ S;  3HP6 A;  2I8E A;  4ZHR A;  3PO5 A;  2XS5 A;  4EZ9 A;  1QE1 A;  2XBP A;  4YB7 A;  1Q81 T;  2NS1 B;  4OZJ A;  4F4W A;  5K8N A;  2ZM6 J;  2BNW A;  2GZO A;  2CUY A;  1NAQ A;  3D67 A;  4QBU A;  4ZLN A;  2KM8 B;  1FNX H;  3JAM U;  4CDI A;  4WK3 A;  5LM7 E;  4P74 A;  4KPY A;  3PJW A;  1E6Y B;  3TWZ A;  1RB0 A;  1X0F A;  3LF0 A;  2J5A A;  4R8U B;  4C11 A;  1KBR A;  1KDN A;  1WJ9 A;  2CJQ A;  4WCE Q;  2UXB J;  2KFZ A;  4J7C A;  1CJV B;  4DPT A;  5LSR A;  1WKL A;  1XMQ F;  4XPE A;  4DLG A;  2CJB A;  2Q43 A;  2B5J B;  5IOL A;  1N52 B;  4DR6 J;  1UKU A;  1PYS B;  3ISZ A;  2GS8 A;  1R6V A;  5KT3 A;  2IRY A;  1Y5I B;  2ZVS A;  2PDA A;  3TVK A;  1YRU A;  3QT6 A;  5DQG A;  3THV A;  3CMQ A;  3VW4 A;  3OTC A;  1KR4 A;  2MZT A;  3IC1 A;  2LXI A;  2CZ4 A;  4LF1 A;  4X4Q A;  2AF6 A;  1OQ6 A;  2GMJ A;  3O5T B;  2NXE A;  4JI0 F;  3FK4 A;  5E33 A;  3R5G A;  4LF5 F;  1FCA A;  2QSF A;  5EUH A;  4ANE A;  2DRD A;  4HT7 A;  4NA2 A;  4RPF A;  4LF4 J;  1MRO A;  2EEY A;  5BR8 F;  2CQ2 A;  3CO0 P;  5K8M A;  2P5V A;  2A2C A;  3TUJ C;  3W65 A;  1TU0 B;  4PYD A;  4LFB F;  1X8D A;  2MZS A;  3HX9 A;  1QJH A;  3W2W B;  1T03 A;  4K7Q A;  3DLB A;  1VCT A;  2HRT A;  1HNZ F;  3RJM B;  1T05 B;  2JEG A;  1TAQ A;  2DNP A;  2K3K A;  4ID5 B;  3ETO A;  4RZR A;  4X4P A;  1O8B A;  2KYX A;  4M5K A;  3M9M B;  3PG9 A;  1U2C A;  1PJ7 A;  3T1H F;  1ZOT A;  3KK2 A;  2MKJ A;  5D0H A;  4IFV B;  4A8O A;  4O4G B;  4JI5 F;  1UEV A;  1Q95 G;  1ZAX A;  1IKV B;  1SUQ A;  4KGK A;  1IKX B;  1EQM A;  1FJG F;  4GKJ J;  1H2T Z;  2L9W A;  5DM6 Q;  2G0I A;  1XNR F;  1JLF B;  1MLA A;  5KG7 A;  3BQ0 A;  1EB0 A;  3Q8U A;  4RW9 B;  4DF8 A;  2VDH A;  4EYI B;  4ZP6 A;  4DLE A;  3JSB A;  3U7J A;  3RBZ A;  4EBC A;  1BLU A;  2MEW A;  4YS2 A;  2XZT B;  5DLG A;  1HHS A;  2IDL A;  2GVD A;  1WF1 A;  6AT1 B;  1NND A;  3SFG A;  3BR9 A;  3FGV A;  4LT6 A;  4YB1 P;  2MKI A;  1D8Y A;  4OLO A;  1ZBT A;  3MPV A;  2DTJ A;  2Z30 B;  3LGM A;  5K9F A;  4C9D A;  1VJQ A;  4IFV A;  4BWM A;  4WF9 Q;  1IR0 A;  2C2D A;  1EAY C;  1JLQ B;  5FDL A;  1OIA A;  2CQB A;  4DPX A;  1T02 A;  2JFD A;  1Q7Y T;  3P3D A;  1RAC B;  1B3T A;  4EZ6 A;  2WVE A;  2OEJ A;  1NDP A;  2GIQ A;  2JX2 A;  4B9L A;  4JI1 F;  4NLV A;  2HHT A;  2FYX A;  1X7V A;  1NU4 A;  1HIY A;  2W4C A;  3F41 A;  2OPS A;  3I4P A;  4ZCI A;  3DDN A;  4FVC A;  1REV B;  4J9L A;  2EFV A;  4TY9 A;  2QX0 A;  2ZBQ A;  4WJB A;  4RUA A;  5HQ8 A;  2XG8 A;  1WG1 A;  2ALY B;  3DNC A;  2DRA A;  3H0P A;  3NCP A;  2MZQ A;  1YSJ A;  3QPI A;  4WTO B;  1NB7 A;  1BC6 A;  3CJ5 A;  4KE5 A;  4JI2 F;  3FCH A;  2BYC A;  1K0V A;  1BQM A;  1KN6 A;  2F40 A;  2GFF A;  1L5U A;  1YJ9 S;  2HHU A;  5HMW A;  1NH7 A;  2QA1 A;  2GVZ A;  3EZU A;  1HNI B;  2R7R A;  1Q82 T;  5KFR A;  4CWB A;  4DUY F;  3MAA A;  2DR5 A;  2HRY A;  4GKK J;  2EXU A;  1RT6 A;  3UO0 A;  1SC4 B;  4IFY A;  1WNE A;  3OJS A;  5KFD A;  2GIR A;  2H48 B;  4G3I A;  1TKX A;  3FMT A;  3LTO A;  3R6G B;  5D4N A;  2CQ0 A;  2KFN A;  1P6T A;  1HD0 A;  3D1Q A;  2MGZ A;  4ER8 A;  4YB6 A;  1U2F A;  2JXI A;  2DGW A;  2MKH A;  1UL3 A;  1VS3 A;  2YNG B;  4CH1 A;  2ATL A;  2XMJ A;  2ZWO A;  1NJZ A;  1RHR B;  2HHX A;  2X1F A;  4M5G A;  2HGL A;  4I4B A;  2JL9 A;  1I6J A;  4I6Y A;  2CQ3 A;  2VBY A;  2ZOG A;  1W2B R;  4LF9 J;  2V2Q A;  1XER A;  3DOM A;  2DGQ A;  2RHS B;  3OR1 B;  4TNO A;  1RAJ A;  2R4F A;  2NUH A;  4NLQ A;  3V6D B;  1YJ7 A;  3MR7 A;  2DNH A;  3KLI A;  1DBD A;  1FE0 A;  1FVS A;  1RT4 A;  2G1D A;  4C3L A;  1CLF A;  2UUT A;  4PR6 A;  4JV0 A;  4DX6 A;  2QG9 B;  4Q44 A;  1EET B;  3GPA A;  3CCL S;  3E01 B;  2B4P A;  1SC6 A;  1U1P A;  4ZP7 A;  3TNV A;  1NZ8 A;  5DZ7 A;  3BGR B;  1HQU B;  2VG7 A;  1TMJ A;  2BV3 A;  3U1L A;  4RR5 A;  5CAB A;  4BHQ A;  2EG2 A;  2WHO A;  3A1Y G;  3EGW B;  3R5A A;  3TZW A;  3KHG A;  1HR0 J;  4BDP A;  4JI4 J;  3HKZ D;  1RAH B;  3R5C A;  3V2U C;  2R8H A;  1T11 A;  3NGK A;  1T8E A;  3Q8R B;  5DJB A;  4Q7A A;  2CPJ A;  4FF2 A;  2KB2 A;  2UV8 G;  1X9W A;  3EVW A;  1WSR A;  2FGO A;  1XMO F;  4OI0 A;  2ZM6 F;  2ABY A;  1LW0 A;  3H5X A;  2CJ9 A;  1SH0 A;  4L6V 3;  4F4Y A;  3SFU A;  1KD1 T;  2UXD F;  4O0I A;  2R7V A;  1SH2 A;  1T9X A;  4A47 A;  3MGJ A;  1Y3K A;  3W8P A;  5IXU A;  4ZPA A;  3R6L B;  1HI0 P;  4OYW A;  3PFE A;  2VKR A;  1FJE B;  3EX7 B;  3I6P A;  5RUB A;  1MNE A;  3N4W A;  2ZBR A;  4LRD A;  5AXM A;  5IZH A;  2OIH A;  5LMN J;  1RHU B;  3GSD A;  2IC3 B;  1V6H A;  4ID8 A;  2LEC A;  5AXK A;  2DO4 A;  1U02 A;  3CF5 Q;  1KTQ A;  1WKK A;  5DDQ C;  3PCO B;  5LL6 d;  5C42 A;  3KLE A;  3VAK A;  1NJW A;  2VOO A;  5I3U B;  1I5O B;  2HFV A;  1N48 A;  4L75 A;  3JTN A;  2XWY A;  4Q0B A;  1HYS A;  3KNG A;  3UCZ P;  4WXW A;  2VKZ G;  3IM9 A;  3P96 A;  1IKY A;  4WIQ A;  5ETS A;  6FD1 A;  1X5O A;  2V5H G;  3HD2 A;  3OW2 R;  1DQA A;  2O67 A;  4C98 A;  4WP8 A;  1IWA A;  2HVZ A;  3EYZ A;  1S1W B;  4IOB A;  2XZD B;  1C2P A;  1UJ5 A;  3CCT A;  2RB7 A;  3TAR A;  2CKW A;  3D1O A;  4DR1 J;  2KTQ A;  2MQO A;  3GV8 B;  4R5P B;  5K8P A;  1F3F A;  2DEI A;  2NXU A;  2CJX B;  2KHC A;  3DGP A;  3R27 A;  4K5S A;  4EO6 A;  5HQM A;  3K17 A;  1B0P A;  4F04 B;  1RSC A;  2HAI A;  2IJN A;  3OQ2 A;  2J9D A;  4YQW A;  4F67 A;  1Q79 A;  2C3Y A;  5JUM A;  3VAG A;  4I67 A;  4DWI A;  4YME A;  3R2C J;  1U47 A;  1U48 A;  2QMX A;  4ECU A;  3KDO A;  4TY8 B;  1HBU A;  2KVQ E;  1N33 F;  2G2O A;  1A6L A;  4LSZ B;  2UV8 A;  4ZVG A;  1FKO A;  3FBB A;  2ZHB A;  4QWD A;  1I94 F;  2K7J A;  3C6U A;  3D66 A;  4M5N A;  4MK9 A;  3W8G A;  1I51 B;  4A46 A;  2GAH C;  2C3P A;  3S8S A;  3CDU A;  2QLW A;  3OFE A;  2EC2 A;  3LP2 A;  5C2C A;  4QIW D;  2XYG B;  5HVH A;  4DQQ A;  2Y1J A;  4Y34 A;  1QUV A;  1FRH A;  1RJJ A;  3AB2 B;  5IM0 A;  4IG3 B;  2YKM A;  2F8E X;  3M2U B;  2DY1 A;  3I5B A;  3KUG A;  3D6F B;  5A8R A;  3CC4 S;  5J1E A;  2CQC A;  2HWH A;  2KOE A;  1CJU B;  5D0E A;  2G1H A;  5I3P A;  3OVA A;  2X1A A;  4MH8 A;  4PAB A;  1FXL A;  2OFH X;  4DR7 F;  1U26 A;  2JLE A;  2AYB A;  3KWM A;  3MR6 A;  3OL9 A;  1WI8 A;  4I2Q A;  1C1B B;  3KLF A;  4C11 B;  1FF2 A;  3HHD A;  3RZA A;  5KFH A;  3VEA A;  1S49 A;  4J90 A;  3B4D A;  4KFB A;  4QIV A;  5JXS A;  3DHX A;  3MEE A;  1UPP A;  2VA3 A;  3CIM A;  1CJT A;  1FRX A;  5FII A;  4WII A;  4HEA 9;  1VC0 A;  4G65 A;  2G0J A;  3W61 A;  4UST A;  1RKI A;  2APO A;  3KLH B;  1SL1 A;  1MN7 A;  2DKO B;  5LMU F;  1QVG R;  1N4L A;  3QOQ A;  2M7S A;  4KR0 B;  4A8Y A;  2NUU G;  4Z37 A;  3W9H A;  4OYB A;  3PX6 A;  4F3M A;  1K47 A;  4WU3 A;  2UUA J;  5A8R B;  4YEA A;  4LF9 F;  1Q7L B;  2AEJ A;  1M5H A;  4USK A;  1HNI A;  2G4B A;  2N7C A;  3JS9 A;  2XS2 A;  5H9E K;  1R8H A;  2BAN B;  4ZVR B;  3I0R A;  1BQM B;  3HF5 A;  1K9M T;  4DV5 F;  1KQK A;  2ASJ A;  1TKX B;  2DT9 A;  4WU2 A;  3GE9 A;  3W3S A;  3ILJ A;  2BR0 A;  4NLG A;  1WC5 A;  2CDR B;  4GKK F;  4DCO B;  1H73 A;  5DDR C;  4JYA F;  2MQL A;  1J5O A;  1UEU A;  4M5D B;  5DG9 A;  3T5K A;  1LWF B;  1U7L A;  1VQM S;  4IKA A;  2HHS A;  4NAS A;  4ZVF A;  2VPY B;  3KK1 A;  4ED1 A;  3SDE A;  3AQO A;  1KC8 T;  3M2V B;  4E0D A;  4ZVQ B;  3DMJ B;  4DV1 F;  4ENO A;  4HDH A;  3KG1 A;  4WFX A;  2PEB A;  3CCS S;  1SJF A;  4NRU A;  2UU9 J;  3NNA A;  4LFC F;  2V9W A;  2BXJ A;  3BN7 A;  3JXO A;  5HO4 A;  2X51 A;  1IBM J;  2NSC A;  2DXE A;  2BJD A;  2WB1 D;  3IO1 A;  2ZNZ A;  3F0N A;  3PEJ A;  1IR1 A;  3H5Y A;  3O3L A;  4H4O A;  4NLD A;  2NQP A;  5ETL A;  3VTI A;  1RWO B;  2JNJ A;  3UDL A;  4C6A A;  2AKW B;  2RE1 A;  1XMB A;  1YHQ S;  4KH0 B;  1QTG A;  2V68 A;  4JBC A;  4WFN Q;  3Q22 A;  4DL4 A;  4DBQ A;  1VQ7 S;  5CHC B;  1B01 A;  3AA9 A;  4LIR A;  2E7X A;  4WFA Q;  1WEX A;  3DLK A;  3AFG A;  1TFW A;  2NSB A;  5AXN A;  2R8G A;  1RWP B;  3CDB A;  2H65 B;  3PAC A;  3SCJ E;  2KKH A;  1MWZ A;  2AX0 A;  3D4J A;  2YY3 A;  4AE5 A;  2CAD A;  5H1S V;  5HP1 B;  2CVI A;  2K1R A;  2Y1L B;  3IMQ J;  3LAK A;  3NRB A;  4UUX A;  3W63 A;  4DHV A;  4UT4 A;  4F4Z A;  5DG7 A;  4UOC A;  4ILM A;  4RW4 A;  4HHJ A;  3CE8 A;  3T6J A;  3OR2 B;  1XNR J;  3DU5 A;  4PWD B;  1JLE B;  1WF2 A;  3DRP A;  1LFW A;  2L48 A;  4DN0 A;  3C2P A;  2GJI A;  2WSE C;  1F9E B;  4IO1 A;  2XMA A;  1Q16 B;  4O3S A;  3A8J A;  1LW0 B;  2GIF A;  3TVZ A;  3TW0 A;  5K14 A;  4JI5 J;  3KK2 B;  5D15 A;  2JH3 A;  3EGV A;  1NK9 A;  1B70 B;  2R8I A;  3T1H J;  1FXD A;  3T5J A;  4EUV A;  1T05 A;  3MM9 B;  5E3P A;  5B08 A;  1ZPV A;  2OP5 A;  1Y10 A;  3POT B;  1KFS A;  2OPR B;  1VC5 A;  4RW8 B;  1IKV A;  1SUQ B;  2VIC A;  4L72 B;  4DX8 H;  4Q0B B;  1HWK A;  3RBX A;  3MF5 A;  4LF7 F;  2I1R A;  4NOH A;  4CLW A;  4OZ0 A;  4X4V A;  4NCG B;  4QYZ J;  4ID5 A;  1JMT A;  4MFB B;  4WYW A;  3EM1 A;  2V6A A;  3TYT A;  5C25 B;  4OFZ A;  2HVI A;  4KQZ A;  2N4D A;  2M8H A;  2K9I A;  2HFZ A;  3PJX A;  4DR4 J;  1XBW A;  5LJ3 Y;  2AP6 A;  2AIR B;  3CJ8 A;  1FO1 A;  2W9C A;  2DGO A;  1SJ4 P;  4LSN B;  2NXN A;  3TA0 A;  1IQZ A;  5E3Q A;  5LMU J;  2E44 A;  2H54 B;  4DQS A;  3VZI A;  2BE7 D;  1YBA A;  3PHT A;  3PRV A;  5EX3 A;  3AT1 B;  2QT7 A;  4UQG A;  4J9U E;  1BWE A;  4F2R A;  1KKH A;  5C7P A;  2XB2 D;  2JEF A;  3MMA B;  3OT9 A;  5IC4 B;  5HRO B;  4ZVE A;  2BW2 A;  2VHG A;  1YJT A;  3NBP A;  4Z7Y A;  4LJM A;  1ZM4 A;  2D3U A;  1S0V A;  3DI6 A;  4MT1 A;  4XDD A;  1TUG B;  2HAF A;  1XMQ J;  2VDI A;  2VOP A;  1P94 A;  3E01 A;  2GJ2 A;  2WTF A;  3VAF A;  4LRF A;  1JLA A;  2I38 A;  3HLU A;  2HNY A;  2HSE B;  2DIT A;  5HVG A;  3BKT A;  1H74 A;  1Q8I A;  2IJR A;  2D3O R;  2QN6 B;  3MM6 B;  4FNI A;  5HJY A;  1KRP A;  1EA4 A;  1MNT A;  3IBC B;  2NZ4 A;  2HRU A;  2YTC A;  4CO3 A;  1BAZ A;  1FTR A;  2CPF A;  2E5H A;  1HMV B;  2QSW A;  3DI6 B;  7AT1 B;  1DLO A;  3KG4 A;  1T9W A;  2VB6 A;  3BV8 A;  3M1V B;  4I2P B;  1S72 S;  4ECX A;  5HRO A;  4W92 B;  3HHN B;  3IG1 A;  2DNM A;  2Q3P A;  2YNF A;  1NPP A;  1MW7 A;  3ITH A;  1RWV B;  2K29 A;  1QE1 B;  3TAN A;  2JOQ A;  2UXC F;  4HH0 A;  3SMZ A;  1N5V A;  4Q43 A;  1WI6 A;  2B8P A;  3R97 A;  2ASD A;  1JK9 B;  2AX1 A;  4X64 J;  1L3S A;  4OHY A;  2LXF A;  3PIO Q;  1WTF A;  3PYG A;  4PG5 A;  3HSG A;  3UN3 A;  5C5J A;  1LV5 A;  2UUB F;  4DV4 J;  1LXN A;  2WSF C;  2FHJ D;  2BVZ A;  2Z57 B;  4B3S F;  4B3S J;  2XSJ B;  3J7Y U;  4ZCL A;  4CYU B;  3CNQ P;  2RU3 A;  1J27 A;  1X4H A;  3UD3 P;  2LA6 A;  4DZ6 A;  4B9U A;  3MR3 A;  4X64 F;  1D09 B;  5ETM A;  3IR6 B;  3UN5 A;  4Q45 A;  2WAQ D;  4F4A A;  3WIV A;  3T5H A;  3RR7 A;  3KNA A;  3UNG C;  1X4D A;  1N5Y B;  3FCW A;  3MED A;  3RU0 A;  1WF0 A;  1F9H A;  3CJK A;  2VON A;  2FVS A;  2E66 A;  4B9S A;  2R7O A;  2KEL A;  4OZ2 A;  3GZ7 A;  4PXB A;  2WOM A;  4OZL A;  4ZOS A;  4B3R F;  2KI2 A;  2FHM A;  1RWK B;  4DUZ J;  1IM6 A;  1RA6 A;  2XUL A;  4CLU A;  1NHK L;  1UMJ A;  1YQH A;  4DV6 J;  3OXG A;  1NDC A;  4USJ C;  1LXJ A;  2B7C B;  2OHD A;  1CQM A;  2X1B A;  1URN A;  1TL5 A;  3MI7 X;  2OPP B;  1MMD A;  1GMU A;  1WWH A;  2DNL A;  2JLF A;  2RQK A;  2ZNY A;  1P27 B;  1YBU A;  2BAC A;  4LVN P;  4M8L A;  2WRM A;  3SBM A;  3JSM A;  3F73 A;  3BO3 A;  1HNV A;  4L74 A;  5L38 A;  2BNZ A;  3I55 S;  4GC6 A;  3RB0 A;  3DLH A;  3D54 A;  2GMH A;  4X84 A;  5F3T A;  9RUB A;  4H4M A;  5D6G A;  4A48 A;  3CCU S;  2HHH F;  1LWC A;  3GLJ A;  3NOG A;  2HFN A;  3BEG B;  3S7R A;  1X4G A;  3UWT A;  3MZI A;  1B0V A;  3ZTQ A;  5LXR A;  1R0A A;  2ZC4 A;  1WTB A;  2YQ0 A;  3QMQ A;  2LDI A;  1SI9 A;  3GSI A;  5BYQ A;  1VK8 A;  2O5D A;  4J37 A;  5AT1 B;  3X3U A;  5HP1 A;  3M8Q B;  5L9N A;  4DR3 F;  4OHX A;  3I9V 9;  1GX5 A;  3ZC4 A;  1F3V A;  4CO5 A;  3I56 S;  1TL1 A;  4OI6 A;  2HMI A;  3M05 A;  2FC9 A;  1NDL A;  3NKY A;  5CZX A;  1RWW B;  5GME A;  2BJ1 A;  3C14 A;  4U6P A;  1GTE A;  2FJE B;  3QYY A;  2PD1 A;  4KKO B;  2HQG A;  5I3Q A;  1UP1 A;  1N54 B;  4CO4 A;  3ITH B;  4ED0 A;  2VPZ B;  2Y9H A;  3KLI B;  3BRE A;  3E3X A;  1FD2 A;  3GYN A;  4B9N A;  3UR3 C;  1GMV A;  1DTT B;  1Q0N A;  2F8H A;  1MG7 A;  1TKT A;  2CPZ A;  3DOM B;  2MY8 A;  1HAR A;  2E1P A;  4KPC A;  3BGR A;  3T6B A;  5MLC V;  4JI8 F;  1V3S A;  1ZAW A;  1W7W A;  4LSL A;  4OX8 A;  1KTV A;  3US5 A;  3C6T A;  2PA3 A;  4DR1 F;  2O3D A;  1UVN A;  4LF7 J;  1ARO P;  2DB1 A;  3LW5 C;  3HM9 A;  2E5I A;  2F9J A;  3AH6 A;  2FY1 A;  4R25 A;  4QU7 A;  2D9P A;  4WP3 A;  1YDL A;  5LXY A;  3ZZ0 A;  2JC0 A;  2JXG A;  1RA7 A;  4KKO A;  4AQY J;  2B43 A;  1S77 D;  4OIX A;  1EZZ B;  4DSF A;  4RNM A;  3M2U A;  1O5J A;  1FDA A;  4PUO A;  4ZLP A;  2LU1 A;  2XWX A;  3BGU A;  2H9Z A;  1U09 A;  4HHH A;  4USI A;  1SCJ B;  1N56 A;  3MMB A;  1YJR A;  2X3G A;  4NZ6 A;  5KG6 A;  1SKR A;  2L9N A;  4MIA A;  1ROF A;  2VA2 A;  4Q2M A;  1EP4 A;  1TK8 A;  2W2P P;  2MKC A;  3OHB A;  2YQ1 A;  4F3Q A;  3HCX A;  2CJA A;  5E3R A;  2R8K A;  4FS1 A;  3V4I B;  1FWK A;  3DKD A;  1RHK B;  3IRX A;  1L3T A;  2IDE A;  1SV5 B;  5B0E A;  3OFF A;  2W9C B;  4DV7 F;  1PAE X;  1YK9 A;  2EKY A;  3UW1 A;  3KJQ B;  5HSP A;  4YY3 F;  2IMO A;  3MEE B;  1DZ5 A;  3M9N B;  5GAD I;  1APS A;  3HD1 A;  5T14 A;  3LH2 S;  4CIO A;  4LF8 F;  3B8H A;  2EKN A;  1JLC A;  1FKP B;  5CQG A;  3N01 A;  4ZPV R;  1AZS B;  4N76 A;  2MLX A;  1N36 J;  5B0G A;  1NBE B;  4J9R A;  3CUL A;  2J0Q D;  4FN5 A;  2XGP A;  2EFQ A;  4IH7 A;  4MKV A;  4XTT A;  3I31 A;  4ELT A;  4HR2 A;  1IKY B;  1N5Q A;  3H42 A;  2B4O A;  2CRL A;  2E1A A;  3CJK B;  4LBI A;  3UDV A;  1RAE B;  1VHI A;  5MAO A;  2UU9 F;  1VDH A;  4C8Z A;  1O51 A;  4K0K J;  1N5S A;  2HBR B;  4MKA A;  1D9F A;  4X4O A;  4I6A A;  1TK0 A;  2R7X A;  3GV5 B;  1RT1 A;  3S1T A;  3RGI A;  1U49 A;  3D1H A;  1JLQ A;  1FEE A;  1RGV A;  1VRU B;  2DH7 A;  3PEH A;  1S9G B;  3ZZY A;  2DCU B;  4ZA1 A;  3OSP A;  2YXL A;  5KFK A;  2NR0 A;  2B4U A;  2V67 A;  2U2F A;  2NYH A;  1S1V A;  1CSJ A;  3W62 A;  3BQ1 A;  1HNX J;  3GFH A;  1JNZ B;  2OEM A;  3C66 A;  2O1P A;  1HBM A;  1S6P A;  2MY7 A;  2EWH A;  2F7V A;  3VR1 A;  2IBO A;  2GJF A;  3CD5 A;  2HG4 A;  3DRS B;  3PVX A;  4WPA A;  1Y0H A;  2R9L A;  3P49 B;  2XI3 A;  1K1S A;  4KT0 C;  2QFI A;  5B0D A;  4J9S A;  1YKW A;  1UEK A;  1XC9 A;  2DVI A;  1VRU A;  3R7N B;  4DSI A;  4JI7 J;  4QCL A;  1KVJ A;  4KAI A;  1M1H A;  2VOD A;  4WE1 B;  4MK8 A;  4XDC A;  4DUY J;  1GAO A;  3Q8Q B;  4NWB A;  4PXE A;  4ETX A;  4J9O A;  1FKA F;  4JI3 J;  2H5E A;  1HLW A;  3DLK B;  4YN3 B;  3SV4 A;  3TAM A;  4Y2A A;  3MAH A;  4DF4 A;  1PBA A;  3SXL A;  3NAI A;  2FTR A;  2HQC A;  1W25 A;  5DZ6 A;  4N8N A;  3DOK A;  4J9Q A;  3LJP A;  3HXM A;  2W8K A;  5F0W A;  1Y7P A;  3N9U C;  4NLX A;  5J2P A;  2V8P A;  4NI2 B;  4HDG A;  2DK2 A;  3VQT A;  1RTH B;  2GHV C;  3GB0 A;  3BJY A;  1JXL A;  3KUH A;  5CCM A;  2IC3 A;  2B51 A;  2PMH A;  4CZC A;  3TAP A;  3PV8 A;  1QAI A;  1BE4 A;  3RRK A;  5A8K A;  5KG0 A;  1CPZ A;  2GA7 A;  2V2Z A;  4CLZ A;  4DZD A;  4IOA Q;  1PO6 A;  2OTJ S;  2C22 A;  3DLJ A;  5D78 A;  3NGR A;  1C0T A;  1RAG B;  2I5J A;  3GR1 A;  3O44 A;  4RU9 A;  2IA0 A;  1T94 A;  1SV5 A;  4I56 A;  3TJ8 A;  3MUV P;  2H5I B;  2YKN B;  1VC6 A;  1WEZ A;  3N6M A;  1UFK A;  3ZNJ 1;  1MWQ A;  4OYZ A;  2ZH7 A;  2JC1 A;  4KY3 A;  1G6B A;  3JAM Y;  4KHM A;  2DH9 A;  3N0V A;  1HW8 A;  2QC3 A;  3J81 Y;  2E1C A;  2E9R X;  2AJ0 A;  4KHP F;  1WSV A;  3NGT A;  2K6L A;  4I7F A;  1NHV A;  2RS8 A;  1RQ0 A;  2X7I A;  5KFM A;  4K4V A;  3EDR B;  3MMB B;  1EJ7 L;  4UTG A;  1OO0 B;  1AFJ A;  3M1V A;  3A13 A;  2LXU A;  2Z58 B;  1UW4 A;  3DHW C;  3M6X A;  3GU0 A;  4OYM A;  3VCD A;  5L1I A;  5J2N A;  5G4D A;  2N3O A;  1HL6 A;  5J2M B;  3DXB A;  5F3Z A;  1U1N A;  1CVJ A;  4PXC A;  3HVR A;  5F9N A;  5HQL A;  3UDC A;  4ED5 A;  1FT8 A;  2Q6B A;  1RLC L;  1WUU A;  4TXS A;  2IVF B;  1YJN S;  1JLB A;  2WZ1 A;  3CDA A;  3MEG B;  1N88 A;  3NAH A;  2XM3 A;  2ERR A;  5J1E B;  1RIS A;  2OML A;  3BM7 A;  4AND A;  1NK5 A;  5IT9 U;  1U2R A;  2FVC A;  3TA1 A;  3TVY A;  5J2M A;  4WZM A;  2IVY A;  5KOX A;  2XS7 A;  2CQH A;  2W24 A;  1YIT S;  4DN9 A;  2COL A;  2OGU A;  3KUE A;  3OPK A;  4I2Q B;  2FJB B;  3KLF B;  1MSW D;  1HNZ J;  1X93 A;  2D7S A;  2KN4 A;  2JRS A;  5L1L A;  1H2V Z;  5KG1 A;  3G6Y A;  2BQ3 A;  1TL3 A;  2VFV A;  4F0M A;  1HKA A;  2QA4 G;  3GJS B;  2FB0 A;  2CQD A;  3BBF A;  1X0P A;  3GJT B;  1Z1Z A;  3NCQ A;  3PFO A;  4DJB A;  1L3K A;  5GMK a;  1WOS A;  3MAA B;  5K5M A;  3M8S A;  2UXC J;  5A8W A;  4RU2 A;  1ICE B;  4N47 A;  2UUA F;  3L3C A;  4UZB A;  4LF6 F;  3KOA A;  1QAY A;  3NG8 A;  3PRB A;  1VRT B;  2CVE A;  4IH5 A;  4KGM A;  4LF5 J;  2AJ4 A;  5CYQ B;  1VIO A;  3IXQ A;  3P5T L;  3DGP B;  4LBP A;  5IWA F;  3PKM A;  1VLY A;  5HBM B;  1B7F A;  3ZFV A;  2R3V A;  4WKR A;  5KFZ A;  4RWW A;  3QRQ A;  3HUL A;  4YFU A;  2VFS A;  3HZG A;  3BBC A;  3VVT A;  4FBU A;  4NCG A;  4QIF A;  2LQ8 A;  3G71 S;  2EBG A;  2E5J A;  1CQN A;  5SZT A;  2J7K A;  1S0N A;  4LQ9 A;  2VAS A;  2A2B A;  4I6W A;  1IUJ A;  2POK A;  2OPR A;  3OL7 A;  3M2R B;  3G6E S;  1YRT A;  3ELH A;  1VLO A;  4P2S A;  1PYT A;  2HUR A;  3NL0 A;  2YKA A;  3MMJ A;  3T1Y F;  3THP A;  4U96 A;  3IR7 B;  3VGU A;  2CIM A;  2ZBI A;  1S10 A;  4G1I A;  3I9Z A;  2R2T A;  2CPE A;  4AL7 A;  1AZS A;  3PHE A;  3BSC A;  1JLC B;  1FKP A;  3Q8S B;  5ETT A;  4MJK A;  4C7Q A;  3G96 A;  5H9F K;  3MHY A;  2HVH A;  1RT7 B;  3R1H A;  1AUD A;  2FPH X;  4I69 A;  3SDE B;  4CM0 A;  3PZP A;  2K06 A;  2G2Y A;  1FRM A;  3C15 A;  5KFW A;  4B3M F;  5C24 A;  1HWI A;  1PAU B;  4B3R J;  1WC3 A;  1Y11 A;  3LP1 B;  3AD9 C;  3T9Z A;  2FLN A;  1RT3 A;  1WHW A;  4CLF A;  3KJF B;  1BQN A;  3TZX A;  5DO2 A;  3VAM A;  4C0O C;  2OSQ A;  1ZZF A;  2XNR A;  4KO0 B;  2CAX A;  2CZV C;  3U27 A;  2XSJ A;  5HLF A;  4K4W A;  2RH3 A;  1QAJ A;  2CNK B;  4DFK A;  3L09 A;  4ED3 A;  1HQ2 A;  4DQP A;  3OVB A;  1A7G E;  3HVA A;  1DY3 A;  2C3U A;  3OTD A;  4WK1 A;  2WCX A;  3UCG A;  4LIW A;  2CZ9 A;  2RIL A;  2PT0 A;  5KFF A;  3K59 A;  2H4Y B;  3L4B C;  5CYM B;  2HNZ A;  5HJX A;  2FGC A;  1KLN A;  1S1T B;  3EPI A;  1CUL A;  2CQI A;  4LF2 A;  4OYX A;  1MWY A;  3H87 C;  1SKU B;  3B54 A;  3M32 B;  1JNR B;  5ETK A;  4CLS A;  4ZLJ A;  2GO8 A;  1IJF B;  2PN6 A;  3FKB A;  1ZS6 A;  1YRX A;  3ISN D;  1WG4 A;  2YWW A;  4KSE B;  4U8V A;  3W9J A;  4C48 A;  1N34 J;  1PAR A;  2LMI A;  4P52 A;  3R7S B;  5D77 A;  3Q23 A;  1FDB A;  2A3J A;  3SV3 A;  3ISN C;  4KBI A;  4QQB A;  4JV1 A;  2ZFH A;  4I68 A;  1VQP S;  1K0T A;  1TQL A;  3M32 A;  4QW9 A;  4ZP9 A;  1GX6 A;  4NPO A;  4ECT A;  5M2U A;  4ZS6 A;  4BS2 A;  5HMX A;  5CYM A;  4QWE A;  3RTV A;  1U8S A;  3ET6 B;  1RAD B;  8RUC A;  2YKM B;  1SC3 B;  5L1J A;  4LRB A;  2GML A;  5D4O A;  1CS4 B;  2M0G B;  4A8X A;  4DG1 A;  5A6P A;  3MCO A;  3MFI A;  3ILO A;  4J5O A;  2AV5 A;  2IYG A;  2YBV A;  2OI2 A;  4USM A;  1NK8 A;  2JXH A;  3HHK A;  1FJC A;  1OYD A;  4PRF A;  1PG5 B;  3JQJ A;  3SQG B;  2KZZ A;  4BLG A;  1ZH5 A;  5IQQ A;  1UWB A;  2DD8 S;  1T0T V;  1TV6 A;  1RT6 B; 
#chains in the Genus database with same CATH homology
 4D8J A;  2AY0 A;  1BDT A;  1PAR A;  2K6L A;  3FMT A;  2BJ8 A;  2BA3 A;  3LGH A;  2BJ9 A;  2CAD A;  1X93 A;  3VEA A;  2CAX A;  2HZV A;  2NZC A;  2KEL A;  2WVC A;  2K29 A;  1MYK A;  1BDV A;  2JXI A;  2F1F A;  2PC6 A;  1MYL A;  1Q5Y A;  3QOQ A;  1NLA A;  3OD2 A;  2JXG A;  3BKU A;  3FT7 A;  1P94 A;  2K9I A;  2BJ1 A;  2FGC A;  2Y3Y A;  3GXQ A;  2HZA A;  2BSQ E;  2WVB A;  4ME7 E;  3BKT A;  1ARR A;  2CAJ A;  1B28 A;  4FXE A;  3VEB A;  3BKF A;  2BJ7 A;  1IRQ A;  1QTG A;  2JXH A;  3H87 C;  2RBF A;  2GPE A;  2H1O E;  1EA4 A;  1MNT A;  2WVD A;  2K1O A;  2BNZ A;  1Q5V A;  4HV0 A;  2WVE A;  1U9P A;  2WVF A;  2BJ3 A;  1B01 A;  2BNW A;  1BAZ A;  2K5J A;  3VW4 A;  2CPG A;  2CA9 A;  1ARQ A;  3PHT A;  3QSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...