1Q5VA

Apo-nikr
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
132
structure length
115
Chain Sequence
MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQHGTQGFAVLSYVYEHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nickel responsive regulator
publication title Crystal Structure of the Nickel-Responsive Transcription Factor NikR
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 26
structure length 115
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 1q5vA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 1q5vA02
2GPEA 2F1FA 2Y3YA 1MYKA 2BSQE 4D8JA 3FMTA 2FGCA 2WVFA 4FXEA 2HZVA 2WVDA 2JXIA 2BJ8A 2RBFA 2BJ9A 2KELA 1ARRA 3H87C 2K5JA 2WVCA 3OD2A 2BNWA 2CADA 2K1OA 1QTGA 2H1OE 1U9PA 1MYLA 2CAJA 2BJ3A 3QOQA 1Q5VA 2JXHA 1BDVA 3QSIA 3BKUA 1MNTA 3VW4A 1IRQA 2BA3A 2K9IA 2WVEA 1PARA 2WVBA 3PHTA 1X93A 3VEBA 2K29A 1EA4A 2AY0A 4HV0A 2CPGA 1P94A 1BDTA 3BKTA 2HZAA 2K6LA 1B28A 1B01A 3BKFA 3LGHA 1BAZA 3FT7A 2PC6A 2BJ1A 4ME7E 2BJ7A 3GXQA 2CAXA 2JXGA 3VEAA 2NZCA 2CA9A 1Q5YA 1NLAA 1ARQA 2BNZA
chains in the Genus database with same CATH superfamily
2B51A 1RT5A 1VC0A 1SUQA 3LP0B 1GXLA 2H54B 1YJNS 1PCAA 4HR2A 1L3SA 1BD6A 3DDKA 2ZBQA 2QLJB 4JYAJ 2ROGA 3PKYA 3CTRA 4C0OC 2R7TA 2HW3A 1RYSA 2YNGA 1M1GA 2XS5A 5CYQA 3R5AA 3CIZA 3J81j 3LP1B 4OYAA 2ZOFA 3TUJC 5F9NA 4ZLPA 2M8HA 2R8JA 5AE1A 1H2TZ 3L7UA 2GMHA 3R1LA 4XIUA 2MQMA 4DV7J 1TL3B 1V3ZA 5KFOA 1KOHA 1UJ4A 4R8UA 2G0CA 3HK2A 3KLIB 4H4KC 4RNOA 2IBOA 2R8IA 3K59A 2QL7B 1RAFB 2LYVA 1YZ7A 3NOCA 1PGZA 3M4XA 1GQEA 1YVFA 1CJUB 1RAGB 5DDQC 1ZETA 2YY3A 1WHXA 1NUEA 4NYOA 2YKNB 1FCAA 5KG3A 5EX3A 2C3OA 5K8MA 1WHYA 4JI6J 4CH7A 4ED0A 2VQFF 1NKEA 2CKWA 4TU7A 2XI3A 4YY3J 3KXDA 2C28A 2Z2YB 1M90T 1RE1B 2AGOA 3N79A 4RW4B 1NZAA 4JB8B 5FD1A 4OZNA 3SEOA 1M5PC 2O1PA 3TEHB 2KB2A 4B9SA 1EQ0A 1S4FA 2ZH4A 3CSKA 5KFHA 5KG6A 5AE2A 2B3TB 2BJ3A 4WTYA 1UW9A 4OZ3A 3NGRA 1LWFB 2G9OA 3DI6B 2HNDA 1VQKS 1LW0A 3AQPA 4J9MA 5FIIA 3K8VA 1KONA 2VB6A 4USWA 2VKRA 2GJIA 3NNAA 1N5TA 3SSRA 3AJ2A 5IT0A 1RTZA 2VUGA 3RRKA 1KOOA 3EWGA 4LRAA 2R7RA 2EFPA 3P5BP 3B54A 2IYGA 4FXWA 1HNVB 4UOHA 2E9ZA 3HP6A 2IMWP 4X4VA 1QJHA 4LR8A 5BR8F 3QJJA 2CQ1A 4EWTA 3HJVA 3M8RA 3W61A 2AEJA 4IRDA 3CF5Q 4YB5A 3H59A 3PDNA 3EDQB 1RBAA 4CYUB 4MJKA 5K5MA 2UXCF 1CLFA 5CABA 1AW0A 2VC0A 4O3NA 1S48A 1HNZF 2HEKA 2P5VA 2V0NA 4DUTA 4NI2A 2RF2A 2JJ4D 2WVCA 5HQ8A 4TYAA 3N28A 3OR1A 2ZH5A 2CIMA 4FF2A 4LFBF 1N5VA 3Q86A 3DDIA 5ETNA 1V5VA 2CJBA 3GIRA 1BWVA 1RT3A 3RR8A 1BQXA 2V69A 4L3KA 3TR5A 4IH7A 1N54B 1QVFR 2J0SD 3HDSA 5BYQA 2EXUA 3LGNA 2E5IA 3QBCA 3LPYA 5LL6d 3M8ZA 4MIBA 4WFAQ 3POTB 5HJYA 3CNQP 3FMWA 1UWBA 4Y2AA 1UPMB 1Y5IB 4Z7YA 4PR6A 2GQCA 2GA7A 3QJLA 2UU9J 4C98A 2HAIA 2HQDA 1VK3A 2NCKL 1HQ2A 5K20B 2KTQA 1C1CA 2MKIA 1ZM3A 3RZAA 2OP5A 3LWMA 3ENAA 5CH7B 3X3UA 3BB5A 5KG2A 1HR0F 1MG7A 1RBLA 4IKAA 3NNCA 1VOMA 4ED7A 4M5DA 1S0VA 2CQHA 1VYAA 3OVSA 4PG5A 5DDRC 2V8PA 1WUUA 5C2GA 3WDOA 4IH6A 4JUZA 3AXMA 4KGKA 1X7VA 2RNEA 1RYRA 2I2YA 2XSFA 4JI8J 2QT7A 1U1PA 5E5NA 1DZ5A 1T9WA 2VFUA 3M32B 3I0SB 2DD8S 4RW8B 1N56A 2FD2A 3D6FB 1X4GA 1GNKA 1C4AA 2CPGA 3N6NA 1U0HB 4DZDA 3TJAA 2R8HA 3NXZA 1OSCA 4F36A 3CCTA 3PCOB 3LPEA 4NCGB 4IOAQ 3MTJA 4B3OA 2F40A 2EG2A 3EGVA 2JNJA 3H8YA 4F0KA 3IRXB 3U7JA 5A8WB 4GVBA 3ZNJ1 3O8WA 2I8EA 2PMWA 3R5GA 1SXLA 4DI6A 1NXIA 1FJGJ 4F2SA 1FFGB 1FKPA 5KG7A 4DR1J 2UV8A 3DLBA 2BRKA 1FRLA 1PSDA 2WSEC 2YKPA 4OV6A 1SC4B 5C25A 4C3KA 5LSOA 2VFTA 1QAIA 5CD4A 2ZD1A 4LFCF 4OX9F 3W3SA 1IKYB 1WD6A 3W1YC 3O6QA 2AV5A 2UXBF 1HARA 3M2VA 2BW7A 3NAHA 2O5DA 3MDFA 4DR4F 3C15A 2CQPA 2V4JA 1Q16A 3CMAS 3VHQA 1F9FA 1LWCB 2PD1A 3D4JA 2ATLA 3ENQA 3CD6S 1KFDA 5B0EA 1OYDA 1S57A 4A4JA 1JLEB 2HFOA 1VJQA 2N3LA 1NDPA 2C2KB 2O01C 2QLXA 1B01A 4LFBJ 4MYTA 3HFKA 3R5CA 4ZVSB 4DL0C 2U1AA 3DXSX 4CZCA 2NYHA 1KLNA 2V2VA 4FKXA 3KNGA 4DR6J 1HPZA 2R9LA 1K73T 3DLEA 2A3JA 1VQ8S 3M6XA 1S79A 1U1RA 2WOMB 5CCLA 3HO1A 3W5ZA 4NLSA 2LVWA 4LF6F 3MM6A 1RT2B 4ZPDA 4WPAA 2XWYA 4F2RA 2D9PA 3GR1A 2CAJA 1TV6B 2OD6A 4IG0A 2RQKA 5KFUA 3CJ3A 4DWIA 4YB1P 2XYPB 3I32A 1DAXA 1PAUB 2KFYA 3KJNB 3IBFB 4ZDNA 5LOQA 2C2EA 3UW1A 3OTOF 4IQMA 4U8YA 2H3AA 2PA8D 4HACB 5J2MA 4CM0A 2ZVSA 2J6UA 2B4UA 1HNIB 1ZOTA 1R6YA 2EFVA 4IUFA 1EARA 4YQWA 2ACYA 2MLZA 1FDAA 4URQU 1Q8BA 2B4PA 1U6FA 5EUHA 4DPOA 3HHLC 3T5JA 2LU2A 1FDBA 4KV8A 3G82A 2N7YA 1ZAWA 4WXWA 2PI4A 2FY1A 3RG6A 2K1OA 1T95A 4WZMA 2MPUA 3D6MB 2ZBIA 5HMYA 1YDLA 2VICA 3QQCD 1F9HA 1ZTTA 4I6WA 1NO8A 3OLBA 2XBPA 2MQ8A 4NLDA 3AHPA 3DN9A 3GCXP 3TZZA 2GVDA 2L41A 5G0RB 4LFCJ 4WU2A 4RU9A 2DNOA 2UXBJ 1RI7A 1DHMA 4URSA 4DV0F 5K9FA 2RHQB 4DR4J 1LKZA 3KHHA 1XMOF 3PW0A 4BWJA 2IM0A 3DOLA 1KQKA 3GILA 1QAYA 2NSCA 5T7LB 1AB8A 1WHVA 3ZZ0A 3D6HB 3MM9B 4U67Q 3G86A 2RT3A 2H1YA 3KLGB 1KDNA 1RT5B 5D0EA 5IXUA 1GTHA 4QYZJ 2U2FA 2AX0A 2C42A 2YNHB 3FBBA 4ZCIA 2XO7A 2KO1A 4DBQA 3WX4A 4DR3F 1NSPA 3N01A 4J9RA 2R2TA 2FLPA 4RNHA 5CYQB 5DRKA 4F02A 1UEKA 3TVKA 3FZ2A 1UEVA 3D1HA 2BM0A 5E3PA 2M4MA 3PHTA 2HGNA 2NS1B 4LF6J 5SUHA 2JFKA 1VK8A 3OL7A 1KS2A 4NXNF 2RS8A 3QFHA 4R8UB 3MMJA 2Q3PA 5IOLA 3HD1A 2IYIA 1QDUB 2DR6A 4ZVTB 3D1OA 4IRCA 1J27A 5B0BA 4RO0A 5SZTA 1VLOA 1JQGA 4DSJA 1X8DA 3QT6A 1CS4A 2LQBA 4ZP8A 3IGVA 3QRRA 1IKVB 2QMWA 2VBXA 4FPIA 3M9OB 4G1QA 5EGYA 2AIRB 5HI7A 4DLGA 1SJ1A 2IC3B 1AROP 1FXLA 2ASJA 1CQNA 2M7SA 4DQSA 4V1Ak 1VJWA 1GK8A 2YH0A 4N41A 2MB0B 2ZOGA 4FBTA 2HGLA 1ZAVA 1WC3A 3TZWA 2EFQA 1FNMA 3TWZA 3CMES 4CLPA 2UZAA 4KGXB 2GHWA 2CQGA 5HK4A 1RZMA 4ZCKA 2F9JA 1S9EA 4C3MA 3GE9A 2IY5B 4ILMA 4M5GA 2A1BA 3UO0A 2IHR1 5FDLA 3FFIA 4LVOP 3CDAA 4OJ1A 2RUSA 4WYWA 1NRKA 4PG8A 3KLHA 3W62A 1FEHA 3IP0A 2DHAA 4H4OB 2GX8A 4CCHA 1RXOB 1WF1A 1NJIT 4DV6F 2VDIA 4ZJOA 5JUMA 4OZ2A 4TU8A 2HK2A 4NLQA 2KZZA 1SKUB 4RNMA 1OQ3A 2PIIA 1LQ9A 4JI5J 1LW2A 4DV0J 4A8SA 4O0NA 5J1EA 1CPZA 2O67A 1TQLA 3MHYA 3SI8A 1YLXA 2YWHA 5CA5A 4KBIA 4IR1A 2WAQD 3IM8A 3WC0A 3HVAA 1R8CA 1MWZA 4CH0S 3R5DA 3M8QA 2Q43A 1D0EA 1S72S 1RT3B 3MMBA 4DR2F 1IJEB 3OL9A 1RA6A 2ZNZA 4QIWD 4HDGA 4OQJA 1K9MT 2W9CA 2MTLA 3J7A1 4DR3J 2SXLA 2R8GA 3P5TL 1RTHB 1YTYA 4P7VA 1NK4A 2DR9A 2HPUA 1HMVA 4F0HA 1FTCA 4WWSA 2EKNA 1CC8A 3JSBA 3ZXWA 4AL5A 4DX5A 5CHCB 1KTQA 3H20A 2LQ9A 4FYVB 4NXNJ 2BQ3A 1S9FA 1SC3B 3OHBA 4P2MA 4FVCA 1B99A 1JKHA 4P10A 3EMTA 4ICLB 4Y2KA 3W9JA 3M8YA 5E3QA 1P8GA 4TY8A 2JEFA 3UD3P 2ROPA 1GT8A 4RWWA 4BC9A 1U49A 3OR2B 2A2BA 4X4TA 3SXLA 5KFRA 1JB0C 4RZRA 3M2UA 2ZHBA 5K14B 1NSAA 2LEPA 5I3PA 4P52A 5HLFB 4J9SA 2NXJA 4EYHB 2X51A 4IFYA 1RWPB 3M8PA 5KFGA 2KH9A 3GMGA 1JX4A 1UJ6A 1ZTWA 4KAIA 1FE4A 1X5TA 2VG6A 2NZ4A 1J5OA 2R7UA 4C7QA 3MOJB 2OTJS 1UZDA 2MKJA 4MKBA 5ETRA 2ZBRA 4B3OB 4IO1A 2E5HA 4ECUA 4QWCA 1VQ9S 2G1HA 2FJXA 2GPEA 3HI9A 3UDCA 4LF7F 3ENWA 2RRAA 3LP2B 2MZJA 3PKMA 3MM8B 4WFZA 4P74A 2MQPA 1HI8A 2W2QP 2XHCA 4PPDA 3MWBA 1X5OA 4NZ6A 4D3HA 4P2XA 2HFSA 3AOAA 3UCZP 1IJFB 2IMOA 4J90A 2LXFA 3LWLA 2KKHA 4P2SA 3B6BA 2BJEA 3ILIA 5B0DA 4GO7X 4JI7J 3AD9C 2AQ4A 4CH1A 3NBPB 3JYTA 2B6AA 1HLWA 3GCWP 4O0IA 1AUSL 4NE9C 2ZWOA 3C15B 4CT9A 4KH1B 5DLGA 2EFNA 2MZSA 5F8JA 3MMAB 3TA0A 2DPIA 4ZMMA 3A8JA 2BR0A 3DOKB 2F65A 2C2NA 3DKDA 1Y7PA 2ASYA 3I87A 2YX4A 4DR2J 4Q45A 1KLMA 5IZHA 1RP5A 3DRSA 3A8KA 1D9FA 2ZC3A 1U02A 3H90A 2IAJB 2GGPB 1FEEA 3H25A 3OVBA 3AA8A 4MK9A 1X9MA 3NAIA 4CI0B 4C8ZA 1H6KX 5F3ZA 4PAAA 2MY8A 1Q8KA 3R5BA 2H4YB 4OLPA 1PIEA 4PQUA 5G4DA 3OFHA 2DNZA 3KJVA 1VHIA 1FRJA 1S49A 3PNIA 4IG0B 1XC9A 5EN1A 1U48A 4QWAA 4QBUA 3GONA 2Z4PA 4DX7A 4LMZA 3GFZA 2KG1A 2KZMA 2DRDA 4ATNA 1ZA1B 5D4LA 4GKJF 2ZDOA 3VF0B 4K50A 1GEHA 8ATCB 4C8LA 4OYZA 1N0VC 2FTRA 3KG0A 1IVZA 3CO9A 2PGCA 5A8KA 5IWAJ 4ZIWA 1MU2B 4U96A 2EI5A 2F1FA 4ANEA 4L75A 1OWXA 5A8RA 2V63A 2M8DB 1R3NA 2J9CA 3QSYB 2KKEA 1NHUA 1XNQF 1NPKA 2O3DA 2CNOB 3HVWA 5J1NA 2OSRA 1CVJA 1RHKB 2BKPA 3P3DA 2MGZA 5ETPA 4ES3A 3C14A 4CP5A 3D6TB 3DCAA 1ZAXA 4Y65A 1D8YA 1ZM2A 4TVAB 4D3GA 4ETXA 2YKQA 4OYXA 5GAGI 2ZH6A 1TL7B 1SIWA 3W2WB 2AX1A 1RGVA 2DTJA 4ZHRB 4MFBA 4RUCA 3LAMA 1DQAA 2J9DE 1BDTA 3IFEA 1RJJA 3NGDA 2RAQA 2HVIA 1EP4A 3TA2A 4K2XA 4IG3A 4WK1A 4WK3A 4ZVGA 1F9EB 3PEJA 1RWWB 1WDDA 2QIFA 4I2QB 4HLBA 2COLA 4WFNQ 3U27A 5HN0A 2V2KA 3OTBA 1ARQA 4M5KA 1SIZA 3JQMA 1X9SA 4J37A 2CPZA 2IM1A 2LMIA 3CMQA 5DLFA 4KT0C 2XLKA 5KFWA 4ECVA 5C24B 2DNNA 1JXVA 3FJ2A 4A48A 1JNZB 3V6HA 2OI2A 1YQHA 4RUHA 3A12A 1IWAA 2GO8A 3M7VA 3BKUA 4N76A 4O3QA 1RT4A 4AL6A 2YWKA 2ZE2A 4KSEB 1FTRA 1VGYA 4HT7A 4RW9A 1RAHB 2C22A 4WIIA 1OS5A 2VOPA 4O3PA 2D1CA 1LXJA 1SKRA 1XBWA 3J80U 2CPYA 3M9MB 5I3QA 4PWDA 2JFDA 1WACA 1L3VA 2I5JA 1NK8A 4Y28C 2AYBA 2HHXA 2BANA 3DHXA 1Z1ZA 2DEIA 3LAKA 3K2YA 2NREA 4DV4J 1KQGB 4AFFA 2ZH3A 2QJ3A 3CJTA 1KWMA 2DY1A 3ZZPA 2I0XA 2RDDA 1T05A 4G1QB 3O2IA 1FKAF 1FO1A 2R7XA 2K2PA 4Y2CA 2HQIA 2KXNB 1M5HA 4AAIA 4PUOB 4CLZA 3E8OA 1NK6A 2DNHA 4OZ1A 2DY9A 3OXFA 3BKTA 4A8KA 1QD1A 3H98A 1TVRB 2XZTB 4OIXA 8AT1B 2LA4A 1FDDA 1VQSA 2GQQA 5D4NA 1VHFA 2L08A 1RT1A 1H74A 1RTJB 2XULA 3FFIB 2JXGA 1SV5B 1AZSA 1N32J 5KFTA 1E6YB 1BWEA 2Y1RI 1WELA 3K0JA 4EO8A 4ZVEA 2DIVA 1PJ6A 2MHEA 4DUYF 4ZLJA 3Q8YA 2APOA 3EGZA 3LH2S 2C2ZB 2YNFB 3IR7B 4B9UA 1RTIB 3H0PA 1BHNA 1ZPVA 2EK1A 2HVHA 1EKSA 2QLWA 3DRPA 4FS2A 4J9UE 1BUXA 1UFWA 3SYZA 3KK2A 2PI5A 1RAJA 3WC2A 5J1EB 2AGPA 1K0VA 3I55S 3TX0A 3FRZA 3RW7A 1SQGA 2FVQA 1YBTA 4USUA 3CC4S 4QPXA 3MOZA 3PHEA 3Q2TC 2L9NA 3MI7X 4EK2A 4WP3A 3KJFB 1JLQA 2CQ3A 2XMUA 3DLKB 3GFYA 3NP5A 3G6XA 1T03B 3Q23A 1QY7A 1K0TA 4HTJA 1AT1B 2J6SA 1T9UA 1R0CB 2N4CA 2OFGX 3FSIA 4O44B 3LGHA 5KFBA 2LCWA 1KNZA 2W9CB 3US5A 2X1AA 4H4KA 2XWXA 4LSLA 1WWHA 1UVNA 2ZHOA 4AXIA 2HWHA 2R7OA 1T9YA 1Q53A 2FYXA 2PMHA 3K5PA 3MCSA 3OJUA 3QLHB 4WXOA 4ZLNA 2A6OA 4KPYA 1XK8A 5DO2A 1YZ6A 3V4IA 2HHVA 2JLFA 4USKA 3KK1A 2WTFA 4IH5A 3RAMA 4F3OA 3BYRA 2XI2A 2ZUGA 3SV4A 1RAOA 1VIXA 3Q0AA 2F5GA 1UL3A 2Y1LB 2JEGA 2ATCB 3KNAA 1M5SA 4NX9A 2F4FA 1NAQA 2HQCA 2M9KA 4ILRA 3UN2A 1OO0B 4M8LA 2XCPA 4USJC 2WB4A 4KHRA 1SJFA 1EA4A 4B3RF 3DOMA 2RKIB 3QO9A 4X4OA 4Z37A 4ELUA 2AYGA 3EVMA 2V8VA 2XQCA 2AZ3A 3QZ8A 4OYOA 1TFYA 3RBXA 2RS2A 1SC1B 3E01B 2KJVA 1WORA 3JTPA 5GAEU 4ZCMA 1UA1A 3GIJA 1SJQA 2HFNA 2XY5A 2Y0SD 1YKWA 2DHHA 2DITA 4B08A 1H98A 1I3OB 2YH1A 2E66A 5CQGA 1UAWA 2D3ZA 2I6WA 1B70B 4M5NA 3KHRA 4ECZA 2KT3A 4DXLA 2CZ4A 2L9WA 1WKLA 3FK4A 4PG7A 3V6JA 2YXLA 2DCLA 3N6MA 2CJ9A 3IG1B 1UCNA 3G96A 4DUYJ 1TKXB 3W2VB 5KFDA 4V19X 2IJNA 2LQJA 4E0DA 1T3NA 4CLWA 9RUBA 1X93A 3TO8A 2QC3A 1NLKL 1AXQA 4PYAA 4HEA9 2HLTA 1M5KC 1N33F 2ZH7A 3JXOA 3J7AN 2NUUG 4IRKA 3CDWA 2HNYB 1UW4A 2YWFA 2DNMA 2E5JA 1EQMA 2B43A 2AJ4A 4ERDA 2DH8A 1X4FA 4J9KA 2AJQA 4WBFA 4YR2A 4QW8A 4HHHA 2AZ1A 2J0WA 1PARA 3MCNA 2HHSA 4Q2MA 4FXEA 3T1HJ 5GMEA 1VFJA 1S4EA 3JSMA 5J2QA 4JI4F 3ZTOA 2FLLA 4DSIA 2BJ9A 4ZCLA 2MHNA 3TI0A 3AD8C 3BGOP 1PJ5A 4RX6A 3PXGa 4LF5J 2BM1A 5KTQA 3ET6B 2G2ZA 1U9PA 3MM5A 2DO4A 3A3OB 4G65A 1S5ZA 4LF8F 3R1HA 4PQUB 2OMLA 4ZVUB 3HZEA 3UN5A 1QVGR 2WONB 3BGRA 3QIPB 4QW9A 2DR8A 3BH7B 3ZTSA 1NPPA 4MJWA 1RTDB 1JLFA 1IN0A 2HGMA 3B78A 4F4XA 3IRWP 3NMRA 2CDQA 3MEDB 4YHHF 5I42B 3LP0A 3BKFA 2HVDA 4UZCA 4LRBA 2CG8A 2MZQA 2AEFA 3MR5A 3IWNC 3MTKA 2VPZB 3I9V9 4ZKAA 2GMJA 2P8IA 2R7VA 2Z2ZA 1RLCL 4PXEA 3HVTB 3LP1A 3TZXA 1PBUA 3WX8A 4F67A 4K5SA 3M05A 2YWGA 1N34F 1WTFA 3AFGA 3PG9A 2FC9A 3ZZZA 2ZZMA 5B0GA 4YMEA 2KELA 2ILYA 4J91A 3SQGA 2LKZA 3W60A 3GFXA 1TUVA 2IVFB 2LECA 2VG5B 5HROB 2B8QA 4FYWB 3KLIA 3GU0A 4GMKA 2FJBB 1RKIA 2QYGA 4OMFG 4ECRA 4KPCA 3C14B 1RAEB 3Q8UA 1T9VA 2HHPA 3VW4A 2IRUA 3G6ES 1IQZA 4CRJA 2YKNA 1XTZA 3EVOA 1F3FA 1R8PA 4LBIA 4GC7A 3U1MA 3W64A 1VI7A 2K6LA 2MY7A 2MKCA 1UFKA 4ES1A 4RW4A 3NEKA 3NY0A 2BA9A 1Y10A 1VQLS 4N77A 3N0VA 2CQIA 5HP1B 1JJ4A 2JH3A 1S7HA 5F8HA 4C11A 1KBRA 4OX7A 2F3JA 2RDIA 1N33J 2MSSA 5GMDA 2ZZTA 3P49B 3C66A 5MAOA 5E33A 2XHWA 5L1KA 3IO1A 5A0YB 3EVWA 4EUVA 5IV3A 1WEXA 1LK7A 1TL1B 1FRMA 1QAJA 3H5XA 1U6BA 2FVCA 1U1MA 4XPCA 2JVOA 2BJDA 2EWHA 3JAMY 2BYCA 2DK2A 4ZP9A 1RQ0A 5F8IA 4JI4J 2DGOA 4NRTA 2IPOB 1IBKJ 3ILOA 1G2EA 3VEBA 1XMQF 2B9EA 3D0HE 3G8QA 2CPEA 1N0UA 3U02A 4DOZA 3CT9A 4Y00A 1CBKA 1U1LA 4LF8J 4M5JA 2OPRB 1HBUB 4R0EA 2OGUA 3BSNA 5IS2A 4X4RA 4KY3A 4DV3F 3TUIC 2VU5A 3FBEA 1HYSB 3SQOP 3QWUA 2BANB 1TKTB 3RTVA 1H38A 1TK5A 3AJDA 4NLVA 3AXKA 4MIWA 4QR2A 1SQFA 3MPDA 2W25A 1MROB 2MKKA 1WKJA 3POTA 3CB4A 3SCKE 3NS7B 4BDPA 4LT6A 2VG7B 3QOQA 3R8YA 3RRGA 2CG4A 1N34J 2POKA 4XO0A 3JB9k 4NZ0A 5HVGA 3IAS9 5KFKA 1XNRF 1FD8A 2Y1JA 2NXUA 2J5AA 3T1AA 4B3SJ 1PBAA 1P94A 1IWGA 1LEOA 3PYFA 1IBCB 2EC2A 4M95A 4JI2J 2ZBPA 2X1GA 4PYDA 4QIGA 3CJRA 4I0WA 3HZGA 5KT2A 2ZHAA 4ZPAA 3E3XA 4FNHA 5DM6Q 2FDNA 2OH2A 1N8RT 3M2RB 1N6QB 2XSJB 5ETMA 1GXUA 4DPWA 4DL2A 2VZ9A 4HI2A 5E41A 2WHOA 3HHLD 4X64J 1HQEB 2ZOMA 2J9EA 3O3LA 2UXDF 1DURA 3M9NB 1A7GE 3DMJB 4JV1A 1NJYA 4OZ5A 4Y0FA 1S1UB 2J7WA 3I0SA 3M8WA 4ZPWR 4RW8A 2M3DA 3EX7B 3T9NA 3VCDA 2Q66A 4XAKA 4NCGA 2CJQA 2GJ2A 4KIAA 1XR7A 2H5EA 5D77A 1JLCB 1KRPA 1ICEB 5IT9U 3IN5A 4N8OA 2LQ8A 3IRXA 1VS3A 3OTEA 2FHOB 1KHWA 4DQRA 2HAFA 2DB1A 5LMNF 4WJBA 3QT5A 4DL5A 2PT0A 2YKMB 3VZIA 2BKOA 3DXBA 2KU7A 1WOPA 1ACMB 4DR7J 1S6PB 4X4NA 3M6UA 4A46A 1F60B 4OHWA 1IKYA 3KUHA 2NPFA 2ZZNA 1FE0A 6AT1B 2KYXA 4RUAA 3SDEB 5DQHA 2BV3A 1UFLA 1C1BB 3BV8A 1MYKA 2QSWA 3GPAA 3NNHA 5ETOA 4I7FB 1LWCA 7AT1B 4YR0A 2KM8C 4DG1B 1LFWA 4ELTA 1DY3A 3NCQA 4DLEA 2BXJA 1PYTA 4LF9J 3SSSA 1R0BG 3C3LA 4OHXA 1JLEA 3R2DJ 3FUYA 1VQYA 5GVQA 4NLYA 3T5LA 4WCEQ 3UFCX 4U9RA 4X84A 1B3TA 2Z30B 1T0TV 1S9GA 2BOPA 2OEJA 2JVRA 2NXNA 4RJVA 1OYEA 3D3CJ 2W4PA 1FFSB 4KR0B 2BACA 3OFEA 4JYAF 1TR0A 2WBMA 4A8OA 3QZ7A 1HBMB 4XTTA 4E98A 2DR5A 4F3QA 2V2ZA 4KO0B 3V5RA 2FIUA 3FEYB 2WOMA 4ED1A 5LMUF 4YUDA 1KC8T 5KG0A 2JRSA 3KHLA 2E44A 4ME7E 2OPSB 4DV7F 3PR5B 4N8NA 2IDLA 1VQOS 5LSLA 1RT2A 4QWBA 2ZEJA 2QZ8A 3T9ZA 4QIVA 2VKZG 1XNRJ 1JLAB 4W98A 2BSQE 2XS7A 2RVJA 1V9OA 4USIA 4QYRA 4PCQA 3KMQA 4NMXA 4O3SA 1U2FA 3CDUA 1IR2A 4LIWA 2Z2MA 3G5OA 1HBOB 1IBMJ 5L38A 5CXTA 2VH7A 5DQGA 3CCZA 2F8EX 5DJBA 2CVEA 4X65J 3TA1A 1SB6A 5EWEA 3ZNUA 4JI6F 4R5PB 4ZVOB 1ZZNA 2HLUA 4FS1A 4YY3F 3QJPA 3KLEB 2A2DA 4HACA 2CQCA 2MQLA 4CQ1A 2CQ4A 1HNIA 2V8GA 5L1LA 4LSNB 5CD4H 3AOCA 3MUMP 2PN6A 2HWIA 3GG0A 1BGXT 2AKWB 1QTNB 2G4BA 3BSAA 4YB6A 4NLPA 2FZGB 4H4MB 3EGNA 1YRXA 1Z2ZA 2WB1D 4MKYA 3P4UB 2W01A 3P96A 4RKUC 2IRYA 3H5UA 4A8QA 2ACMA 2MXYA 1XR6A 4NLOA 3BGLA 3QAEA 2KFNA 3UWTA 4RPFA 2E7XA 4RWXA 3PFOA 2F4VJ 4K7QA 3AQOA 2W4CA 2DR7A 1WKKA 1HD1A 2WSFC 5G0RA 2GIQA 3FBCA 4IOBA 3PY8A 1MLAA 1VIOA 2CADA 1I1GA 4AUKA 2BX6A 1PKUA 2KG0A 1HA1A 5C7PA 2JEIA 1K44A 2W8KA 3J80Y 3Q8QB 4FYYB 2G1DA 4RW7B 1U8WA 4I68A 2HNZB 4DX8H 2W7PA 1YHQS 1MNEA 3HKZD 3HSDA 3MM9A 1UZHA 4NZ7A 3VTIA 1UTAA 5HO4A 2P6SA 2EBGA 3MMCB 3KLGA 1WNEA 1JLFB 1BLUA 2HIYA 4UUWA 1VRTB 2YNHA 3A4TA 2J8AA 3UI3A 1GMUA 1Q5YA 1MMLA 2HFVA 5IT4A 2YTCA 3C6UA 2Y8WA 4N7TA 5M2RA 2BUNA 2MLYA 1TAQA 2GQ2A 2BW2A 3CGIA 4UY8T 5HBMB 1FWKA 5JMNA 2ADLA 3CIMA 1DTQB 2RE1A 3OPKA 2Z58B 2UU9F 5LMUJ 4R25A 2DEJA 1IBLF 1RISA 1TELA 2V8HA 2RQ4A 4U6PA 5D3GB 3MPWA 3AB4B 1KVJA 4DF8A 2BQUA 3SQGB 2FUG9 5KFEA 1H72C 3FVYA 2MKSA 5EWGA 2CJXB 2HRUA 1I6JA 3VAFA 1HBNB 4NLUA 4DUZF 2WW8A 2Z57B 4NLWA 2R7QA 4BWMA 2CFXA 1EX8A 2HHTA 1N5QA 1YBAA 4F04B 5KG4A 3H5SA 2DCUB 2DGXA 1SJRA 4E8UA 2RU9A 1IKVA 3FEZA 5KFCA 5IC6B 4JI8F 2IC3A 1X4DA 3BEGB 3QFWA 5THWA 4ILLA 2ZWPA 1D8ZA 3NKYA 1N48A 2VA2A 5ETTA 3MEKA 3NGSA 3D9BA 2Y0BB 3CDBA 2DH9A 1Y11A 4C11B 1FNOA 2H3EB 2YWEA 2KRBA 2HHWA 4NYZA 4F25A 4ECXA 4OZ0A 5HANA 3LANA 2LA6A 1HQUB 3BSOA 1RHUB 4ECYA 3OXLA 1FJGF 1VBZA 4AQYJ 1NK5A 4TXSA 4DR1F 2A18A 5DG9A 4A8XA 2R8KA 3D1QA 3K58A 4H4OA 2GVZB 3JSYA 5JJBA 2OAUA 1BC6A 4RUBA 1TL5A 3THTA 4QWDA 2QSFA 4X62J 5A2QY 4WFYA 3R5JB 5KFLA 3HXMA 2HS3A 3FGVA 2CVIA 3D0IE 1JXEA 2AT1B 1N4LA 4F3MA 1CSJA 2YPZA 2DXDA 1RT7B 3NGKA 4KHPF 2DKOB 5H1SV 5EX0A 4HDHA 3BJYA 2J7UA 3C16B 3N9UC 2J6TA 4FF3A 2OSQA 3TP2A 2HHHJ 4N47A 4CM2A 1D3WA 4Q0BB 2CPHA 3H2LA 4CT8A 4S0MA 4OLOA 4EGLA 1FT8A 3RGIA 1JK9B 3CO0P 1G4CA 1UVKA 2AWZA 2UP1A 4K0KJ 1CJKB 1TFWA 4DR6F 2DISA 2GO9A 2KRRA 3CCJS 3QRPA 4NA2A 1RTHA 1REVB 3HHLB 3R7BB 4LREA 2C3YA 3V6KA 1VQ7S 1FVQA 1XMBA 1C0UA 1XR5A 3VQTA 3L7PA 2UUAF 1IBLJ 3RBDA 2OLWA 1FVSA 3T1YF 3I56S 1HWJA 4C48A 3MAAB 1WJ9A 2CQBA 3PYGA 3RB0A 3R2CJ 4ICLA 5HMWA 2IFXA 4DUZJ 4KB7A 4Y3CA 3QMQA 2DNGA 1SH3A 1S77D 2M0GB 2DGWA 2DGQA 3L09A 1X4EA 3OR2A 1VQ6S 1FX2A 4I1TA 1EAYC 4MH8A 1A9NB 2UVUA 5F8GA 3G6VA 4XDDA 4JOUA 5K14A 2QMXA 2VF3A 5HLFA 4IO9Q 4KYZA 2UV8G 4DSEA 1HI1A 1P9QC 3SCLE 1NDKA 2W7AA 1MW7A 5J2PB 2VIHA 2HVEA 3RJMB 2HBRB 4YP3A 3MR6A 5HVFA 2ALYB 1U2CA 3GYGA 4Y2MA 3MUTP 2CZ9A 1GX5A 4DFKA 3LP2A 2FJDB 3PIPQ 1SVDA 2IJFA 2V9KA 3MM8A 2NR0A 3HSJA 3VAMA 1L5UA 4DN9A 4M1KA 4QJVA 4URGA 4DS4A 2OPPB 1Y9OA 4PABA 5C2CA 2RHSB 2GNKA 2RB7A 2IA0A 1YJWS 1QUPA 3R27A 3DDNA 1RT6B 2FQQB 3K7RA 5DGAA 3QPIA 3NBPA 4PZVA 3MR7A 3NWGA 1S1VB 1NH8A 2ZM6F 4GKKJ 3DGPB 3A13A 3TNVA 3N5FA 1FRKA 4KHPJ 4ZP7A 4E2FB 4ZVFA 4XPEA 3MMAA 3PX4A 4OX6A 3I96A 3BSCA 2V8DA 4DS5A 1Q5VA 1KR4A 3DOKA 5LJ3Y 1QSSA 4JP8A 2QV6A 4TY9A 5DG7A 3OXGA 5E3CA 1UVLA 1S9GB 5E3AA 3VV2B 4M94A 4PWWA 1EJ7L 4CLUA 2V50A 2IAJA 2GGPA 1IKXB 3ENVA 5MLCV 3PW4A 2HMIB 4F4WA 1NBEB 2OHDA 2PC6A 4UQTA 3I31A 5L9NA 5KT5A 1OG7A 1S0OA 4B9TA 3OUYB 4DEZA 3GV8B 3V2UC 1N52B 1X9WA 5GAGU 2CPFA 2UUAJ 4ED2A 4DFJA 1R31A 1MMNA 5ETLA 2W9BA 4LRFA 9ATCB 1T9TA 3T1YJ 3LF0A 4HT5A 3AAWB 3A8EA 3P6YC 3MAQA 2D41A 4KRWA 4YEAA 5ADZA 1FNXH 1OJ4A 1YJUA 4K4VA 2D3O1 4OI2A 1KTVA 2DNKA 3BDPA 1MN9A 1GTEA 3DRRB 3MECB 1ELOA 3CJ0A 4P6QA 2BE7D 2YNIB 4NMLA 4J5OA 2ZH9A 3HFZB 1R8BA 1U1NA 2HHQA 3TJ8A 2C2OB 3GG1A 3GJRB 1MU2A 4HI1A 4LFAF 3M30B 3PW5A 4U8VA 2V68A 2OUGA 1NKCA 4HV0A 3GFHA 4UOFA 2ZBCA 2H65B 3BR8A 1NJZA 1I94F 4ZLLA 2QYCA 1AUDA 3NGTA 3W65A 3PYEA 2BE2B 4G3IA 1S6OA 4DR5F 2CAXA 3HX9A 2A6MA 1KVKA 2VJUA 5HQLA 3KFWX 3B4DA 4ITSA 1F3VA 3BGFA 2CJKA 3A8IA 4O23A 3WQPA 1TL7A 5D15A 3W2WA 3EICA 2MJNA 4X2BA 5KT6A 2XEXA 2JXIA 1B0TA 1H2UX 3CJKB 5KFXA 3VAHA 1HW9A 4ZHRA 2CUYA 4ED5A 2DIUA 1APSA 2B5JB 5ITHA 4JI1F 1RWMB 2H5IB 1ZZFA 2KYZA 4NLXA 2PFDA 1RU1A 2R7WA 3RU0A 4ED3A 4FNIA 1WC4A 2AU0A 4JI5F 4I2QA 3HLUA 2MQQA 3G2XA 2RD5C 2ZM6J 2XS2A 1SH2A 2C3MA 4DN0A 4NLRA 5IC4B 2I38A 1OPIA 2RRNA 3M6WA 2XLIA 3SSQA 4J9NA 3BBBA 2H5JB 2ALZA 2UUBJ 3MXHP 2GZOA 3H42A 1TL4A 2P9EA 5KAKA 5M2PA 4WKYA 3LOUA 4B3TJ 5C24A 1IQTA 2XLJA 2BDPA 4CNYA 3GJSB 1OMSA 2W2MP 1M5VC 4M5HA 4CDIA 1JNRB 3C6UB 2D3UA 3QGIA 5ETSA 3HHEA 2FHMA 3IAM9 1KKHA 2BJ8A 4I64A 1EB0A 3QT8A 1Y3JA 3E51A 2CNNB 3TAPA 4NPOA 2M52A 4QOTA 3ADAC 2DPJA 3CCMS 5KG5A 1WTBA 2PEHA 1BQMB 3K89A 2VASA 2YPYA 3MCOA 2DNRA 1HWKA 1PYOB 1S1XA 4UQGA 5DZ6A 1X4AA 1VC5A 2FGOA 5K8PA 1HHSA 2CYYA 3L3CA 3G71S 1S0MA 1F0XA 3I4HX 1JLBB 2AYMA 3TX8A 1VR6A 4LFAJ 4JV5J 3TJ9A 1G6BA 2A2CA 3K17A 1RK8A 2BABA 4B17A 5L9XA 4YR3A 4PUOA 2J0XA 3T5KA 2NYIA 2DJWA 4QR1A 1I94J 1S0NA 1S12A 2JC0A 5LSRA 1LK5A 4ID5B 4DR5J 5IT9Y 5H9EK 4K5RA 1TVRA 4BHQA 2G2OA 1RSCA 2XZWA 2XGQA 2LLZA 1VRUB 5A6WA 1F6TA 1XEZA 1RTJA 1VBXA 1Y5LB 1SV5A 4QCLA 4B3MF 3GV7B 4K4SA 1E6YA 4UOCA 3G87A 5EHHA 3W8GA 1KSPA 3DNCA 2K29A 2K1RB 3VGUA 1H0HB 3RBEA 1LWEB 2FJWA 3QRQA 2FJAB 1U09A 1M1HA 3RRHA 4JI1J 4ZPTR 3VAKA 5A76A 2LEBA 2YNFA 3IR7A 2JLEA 1GH8A 1RLDA 1RTIA 2OPQB 2W2OP 3MGJA 5CYJA 3RUBL 4JI7F 1RKJA 4EBCA 1CEZA 4O3RA 1HNXF 2M70A 3PJ9A 1RUSA 4DV1J 3A3NB 1KFSA 3UNGC 3ZTQA 5B0CA 3RB4A 2ZJQQ 2XG8A 4EZ9A 2WVDA 5IFMA 2LXUA 3I4PA 1UETA 5AJ3J 4KQZA 1WI8A 3DLKA 4Q2LA 1T03A 3LUYA 4LRDA 1W2BR 4CTAB 5AE3A 4FZVA 3OFGA 3IMQJ 3WZ0A 3D67A 5FJ4A 1WC5A 4O44A 3JAMU 1EIYB 2C3UA 1SKWA 1UWAA 3P45B 4FYDA 4OL8A 2LEAA 1I51B 4C3LA 1S7IA 2VQEJ 4Y34A 3CULA 4M5IA 3QLHA 1YJ7A 1C0UB 2NXEA 3ZC4A 4CLFA 2MEWA 1TUWA 3PO4A 4DMZA 4J9PA 5J1PA 1I5OB 1TK8A 2KHDA 4PXBA 1DTTB 4F4AA 3K5MA 1E6VB 4OJ3A 3BREA 2K3IA 1IM4A 1UVJA 3DGVA 2DXEA 3VZHA 2EEYA 2D7SA 1Q7YT 4I6AA 4MKVA 2YQ1A 2C3PA 3GLJA 1F2GA 1ZA2B 5IWAF 2AEMA 3EGWB 2RKIA 1EETB 4P9SA 3U1NA 2H1OE 4KC5A 1Y5NB 3I6PA 5CYMB 4O3OA 5AXMA 2V4RA 3LQVA 3Q8VA 3VQSA 4KHMA 2DNLA 3I5BA 4CLLA 2QA1A 3O44A 5AXLA 3E01A 4RLEA 4WKRA 3OT9A 3IS9B 4ER8A 1X4BA 4KGZB 1HKAA 3OTDA 2VOOA 3CD5A 5HAOA 1R6VA 4QZVB 2G13A 3A3PB 1UVIA 2PA3A 4TLQA 1SC6A 1S59A 1VISA 3BO4A 3VALA 3TQEA 4B3MJ 4EYIB 3IG1A 3MZIA 5L8RC 3EPGA 1TKXA 2BKNA 3PX0A 4C0BA 3W2VA 4NOHA 4LJMA 4RU2A 4DSFA 2V9WA 1NKBA 3W66A 1K1SA 3PYDA 3V81B 2VHGA 3GR0A 1D09B 2QFIA 4M63A 3V4MA 1HNXJ 4U7UK 1NCLA 2HNYA 2KFZA 1MYLA 4LVNP 3GJQB 4KH0B 2OJ3A 2EPIA 1KQSR 1FXDA 4WTOB 1KN6A 4OZLA 3D66A 1NNDA 4OYMA 5A6PA 3AOBA 3EUNA 3D7SB 5KOXA 4LRVA 3D28A 3PRBA 5AXNA 2MJUA 3S8SA 4FYXB 2NQPA 3VAGA 5T14A 5U47A 4CLTA 5D6GA 2J0QD 3T41A 2DBBA 1XERA 3ET6A 2LDIA 3SIPB 5I4MA 3QATA 3DM2B 2ZC4A 2UUWA 2XMAA 3OL6A 3UCGA 4J9QA 2K3KA 4NCBA 3QAUA 1VQNS 2WONA 3QIPA 3TAMB 1YJTA 3GIKA 1Q1KA 2W9BB 1P1TA 4FN5A 4CLYA 1RTDA 5F8LA 4WU3A 2ERRA 3MEDA 2BOAA 5I42A 1YJ9S 4DV4F 2FZKB 2EC0A 4C8YA 1Q4RA 5L39A 1P1LA 4I67A 1SCJB 5CAAA 3CJ8A 3NCPA 3HVTA 3LW5C 3KOAA 1VQ4S 2D69A 2N3OA 2CNLB 2HFZA 1P6TA 4QQBA 4FP9A 2XB2D 2EG1A 3BDEA 1LOUA 1BAZA 3FT7A 1JMTA 7FDRA 2VG5A 5HROA 3Q22A 2DGUA 4W92B 4P72A 5HL7Q 1TMMA 1T11A 2JEJA 5IM0B 4USMA 3VR1A 2IM3A 3UVJB 3TZYA 2WRMA 4Q8EA 3UR0A 1DLOB 3OW2R 3LALA 1UPPA 3MPVA 1JLGB 5F8NA 4C6AA 3AB2B 4F7VA 1W2IA 1WEZA 1K1QA 1N32F 1RAIB 2VPXB 4K4TA 2DGVA 3K57A 1U1KA 1GX6A 1O51A 2QMUB 2ZKTA 4P2FA 4DFPA 1R7IA 5HP1A 4DDFA 2CZVC 1T94A 1YBUA 2R2SA 2QTWA 1D9AA 1VBKA 3ILJA 2VD3A 3ITHB 3IM9A 1SL2A 4NLGA 1U24A 2IVMA 2ZJRQ 2VQFJ 4UT4A 2AJ1A 3TUPA 4TKTA 5A0YA 1RADB 3J7YI 4LR9A 2VBZA 3VAIA 1M0SA 2FJVA 1TL1A 4Q43A 2HSEB 2MQOA 2VL1A 3MUVP 1QE1A 3C6TB 3KKFA 4G1IA 2V4QA 2YQ0A 4HH1A 1CJVB 5DDPC 2W8LA 1OY9A 2RBFA 5BYSA 3KYLA 2ZJPQ 3ZZUA 4ANCA 3VVTA 2XMVA 5KG1A 1U8SA 1ZBTA 2O66A 4YS2A 2OD4A 3S6EA 2DNYA 1FK9B 3MFIA 2WZ1A 4MTPA 3DC2A 2HFUA 3LO3A 1C4CA 3FSYA 1YIJS 4USTA 3HHDA 1WF2A 2HVZA 5DG8A 2OPRA 3GTYX 1HBUA 1FD2A 2HKEA 3MF5A 2EK6A 4WFBQ 5BR8J 2ZKUA 4JV0A 2VV5A 1RWUA 1EKRA 4FPRA 2E9RX 4EU0A 1FKOB 2E9TA 1R0AB 1HYSA 1TKTA 4XK8C 4KTQA 4O4GB 5E2QA 5D4OA 3EDRB 4ZJQA 1S1XB 2XZDB 4PWUA 5J2NB 2UXCJ 1HL6A 4DSLA 4K4UA 5KFPA 1CULA 1HNZJ 3DYAA 4I2PB 1MROA 4NRUA 2BBEA 3T5HA 4WZQA 4IDKB 2PSZA 3WIVA 4OI0A 4NLTA 3HM9A 2UVVA 4Y6IA 2VG7A 2EKYA 3X1LB 1XQIA 4QWEA 3VGSA 4KFBB 2QLFB 3AA9A 2OIHA 1N5YA 2DXFA 2PE8A 3DLGB 5LJ5Y 2DVIA 2CNKB 3OD2A 2ZITA 3O5TB 4NA3A 3C8YA 1TAUA 3CPWR 1U25A 1Q7LB 2WW4A 1HW8A 1QSYA 1Y4ZB 4G1PA 3DRYA 3UCUP 4KKOB 3CCLS 2KVIA 4DZ6A 1FDNA 2R2UA 2JX2A 3M2RA 1N6QA 2XSJA 4ZJLA 3DLLQ 2D3OR 3OBIA 4P7TA 4F26A 3BPSP 4KJIA 1LWXA 1HQEA 4DL7A 5L1JA 1IKWB 3UQSA 3DMJA 2NXCA 3FNNA 1CC7A 1W26A 1S1UA 3PR4A 1YI2S 1HR0J 2MQNA 5F8MA 3SZ2A 1FESA 3ISZA 3BGUA 4IFVB 2CWKA 2VPYB 3CCRS 1G3OA 3W9HA 1RU2A 4PPZA 2FC8A 4NWBA 4OI4A 5GAHI 3AODA 1TKZA 4NEZA 1JLCA 1V5IB 3ISND 1X0PA 1U45A 1WG1A 2EVZA 3MEEB 1QTMA 4DPYA 3THPA 1FJ7A 2IRXA 4ECWA 2YKMA 2UUCF 4ZP6A 2JHEA 4EMDA 1Q82T 4OYPA 3RAQA 3T1HF 3QSIA 4HYKA 5I3UA 4O4RA 1S6PA 4PXCA 1MWQA 5JXSA 2CPXA 1H7XA 3D3BJ 3DU6A 2B9WA 3HULA 4PQAA 2XY6A 4OJHA 3SDEA 2JC1A 1J2VA 1A0OB 1Q8IA 1C1BA 1SPBP 3I0RB 5A2QU 5D0GA 4LF5F 2DRBA 2ZUAA 4I7FA 5RUBA 2VC1A 3NO7A 2GHVC 2ILZA 1ZH5A 3GSDA 4DG1A 1VRQC 2D74B 1S10A 1JWWA 2JOQA 4J9OA 4DF4A 4QYZK 1PC5A 4OX9J 5HVHA 3EYZA 5DM7Q 2VPWB 3MEGB 3L4BC 3ZZTA 3DRXA 2P9CA 3PIOQ 3MM7B 4MK8A 3HVRA 1WSRA 1MSWD 4RW6B 1F2HA 1HNWF 4DFMA 2YQ3A 4DSKA 2CPIA 1HBMA 1N88A 1H7WA 2BNWA 4DPUA 4KO0A 3M1VB 3AH6A 3CVKA 3H7HB 2OFHX 1S6QA 3OL8A 1S1TB 3CCUS 5KFYA 3BM7A 3W7BA 1SUQB 2IVYA 2OPSA 4L72B 2M88A 2JZ5A 4ALZA 4PG6A 1S6UA 3CXCR 1NB2A 2WVEA 2CWXA 4B9MA 1KVIA 3L7OA 2F63A 2WVBA 1CQMA 4CO3A 4MK7A 1JLAA 1GAOA 1URRA 2CPJA 2W4DA 3BO2A 1YWXA 1B7YB 3D5MA 2YNGB 1B7FA 3MD3A 1HBOA 4PEOA 3MAHA 4EFAC 5D0RA 2V5HG 3JSRA 1NHKL 4CWBA 1RDRA 4ZK7M 2HRYA 2V34A 1YX2A 6FD1A 2R42A 2B4OA 5BJRA 3HHKA 2HBQB 4R5PA 4F50A 3KLEA 4C8KA 2DNPA 4FBUA 3OTCA 2BQRA 3MFHA 5F3TA 3DFEA 4LSNA 3S01A 4LQ3A 3A1YG 3VGTA 4DHVA 1NJWA 4OI6A 3GV5B 1BXNA 1JXLA 1AYEA 2DH7A 4I69A 4H4MA 5KFQA 2JXHA 3U1LA 5EDWA 4NASA 3OTOJ 3BS9A 5IQQA 1HHTP 3UR3C 1Q86T 3AY0A 1OQ6A 3CC2S 1DBDA 4CLKA 2QA2A 1TK0A 2FJEB 4C97A 2ZDPA 2EBEA 4G6VB 4I56A 2MZ1A 1U26A 2UUCJ 2M2BA 2C2MB 2RQCA 4ANDA 4AT1B 5HSPA 5M2UA 3HSZA 1VMBA 4OYIA 4ELVA 2HNDB 2RDJA 2M5YA 2K06A 1IBKF 2E29A 5IV4A 1LW0B 3K5LA 3BQ1A 1Z2LA 4DQIA 3BBFA 2X1FA 5E0OA 2KL8A 2UUTA 1OY6A 3GB0A 5B08A 3R9LA 2MMYA 3LTOA 3TARA 2GC8A 1O0PA 1VCTA 5DGBA 4RW7A 4PRFA 4KGMA 4C8NA 3FKBA 2HNZA 4GC6A 4YDDB 2DHSA 4OHVA 4OYBA 3J81U 3MMCA 3KJQB 2E5LF 3QYYA 4LF1A 4IOCQ 3CJ2A 4IQXA 1VRTA 5CZXA 2MZTA 2HBYB 3F0NA 1NDCA 1XMOJ 2IIHA 2QO3A 4FXDA 1HNWJ 4J9LA 5ETVA 4NI2B 3W5XA 1W25A 3NGUA 1N36F 2RF2B 1X60A 4XDCA 3OR1B 1FJEB 1G7CB 4RNNA 1KQFB 3BN7A 5HBMA 1B28A 1JJHA 3PACA 3T3FA 1DTQA 4MIAA 3SV3A 4ZPVR 1OPZA 4DL6A 1SJ3P 4QPTA 4OYWA 3EE3A 5KOWA 1FA0A 3EXCX 3N4WA 3QGGA 5D3GA 3FBFA 4TYBA 3PEHA 1WDTA 1NJXA 2B8PA 4B3SF 4DPXA 2KT2A 4F4YA 4L76A 3TEGA 2HYIB 1HBNA 2I1RA 4X4SA 2HQFA 1VQMS 2ZH8A 4JI2F 1JJCB 1U1OA 2HRTA 5ETQA 1UWBB 2P9GA 2AW0A 3R7SB 2LU1A 2GHPA 4DQQA 3H87C 1NMEB 5GADU 2BE9B 2BVZA 4X64F 1C1CB 4C8MA 4W90B 3KG4A 2R3VA 4QU6A 4B9LA 5DDOC 3CD7A 1S1WA 2FB0A 3ZO7A 2KM8B 3H4DA 2OKQA 3GQCA 1M1KT 2CDRB 3CJSA 3EZ5A 4GO5X 2C2RA 4CO5A 4M5DB 3CCQS 4F0MA 4FKYA 5B0AA 3OHAA 2MKHA 3BBCA 2YKOA 4LF4F 2HQGA 4NEYA 5B09A 4K2JA 3WIUA 2B4VA 2QG9B 2IA6A 5LXYA 3W9IA 2GIFA 1KD1T 4QIFA 1DQ9A 3KLFA 4MYUA 3OV7A 3TRGA 1HQUA 3TVZA 2D9OA 4C4WA 1A6LA 1XJWB 3RW6A 1QSLA 1RA7A 2F8HA 4X4QA 2GVZA 2Q1LA 2Q6BA 4C8OA 2Z8QA 3FEXB 3TW0A 2V2QA 1QE1B 4DR7F 1R8HA 1BMQB 2X7IA 4K59A 2CRLA 4GVBB 3PO5A 2ASLA 4NYPA 3S1TA 4FXVA 1X4CA 3NNEA 4FF4A 2JL9A 3MPUB 4P71A 1RB0A 1FKPB 3D2WA 1RT7A 4QR0A 3Q89A 3KG1A 1BQNA 4EO6A 3RBZA 5C25B 2BA3A 3PJWA 3C16A 2XMTA 2XYHB 4LF9F 4DV6J 3IXQA 2ZD1B 3PJXA 1QM9A 3NS6A 1WG5A 4Q0BA 2V67A 4DV2F 4L6V3 3MD1A 3M2VB 5KT4A 3MR3A 4DV5F 2E5LJ 3HHNB 3BYPA 4TNOA 4WE1A 2V4JB 1Q16B 1OIAA 1SQEA 4BCAA 4UTGA 2BJ7A 3FMBA 1T9XA 1ULRA 3FCHA 4UOGA 1CJKA 4EBDA 1CULB 3DYAB 1NLAA 1YRUA 1GXTA 1N36J 1WG4A 1REVA 3HHLA 5FLXU 1RCXB 4OI1A 4AYBD 5C5JA 1ARRA 2VBYA 1N5YB 1IM6A 1QLNA 3Q83A 4HHJA 3MAAA 3GWCA 3C46A 3L95X 2Y1IA 1R89A 1VDHA 1HPZB 3DLEB 3QT7A 3OSPA 3C19A 1IBMF 4ZS6A 1FHTA 2MZRA 2HURA 4B9NA 1IRQA 2CQDA 2VA3A 4X65F 2G0IA 3HKWA 2X1BA 2JWNA 3MM6B 2UVWA 2Y8YA 5E3RA 2CJAA 1WOSA 1HWUA 2XMWA 3HT0A 3UDLA 1NEEA 3CJQA 4OHYA 1HWLA 1TU0B 4D8JA 1WF0A 2KJWA 1KP6A 2FGCA 4OI3A 5J2PA 4LF4J 1U47A 2JBVA 1PC4A 1NSKL 1TKZB 5J2MB 3UNYA 4N5SA 1HD0A 4ZOSA 3R3TA 2J8SA 3Q2SC 4ID8A 4LR7A 3KUGA 5LXRA 5B0FA 2AP6A 4CO0A 1RACB 2C2DA 2BZ2A 2FVRA 3F73A 3R97A 3BZQA 1NHVA 2OPPA 1DQ8A 1MWYA 5KFNA 2F4VF 5AT1B 4JV2A 3F56A 3JQKA 1DARA 5I3UB 3CCSS 1S99A 1TKDA 1RT6A 4KV8B 3K5OA 3G82B 2JDJA 3PV8A 2IBKA 3BN4A 1Y3KA 4BLGA 4LF7J 2NSBA 4PKDB 2K7KA 3ZZYA 1S1VA 4RNFA 2EW9A 4LUBA 3Q8PB 3DGPA 5B7WA 3NL0A 1X5PA 2PFFB 3DLHA 3M6VA 2V94A 2XMKA 1ITPA 4DL4A 2QN6B 3SCIE 3EXYA 2QL9B 3B82A 3K8WA 3FQLA 1U7LA 4Q7AA 3CDEA 2GVDB 1X4HA 4U7UD 4DV2J 1PILA 5KFIA 1ZM4A 3ETMA 4DV5J 4ZVRB 2YWWA 1AA1B 2P6TA 7FD1A 1URNA 3T19A 2BRLA 2YX7A 1QAXA 3DOLB 3DLJA 3IA0A 1IKXA 2J9DA 4DX6A 3G6YA 2HMIA 4JBCA 2KI2A 2PDAA 2B9XA 4HKQA 2NLWA 1D1UA 4V19J 5F0UA 1RABB 3WHIA 2XNRA 3JTNA 1S6QB 1NM2A 3F44A 4TN2A 4P75A 4ZPCA 3OUYA 1QUVA 2XO6A 1YITS 1T8EA 4ECSA 2AY0A 3QNWB 5K8OA 4QU7A 4OX8A 4R0JA 4F4KA 1YRTA 2E1CA 1DJ0A 3KDNA 3PX6A 3HJFA 4A8YA 4WP9A 2XGPA 1LXNA 4K8RA 4ECTA 2CA9A 1U0SA 1NDLA 3JS9A 3DRRA 1B0PA 3MECA 2WCXA 3V6DA 2LXIA 2XC9A 1WEYA 2YNIA 3FCWA 3PZPA 4Q44A 4OFZA 3PFEA 1T3OA 2XM3A 3FRYA 3M30A 4K4XA 1WI6A 4ED4A 2H48B 4YOEA 3CD0A 2KT5A 4RBTA 2BE2A 3IGNA 3JTOA 1CS4B 3FZBA 1NK9A 2LFVA 4GKJJ 1R27B 4IYQA 2KXHA 4U7CA 2QRRA 2FZCB 4BBYA 4USVA 1J5EF 1IXKA 1B0VA 3RAXA 5LT5A 2CXEA 2ZH1A 4ETZA 1IUJA 4AL7A 4AQYF 3W63A 3EZOA 3HT3A 1MN7A 1PG5B 1FRHA 3CJKA 3ZZRA 2OMOA 1SL1A 2B7BB 1XNQJ 3QWPA 3BH6B 2B5JA 3R6LB 1JJ2R 5D0HA 3EZUA 3H2VE 2BMBA 3EPIA 2PEBA 4X62F 1WHWA 2HK3A 1YSJA 1S9EB 4TLRA 4GRSA 4MT1A 3L9ZA 1PJ7A 2L48A 3TVYA 5FDLB 1VQPS 4BS2A 1TP7A 3KLHB 1FXRA 5KFMA 1BY9A 1HFEL 2K5JA 1V3RA 1DRZA 4EBEA 2GS8A 1YG0A 5KFZA 3IR5B 1QTGA 3D54A 3KK3A 2HHHF 2DGSA 3ETOA 3MURP 1IR1A 3FCVA 4UY85 4FVMA 2P2CB 2EFGA 5HATA 1MNTA 2WSCC 3D0GE 3OQ2A 1KHVA 1LW2B 8RUCA 2FLNA 2DHXA 4AXJA 3IWXA 4K0KF 4ZIVA 1WC6A 3KTQA 1NB7A 3UN3A 3KMSA 3I82A 3M8QB 3EM1A 1ZS6A 3QGHA 3J7Z5 2ROEA 3MMBB 4ED6A 4CO4A 4W4MA 1BQMA 3GJTB 1Y0HA 5T41A 2Y3YA 4Z7CA 1WC0A 4LQ9A 3KLVA 3B4MA 3ICLA 1VLYA 1CG2A 1ROFA 3SCJE 2YBVA 4NL5A 3VAJA 5HMZA 3N5BA 1JIHA 1HMVB 1NH7A 2RRBA 2ADCA 3UE2A 4X66F 3J7ZT 3I5CA 3LJPA 3IWLA 3SFUA 5DQIA 1JLBA 1H2VZ 3CUNA 2GCFA 4YDXA 4DQPA 2GV1A 2R4FA 5KFVA 1JKHB 1S1WB 2QLBB 3FDSA 2LP4A 1RHRB 3DU5A 1UMJA 3OVAA 2ABYA 4TY8B 1D9DA 2FY8A 4N56A 4LRCA 1XN9A 2FVSA 2YX1A 3NOGA 1C2PA 3JQJA 4OZJA 5BXIA 2E1AA 4MMOA 2OO4A 3M2UB 3Q8SB 3MCMA 4ID5A 4WYLA 1K47A 2VODA 4EZ6A 1J5EJ 4RBUA 4QIEA 3KLFB 2BNZA 1FWLA 4IFYB 3BO3A 3RYLA 3M8PB 1VRUA 3FMTA 4JI0F 1YJVA 3BQ2A 2DO0A 2VG6B 2ZH2A 2K1RA 4RR5A 1LWEA 3GYNA 5IQ6A 1J5OB 1ZPWX 4RBVA 2KVQE 1VBYA 2VBWA 2OPQA 2AJ2A 3GIMA 5GADI 3HSGA 2UVRA 2RQMA 1B64A 4GKKF 2KHCA 4GVLA 3G4SS 4HHUA 2FVPA 2Y9HA 2PO4A 2L3MA 5CCMA 1BQNB 2XCAA 2XTJP 2W9AA 2W7OA 3GIIA 4HL9A 1B4SA 2LQ5A 2VJVA 3BR9A 2ASDA 4ED8A 2Z56B 4LIRA 3ZFVA 1GMWA 3JYTB 2B6AB 3VEAA 4CTAA 4IR9A 4WE1B 2AHOB 1SH0A 4F4ZA 1LV5A 1GFWB 5K8NA 1C0TA 1L3UA 1UEUA 1R43A 2Q79A 1Q0NA 3DHWC 3ONQA 4ZVHA 1AFJA 3NS5A 2DT9A 3KHGA 4FF1A 1FI4A 4A47A 2B0GA 3M8SA 1XIQA 1KLMB 2VFSA 4YB7A 3DRSB 1S97A 1RHJB 3NCRA 2N7CA 1UP1A 2B9YA 4CO2A 5HQMA 4ZVQB 3P8BB 1DTTA 1GMWD 3H4BA 3AT1B 2HS4A 2B56A 1EHWA 3MR2A 4J9VA 1E6VA 3IBCB 5KT7A 1CJTA 3NWRA 3IR6B 2RJZA 5C42A 2XY7A 5KFFA 3C2PA 4X66J 3TYTA 1HHQA 4B02A 4B9VA 1RAAB 1MMDA 3CW2C 2KXFA 2QGFB 3KJVB 3TQ1A 1Q95G 1SL0A 1U4BA 4H54A 1Q78A 1EETA 3VWSA 4F8RA 5DS7A 2HS0A 2R7SA 5CYMA 2OEMA 2WVFA 3Q24A 1O6XA 2N4DA 2HG4A 1U1QA 1PYSB 3OFFA 1OHNA 4LSZB 4UUXA 2VFVA 2FPHX 3IS9A 3TUZC 2KOEA 2E5GA 3H5YA 1LFPA 3CCVS 4ZVPB 2Z2LA 4B3RJ 3BF4A 4DPTA 5A8KB 3IBWA 1RWKB 1RWOB 3W5YA 1YGYA 5A8RB 1TL3A 1F1BB 2IDEA 4KE5A 2OELA 3UD5A 2ZVIA 3SFGA 5KT3A 4YFUA 4TU9A 4X4UA 2X3DA 4JI0J 2VFRA 1EZZB 2MGZB 1NZ8A 1OSDA 2Q2KA 1CJUA 2IM2A 4OHZA 1L3TA 1F5BA 1WC1A 2IJRA 3V81A 3LA0A 1FRIA 3PW7A 3MPYA 1SIWB 2I9SA 4MFBB 2ZFHA 2NUHA 1V6HA 5D8HB 4PXDA 2G0JA 4P73A 3J81Y 4L74A 3ZTPA 2UUBF 2KN4A 1EP4B 3CJ4A 4IG3B 2R2RA 2XMJA 4B3TF 3RR7A 1SI9A 3RB3A 3QGPA 2F8MA 4YN3B 1K8AT 4UZBA 5JVHQ 2RMLA 1LWFA 3DI6A 4WFXA 5JVGQ 3PW2A 3UPFA 1FF2A 2HZCA 1Y00A 3Q8RB 2W1BA 1FJCA 4HVZA 1Q79A 3O1LA 4TQRA 1Z4UA 2J76E 2GAGC 2YKAA 3DM2A 2GIRA 3VGVA 4RL1A 1HNVA 4TQSA 2AN7A 3TAMA 2NPIA 3NRBA 1VQ5S 1RT4B 4HTIA 3HF5A 2ZE2B 5L1IA 1AFIA 1IR0A 1L3KA 4CYUA 4LBHA 4RW9B 4LF2A 3HPOA 2FHKA 1O5JA 1TMJA 4C2MA 3OLAA 2EFOA 4ZPBA 1T7PA 3PRDA 1V3SA 1NSQA 3CJ5A 3ELHA 2XMMA 5DZ7A 4DJBA 4DU7A 4PWDB 3V6DB 1ZYQA 2B7CB 1W7WA 1WSVA 2I5JB 5HJXA 5H9FK 1TTHB 1F5AA 2LDYA 5F41A 1NPRA 2GAHC 4ZA1A 2VDHA 5L46A 4JV5F 1X0FA 2RH3A 3LGMA 2QA4G 3WBZA 4YHHJ 5D4PA 3J7YU 3TANA 1NU4A 3GP9A 4X4PA 5F0WA 2XNQA 2A0FB 4ENOA 2WK4A 3W8PA 1YJRA 4C0HA 1GMVA 4I4BA 2HWTA 5IM0A 4ECQA 2MSTA 3B8HA 3GSIA 5E7OB 3UVJA 1T05B 4ES2A 5LM7E 1DLOA 1JLGA 2AJ0A 3BQ0A 5H9FJ 4DCPB 3PRVA 4ZN3A 4USHA 3GXQA 3UD4P 3OSNA 4NA1A 4K4YA 4J7CA 2KDOA 4KGVB 3ILLA 5BYRA 4K4WA 2DHGA 1FRXA 3KWMA 2G2YA 3KDOA 3HFVA 1H3DA 1RWNB 2X3GA 2MKYA 2H51B 5KFJA 3I9ZA 5KFAA 3AD7C 4JI3F 1S76D 1RT1B 2HIQA 1WOOA 3ITHA 4A8FA 1F5CA 1AZSB 4DV1F 3M32A 3NLCA 2AD9A 3K5NA 3NMAA 2QL5B 2FHJA 3KK3B 1X5SA 5AJ3F 1U0HA 2DNQA 3DRPB 1BE4A 1T02A 3C6TA 2HBZB 3E2EA 4A8MP 3KK2B 1HWIA 4U95A 6FDRA 4WF9Q 2GFFA 2HZAA 1FFWB 3HCXA 1Q8LA 1CJVA 4DU8A 4ZN1A 3T6BA 2DYAA 4MAKA 3SMZA 3TOQA 5A8WA 3G8TA 4CIOA 4Q5VA 2A10A 3H40A 5FLXY 2W2PP 2E1RA 2VQEF 3GZ7A 5EWFA 4NXMF 1RBOB 3F41A 1FK9A 5F9LA 3PVXA 4CNZA 1JLQB 2H9ZA 2W24A 2VONA 3FSXA 3R7NB 1UJ5A 1FWPA 4HH0A 2HZVA 1HI0P 1NK7A 2FHJD 3G9CA 2HHUA 3PM9A 5CZVA 2JLGA 4DCJB 1M5OC 4EI2A 3CWJA 1UVMA 2V6AA 1FKOA 2ADBA 4OJGA 3ZTRA 4WIQA 1R0AA 2J7KA 1XMQJ 4LSLB 2ZNYA 3OJSA 2E7WA 4FDFA 4O4GA 1U2RA 3RB6A 5J2NA 2E1PA 2AGQA 1REGX 4I2PA 4AD6A 4IDKA 3IC1A 3V4IB 3CE8A 2K9IA 4I6YA 3KK1B 1TUGB 5GAHU 2WBRA 4DV3J 2BEFA 2GW8A 3CC7S 3FQKA 4KFBA 2AMCB 3G8SA 1O8BA 3DLGA 3H2UB 1FX4A 2Z0GA 4UW2A 3EJMA 1VC6A 2QA4S 2K8GA 4ZITA 2PMZD 3GYXB 2NZCA 3S7RA 3HMJG 4DCOB 2QEXS 2AJFE 1LNQA 2RIJA 3KUEA 1PAEX 3DOMB 3UDVA 4KKOA 1H73A 2RU3A 3QO9B 1YK9A 2E7VA 1UKUA 2C1EB 2F9DA 2DRAA 2QE5A 4OV1A 2K7JA 1SBRA 1TV6A 1IKWA 3UDEA 3ULHA 4Z2XA 1FERA 1HIYA 3N6LA 4K4ZA 4IFVA 1PO6A 5GMKa 4MKAA 1R8AA 1XWLA 2FLOA 1OY8A 4CLSA 5H9EJ 2CPDA 4JI3J 1U6ZA 4M5LA 1G1XA 2MLXA 2RILA 4L3NA 2QX0A 2CQ0A 2UXDJ 3T6JA 3MEEA 4M5MA 1RWXB 4WP8A 5HMXA 5DETA 4BC7A 4A8WA 3ZZOA 4L73A 3I5AA 2XYGB 2MYFA 4Q8FA 3CEDA 3VVUA 1RCOB 1X31C 2OTLS 2RSQA 1SJ4P 1RHMB 3NG8A 1C0TB 2CJYB 2YVSA 2F7VA 4EEYA 2L9DA 3AJ1A 3HD2A 1RWVB 2N82B 3I0RA 2JSXA 5KFSA 3BPDA 4DL3A 5LMNJ 4Y2IA 1ZM9A 2AYEA 4NXMJ 2GMLA 3D68A 1UA0A 1RHQB 1BDVA 5GAEI 2RUGA 2AF6A 2MDAA 3THVA 5J2QB 3JSMB 3ISNC 3R6GB 3QIDA 1P9YA 1KEKA 2Q6CA 2CQ2A 1Q81T 4LBPA 2E1MC 3MEGA 1TZ0A 5D78A 4NCAA 4PG4A 1DFDA 1N5SA 2W2NP 2HQ3A 5ETKA 2DGTA 1NK0A 3CCES 3MM7A 3MM5B 4UF4A 4RW6A 1CJTB 3TAQA 5AXKA 1SKSA 2QFJA 4C9DA 5C42B 2BJ1A 5T7LA 1P27B 3PTWA 3CCWA 3M1VA 3FC9A 3BGRB 4AE5A 2H4WB 3SBMA 4CO1A 1S1TA 2GJFA 2OEKA
chains in the Genus database with same CATH topology
2GPEA 2F1FA 2Y3YA 1MYKA 2BSQE 4D8JA 3FMTA 2FGCA 2WVFA 4FXEA 2HZVA 2WVDA 2JXIA 2BJ8A 2RBFA 2BJ9A 2KELA 1ARRA 3H87C 2K5JA 2WVCA 3OD2A 2BNWA 2CADA 2K1OA 1QTGA 2H1OE 1U9PA 1MYLA 2CAJA 2BJ3A 3QOQA 1Q5VA 2JXHA 1BDVA 3QSIA 3BKUA 1MNTA 3VW4A 1IRQA 2BA3A 2K9IA 2WVEA 1PARA 2WVBA 3PHTA 1X93A 3VEBA 2K29A 1EA4A 2AY0A 4HV0A 2CPGA 1P94A 1BDTA 3BKTA 2HZAA 2K6LA 1B28A 1B01A 3BKFA 3LGHA 1BAZA 3FT7A 2PC6A 2BJ1A 4ME7E 2BJ7A 3GXQA 2CAXA 2JXGA 3VEAA 2NZCA 2CA9A 1Q5YA 1NLAA 1ARQA 2BNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GPE A;  2F1F A;  2Y3Y A;  1MYK A;  2BSQ E;  4D8J A;  3FMT A;  2FGC A;  2WVF A;  4FXE A;  2HZV A;  2WVD A;  2JXI A;  2BJ8 A;  2RBF A;  2BJ9 A;  2KEL A;  1ARR A;  3H87 C;  2K5J A;  2WVC A;  3OD2 A;  2BNW A;  2CAD A;  2K1O A;  1QTG A;  2H1O E;  1U9P A;  1MYL A;  2CAJ A;  2BJ3 A;  3QOQ A;  1Q5V A;  2JXH A;  1BDV A;  3QSI A;  3BKU A;  1MNT A;  3VW4 A;  1IRQ A;  2BA3 A;  2K9I A;  2WVE A;  1PAR A;  2WVB A;  3PHT A;  1X93 A;  3VEB A;  2K29 A;  1EA4 A;  2AY0 A;  4HV0 A;  2CPG A;  1P94 A;  1BDT A;  3BKT A;  2HZA A;  2K6L A;  1B28 A;  1B01 A;  3BKF A;  3LGH A;  1BAZ A;  3FT7 A;  2PC6 A;  2BJ1 A;  4ME7 E;  2BJ7 A;  3GXQ A;  2CAX A;  2JXG A;  3VEA A;  2NZC A;  2CA9 A;  1Q5Y A;  1NLA A;  1ARQ A;  2BNZ A; 
#chains in the Genus database with same CATH topology
 2B51 A;  1RT5 A;  1VC0 A;  1SUQ A;  3LP0 B;  1GXL A;  2H54 B;  1YJN S;  1PCA A;  4HR2 A;  1L3S A;  1BD6 A;  3DDK A;  2ZBQ A;  2QLJ B;  4JYA J;  2ROG A;  3PKY A;  3CTR A;  4C0O C;  2R7T A;  2HW3 A;  1RYS A;  2YNG A;  1M1G A;  2XS5 A;  5CYQ A;  3R5A A;  3CIZ A;  3J81 j;  3LP1 B;  4OYA A;  2ZOF A;  3TUJ C;  5F9N A;  4ZLP A;  2M8H A;  2R8J A;  5AE1 A;  1H2T Z;  3L7U A;  2GMH A;  3R1L A;  4XIU A;  2MQM A;  4DV7 J;  1TL3 B;  1V3Z A;  5KFO A;  1KOH A;  1UJ4 A;  4R8U A;  2G0C A;  3HK2 A;  3KLI B;  4H4K C;  4RNO A;  2IBO A;  2R8I A;  3K59 A;  2QL7 B;  1RAF B;  2LYV A;  1YZ7 A;  3NOC A;  1PGZ A;  3M4X A;  1GQE A;  1YVF A;  1CJU B;  1RAG B;  5DDQ C;  1ZET A;  2YY3 A;  1WHX A;  1NUE A;  4NYO A;  2YKN B;  1FCA A;  5KG3 A;  5EX3 A;  2C3O A;  5K8M A;  1WHY A;  4JI6 J;  4CH7 A;  4ED0 A;  2VQF F;  1NKE A;  2CKW A;  4TU7 A;  2XI3 A;  4YY3 J;  3KXD A;  2C28 A;  2Z2Y B;  1M90 T;  1RE1 B;  2AGO A;  3N79 A;  4RW4 B;  1NZA A;  4JB8 B;  5FD1 A;  4OZN A;  3SEO A;  1M5P C;  2O1P A;  3TEH B;  2KB2 A;  4B9S A;  1EQ0 A;  1S4F A;  2ZH4 A;  3CSK A;  5KFH A;  5KG6 A;  5AE2 A;  2B3T B;  2BJ3 A;  4WTY A;  1UW9 A;  4OZ3 A;  3NGR A;  1LWF B;  2G9O A;  3DI6 B;  2HND A;  1VQK S;  1LW0 A;  3AQP A;  4J9M A;  5FII A;  3K8V A;  1KON A;  2VB6 A;  4USW A;  2VKR A;  2GJI A;  3NNA A;  1N5T A;  3SSR A;  3AJ2 A;  5IT0 A;  1RTZ A;  2VUG A;  3RRK A;  1KOO A;  3EWG A;  4LRA A;  2R7R A;  2EFP A;  3P5B P;  3B54 A;  2IYG A;  4FXW A;  1HNV B;  4UOH A;  2E9Z A;  3HP6 A;  2IMW P;  4X4V A;  1QJH A;  4LR8 A;  5BR8 F;  3QJJ A;  2CQ1 A;  4EWT A;  3HJV A;  3M8R A;  3W61 A;  2AEJ A;  4IRD A;  3CF5 Q;  4YB5 A;  3H59 A;  3PDN A;  3EDQ B;  1RBA A;  4CYU B;  4MJK A;  5K5M A;  2UXC F;  1CLF A;  5CAB A;  1AW0 A;  2VC0 A;  4O3N A;  1S48 A;  1HNZ F;  2HEK A;  2P5V A;  2V0N A;  4DUT A;  4NI2 A;  2RF2 A;  2JJ4 D;  2WVC A;  5HQ8 A;  4TYA A;  3N28 A;  3OR1 A;  2ZH5 A;  2CIM A;  4FF2 A;  4LFB F;  1N5V A;  3Q86 A;  3DDI A;  5ETN A;  1V5V A;  2CJB A;  3GIR A;  1BWV A;  1RT3 A;  3RR8 A;  1BQX A;  2V69 A;  4L3K A;  3TR5 A;  4IH7 A;  1N54 B;  1QVF R;  2J0S D;  3HDS A;  5BYQ A;  2EXU A;  3LGN A;  2E5I A;  3QBC A;  3LPY A;  5LL6 d;  3M8Z A;  4MIB A;  4WFA Q;  3POT B;  5HJY A;  3CNQ P;  3FMW A;  1UWB A;  4Y2A A;  1UPM B;  1Y5I B;  4Z7Y A;  4PR6 A;  2GQC A;  2GA7 A;  3QJL A;  2UU9 J;  4C98 A;  2HAI A;  2HQD A;  1VK3 A;  2NCK L;  1HQ2 A;  5K20 B;  2KTQ A;  1C1C A;  2MKI A;  1ZM3 A;  3RZA A;  2OP5 A;  3LWM A;  3ENA A;  5CH7 B;  3X3U A;  3BB5 A;  5KG2 A;  1HR0 F;  1MG7 A;  1RBL A;  4IKA A;  3NNC A;  1VOM A;  4ED7 A;  4M5D A;  1S0V A;  2CQH A;  1VYA A;  3OVS A;  4PG5 A;  5DDR C;  2V8P A;  1WUU A;  5C2G A;  3WDO A;  4IH6 A;  4JUZ A;  3AXM A;  4KGK A;  1X7V A;  2RNE A;  1RYR A;  2I2Y A;  2XSF A;  4JI8 J;  2QT7 A;  1U1P A;  5E5N A;  1DZ5 A;  1T9W A;  2VFU A;  3M32 B;  3I0S B;  2DD8 S;  4RW8 B;  1N56 A;  2FD2 A;  3D6F B;  1X4G A;  1GNK A;  1C4A A;  2CPG A;  3N6N A;  1U0H B;  4DZD A;  3TJA A;  2R8H A;  3NXZ A;  1OSC A;  4F36 A;  3CCT A;  3PCO B;  3LPE A;  4NCG B;  4IOA Q;  3MTJ A;  4B3O A;  2F40 A;  2EG2 A;  3EGV A;  2JNJ A;  3H8Y A;  4F0K A;  3IRX B;  3U7J A;  5A8W B;  4GVB A;  3ZNJ 1;  3O8W A;  2I8E A;  2PMW A;  3R5G A;  1SXL A;  4DI6 A;  1NXI A;  1FJG J;  4F2S A;  1FFG B;  1FKP A;  5KG7 A;  4DR1 J;  2UV8 A;  3DLB A;  2BRK A;  1FRL A;  1PSD A;  2WSE C;  2YKP A;  4OV6 A;  1SC4 B;  5C25 A;  4C3K A;  5LSO A;  2VFT A;  1QAI A;  5CD4 A;  2ZD1 A;  4LFC F;  4OX9 F;  3W3S A;  1IKY B;  1WD6 A;  3W1Y C;  3O6Q A;  2AV5 A;  2UXB F;  1HAR A;  3M2V A;  2BW7 A;  3NAH A;  2O5D A;  3MDF A;  4DR4 F;  3C15 A;  2CQP A;  2V4J A;  1Q16 A;  3CMA S;  3VHQ A;  1F9F A;  1LWC B;  2PD1 A;  3D4J A;  2ATL A;  3ENQ A;  3CD6 S;  1KFD A;  5B0E A;  1OYD A;  1S57 A;  4A4J A;  1JLE B;  2HFO A;  1VJQ A;  2N3L A;  1NDP A;  2C2K B;  2O01 C;  2QLX A;  1B01 A;  4LFB J;  4MYT A;  3HFK A;  3R5C A;  4ZVS B;  4DL0 C;  2U1A A;  3DXS X;  4CZC A;  2NYH A;  1KLN A;  2V2V A;  4FKX A;  3KNG A;  4DR6 J;  1HPZ A;  2R9L A;  1K73 T;  3DLE A;  2A3J A;  1VQ8 S;  3M6X A;  1S79 A;  1U1R A;  2WOM B;  5CCL A;  3HO1 A;  3W5Z A;  4NLS A;  2LVW A;  4LF6 F;  3MM6 A;  1RT2 B;  4ZPD A;  4WPA A;  2XWY A;  4F2R A;  2D9P A;  3GR1 A;  2CAJ A;  1TV6 B;  2OD6 A;  4IG0 A;  2RQK A;  5KFU A;  3CJ3 A;  4DWI A;  4YB1 P;  2XYP B;  3I32 A;  1DAX A;  1PAU B;  2KFY A;  3KJN B;  3IBF B;  4ZDN A;  5LOQ A;  2C2E A;  3UW1 A;  3OTO F;  4IQM A;  4U8Y A;  2H3A A;  2PA8 D;  4HAC B;  5J2M A;  4CM0 A;  2ZVS A;  2J6U A;  2B4U A;  1HNI B;  1ZOT A;  1R6Y A;  2EFV A;  4IUF A;  1EAR A;  4YQW A;  2ACY A;  2MLZ A;  1FDA A;  4URQ U;  1Q8B A;  2B4P A;  1U6F A;  5EUH A;  4DPO A;  3HHL C;  3T5J A;  2LU2 A;  1FDB A;  4KV8 A;  3G82 A;  2N7Y A;  1ZAW A;  4WXW A;  2PI4 A;  2FY1 A;  3RG6 A;  2K1O A;  1T95 A;  4WZM A;  2MPU A;  3D6M B;  2ZBI A;  5HMY A;  1YDL A;  2VIC A;  3QQC D;  1F9H A;  1ZTT A;  4I6W A;  1NO8 A;  3OLB A;  2XBP A;  2MQ8 A;  4NLD A;  3AHP A;  3DN9 A;  3GCX P;  3TZZ A;  2GVD A;  2L41 A;  5G0R B;  4LFC J;  4WU2 A;  4RU9 A;  2DNO A;  2UXB J;  1RI7 A;  1DHM A;  4URS A;  4DV0 F;  5K9F A;  2RHQ B;  4DR4 J;  1LKZ A;  3KHH A;  1XMO F;  3PW0 A;  4BWJ A;  2IM0 A;  3DOL A;  1KQK A;  3GIL A;  1QAY A;  2NSC A;  5T7L B;  1AB8 A;  1WHV A;  3ZZ0 A;  3D6H B;  3MM9 B;  4U67 Q;  3G86 A;  2RT3 A;  2H1Y A;  3KLG B;  1KDN A;  1RT5 B;  5D0E A;  5IXU A;  1GTH A;  4QYZ J;  2U2F A;  2AX0 A;  2C42 A;  2YNH B;  3FBB A;  4ZCI A;  2XO7 A;  2KO1 A;  4DBQ A;  3WX4 A;  4DR3 F;  1NSP A;  3N01 A;  4J9R A;  2R2T A;  2FLP A;  4RNH A;  5CYQ B;  5DRK A;  4F02 A;  1UEK A;  3TVK A;  3FZ2 A;  1UEV A;  3D1H A;  2BM0 A;  5E3P A;  2M4M A;  3PHT A;  2HGN A;  2NS1 B;  4LF6 J;  5SUH A;  2JFK A;  1VK8 A;  3OL7 A;  1KS2 A;  4NXN F;  2RS8 A;  3QFH A;  4R8U B;  3MMJ A;  2Q3P A;  5IOL A;  3HD1 A;  2IYI A;  1QDU B;  2DR6 A;  4ZVT B;  3D1O A;  4IRC A;  1J27 A;  5B0B A;  4RO0 A;  5SZT A;  1VLO A;  1JQG A;  4DSJ A;  1X8D A;  3QT6 A;  1CS4 A;  2LQB A;  4ZP8 A;  3IGV A;  3QRR A;  1IKV B;  2QMW A;  2VBX A;  4FPI A;  3M9O B;  4G1Q A;  5EGY A;  2AIR B;  5HI7 A;  4DLG A;  1SJ1 A;  2IC3 B;  1ARO P;  1FXL A;  2ASJ A;  1CQN A;  2M7S A;  4DQS A;  4V1A k;  1VJW A;  1GK8 A;  2YH0 A;  4N41 A;  2MB0 B;  2ZOG A;  4FBT A;  2HGL A;  1ZAV A;  1WC3 A;  3TZW A;  2EFQ A;  1FNM A;  3TWZ A;  3CME S;  4CLP A;  2UZA A;  4KGX B;  2GHW A;  2CQG A;  5HK4 A;  1RZM A;  4ZCK A;  2F9J A;  1S9E A;  4C3M A;  3GE9 A;  2IY5 B;  4ILM A;  4M5G A;  2A1B A;  3UO0 A;  2IHR 1;  5FDL A;  3FFI A;  4LVO P;  3CDA A;  4OJ1 A;  2RUS A;  4WYW A;  1NRK A;  4PG8 A;  3KLH A;  3W62 A;  1FEH A;  3IP0 A;  2DHA A;  4H4O B;  2GX8 A;  4CCH A;  1RXO B;  1WF1 A;  1NJI T;  4DV6 F;  2VDI A;  4ZJO A;  5JUM A;  4OZ2 A;  4TU8 A;  2HK2 A;  4NLQ A;  2KZZ A;  1SKU B;  4RNM A;  1OQ3 A;  2PII A;  1LQ9 A;  4JI5 J;  1LW2 A;  4DV0 J;  4A8S A;  4O0N A;  5J1E A;  1CPZ A;  2O67 A;  1TQL A;  3MHY A;  3SI8 A;  1YLX A;  2YWH A;  5CA5 A;  4KBI A;  4IR1 A;  2WAQ D;  3IM8 A;  3WC0 A;  3HVA A;  1R8C A;  1MWZ A;  4CH0 S;  3R5D A;  3M8Q A;  2Q43 A;  1D0E A;  1S72 S;  1RT3 B;  3MMB A;  4DR2 F;  1IJE B;  3OL9 A;  1RA6 A;  2ZNZ A;  4QIW D;  4HDG A;  4OQJ A;  1K9M T;  2W9C A;  2MTL A;  3J7A 1;  4DR3 J;  2SXL A;  2R8G A;  3P5T L;  1RTH B;  1YTY A;  4P7V A;  1NK4 A;  2DR9 A;  2HPU A;  1HMV A;  4F0H A;  1FTC A;  4WWS A;  2EKN A;  1CC8 A;  3JSB A;  3ZXW A;  4AL5 A;  4DX5 A;  5CHC B;  1KTQ A;  3H20 A;  2LQ9 A;  4FYV B;  4NXN J;  2BQ3 A;  1S9F A;  1SC3 B;  3OHB A;  4P2M A;  4FVC A;  1B99 A;  1JKH A;  4P10 A;  3EMT A;  4ICL B;  4Y2K A;  3W9J A;  3M8Y A;  5E3Q A;  1P8G A;  4TY8 A;  2JEF A;  3UD3 P;  2ROP A;  1GT8 A;  4RWW A;  4BC9 A;  1U49 A;  3OR2 B;  2A2B A;  4X4T A;  3SXL A;  5KFR A;  1JB0 C;  4RZR A;  3M2U A;  2ZHB A;  5K14 B;  1NSA A;  2LEP A;  5I3P A;  4P52 A;  5HLF B;  4J9S A;  2NXJ A;  4EYH B;  2X51 A;  4IFY A;  1RWP B;  3M8P A;  5KFG A;  2KH9 A;  3GMG A;  1JX4 A;  1UJ6 A;  1ZTW A;  4KAI A;  1FE4 A;  1X5T A;  2VG6 A;  2NZ4 A;  1J5O A;  2R7U A;  4C7Q A;  3MOJ B;  2OTJ S;  1UZD A;  2MKJ A;  4MKB A;  5ETR A;  2ZBR A;  4B3O B;  4IO1 A;  2E5H A;  4ECU A;  4QWC A;  1VQ9 S;  2G1H A;  2FJX A;  2GPE A;  3HI9 A;  3UDC A;  4LF7 F;  3ENW A;  2RRA A;  3LP2 B;  2MZJ A;  3PKM A;  3MM8 B;  4WFZ A;  4P74 A;  2MQP A;  1HI8 A;  2W2Q P;  2XHC A;  4PPD A;  3MWB A;  1X5O A;  4NZ6 A;  4D3H A;  4P2X A;  2HFS A;  3AOA A;  3UCZ P;  1IJF B;  2IMO A;  4J90 A;  2LXF A;  3LWL A;  2KKH A;  4P2S A;  3B6B A;  2BJE A;  3ILI A;  5B0D A;  4GO7 X;  4JI7 J;  3AD9 C;  2AQ4 A;  4CH1 A;  3NBP B;  3JYT A;  2B6A A;  1HLW A;  3GCW P;  4O0I A;  1AUS L;  4NE9 C;  2ZWO A;  3C15 B;  4CT9 A;  4KH1 B;  5DLG A;  2EFN A;  2MZS A;  5F8J A;  3MMA B;  3TA0 A;  2DPI A;  4ZMM A;  3A8J A;  2BR0 A;  3DOK B;  2F65 A;  2C2N A;  3DKD A;  1Y7P A;  2ASY A;  3I87 A;  2YX4 A;  4DR2 J;  4Q45 A;  1KLM A;  5IZH A;  1RP5 A;  3DRS A;  3A8K A;  1D9F A;  2ZC3 A;  1U02 A;  3H90 A;  2IAJ B;  2GGP B;  1FEE A;  3H25 A;  3OVB A;  3AA8 A;  4MK9 A;  1X9M A;  3NAI A;  4CI0 B;  4C8Z A;  1H6K X;  5F3Z A;  4PAA A;  2MY8 A;  1Q8K A;  3R5B A;  2H4Y B;  4OLP A;  1PIE A;  4PQU A;  5G4D A;  3OFH A;  2DNZ A;  3KJV A;  1VHI A;  1FRJ A;  1S49 A;  3PNI A;  4IG0 B;  1XC9 A;  5EN1 A;  1U48 A;  4QWA A;  4QBU A;  3GON A;  2Z4P A;  4DX7 A;  4LMZ A;  3GFZ A;  2KG1 A;  2KZM A;  2DRD A;  4ATN A;  1ZA1 B;  5D4L A;  4GKJ F;  2ZDO A;  3VF0 B;  4K50 A;  1GEH A;  8ATC B;  4C8L A;  4OYZ A;  1N0V C;  2FTR A;  3KG0 A;  1IVZ A;  3CO9 A;  2PGC A;  5A8K A;  5IWA J;  4ZIW A;  1MU2 B;  4U96 A;  2EI5 A;  2F1F A;  4ANE A;  4L75 A;  1OWX A;  5A8R A;  2V63 A;  2M8D B;  1R3N A;  2J9C A;  3QSY B;  2KKE A;  1NHU A;  1XNQ F;  1NPK A;  2O3D A;  2CNO B;  3HVW A;  5J1N A;  2OSR A;  1CVJ A;  1RHK B;  2BKP A;  3P3D A;  2MGZ A;  5ETP A;  4ES3 A;  3C14 A;  4CP5 A;  3D6T B;  3DCA A;  1ZAX A;  4Y65 A;  1D8Y A;  1ZM2 A;  4TVA B;  4D3G A;  4ETX A;  2YKQ A;  4OYX A;  5GAG I;  2ZH6 A;  1TL7 B;  1SIW A;  3W2W B;  2AX1 A;  1RGV A;  2DTJ A;  4ZHR B;  4MFB A;  4RUC A;  3LAM A;  1DQA A;  2J9D E;  1BDT A;  3IFE A;  1RJJ A;  3NGD A;  2RAQ A;  2HVI A;  1EP4 A;  3TA2 A;  4K2X A;  4IG3 A;  4WK1 A;  4WK3 A;  4ZVG A;  1F9E B;  3PEJ A;  1RWW B;  1WDD A;  2QIF A;  4I2Q B;  4HLB A;  2COL A;  4WFN Q;  3U27 A;  5HN0 A;  2V2K A;  3OTB A;  1ARQ A;  4M5K A;  1SIZ A;  3JQM A;  1X9S A;  4J37 A;  2CPZ A;  2IM1 A;  2LMI A;  3CMQ A;  5DLF A;  4KT0 C;  2XLK A;  5KFW A;  4ECV A;  5C24 B;  2DNN A;  1JXV A;  3FJ2 A;  4A48 A;  1JNZ B;  3V6H A;  2OI2 A;  1YQH A;  4RUH A;  3A12 A;  1IWA A;  2GO8 A;  3M7V A;  3BKU A;  4N76 A;  4O3Q A;  1RT4 A;  4AL6 A;  2YWK A;  2ZE2 A;  4KSE B;  1FTR A;  1VGY A;  4HT7 A;  4RW9 A;  1RAH B;  2C22 A;  4WII A;  1OS5 A;  2VOP A;  4O3P A;  2D1C A;  1LXJ A;  1SKR A;  1XBW A;  3J80 U;  2CPY A;  3M9M B;  5I3Q A;  4PWD A;  2JFD A;  1WAC A;  1L3V A;  2I5J A;  1NK8 A;  4Y28 C;  2AYB A;  2HHX A;  2BAN A;  3DHX A;  1Z1Z A;  2DEI A;  3LAK A;  3K2Y A;  2NRE A;  4DV4 J;  1KQG B;  4AFF A;  2ZH3 A;  2QJ3 A;  3CJT A;  1KWM A;  2DY1 A;  3ZZP A;  2I0X A;  2RDD A;  1T05 A;  4G1Q B;  3O2I A;  1FKA F;  1FO1 A;  2R7X A;  2K2P A;  4Y2C A;  2HQI A;  2KXN B;  1M5H A;  4AAI A;  4PUO B;  4CLZ A;  3E8O A;  1NK6 A;  2DNH A;  4OZ1 A;  2DY9 A;  3OXF A;  3BKT A;  4A8K A;  1QD1 A;  3H98 A;  1TVR B;  2XZT B;  4OIX A;  8AT1 B;  2LA4 A;  1FDD A;  1VQS A;  2GQQ A;  5D4N A;  1VHF A;  2L08 A;  1RT1 A;  1H74 A;  1RTJ B;  2XUL A;  3FFI B;  2JXG A;  1SV5 B;  1AZS A;  1N32 J;  5KFT A;  1E6Y B;  1BWE A;  2Y1R I;  1WEL A;  3K0J A;  4EO8 A;  4ZVE A;  2DIV A;  1PJ6 A;  2MHE A;  4DUY F;  4ZLJ A;  3Q8Y A;  2APO A;  3EGZ A;  3LH2 S;  2C2Z B;  2YNF B;  3IR7 B;  4B9U A;  1RTI B;  3H0P A;  1BHN A;  1ZPV A;  2EK1 A;  2HVH A;  1EKS A;  2QLW A;  3DRP A;  4FS2 A;  4J9U E;  1BUX A;  1UFW A;  3SYZ A;  3KK2 A;  2PI5 A;  1RAJ A;  3WC2 A;  5J1E B;  2AGP A;  1K0V A;  3I55 S;  3TX0 A;  3FRZ A;  3RW7 A;  1SQG A;  2FVQ A;  1YBT A;  4USU A;  3CC4 S;  4QPX A;  3MOZ A;  3PHE A;  3Q2T C;  2L9N A;  3MI7 X;  4EK2 A;  4WP3 A;  3KJF B;  1JLQ A;  2CQ3 A;  2XMU A;  3DLK B;  3GFY A;  3NP5 A;  3G6X A;  1T03 B;  3Q23 A;  1QY7 A;  1K0T A;  4HTJ A;  1AT1 B;  2J6S A;  1T9U A;  1R0C B;  2N4C A;  2OFG X;  3FSI A;  4O44 B;  3LGH A;  5KFB A;  2LCW A;  1KNZ A;  2W9C B;  3US5 A;  2X1A A;  4H4K A;  2XWX A;  4LSL A;  1WWH A;  1UVN A;  2ZHO A;  4AXI A;  2HWH A;  2R7O A;  1T9Y A;  1Q53 A;  2FYX A;  2PMH A;  3K5P A;  3MCS A;  3OJU A;  3QLH B;  4WXO A;  4ZLN A;  2A6O A;  4KPY A;  1XK8 A;  5DO2 A;  1YZ6 A;  3V4I A;  2HHV A;  2JLF A;  4USK A;  3KK1 A;  2WTF A;  4IH5 A;  3RAM A;  4F3O A;  3BYR A;  2XI2 A;  2ZUG A;  3SV4 A;  1RAO A;  1VIX A;  3Q0A A;  2F5G A;  1UL3 A;  2Y1L B;  2JEG A;  2ATC B;  3KNA A;  1M5S A;  4NX9 A;  2F4F A;  1NAQ A;  2HQC A;  2M9K A;  4ILR A;  3UN2 A;  1OO0 B;  4M8L A;  2XCP A;  4USJ C;  2WB4 A;  4KHR A;  1SJF A;  1EA4 A;  4B3R F;  3DOM A;  2RKI B;  3QO9 A;  4X4O A;  4Z37 A;  4ELU A;  2AYG A;  3EVM A;  2V8V A;  2XQC A;  2AZ3 A;  3QZ8 A;  4OYO A;  1TFY A;  3RBX A;  2RS2 A;  1SC1 B;  3E01 B;  2KJV A;  1WOR A;  3JTP A;  5GAE U;  4ZCM A;  1UA1 A;  3GIJ A;  1SJQ A;  2HFN A;  2XY5 A;  2Y0S D;  1YKW A;  2DHH A;  2DIT A;  4B08 A;  1H98 A;  1I3O B;  2YH1 A;  2E66 A;  5CQG A;  1UAW A;  2D3Z A;  2I6W A;  1B70 B;  4M5N A;  3KHR A;  4ECZ A;  2KT3 A;  4DXL A;  2CZ4 A;  2L9W A;  1WKL A;  3FK4 A;  4PG7 A;  3V6J A;  2YXL A;  2DCL A;  3N6M A;  2CJ9 A;  3IG1 B;  1UCN A;  3G96 A;  4DUY J;  1TKX B;  3W2V B;  5KFD A;  4V19 X;  2IJN A;  2LQJ A;  4E0D A;  1T3N A;  4CLW A;  9RUB A;  1X93 A;  3TO8 A;  2QC3 A;  1NLK L;  1AXQ A;  4PYA A;  4HEA 9;  2HLT A;  1M5K C;  1N33 F;  2ZH7 A;  3JXO A;  3J7A N;  2NUU G;  4IRK A;  3CDW A;  2HNY B;  1UW4 A;  2YWF A;  2DNM A;  2E5J A;  1EQM A;  2B43 A;  2AJ4 A;  4ERD A;  2DH8 A;  1X4F A;  4J9K A;  2AJQ A;  4WBF A;  4YR2 A;  4QW8 A;  4HHH A;  2AZ1 A;  2J0W A;  1PAR A;  3MCN A;  2HHS A;  4Q2M A;  4FXE A;  3T1H J;  5GME A;  1VFJ A;  1S4E A;  3JSM A;  5J2Q A;  4JI4 F;  3ZTO A;  2FLL A;  4DSI A;  2BJ9 A;  4ZCL A;  2MHN A;  3TI0 A;  3AD8 C;  3BGO P;  1PJ5 A;  4RX6 A;  3PXG a;  4LF5 J;  2BM1 A;  5KTQ A;  3ET6 B;  2G2Z A;  1U9P A;  3MM5 A;  2DO4 A;  3A3O B;  4G65 A;  1S5Z A;  4LF8 F;  3R1H A;  4PQU B;  2OML A;  4ZVU B;  3HZE A;  3UN5 A;  1QVG R;  2WON B;  3BGR A;  3QIP B;  4QW9 A;  2DR8 A;  3BH7 B;  3ZTS A;  1NPP A;  4MJW A;  1RTD B;  1JLF A;  1IN0 A;  2HGM A;  3B78 A;  4F4X A;  3IRW P;  3NMR A;  2CDQ A;  3MED B;  4YHH F;  5I42 B;  3LP0 A;  3BKF A;  2HVD A;  4UZC A;  4LRB A;  2CG8 A;  2MZQ A;  2AEF A;  3MR5 A;  3IWN C;  3MTK A;  2VPZ B;  3I9V 9;  4ZKA A;  2GMJ A;  2P8I A;  2R7V A;  2Z2Z A;  1RLC L;  4PXE A;  3HVT B;  3LP1 A;  3TZX A;  1PBU A;  3WX8 A;  4F67 A;  4K5S A;  3M05 A;  2YWG A;  1N34 F;  1WTF A;  3AFG A;  3PG9 A;  2FC9 A;  3ZZZ A;  2ZZM A;  5B0G A;  4YME A;  2KEL A;  2ILY A;  4J91 A;  3SQG A;  2LKZ A;  3W60 A;  3GFX A;  1TUV A;  2IVF B;  2LEC A;  2VG5 B;  5HRO B;  2B8Q A;  4FYW B;  3KLI A;  3GU0 A;  4GMK A;  2FJB B;  1RKI A;  2QYG A;  4OMF G;  4ECR A;  4KPC A;  3C14 B;  1RAE B;  3Q8U A;  1T9V A;  2HHP A;  3VW4 A;  2IRU A;  3G6E S;  1IQZ A;  4CRJ A;  2YKN A;  1XTZ A;  3EVO A;  1F3F A;  1R8P A;  4LBI A;  4GC7 A;  3U1M A;  3W64 A;  1VI7 A;  2K6L A;  2MY7 A;  2MKC A;  1UFK A;  4ES1 A;  4RW4 A;  3NEK A;  3NY0 A;  2BA9 A;  1Y10 A;  1VQL S;  4N77 A;  3N0V A;  2CQI A;  5HP1 B;  1JJ4 A;  2JH3 A;  1S7H A;  5F8H A;  4C11 A;  1KBR A;  4OX7 A;  2F3J A;  2RDI A;  1N33 J;  2MSS A;  5GMD A;  2ZZT A;  3P49 B;  3C66 A;  5MAO A;  5E33 A;  2XHW A;  5L1K A;  3IO1 A;  5A0Y B;  3EVW A;  4EUV A;  5IV3 A;  1WEX A;  1LK7 A;  1TL1 B;  1FRM A;  1QAJ A;  3H5X A;  1U6B A;  2FVC A;  1U1M A;  4XPC A;  2JVO A;  2BJD A;  2EWH A;  3JAM Y;  2BYC A;  2DK2 A;  4ZP9 A;  1RQ0 A;  5F8I A;  4JI4 J;  2DGO A;  4NRT A;  2IPO B;  1IBK J;  3ILO A;  1G2E A;  3VEB A;  1XMQ F;  2B9E A;  3D0H E;  3G8Q A;  2CPE A;  1N0U A;  3U02 A;  4DOZ A;  3CT9 A;  4Y00 A;  1CBK A;  1U1L A;  4LF8 J;  4M5J A;  2OPR B;  1HBU B;  4R0E A;  2OGU A;  3BSN A;  5IS2 A;  4X4R A;  4KY3 A;  4DV3 F;  3TUI C;  2VU5 A;  3FBE A;  1HYS B;  3SQO P;  3QWU A;  2BAN B;  1TKT B;  3RTV A;  1H38 A;  1TK5 A;  3AJD A;  4NLV A;  3AXK A;  4MIW A;  4QR2 A;  1SQF A;  3MPD A;  2W25 A;  1MRO B;  2MKK A;  1WKJ A;  3POT A;  3CB4 A;  3SCK E;  3NS7 B;  4BDP A;  4LT6 A;  2VG7 B;  3QOQ A;  3R8Y A;  3RRG A;  2CG4 A;  1N34 J;  2POK A;  4XO0 A;  3JB9 k;  4NZ0 A;  5HVG A;  3IAS 9;  5KFK A;  1XNR F;  1FD8 A;  2Y1J A;  2NXU A;  2J5A A;  3T1A A;  4B3S J;  1PBA A;  1P94 A;  1IWG A;  1LEO A;  3PYF A;  1IBC B;  2EC2 A;  4M95 A;  4JI2 J;  2ZBP A;  2X1G A;  4PYD A;  4QIG A;  3CJR A;  4I0W A;  3HZG A;  5KT2 A;  2ZHA A;  4ZPA A;  3E3X A;  4FNH A;  5DM6 Q;  2FDN A;  2OH2 A;  1N8R T;  3M2R B;  1N6Q B;  2XSJ B;  5ETM A;  1GXU A;  4DPW A;  4DL2 A;  2VZ9 A;  4HI2 A;  5E41 A;  2WHO A;  3HHL D;  4X64 J;  1HQE B;  2ZOM A;  2J9E A;  3O3L A;  2UXD F;  1DUR A;  3M9N B;  1A7G E;  3DMJ B;  4JV1 A;  1NJY A;  4OZ5 A;  4Y0F A;  1S1U B;  2J7W A;  3I0S A;  3M8W A;  4ZPW R;  4RW8 A;  2M3D A;  3EX7 B;  3T9N A;  3VCD A;  2Q66 A;  4XAK A;  4NCG A;  2CJQ A;  2GJ2 A;  4KIA A;  1XR7 A;  2H5E A;  5D77 A;  1JLC B;  1KRP A;  1ICE B;  5IT9 U;  3IN5 A;  4N8O A;  2LQ8 A;  3IRX A;  1VS3 A;  3OTE A;  2FHO B;  1KHW A;  4DQR A;  2HAF A;  2DB1 A;  5LMN F;  4WJB A;  3QT5 A;  4DL5 A;  2PT0 A;  2YKM B;  3VZI A;  2BKO A;  3DXB A;  2KU7 A;  1WOP A;  1ACM B;  4DR7 J;  1S6P B;  4X4N A;  3M6U A;  4A46 A;  1F60 B;  4OHW A;  1IKY A;  3KUH A;  2NPF A;  2ZZN A;  1FE0 A;  6AT1 B;  2KYX A;  4RUA A;  3SDE B;  5DQH A;  2BV3 A;  1UFL A;  1C1B B;  3BV8 A;  1MYK A;  2QSW A;  3GPA A;  3NNH A;  5ETO A;  4I7F B;  1LWC A;  7AT1 B;  4YR0 A;  2KM8 C;  4DG1 B;  1LFW A;  4ELT A;  1DY3 A;  3NCQ A;  4DLE A;  2BXJ A;  1PYT A;  4LF9 J;  3SSS A;  1R0B G;  3C3L A;  4OHX A;  1JLE A;  3R2D J;  3FUY A;  1VQY A;  5GVQ A;  4NLY A;  3T5L A;  4WCE Q;  3UFC X;  4U9R A;  4X84 A;  1B3T A;  2Z30 B;  1T0T V;  1S9G A;  2BOP A;  2OEJ A;  2JVR A;  2NXN A;  4RJV A;  1OYE A;  3D3C J;  2W4P A;  1FFS B;  4KR0 B;  2BAC A;  3OFE A;  4JYA F;  1TR0 A;  2WBM A;  4A8O A;  3QZ7 A;  1HBM B;  4XTT A;  4E98 A;  2DR5 A;  4F3Q A;  2V2Z A;  4KO0 B;  3V5R A;  2FIU A;  3FEY B;  2WOM A;  4ED1 A;  5LMU F;  4YUD A;  1KC8 T;  5KG0 A;  2JRS A;  3KHL A;  2E44 A;  4ME7 E;  2OPS B;  4DV7 F;  3PR5 B;  4N8N A;  2IDL A;  1VQO S;  5LSL A;  1RT2 A;  4QWB A;  2ZEJ A;  2QZ8 A;  3T9Z A;  4QIV A;  2VKZ G;  1XNR J;  1JLA B;  4W98 A;  2BSQ E;  2XS7 A;  2RVJ A;  1V9O A;  4USI A;  4QYR A;  4PCQ A;  3KMQ A;  4NMX A;  4O3S A;  1U2F A;  3CDU A;  1IR2 A;  4LIW A;  2Z2M A;  3G5O A;  1HBO B;  1IBM J;  5L38 A;  5CXT A;  2VH7 A;  5DQG A;  3CCZ A;  2F8E X;  5DJB A;  2CVE A;  4X65 J;  3TA1 A;  1SB6 A;  5EWE A;  3ZNU A;  4JI6 F;  4R5P B;  4ZVO B;  1ZZN A;  2HLU A;  4FS1 A;  4YY3 F;  3QJP A;  3KLE B;  2A2D A;  4HAC A;  2CQC A;  2MQL A;  4CQ1 A;  2CQ4 A;  1HNI A;  2V8G A;  5L1L A;  4LSN B;  5CD4 H;  3AOC A;  3MUM P;  2PN6 A;  2HWI A;  3GG0 A;  1BGX T;  2AKW B;  1QTN B;  2G4B A;  3BSA A;  4YB6 A;  4NLP A;  2FZG B;  4H4M B;  3EGN A;  1YRX A;  1Z2Z A;  2WB1 D;  4MKY A;  3P4U B;  2W01 A;  3P96 A;  4RKU C;  2IRY A;  3H5U A;  4A8Q A;  2ACM A;  2MXY A;  1XR6 A;  4NLO A;  3BGL A;  3QAE A;  2KFN A;  3UWT A;  4RPF A;  2E7X A;  4RWX A;  3PFO A;  2F4V J;  4K7Q A;  3AQO A;  2W4C A;  2DR7 A;  1WKK A;  1HD1 A;  2WSF C;  5G0R A;  2GIQ A;  3FBC A;  4IOB A;  3PY8 A;  1MLA A;  1VIO A;  2CAD A;  1I1G A;  4AUK A;  2BX6 A;  1PKU A;  2KG0 A;  1HA1 A;  5C7P A;  2JEI A;  1K44 A;  2W8K A;  3J80 Y;  3Q8Q B;  4FYY B;  2G1D A;  4RW7 B;  1U8W A;  4I68 A;  2HNZ B;  4DX8 H;  2W7P A;  1YHQ S;  1MNE A;  3HKZ D;  3HSD A;  3MM9 A;  1UZH A;  4NZ7 A;  3VTI A;  1UTA A;  5HO4 A;  2P6S A;  2EBG A;  3MMC B;  3KLG A;  1WNE A;  1JLF B;  1BLU A;  2HIY A;  4UUW A;  1VRT B;  2YNH A;  3A4T A;  2J8A A;  3UI3 A;  1GMU A;  1Q5Y A;  1MML A;  2HFV A;  5IT4 A;  2YTC A;  3C6U A;  2Y8W A;  4N7T A;  5M2R A;  2BUN A;  2MLY A;  1TAQ A;  2GQ2 A;  2BW2 A;  3CGI A;  4UY8 T;  5HBM B;  1FWK A;  5JMN A;  2ADL A;  3CIM A;  1DTQ B;  2RE1 A;  3OPK A;  2Z58 B;  2UU9 F;  5LMU J;  4R25 A;  2DEJ A;  1IBL F;  1RIS A;  1TEL A;  2V8H A;  2RQ4 A;  4U6P A;  5D3G B;  3MPW A;  3AB4 B;  1KVJ A;  4DF8 A;  2BQU A;  3SQG B;  2FUG 9;  5KFE A;  1H72 C;  3FVY A;  2MKS A;  5EWG A;  2CJX B;  2HRU A;  1I6J A;  3VAF A;  1HBN B;  4NLU A;  4DUZ F;  2WW8 A;  2Z57 B;  4NLW A;  2R7Q A;  4BWM A;  2CFX A;  1EX8 A;  2HHT A;  1N5Q A;  1YBA A;  4F04 B;  5KG4 A;  3H5S A;  2DCU B;  2DGX A;  1SJR A;  4E8U A;  2RU9 A;  1IKV A;  3FEZ A;  5KFC A;  5IC6 B;  4JI8 F;  2IC3 A;  1X4D A;  3BEG B;  3QFW A;  5THW A;  4ILL A;  2ZWP A;  1D8Z A;  3NKY A;  1N48 A;  2VA2 A;  5ETT A;  3MEK A;  3NGS A;  3D9B A;  2Y0B B;  3CDB A;  2DH9 A;  1Y11 A;  4C11 B;  1FNO A;  2H3E B;  2YWE A;  2KRB A;  2HHW A;  4NYZ A;  4F25 A;  4ECX A;  4OZ0 A;  5HAN A;  3LAN A;  2LA6 A;  1HQU B;  3BSO A;  1RHU B;  4ECY A;  3OXL A;  1FJG F;  1VBZ A;  4AQY J;  1NK5 A;  4TXS A;  4DR1 F;  2A18 A;  5DG9 A;  4A8X A;  2R8K A;  3D1Q A;  3K58 A;  4H4O A;  2GVZ B;  3JSY A;  5JJB A;  2OAU A;  1BC6 A;  4RUB A;  1TL5 A;  3THT A;  4QWD A;  2QSF A;  4X62 J;  5A2Q Y;  4WFY A;  3R5J B;  5KFL A;  3HXM A;  2HS3 A;  3FGV A;  2CVI A;  3D0I E;  1JXE A;  2AT1 B;  1N4L A;  4F3M A;  1CSJ A;  2YPZ A;  2DXD A;  1RT7 B;  3NGK A;  4KHP F;  2DKO B;  5H1S V;  5EX0 A;  4HDH A;  3BJY A;  2J7U A;  3C16 B;  3N9U C;  2J6T A;  4FF3 A;  2OSQ A;  3TP2 A;  2HHH J;  4N47 A;  4CM2 A;  1D3W A;  4Q0B B;  2CPH A;  3H2L A;  4CT8 A;  4S0M A;  4OLO A;  4EGL A;  1FT8 A;  3RGI A;  1JK9 B;  3CO0 P;  1G4C A;  1UVK A;  2AWZ A;  2UP1 A;  4K0K J;  1CJK B;  1TFW A;  4DR6 F;  2DIS A;  2GO9 A;  2KRR A;  3CCJ S;  3QRP A;  4NA2 A;  1RTH A;  1REV B;  3HHL B;  3R7B B;  4LRE A;  2C3Y A;  3V6K A;  1VQ7 S;  1FVQ A;  1XMB A;  1C0U A;  1XR5 A;  3VQT A;  3L7P A;  2UUA F;  1IBL J;  3RBD A;  2OLW A;  1FVS A;  3T1Y F;  3I56 S;  1HWJ A;  4C48 A;  3MAA B;  1WJ9 A;  2CQB A;  3PYG A;  3RB0 A;  3R2C J;  4ICL A;  5HMW A;  2IFX A;  4DUZ J;  4KB7 A;  4Y3C A;  3QMQ A;  2DNG A;  1SH3 A;  1S77 D;  2M0G B;  2DGW A;  2DGQ A;  3L09 A;  1X4E A;  3OR2 A;  1VQ6 S;  1FX2 A;  4I1T A;  1EAY C;  4MH8 A;  1A9N B;  2UVU A;  5F8G A;  3G6V A;  4XDD A;  4JOU A;  5K14 A;  2QMX A;  2VF3 A;  5HLF A;  4IO9 Q;  4KYZ A;  2UV8 G;  4DSE A;  1HI1 A;  1P9Q C;  3SCL E;  1NDK A;  2W7A A;  1MW7 A;  5J2P B;  2VIH A;  2HVE A;  3RJM B;  2HBR B;  4YP3 A;  3MR6 A;  5HVF A;  2ALY B;  1U2C A;  3GYG A;  4Y2M A;  3MUT P;  2CZ9 A;  1GX5 A;  4DFK A;  3LP2 A;  2FJD B;  3PIP Q;  1SVD A;  2IJF A;  2V9K A;  3MM8 A;  2NR0 A;  3HSJ A;  3VAM A;  1L5U A;  4DN9 A;  4M1K A;  4QJV A;  4URG A;  4DS4 A;  2OPP B;  1Y9O A;  4PAB A;  5C2C A;  2RHS B;  2GNK A;  2RB7 A;  2IA0 A;  1YJW S;  1QUP A;  3R27 A;  3DDN A;  1RT6 B;  2FQQ B;  3K7R A;  5DGA A;  3QPI A;  3NBP A;  4PZV A;  3MR7 A;  3NWG A;  1S1V B;  1NH8 A;  2ZM6 F;  4GKK J;  3DGP B;  3A13 A;  3TNV A;  3N5F A;  1FRK A;  4KHP J;  4ZP7 A;  4E2F B;  4ZVF A;  4XPE A;  3MMA A;  3PX4 A;  4OX6 A;  3I96 A;  3BSC A;  2V8D A;  4DS5 A;  1Q5V A;  1KR4 A;  3DOK A;  5LJ3 Y;  1QSS A;  4JP8 A;  2QV6 A;  4TY9 A;  5DG7 A;  3OXG A;  5E3C A;  1UVL A;  1S9G B;  5E3A A;  3VV2 B;  4M94 A;  4PWW A;  1EJ7 L;  4CLU A;  2V50 A;  2IAJ A;  2GGP A;  1IKX B;  3ENV A;  5MLC V;  3PW4 A;  2HMI B;  4F4W A;  1NBE B;  2OHD A;  2PC6 A;  4UQT A;  3I31 A;  5L9N A;  5KT5 A;  1OG7 A;  1S0O A;  4B9T A;  3OUY B;  4DEZ A;  3GV8 B;  3V2U C;  1N52 B;  1X9W A;  5GAG U;  2CPF A;  2UUA J;  4ED2 A;  4DFJ A;  1R31 A;  1MMN A;  5ETL A;  2W9B A;  4LRF A;  9ATC B;  1T9T A;  3T1Y J;  3LF0 A;  4HT5 A;  3AAW B;  3A8E A;  3P6Y C;  3MAQ A;  2D41 A;  4KRW A;  4YEA A;  5ADZ A;  1FNX H;  1OJ4 A;  1YJU A;  4K4V A;  2D3O 1;  4OI2 A;  1KTV A;  2DNK A;  3BDP A;  1MN9 A;  1GTE A;  3DRR B;  3MEC B;  1ELO A;  3CJ0 A;  4P6Q A;  2BE7 D;  2YNI B;  4NML A;  4J5O A;  2ZH9 A;  3HFZ B;  1R8B A;  1U1N A;  2HHQ A;  3TJ8 A;  2C2O B;  3GG1 A;  3GJR B;  1MU2 A;  4HI1 A;  4LFA F;  3M30 B;  3PW5 A;  4U8V A;  2V68 A;  2OUG A;  1NKC A;  4HV0 A;  3GFH A;  4UOF A;  2ZBC A;  2H65 B;  3BR8 A;  1NJZ A;  1I94 F;  4ZLL A;  2QYC A;  1AUD A;  3NGT A;  3W65 A;  3PYE A;  2BE2 B;  4G3I A;  1S6O A;  4DR5 F;  2CAX A;  3HX9 A;  2A6M A;  1KVK A;  2VJU A;  5HQL A;  3KFW X;  3B4D A;  4ITS A;  1F3V A;  3BGF A;  2CJK A;  3A8I A;  4O23 A;  3WQP A;  1TL7 A;  5D15 A;  3W2W A;  3EIC A;  2MJN A;  4X2B A;  5KT6 A;  2XEX A;  2JXI A;  1B0T A;  1H2U X;  3CJK B;  5KFX A;  3VAH A;  1HW9 A;  4ZHR A;  2CUY A;  4ED5 A;  2DIU A;  1APS A;  2B5J B;  5ITH A;  4JI1 F;  1RWM B;  2H5I B;  1ZZF A;  2KYZ A;  4NLX A;  2PFD A;  1RU1 A;  2R7W A;  3RU0 A;  4ED3 A;  4FNI A;  1WC4 A;  2AU0 A;  4JI5 F;  4I2Q A;  3HLU A;  2MQQ A;  3G2X A;  2RD5 C;  2ZM6 J;  2XS2 A;  1SH2 A;  2C3M A;  4DN0 A;  4NLR A;  5IC4 B;  2I38 A;  1OPI A;  2RRN A;  3M6W A;  2XLI A;  3SSQ A;  4J9N A;  3BBB A;  2H5J B;  2ALZ A;  2UUB J;  3MXH P;  2GZO A;  3H42 A;  1TL4 A;  2P9E A;  5KAK A;  5M2P A;  4WKY A;  3LOU A;  4B3T J;  5C24 A;  1IQT A;  2XLJ A;  2BDP A;  4CNY A;  3GJS B;  1OMS A;  2W2M P;  1M5V C;  4M5H A;  4CDI A;  1JNR B;  3C6U B;  2D3U A;  3QGI A;  5ETS A;  3HHE A;  2FHM A;  3IAM 9;  1KKH A;  2BJ8 A;  4I64 A;  1EB0 A;  3QT8 A;  1Y3J A;  3E51 A;  2CNN B;  3TAP A;  4NPO A;  2M52 A;  4QOT A;  3ADA C;  2DPJ A;  3CCM S;  5KG5 A;  1WTB A;  2PEH A;  1BQM B;  3K89 A;  2VAS A;  2YPY A;  3MCO A;  2DNR A;  1HWK A;  1PYO B;  1S1X A;  4UQG A;  5DZ6 A;  1X4A A;  1VC5 A;  2FGO A;  5K8P A;  1HHS A;  2CYY A;  3L3C A;  3G71 S;  1S0M A;  1F0X A;  3I4H X;  1JLB B;  2AYM A;  3TX8 A;  1VR6 A;  4LFA J;  4JV5 J;  3TJ9 A;  1G6B A;  2A2C A;  3K17 A;  1RK8 A;  2BAB A;  4B17 A;  5L9X A;  4YR3 A;  4PUO A;  2J0X A;  3T5K A;  2NYI A;  2DJW A;  4QR1 A;  1I94 J;  1S0N A;  1S12 A;  2JC0 A;  5LSR A;  1LK5 A;  4ID5 B;  4DR5 J;  5IT9 Y;  5H9E K;  4K5R A;  1TVR A;  4BHQ A;  2G2O A;  1RSC A;  2XZW A;  2XGQ A;  2LLZ A;  1VRU B;  5A6W A;  1F6T A;  1XEZ A;  1RTJ A;  1VBX A;  1Y5L B;  1SV5 A;  4QCL A;  4B3M F;  3GV7 B;  4K4S A;  1E6Y A;  4UOC A;  3G87 A;  5EHH A;  3W8G A;  1KSP A;  3DNC A;  2K29 A;  2K1R B;  3VGU A;  1H0H B;  3RBE A;  1LWE B;  2FJW A;  3QRQ A;  2FJA B;  1U09 A;  1M1H A;  3RRH A;  4JI1 J;  4ZPT R;  3VAK A;  5A76 A;  2LEB A;  2YNF A;  3IR7 A;  2JLE A;  1GH8 A;  1RLD A;  1RTI A;  2OPQ B;  2W2O P;  3MGJ A;  5CYJ A;  3RUB L;  4JI7 F;  1RKJ A;  4EBC A;  1CEZ A;  4O3R A;  1HNX F;  2M70 A;  3PJ9 A;  1RUS A;  4DV1 J;  3A3N B;  1KFS A;  3UNG C;  3ZTQ A;  5B0C A;  3RB4 A;  2ZJQ Q;  2XG8 A;  4EZ9 A;  2WVD A;  5IFM A;  2LXU A;  3I4P A;  1UET A;  5AJ3 J;  4KQZ A;  1WI8 A;  3DLK A;  4Q2L A;  1T03 A;  3LUY A;  4LRD A;  1W2B R;  4CTA B;  5AE3 A;  4FZV A;  3OFG A;  3IMQ J;  3WZ0 A;  3D67 A;  5FJ4 A;  1WC5 A;  4O44 A;  3JAM U;  1EIY B;  2C3U A;  1SKW A;  1UWA A;  3P45 B;  4FYD A;  4OL8 A;  2LEA A;  1I51 B;  4C3L A;  1S7I A;  2VQE J;  4Y34 A;  3CUL A;  4M5I A;  3QLH A;  1YJ7 A;  1C0U B;  2NXE A;  3ZC4 A;  4CLF A;  2MEW A;  1TUW A;  3PO4 A;  4DMZ A;  4J9P A;  5J1P A;  1I5O B;  1TK8 A;  2KHD A;  4PXB A;  1DTT B;  4F4A A;  3K5M A;  1E6V B;  4OJ3 A;  3BRE A;  2K3I A;  1IM4 A;  1UVJ A;  3DGV A;  2DXE A;  3VZH A;  2EEY A;  2D7S A;  1Q7Y T;  4I6A A;  4MKV A;  2YQ1 A;  2C3P A;  3GLJ A;  1F2G A;  1ZA2 B;  5IWA F;  2AEM A;  3EGW B;  2RKI A;  1EET B;  4P9S A;  3U1N A;  2H1O E;  4KC5 A;  1Y5N B;  3I6P A;  5CYM B;  4O3O A;  5AXM A;  2V4R A;  3LQV A;  3Q8V A;  3VQS A;  4KHM A;  2DNL A;  3I5B A;  4CLL A;  2QA1 A;  3O44 A;  5AXL A;  3E01 A;  4RLE A;  4WKR A;  3OT9 A;  3IS9 B;  4ER8 A;  1X4B A;  4KGZ B;  1HKA A;  3OTD A;  2VOO A;  3CD5 A;  5HAO A;  1R6V A;  4QZV B;  2G13 A;  3A3P B;  1UVI A;  2PA3 A;  4TLQ A;  1SC6 A;  1S59 A;  1VIS A;  3BO4 A;  3VAL A;  3TQE A;  4B3M J;  4EYI B;  3IG1 A;  3MZI A;  5L8R C;  3EPG A;  1TKX A;  2BKN A;  3PX0 A;  4C0B A;  3W2V A;  4NOH A;  4LJM A;  4RU2 A;  4DSF A;  2V9W A;  1NKB A;  3W66 A;  1K1S A;  3PYD A;  3V81 B;  2VHG A;  3GR0 A;  1D09 B;  2QFI A;  4M63 A;  3V4M A;  1HNX J;  4U7U K;  1NCL A;  2HNY A;  2KFZ A;  1MYL A;  4LVN P;  3GJQ B;  4KH0 B;  2OJ3 A;  2EPI A;  1KQS R;  1FXD A;  4WTO B;  1KN6 A;  4OZL A;  3D66 A;  1NND A;  4OYM A;  5A6P A;  3AOB A;  3EUN A;  3D7S B;  5KOX A;  4LRV A;  3D28 A;  3PRB A;  5AXN A;  2MJU A;  3S8S A;  4FYX B;  2NQP A;  3VAG A;  5T14 A;  5U47 A;  4CLT A;  5D6G A;  2J0Q D;  3T41 A;  2DBB A;  1XER A;  3ET6 A;  2LDI A;  3SIP B;  5I4M A;  3QAT A;  3DM2 B;  2ZC4 A;  2UUW A;  2XMA A;  3OL6 A;  3UCG A;  4J9Q A;  2K3K A;  4NCB A;  3QAU A;  1VQN S;  2WON A;  3QIP A;  3TAM B;  1YJT A;  3GIK A;  1Q1K A;  2W9B B;  1P1T A;  4FN5 A;  4CLY A;  1RTD A;  5F8L A;  4WU3 A;  2ERR A;  3MED A;  2BOA A;  5I42 A;  1YJ9 S;  4DV4 F;  2FZK B;  2EC0 A;  4C8Y A;  1Q4R A;  5L39 A;  1P1L A;  4I67 A;  1SCJ B;  5CAA A;  3CJ8 A;  3NCP A;  3HVT A;  3LW5 C;  3KOA A;  1VQ4 S;  2D69 A;  2N3O A;  2CNL B;  2HFZ A;  1P6T A;  4QQB A;  4FP9 A;  2XB2 D;  2EG1 A;  3BDE A;  1LOU A;  1BAZ A;  3FT7 A;  1JMT A;  7FDR A;  2VG5 A;  5HRO A;  3Q22 A;  2DGU A;  4W92 B;  4P72 A;  5HL7 Q;  1TMM A;  1T11 A;  2JEJ A;  5IM0 B;  4USM A;  3VR1 A;  2IM3 A;  3UVJ B;  3TZY A;  2WRM A;  4Q8E A;  3UR0 A;  1DLO B;  3OW2 R;  3LAL A;  1UPP A;  3MPV A;  1JLG B;  5F8N A;  4C6A A;  3AB2 B;  4F7V A;  1W2I A;  1WEZ A;  1K1Q A;  1N32 F;  1RAI B;  2VPX B;  4K4T A;  2DGV A;  3K57 A;  1U1K A;  1GX6 A;  1O51 A;  2QMU B;  2ZKT A;  4P2F A;  4DFP A;  1R7I A;  5HP1 A;  4DDF A;  2CZV C;  1T94 A;  1YBU A;  2R2S A;  2QTW A;  1D9A A;  1VBK A;  3ILJ A;  2VD3 A;  3ITH B;  3IM9 A;  1SL2 A;  4NLG A;  1U24 A;  2IVM A;  2ZJR Q;  2VQF J;  4UT4 A;  2AJ1 A;  3TUP A;  4TKT A;  5A0Y A;  1RAD B;  3J7Y I;  4LR9 A;  2VBZ A;  3VAI A;  1M0S A;  2FJV A;  1TL1 A;  4Q43 A;  2HSE B;  2MQO A;  2VL1 A;  3MUV P;  1QE1 A;  3C6T B;  3KKF A;  4G1I A;  2V4Q A;  2YQ0 A;  4HH1 A;  1CJV B;  5DDP C;  2W8L A;  1OY9 A;  2RBF A;  5BYS A;  3KYL A;  2ZJP Q;  3ZZU A;  4ANC A;  3VVT A;  2XMV A;  5KG1 A;  1U8S A;  1ZBT A;  2O66 A;  4YS2 A;  2OD4 A;  3S6E A;  2DNY A;  1FK9 B;  3MFI A;  2WZ1 A;  4MTP A;  3DC2 A;  2HFU A;  3LO3 A;  1C4C A;  3FSY A;  1YIJ S;  4UST A;  3HHD A;  1WF2 A;  2HVZ A;  5DG8 A;  2OPR A;  3GTY X;  1HBU A;  1FD2 A;  2HKE A;  3MF5 A;  2EK6 A;  4WFB Q;  5BR8 J;  2ZKU A;  4JV0 A;  2VV5 A;  1RWU A;  1EKR A;  4FPR A;  2E9R X;  4EU0 A;  1FKO B;  2E9T A;  1R0A B;  1HYS A;  1TKT A;  4XK8 C;  4KTQ A;  4O4G B;  5E2Q A;  5D4O A;  3EDR B;  4ZJQ A;  1S1X B;  2XZD B;  4PWU A;  5J2N B;  2UXC J;  1HL6 A;  4DSL A;  4K4U A;  5KFP A;  1CUL A;  1HNZ J;  3DYA A;  4I2P B;  1MRO A;  4NRU A;  2BBE A;  3T5H A;  4WZQ A;  4IDK B;  2PSZ A;  3WIV A;  4OI0 A;  4NLT A;  3HM9 A;  2UVV A;  4Y6I A;  2VG7 A;  2EKY A;  3X1L B;  1XQI A;  4QWE A;  3VGS A;  4KFB B;  2QLF B;  3AA9 A;  2OIH A;  1N5Y A;  2DXF A;  2PE8 A;  3DLG B;  5LJ5 Y;  2DVI A;  2CNK B;  3OD2 A;  2ZIT A;  3O5T B;  4NA3 A;  3C8Y A;  1TAU A;  3CPW R;  1U25 A;  1Q7L B;  2WW4 A;  1HW8 A;  1QSY A;  1Y4Z B;  4G1P A;  3DRY A;  3UCU P;  4KKO B;  3CCL S;  2KVI A;  4DZ6 A;  1FDN A;  2R2U A;  2JX2 A;  3M2R A;  1N6Q A;  2XSJ A;  4ZJL A;  3DLL Q;  2D3O R;  3OBI A;  4P7T A;  4F26 A;  3BPS P;  4KJI A;  1LWX A;  1HQE A;  4DL7 A;  5L1J A;  1IKW B;  3UQS A;  3DMJ A;  2NXC A;  3FNN A;  1CC7 A;  1W26 A;  1S1U A;  3PR4 A;  1YI2 S;  1HR0 J;  2MQN A;  5F8M A;  3SZ2 A;  1FES A;  3ISZ A;  3BGU A;  4IFV B;  2CWK A;  2VPY B;  3CCR S;  1G3O A;  3W9H A;  1RU2 A;  4PPZ A;  2FC8 A;  4NWB A;  4OI4 A;  5GAH I;  3AOD A;  1TKZ A;  4NEZ A;  1JLC A;  1V5I B;  3ISN D;  1X0P A;  1U45 A;  1WG1 A;  2EVZ A;  3MEE B;  1QTM A;  4DPY A;  3THP A;  1FJ7 A;  2IRX A;  4ECW A;  2YKM A;  2UUC F;  4ZP6 A;  2JHE A;  4EMD A;  1Q82 T;  4OYP A;  3RAQ A;  3T1H F;  3QSI A;  4HYK A;  5I3U A;  4O4R A;  1S6P A;  4PXC A;  1MWQ A;  5JXS A;  2CPX A;  1H7X A;  3D3B J;  3DU6 A;  2B9W A;  3HUL A;  4PQA A;  2XY6 A;  4OJH A;  3SDE A;  2JC1 A;  1J2V A;  1A0O B;  1Q8I A;  1C1B A;  1SPB P;  3I0R B;  5A2Q U;  5D0G A;  4LF5 F;  2DRB A;  2ZUA A;  4I7F A;  5RUB A;  2VC1 A;  3NO7 A;  2GHV C;  2ILZ A;  1ZH5 A;  3GSD A;  4DG1 A;  1VRQ C;  2D74 B;  1S10 A;  1JWW A;  2JOQ A;  4J9O A;  4DF4 A;  4QYZ K;  1PC5 A;  4OX9 J;  5HVH A;  3EYZ A;  5DM7 Q;  2VPW B;  3MEG B;  3L4B C;  3ZZT A;  3DRX A;  2P9C A;  3PIO Q;  3MM7 B;  4MK8 A;  3HVR A;  1WSR A;  1MSW D;  4RW6 B;  1F2H A;  1HNW F;  4DFM A;  2YQ3 A;  4DSK A;  2CPI A;  1HBM A;  1N88 A;  1H7W A;  2BNW A;  4DPU A;  4KO0 A;  3M1V B;  3AH6 A;  3CVK A;  3H7H B;  2OFH X;  1S6Q A;  3OL8 A;  1S1T B;  3CCU S;  5KFY A;  3BM7 A;  3W7B A;  1SUQ B;  2IVY A;  2OPS A;  4L72 B;  2M88 A;  2JZ5 A;  4ALZ A;  4PG6 A;  1S6U A;  3CXC R;  1NB2 A;  2WVE A;  2CWX A;  4B9M A;  1KVI A;  3L7O A;  2F63 A;  2WVB A;  1CQM A;  4CO3 A;  4MK7 A;  1JLA A;  1GAO A;  1URR A;  2CPJ A;  2W4D A;  3BO2 A;  1YWX A;  1B7Y B;  3D5M A;  2YNG B;  1B7F A;  3MD3 A;  1HBO A;  4PEO A;  3MAH A;  4EFA C;  5D0R A;  2V5H G;  3JSR A;  1NHK L;  4CWB A;  1RDR A;  4ZK7 M;  2HRY A;  2V34 A;  1YX2 A;  6FD1 A;  2R42 A;  2B4O A;  5BJR A;  3HHK A;  2HBQ B;  4R5P A;  4F50 A;  3KLE A;  4C8K A;  2DNP A;  4FBU A;  3OTC A;  2BQR A;  3MFH A;  5F3T A;  3DFE A;  4LSN A;  3S01 A;  4LQ3 A;  3A1Y G;  3VGT A;  4DHV A;  1NJW A;  4OI6 A;  3GV5 B;  1BXN A;  1JXL A;  1AYE A;  2DH7 A;  4I69 A;  4H4M A;  5KFQ A;  2JXH A;  3U1L A;  5EDW A;  4NAS A;  3OTO J;  3BS9 A;  5IQQ A;  1HHT P;  3UR3 C;  1Q86 T;  3AY0 A;  1OQ6 A;  3CC2 S;  1DBD A;  4CLK A;  2QA2 A;  1TK0 A;  2FJE B;  4C97 A;  2ZDP A;  2EBE A;  4G6V B;  4I56 A;  2MZ1 A;  1U26 A;  2UUC J;  2M2B A;  2C2M B;  2RQC A;  4AND A;  4AT1 B;  5HSP A;  5M2U A;  3HSZ A;  1VMB A;  4OYI A;  4ELV A;  2HND B;  2RDJ A;  2M5Y A;  2K06 A;  1IBK F;  2E29 A;  5IV4 A;  1LW0 B;  3K5L A;  3BQ1 A;  1Z2L A;  4DQI A;  3BBF A;  2X1F A;  5E0O A;  2KL8 A;  2UUT A;  1OY6 A;  3GB0 A;  5B08 A;  3R9L A;  2MMY A;  3LTO A;  3TAR A;  2GC8 A;  1O0P A;  1VCT A;  5DGB A;  4RW7 A;  4PRF A;  4KGM A;  4C8N A;  3FKB A;  2HNZ A;  4GC6 A;  4YDD B;  2DHS A;  4OHV A;  4OYB A;  3J81 U;  3MMC A;  3KJQ B;  2E5L F;  3QYY A;  4LF1 A;  4IOC Q;  3CJ2 A;  4IQX A;  1VRT A;  5CZX A;  2MZT A;  2HBY B;  3F0N A;  1NDC A;  1XMO J;  2IIH A;  2QO3 A;  4FXD A;  1HNW J;  4J9L A;  5ETV A;  4NI2 B;  3W5X A;  1W25 A;  3NGU A;  1N36 F;  2RF2 B;  1X60 A;  4XDC A;  3OR1 B;  1FJE B;  1G7C B;  4RNN A;  1KQF B;  3BN7 A;  5HBM A;  1B28 A;  1JJH A;  3PAC A;  3T3F A;  1DTQ A;  4MIA A;  3SV3 A;  4ZPV R;  1OPZ A;  4DL6 A;  1SJ3 P;  4QPT A;  4OYW A;  3EE3 A;  5KOW A;  1FA0 A;  3EXC X;  3N4W A;  3QGG A;  5D3G A;  3FBF A;  4TYB A;  3PEH A;  1WDT A;  1NJX A;  2B8P A;  4B3S F;  4DPX A;  2KT2 A;  4F4Y A;  4L76 A;  3TEG A;  2HYI B;  1HBN A;  2I1R A;  4X4S A;  2HQF A;  1VQM S;  2ZH8 A;  4JI2 F;  1JJC B;  1U1O A;  2HRT A;  5ETQ A;  1UWB B;  2P9G A;  2AW0 A;  3R7S B;  2LU1 A;  2GHP A;  4DQQ A;  3H87 C;  1NME B;  5GAD U;  2BE9 B;  2BVZ A;  4X64 F;  1C1C B;  4C8M A;  4W90 B;  3KG4 A;  2R3V A;  4QU6 A;  4B9L A;  5DDO C;  3CD7 A;  1S1W A;  2FB0 A;  3ZO7 A;  2KM8 B;  3H4D A;  2OKQ A;  3GQC A;  1M1K T;  2CDR B;  3CJS A;  3EZ5 A;  4GO5 X;  2C2R A;  4CO5 A;  4M5D B;  3CCQ S;  4F0M A;  4FKY A;  5B0A A;  3OHA A;  2MKH A;  3BBC A;  2YKO A;  4LF4 F;  2HQG A;  4NEY A;  5B09 A;  4K2J A;  3WIU A;  2B4V A;  2QG9 B;  2IA6 A;  5LXY A;  3W9I A;  2GIF A;  1KD1 T;  4QIF A;  1DQ9 A;  3KLF A;  4MYU A;  3OV7 A;  3TRG A;  1HQU A;  3TVZ A;  2D9O A;  4C4W A;  1A6L A;  1XJW B;  3RW6 A;  1QSL A;  1RA7 A;  2F8H A;  4X4Q A;  2GVZ A;  2Q1L A;  2Q6B A;  4C8O A;  2Z8Q A;  3FEX B;  3TW0 A;  2V2Q A;  1QE1 B;  4DR7 F;  1R8H A;  1BMQ B;  2X7I A;  4K59 A;  2CRL A;  4GVB B;  3PO5 A;  2ASL A;  4NYP A;  3S1T A;  4FXV A;  1X4C A;  3NNE A;  4FF4 A;  2JL9 A;  3MPU B;  4P71 A;  1RB0 A;  1FKP B;  3D2W A;  1RT7 A;  4QR0 A;  3Q89 A;  3KG1 A;  1BQN A;  4EO6 A;  3RBZ A;  5C25 B;  2BA3 A;  3PJW A;  3C16 A;  2XMT A;  2XYH B;  4LF9 F;  4DV6 J;  3IXQ A;  2ZD1 B;  3PJX A;  1QM9 A;  3NS6 A;  1WG5 A;  4Q0B A;  2V67 A;  4DV2 F;  4L6V 3;  3MD1 A;  3M2V B;  5KT4 A;  3MR3 A;  4DV5 F;  2E5L J;  3HHN B;  3BYP A;  4TNO A;  4WE1 A;  2V4J B;  1Q16 B;  1OIA A;  1SQE A;  4BCA A;  4UTG A;  2BJ7 A;  3FMB A;  1T9X A;  1ULR A;  3FCH A;  4UOG A;  1CJK A;  4EBD A;  1CUL B;  3DYA B;  1NLA A;  1YRU A;  1GXT A;  1N36 J;  1WG4 A;  1REV A;  3HHL A;  5FLX U;  1RCX B;  4OI1 A;  4AYB D;  5C5J A;  1ARR A;  2VBY A;  1N5Y B;  1IM6 A;  1QLN A;  3Q83 A;  4HHJ A;  3MAA A;  3GWC A;  3C46 A;  3L95 X;  2Y1I A;  1R89 A;  1VDH A;  1HPZ B;  3DLE B;  3QT7 A;  3OSP A;  3C19 A;  1IBM F;  4ZS6 A;  1FHT A;  2MZR A;  2HUR A;  4B9N A;  1IRQ A;  2CQD A;  2VA3 A;  4X65 F;  2G0I A;  3HKW A;  2X1B A;  2JWN A;  3MM6 B;  2UVW A;  2Y8Y A;  5E3R A;  2CJA A;  1WOS A;  1HWU A;  2XMW A;  3HT0 A;  3UDL A;  1NEE A;  3CJQ A;  4OHY A;  1HWL A;  1TU0 B;  4D8J A;  1WF0 A;  2KJW A;  1KP6 A;  2FGC A;  4OI3 A;  5J2P A;  4LF4 J;  1U47 A;  2JBV A;  1PC4 A;  1NSK L;  1TKZ B;  5J2M B;  3UNY A;  4N5S A;  1HD0 A;  4ZOS A;  3R3T A;  2J8S A;  3Q2S C;  4ID8 A;  4LR7 A;  3KUG A;  5LXR A;  5B0F A;  2AP6 A;  4CO0 A;  1RAC B;  2C2D A;  2BZ2 A;  2FVR A;  3F73 A;  3R97 A;  3BZQ A;  1NHV A;  2OPP A;  1DQ8 A;  1MWY A;  5KFN A;  2F4V F;  5AT1 B;  4JV2 A;  3F56 A;  3JQK A;  1DAR A;  5I3U B;  3CCS S;  1S99 A;  1TKD A;  1RT6 A;  4KV8 B;  3K5O A;  3G82 B;  2JDJ A;  3PV8 A;  2IBK A;  3BN4 A;  1Y3K A;  4BLG A;  4LF7 J;  2NSB A;  4PKD B;  2K7K A;  3ZZY A;  1S1V A;  4RNF A;  2EW9 A;  4LUB A;  3Q8P B;  3DGP A;  5B7W A;  3NL0 A;  1X5P A;  2PFF B;  3DLH A;  3M6V A;  2V94 A;  2XMK A;  1ITP A;  4DL4 A;  2QN6 B;  3SCI E;  3EXY A;  2QL9 B;  3B82 A;  3K8W A;  3FQL A;  1U7L A;  4Q7A A;  3CDE A;  2GVD B;  1X4H A;  4U7U D;  4DV2 J;  1PIL A;  5KFI A;  1ZM4 A;  3ETM A;  4DV5 J;  4ZVR B;  2YWW A;  1AA1 B;  2P6T A;  7FD1 A;  1URN A;  3T19 A;  2BRL A;  2YX7 A;  1QAX A;  3DOL B;  3DLJ A;  3IA0 A;  1IKX A;  2J9D A;  4DX6 A;  3G6Y A;  2HMI A;  4JBC A;  2KI2 A;  2PDA A;  2B9X A;  4HKQ A;  2NLW A;  1D1U A;  4V19 J;  5F0U A;  1RAB B;  3WHI A;  2XNR A;  3JTN A;  1S6Q B;  1NM2 A;  3F44 A;  4TN2 A;  4P75 A;  4ZPC A;  3OUY A;  1QUV A;  2XO6 A;  1YIT S;  1T8E A;  4ECS A;  2AY0 A;  3QNW B;  5K8O A;  4QU7 A;  4OX8 A;  4R0J A;  4F4K A;  1YRT A;  2E1C A;  1DJ0 A;  3KDN A;  3PX6 A;  3HJF A;  4A8Y A;  4WP9 A;  2XGP A;  1LXN A;  4K8R A;  4ECT A;  2CA9 A;  1U0S A;  1NDL A;  3JS9 A;  3DRR A;  1B0P A;  3MEC A;  2WCX A;  3V6D A;  2LXI A;  2XC9 A;  1WEY A;  2YNI A;  3FCW A;  3PZP A;  4Q44 A;  4OFZ A;  3PFE A;  1T3O A;  2XM3 A;  3FRY A;  3M30 A;  4K4X A;  1WI6 A;  4ED4 A;  2H48 B;  4YOE A;  3CD0 A;  2KT5 A;  4RBT A;  2BE2 A;  3IGN A;  3JTO A;  1CS4 B;  3FZB A;  1NK9 A;  2LFV A;  4GKJ J;  1R27 B;  4IYQ A;  2KXH A;  4U7C A;  2QRR A;  2FZC B;  4BBY A;  4USV A;  1J5E F;  1IXK A;  1B0V A;  3RAX A;  5LT5 A;  2CXE A;  2ZH1 A;  4ETZ A;  1IUJ A;  4AL7 A;  4AQY F;  3W63 A;  3EZO A;  3HT3 A;  1MN7 A;  1PG5 B;  1FRH A;  3CJK A;  3ZZR A;  2OMO A;  1SL1 A;  2B7B B;  1XNQ J;  3QWP A;  3BH6 B;  2B5J A;  3R6L B;  1JJ2 R;  5D0H A;  3EZU A;  3H2V E;  2BMB A;  3EPI A;  2PEB A;  4X62 F;  1WHW A;  2HK3 A;  1YSJ A;  1S9E B;  4TLR A;  4GRS A;  4MT1 A;  3L9Z A;  1PJ7 A;  2L48 A;  3TVY A;  5FDL B;  1VQP S;  4BS2 A;  1TP7 A;  3KLH B;  1FXR A;  5KFM A;  1BY9 A;  1HFE L;  2K5J A;  1V3R A;  1DRZ A;  4EBE A;  2GS8 A;  1YG0 A;  5KFZ A;  3IR5 B;  1QTG A;  3D54 A;  3KK3 A;  2HHH F;  2DGS A;  3ETO A;  3MUR P;  1IR1 A;  3FCV A;  4UY8 5;  4FVM A;  2P2C B;  2EFG A;  5HAT A;  1MNT A;  2WSC C;  3D0G E;  3OQ2 A;  1KHV A;  1LW2 B;  8RUC A;  2FLN A;  2DHX A;  4AXJ A;  3IWX A;  4K0K F;  4ZIV A;  1WC6 A;  3KTQ A;  1NB7 A;  3UN3 A;  3KMS A;  3I82 A;  3M8Q B;  3EM1 A;  1ZS6 A;  3QGH A;  3J7Z 5;  2ROE A;  3MMB B;  4ED6 A;  4CO4 A;  4W4M A;  1BQM A;  3GJT B;  1Y0H A;  5T41 A;  2Y3Y A;  4Z7C A;  1WC0 A;  4LQ9 A;  3KLV A;  3B4M A;  3ICL A;  1VLY A;  1CG2 A;  1ROF A;  3SCJ E;  2YBV A;  4NL5 A;  3VAJ A;  5HMZ A;  3N5B A;  1JIH A;  1HMV B;  1NH7 A;  2RRB A;  2ADC A;  3UE2 A;  4X66 F;  3J7Z T;  3I5C A;  3LJP A;  3IWL A;  3SFU A;  5DQI A;  1JLB A;  1H2V Z;  3CUN A;  2GCF A;  4YDX A;  4DQP A;  2GV1 A;  2R4F A;  5KFV A;  1JKH B;  1S1W B;  2QLB B;  3FDS A;  2LP4 A;  1RHR B;  3DU5 A;  1UMJ A;  3OVA A;  2ABY A;  4TY8 B;  1D9D A;  2FY8 A;  4N56 A;  4LRC A;  1XN9 A;  2FVS A;  2YX1 A;  3NOG A;  1C2P A;  3JQJ A;  4OZJ A;  5BXI A;  2E1A A;  4MMO A;  2OO4 A;  3M2U B;  3Q8S B;  3MCM A;  4ID5 A;  4WYL A;  1K47 A;  2VOD A;  4EZ6 A;  1J5E J;  4RBU A;  4QIE A;  3KLF B;  2BNZ A;  1FWL A;  4IFY B;  3BO3 A;  3RYL A;  3M8P B;  1VRU A;  3FMT A;  4JI0 F;  1YJV A;  3BQ2 A;  2DO0 A;  2VG6 B;  2ZH2 A;  2K1R A;  4RR5 A;  1LWE A;  3GYN A;  5IQ6 A;  1J5O B;  1ZPW X;  4RBV A;  2KVQ E;  1VBY A;  2VBW A;  2OPQ A;  2AJ2 A;  3GIM A;  5GAD I;  3HSG A;  2UVR A;  2RQM A;  1B64 A;  4GKK F;  2KHC A;  4GVL A;  3G4S S;  4HHU A;  2FVP A;  2Y9H A;  2PO4 A;  2L3M A;  5CCM A;  1BQN B;  2XCA A;  2XTJ P;  2W9A A;  2W7O A;  3GII A;  4HL9 A;  1B4S A;  2LQ5 A;  2VJV A;  3BR9 A;  2ASD A;  4ED8 A;  2Z56 B;  4LIR A;  3ZFV A;  1GMW A;  3JYT B;  2B6A B;  3VEA A;  4CTA A;  4IR9 A;  4WE1 B;  2AHO B;  1SH0 A;  4F4Z A;  1LV5 A;  1GFW B;  5K8N A;  1C0T A;  1L3U A;  1UEU A;  1R43 A;  2Q79 A;  1Q0N A;  3DHW C;  3ONQ A;  4ZVH A;  1AFJ A;  3NS5 A;  2DT9 A;  3KHG A;  4FF1 A;  1FI4 A;  4A47 A;  2B0G A;  3M8S A;  1XIQ A;  1KLM B;  2VFS A;  4YB7 A;  3DRS B;  1S97 A;  1RHJ B;  3NCR A;  2N7C A;  1UP1 A;  2B9Y A;  4CO2 A;  5HQM A;  4ZVQ B;  3P8B B;  1DTT A;  1GMW D;  3H4B A;  3AT1 B;  2HS4 A;  2B56 A;  1EHW A;  3MR2 A;  4J9V A;  1E6V A;  3IBC B;  5KT7 A;  1CJT A;  3NWR A;  3IR6 B;  2RJZ A;  5C42 A;  2XY7 A;  5KFF A;  3C2P A;  4X66 J;  3TYT A;  1HHQ A;  4B02 A;  4B9V A;  1RAA B;  1MMD A;  3CW2 C;  2KXF A;  2QGF B;  3KJV B;  3TQ1 A;  1Q95 G;  1SL0 A;  1U4B A;  4H54 A;  1Q78 A;  1EET A;  3VWS A;  4F8R A;  5DS7 A;  2HS0 A;  2R7S A;  5CYM A;  2OEM A;  2WVF A;  3Q24 A;  1O6X A;  2N4D A;  2HG4 A;  1U1Q A;  1PYS B;  3OFF A;  1OHN A;  4LSZ B;  4UUX A;  2VFV A;  2FPH X;  3IS9 A;  3TUZ C;  2KOE A;  2E5G A;  3H5Y A;  1LFP A;  3CCV S;  4ZVP B;  2Z2L A;  4B3R J;  3BF4 A;  4DPT A;  5A8K B;  3IBW A;  1RWK B;  1RWO B;  3W5Y A;  1YGY A;  5A8R B;  1TL3 A;  1F1B B;  2IDE A;  4KE5 A;  2OEL A;  3UD5 A;  2ZVI A;  3SFG A;  5KT3 A;  4YFU A;  4TU9 A;  4X4U A;  2X3D A;  4JI0 J;  2VFR A;  1EZZ B;  2MGZ B;  1NZ8 A;  1OSD A;  2Q2K A;  1CJU A;  2IM2 A;  4OHZ A;  1L3T A;  1F5B A;  1WC1 A;  2IJR A;  3V81 A;  3LA0 A;  1FRI A;  3PW7 A;  3MPY A;  1SIW B;  2I9S A;  4MFB B;  2ZFH A;  2NUH A;  1V6H A;  5D8H B;  4PXD A;  2G0J A;  4P73 A;  3J81 Y;  4L74 A;  3ZTP A;  2UUB F;  2KN4 A;  1EP4 B;  3CJ4 A;  4IG3 B;  2R2R A;  2XMJ A;  4B3T F;  3RR7 A;  1SI9 A;  3RB3 A;  3QGP A;  2F8M A;  4YN3 B;  1K8A T;  4UZB A;  5JVH Q;  2RML A;  1LWF A;  3DI6 A;  4WFX A;  5JVG Q;  3PW2 A;  3UPF A;  1FF2 A;  2HZC A;  1Y00 A;  3Q8R B;  2W1B A;  1FJC A;  4HVZ A;  1Q79 A;  3O1L A;  4TQR A;  1Z4U A;  2J76 E;  2GAG C;  2YKA A;  3DM2 A;  2GIR A;  3VGV A;  4RL1 A;  1HNV A;  4TQS A;  2AN7 A;  3TAM A;  2NPI A;  3NRB A;  1VQ5 S;  1RT4 B;  4HTI A;  3HF5 A;  2ZE2 B;  5L1I A;  1AFI A;  1IR0 A;  1L3K A;  4CYU A;  4LBH A;  4RW9 B;  4LF2 A;  3HPO A;  2FHK A;  1O5J A;  1TMJ A;  4C2M A;  3OLA A;  2EFO A;  4ZPB A;  1T7P A;  3PRD A;  1V3S A;  1NSQ A;  3CJ5 A;  3ELH A;  2XMM A;  5DZ7 A;  4DJB A;  4DU7 A;  4PWD B;  3V6D B;  1ZYQ A;  2B7C B;  1W7W A;  1WSV A;  2I5J B;  5HJX A;  5H9F K;  1TTH B;  1F5A A;  2LDY A;  5F41 A;  1NPR A;  2GAH C;  4ZA1 A;  2VDH A;  5L46 A;  4JV5 F;  1X0F A;  2RH3 A;  3LGM A;  2QA4 G;  3WBZ A;  4YHH J;  5D4P A;  3J7Y U;  3TAN A;  1NU4 A;  3GP9 A;  4X4P A;  5F0W A;  2XNQ A;  2A0F B;  4ENO A;  2WK4 A;  3W8P A;  1YJR A;  4C0H A;  1GMV A;  4I4B A;  2HWT A;  5IM0 A;  4ECQ A;  2MST A;  3B8H A;  3GSI A;  5E7O B;  3UVJ A;  1T05 B;  4ES2 A;  5LM7 E;  1DLO A;  1JLG A;  2AJ0 A;  3BQ0 A;  5H9F J;  4DCP B;  3PRV A;  4ZN3 A;  4USH A;  3GXQ A;  3UD4 P;  3OSN A;  4NA1 A;  4K4Y A;  4J7C A;  2KDO A;  4KGV B;  3ILL A;  5BYR A;  4K4W A;  2DHG A;  1FRX A;  3KWM A;  2G2Y A;  3KDO A;  3HFV A;  1H3D A;  1RWN B;  2X3G A;  2MKY A;  2H51 B;  5KFJ A;  3I9Z A;  5KFA A;  3AD7 C;  4JI3 F;  1S76 D;  1RT1 B;  2HIQ A;  1WOO A;  3ITH A;  4A8F A;  1F5C A;  1AZS B;  4DV1 F;  3M32 A;  3NLC A;  2AD9 A;  3K5N A;  3NMA A;  2QL5 B;  2FHJ A;  3KK3 B;  1X5S A;  5AJ3 F;  1U0H A;  2DNQ A;  3DRP B;  1BE4 A;  1T02 A;  3C6T A;  2HBZ B;  3E2E A;  4A8M P;  3KK2 B;  1HWI A;  4U95 A;  6FDR A;  4WF9 Q;  2GFF A;  2HZA A;  1FFW B;  3HCX A;  1Q8L A;  1CJV A;  4DU8 A;  4ZN1 A;  3T6B A;  2DYA A;  4MAK A;  3SMZ A;  3TOQ A;  5A8W A;  3G8T A;  4CIO A;  4Q5V A;  2A10 A;  3H40 A;  5FLX Y;  2W2P P;  2E1R A;  2VQE F;  3GZ7 A;  5EWF A;  4NXM F;  1RBO B;  3F41 A;  1FK9 A;  5F9L A;  3PVX A;  4CNZ A;  1JLQ B;  2H9Z A;  2W24 A;  2VON A;  3FSX A;  3R7N B;  1UJ5 A;  1FWP A;  4HH0 A;  2HZV A;  1HI0 P;  1NK7 A;  2FHJ D;  3G9C A;  2HHU A;  3PM9 A;  5CZV A;  2JLG A;  4DCJ B;  1M5O C;  4EI2 A;  3CWJ A;  1UVM A;  2V6A A;  1FKO A;  2ADB A;  4OJG A;  3ZTR A;  4WIQ A;  1R0A A;  2J7K A;  1XMQ J;  4LSL B;  2ZNY A;  3OJS A;  2E7W A;  4FDF A;  4O4G A;  1U2R A;  3RB6 A;  5J2N A;  2E1P A;  2AGQ A;  1REG X;  4I2P A;  4AD6 A;  4IDK A;  3IC1 A;  3V4I B;  3CE8 A;  2K9I A;  4I6Y A;  3KK1 B;  1TUG B;  5GAH U;  2WBR A;  4DV3 J;  2BEF A;  2GW8 A;  3CC7 S;  3FQK A;  4KFB A;  2AMC B;  3G8S A;  1O8B A;  3DLG A;  3H2U B;  1FX4 A;  2Z0G A;  4UW2 A;  3EJM A;  1VC6 A;  2QA4 S;  2K8G A;  4ZIT A;  2PMZ D;  3GYX B;  2NZC A;  3S7R A;  3HMJ G;  4DCO B;  2QEX S;  2AJF E;  1LNQ A;  2RIJ A;  3KUE A;  1PAE X;  3DOM B;  3UDV A;  4KKO A;  1H73 A;  2RU3 A;  3QO9 B;  1YK9 A;  2E7V A;  1UKU A;  2C1E B;  2F9D A;  2DRA A;  2QE5 A;  4OV1 A;  2K7J A;  1SBR A;  1TV6 A;  1IKW A;  3UDE A;  3ULH A;  4Z2X A;  1FER A;  1HIY A;  3N6L A;  4K4Z A;  4IFV A;  1PO6 A;  5GMK a;  4MKA A;  1R8A A;  1XWL A;  2FLO A;  1OY8 A;  4CLS A;  5H9E J;  2CPD A;  4JI3 J;  1U6Z A;  4M5L A;  1G1X A;  2MLX A;  2RIL A;  4L3N A;  2QX0 A;  2CQ0 A;  2UXD J;  3T6J A;  3MEE A;  4M5M A;  1RWX B;  4WP8 A;  5HMX A;  5DET A;  4BC7 A;  4A8W A;  3ZZO A;  4L73 A;  3I5A A;  2XYG B;  2MYF A;  4Q8F A;  3CED A;  3VVU A;  1RCO B;  1X31 C;  2OTL S;  2RSQ A;  1SJ4 P;  1RHM B;  3NG8 A;  1C0T B;  2CJY B;  2YVS A;  2F7V A;  4EEY A;  2L9D A;  3AJ1 A;  3HD2 A;  1RWV B;  2N82 B;  3I0R A;  2JSX A;  5KFS A;  3BPD A;  4DL3 A;  5LMN J;  4Y2I A;  1ZM9 A;  2AYE A;  4NXM J;  2GML A;  3D68 A;  1UA0 A;  1RHQ B;  1BDV A;  5GAE I;  2RUG A;  2AF6 A;  2MDA A;  3THV A;  5J2Q B;  3JSM B;  3ISN C;  3R6G B;  3QID A;  1P9Y A;  1KEK A;  2Q6C A;  2CQ2 A;  1Q81 T;  4LBP A;  2E1M C;  3MEG A;  1TZ0 A;  5D78 A;  4NCA A;  4PG4 A;  1DFD A;  1N5S A;  2W2N P;  2HQ3 A;  5ETK A;  2DGT A;  1NK0 A;  3CCE S;  3MM7 A;  3MM5 B;  4UF4 A;  4RW6 A;  1CJT B;  3TAQ A;  5AXK A;  1SKS A;  2QFJ A;  4C9D A;  5C42 B;  2BJ1 A;  5T7L A;  1P27 B;  3PTW A;  3CCW A;  3M1V A;  3FC9 A;  3BGR B;  4AE5 A;  2H4W B;  3SBM A;  4CO1 A;  1S1T A;  2GJF A;  2OEK A; 
#chains in the Genus database with same CATH homology
 2GPE A;  2F1F A;  2Y3Y A;  1MYK A;  2BSQ E;  4D8J A;  3FMT A;  2FGC A;  2WVF A;  4FXE A;  2HZV A;  2WVD A;  2JXI A;  2BJ8 A;  2RBF A;  2BJ9 A;  2KEL A;  1ARR A;  3H87 C;  2K5J A;  2WVC A;  3OD2 A;  2BNW A;  2CAD A;  2K1O A;  1QTG A;  2H1O E;  1U9P A;  1MYL A;  2CAJ A;  2BJ3 A;  3QOQ A;  1Q5V A;  2JXH A;  1BDV A;  3QSI A;  3BKU A;  1MNT A;  3VW4 A;  1IRQ A;  2BA3 A;  2K9I A;  2WVE A;  1PAR A;  2WVB A;  3PHT A;  1X93 A;  3VEB A;  2K29 A;  1EA4 A;  2AY0 A;  4HV0 A;  2CPG A;  1P94 A;  1BDT A;  3BKT A;  2HZA A;  2K6L A;  1B28 A;  1B01 A;  3BKF A;  3LGH A;  1BAZ A;  3FT7 A;  2PC6 A;  2BJ1 A;  4ME7 E;  2BJ7 A;  3GXQ A;  2CAX A;  2JXG A;  3VEA A;  2NZC A;  2CA9 A;  1Q5Y A;  1NLA A;  1ARQ A;  2BNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...