1Q5VA

Apo-nikr
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
132
structure length
115
Chain Sequence
MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQHGTQGFAVLSYVYEHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Nickel-Responsive Transcription Factor NikR
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Nickel responsive regulator
total genus 26
structure length 115
sequence length 132
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 1q5vA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 1q5vA02
2CAXA 2K29A 2BSQE 2Y3YA 3VEAA 2AY0A 1X93A 1NLAA 2BJ8A 2WVDA 2WVFA 4HV0A 2HZAA 1B01A 1IRQA 1MNTA 3LGHA 4FXEA 2BNZA 2BJ1A 1U9PA 2WVBA 2GPEA 4ME7E 3BKUA 3BKTA 2F1FA 2BJ7A 3VEBA 2RBFA 1P94A 2K9IA 3VW4A 1BDVA 3PHTA 1Q5YA 2NZCA 2K6LA 1MYKA 1QTGA 2BJ3A 3QSIA 3FMTA 1Q5VA 2BA3A 2JXGA 1ARRA 2CPGA 1BAZA 2JXHA 2K1OA 2WVEA 2KELA 1MYLA 2CAJA 3FT7A 3OD2A 1EA4A 2BJ9A 2HZVA 2WVCA 3H87C 2H1OE 2JXIA 3GXQA 2PC6A 1ARQA 1PARA 2CADA 4D8JA 3QOQA 1BDTA 1B28A 3BKFA 2CA9A 2FGCA 2BNWA 2K5JA
chains in the Genus database with same CATH superfamily
2HNZB 3H2UB 3KLGA 4DQQA 2DY9A 2IA6A 1LXJA 5IQQA 4ENOA 3M2RA 3MMJA 3WDOA 5DQGA 2HHHF 4DSFA 2UVUA 4P2MA 5L39A 4Y2MA 2HSEB 1T9TA 4OLOA 3SSQA 5F8MA 3OL6A 2W2NP 3NOGA 4MFBB 4JI7J 4DR7J 2EFPA 1MMLA 2CQCA 3TOQA 2R42A 4ER8A 2E44A 5HI7A 3WHIA 4WBFA 3PZPA 3HO1A 3KJNB 1FF2A 1FT8A 2R7QA 3KXDA 3N6MA 1DLOA 5DDRC 3CPWR 3CJ3A 4JI2F 1T0TV 3D67A 4OYOA 4DUTA 5EWEA 1C4AA 4PPDA 4XO0A 1IM6A 1D1UA 3ONQA 4NLGA 2MY8A 1WEXA 4NLTA 3ZO7A 1RZMA 2DIUA 2ZUAA 3N4WA 3B78A 3R7NB 5DDQC 2XTJP 3WIUA 1X9WA 3C3LA 4I2QB 4OV6A 1U2FA 2W4PA 1F5BA 3HT0A 2ZFHA 4U9RA 1Q7LB 4ZIWA 3GILA 2YQ1A 1U0HB 4M5KA 2QA2A 2UVVA 1KN6A 3GB0A 4CLPA 5A8RB 2N82B 1WHYA 5IS2A 2JNJA 1D0EA 4ED1A 3QJPA 1WELA 1GH8A 2WOMA 3IXQA 3W62A 3VW4A 3DGVA 4MK9A 5B0AA 8ATCB 1YJNS 3KHLA 1HWIA 2ATCB 1FKAF 3MEGB 1SH0A 2RIJA 5KFSA 3PW4A 3HI9A 3FBBA 1N34F 1D8YA 2AYBA 1DARA 1C1CA 5KFRA 4FXVA 1PARA 1I6JA 1RGVA 1TV6B 4X66J 1U09A 2YNFA 2J8AA 1IQZA 2BSQE 1M1KT 1U6BA 5C24A 5D0GA 1Y9OA 4DDFA 5F3ZA 1SJRA 1QLNA 1UVKA 4F4XA 2A2CA 3OTBA 4J9PA 2GQCA 3MM9A 4OYAA 4RBVA 3CJKA 3R2CJ 1MSWD 3OTOF 1ZZFA 1U6FA 4DHVA 5J1EB 1RLDA 3ISND 2DXFA 1K44A 3LP1A 4Q2MA 2FVQA 2MSTA 2YNGA 3DLLQ 2N7YA 2BDPA 4ZS6A 3LP2B 1W2BR 2Y1JA 1S6UA 2B9XA 1HQUA 1Q53A 2W25A 2RKIA 3H5UA 4N7TA 2AJ1A 5LMNJ 1S1UB 5LMUJ 4CYUA 2OIHA 3HFVA 1HNWJ 3QSIA 1OHNA 1P1LA 3SXLA 4D8JA 1FRXA 4N56A 1CG2A 2XYPB 4QIWD 4PKDB 3BREA 3FFIA 3SSRA 4ANCA 4F3MA 2EPIA 4AYBD 1RHRB 3BPSP 4KGZB 3CD0A 3T1AA 4ZLJA 1K9MT 2DGOA 3EGZA 4O44B 1F2HA 1UPMB 1ZM4A 2B9YA 2IDEA 3PIPQ 4DV2J 4ZVSB 5IT0A 1WF2A 2O1PA 2RILA 4B9TA 2FVSA 2CYYA 3TJ9A 3PW2A 3FRZA 2QEXS 5AT1B 5K14B 2IY5B 3KUGA 4OFZA 3T1HF 3TW0A 1IKXA 1SUQB 5GADI 2YWWA 1LWXA 3MR3A 1OG7A 2LLZA 1DTQB 3KK2A 3A3PB 3TYTA 3TAPA 3QGHA 1LWCA 4V1Ak 3NL0A 2HHVA 5KFJA 4ED6A 4A8WA 3BDEA 3I4PA 5KFMA 4R5PA 2RE1A 3ENWA 2F63A 3BKUA 3A12A 2DR5A 4J9LA 3M8QA 4HI1A 2Z30B 4C0OC 4ZN1A 3KK3B 4PRFA 1KKHA 3SQGB 2ZBPA 1G4CA 2O66A 3KK1B 4NCBA 2OSQA 3ET6B 1X4CA 2LP4A 4HV0A 4AL5A 4DLEA 4B3OB 2WHOA 2CNKB 3N79A 1O6XA 1KS2A 2IPOB 2VG5B 3U27A 3W5ZA 3KLFB 2XGPA 4PUOA 1NDCA 2H5EA 2F7VA 2NSBA 4KGVB 2V4RA 1VQ7S 3M6XA 3E8OA 4USKA 1JLFA 3BDPA 3S1TA 2GV1A 1UFKA 1NCLA 2HNDA 3DOKB 1N32F 3BSOA 2JL9A 2B4OA 2VF3A 4KE5A 5K14A 1TR0A 4F25A 3OXFA 2J9CA 4E8UA 2KYZA 3DMJA 4LT6A 4TXSA 4CT9A 2QGFB 3EM1A 2W4DA 4ECSA 1AUSL 1FE0A 3DYAA 4UZCA 3TO8A 4DV0J 2AF6A 2C28A 1R0AA 3PVXA 2E1CA 2KXHA 4ICLB 1S1VA 4ZVTB 3M1VB 1RBOB 4XIUA 3TUZC 2HHHJ 1FRJA 3MXHP 2J5AA 2KYXA 3N0VA 2FY8A 2NSCA 3BEGB 3O2IA 4HHJA 3VTIA 3H25A 2AQ4A 4LFBF 4B3MJ 2OD4A 1SQGA 2RQKA 4DZDA 2Q1LA 1O51A 4ZP6A 2QFJA 1IUJA 3VAMA 5H9FJ 1T3NA 4IH6A 3QFWA 2MZJA 4N77A 1UPPA 2J7KA 4RUBA 4URGA 5C25A 3DC2A 4LR7A 2YH1A 3IAS9 3TZWA 2FJAB 1D9FA 4IOAQ 3PRVA 3N6NA 1RT5A 4RUCA 3QIDA 2RUGA 1GEHA 1NDKA 1R31A 4ZN3A 2MSSA 5IWAF 2DPJA 4KHPF 1VIOA 2QT7A 4FPRA 1Q8LA 5CAAA 4KBIA 3JS9A 3OQ2A 5KFLA 3WC2A 1HWKA 2GIFA 1IR0A 3MM7B 2RD5C 3UN5A 2ERRA 2LEAA 4NI2B 3U7JA 1NK7A 4ZVEA 3HKZD 3OTDA 2RT3A 2HQIA 2DHXA 2Q6CA 2XSJB 1RCOB 2CWKA 2P6SA 2HZAA 3EMTA 4PYAA 3SQGA 2CPDA 1MNTA 1C2PA 3HVTA 2KRBA 3EXYA 4CLWA 3UNYA 1E6YB 4F0HA 5F8IA 2MGZB 4J9KA 1S0OA 4OHYA 3M6VA 2CDRB 2HLUA 4LFAJ 3MR2A 3P3DA 2CQIA 4NLSA 3Q2TC 1NSAA 4ED7A 1T9WA 5D77A 2JSXA 1UMJA 3BGRA 4L76A 4ALZA 4BC9A 1WNEA 1AW0A 1IBCB 2LKZA 3FKBA 2M8DB 1CVJA 3DOKA 2OEKA 2E29A 3BSAA 3LP0B 4L3NA 1UW9A 1Y10A 3CC7S 2JXGA 3R5DA 4DV5J 1QAXA 1S1WA 2HFZA 5K8NA 2AU0A 4GO7X 4CI0B 2DITA 3GIKA 3RR7A 3M2VA 1SH3A 1UWAA 2BKPA 4CQ1A 3F73A 1S1XA 4NLVA 5KFPA 2E5IA 2CZ4A 2F8EX 5LOQA 1MNEA 4DV4F 4DBQA 1WOOA 3HVTB 1Z2LA 2X1BA 3LH2S 4WYLA 4EBCA 1YTYA 2AKWB 1HHQA 3HXMA 1RB0A 5CCMA 3HVWA 1U8WA 1TP7A 2X3DA 3HZEA 4ZPWR 2QSFA 4I67A 1X4EA 3CGIA 5KFFA 3Q22A 3AXKA 1HR0F 3HX9A 3BBBA 4URSA 4CT8A 5GAEU 4AL6A 3UCUP 1J2VA 2QA4G 4XTTA 4DFMA 2NUUG 3D68A 1HMVA 3THPA 1SC6A 2AN7A 2XSFA 5LXYA 3CMES 4MFBA 2YNGB 1HBMB 2UUAF 3GCXP 3UR3C 1S0VA 4NLDA 1ARQA 4AT1B 3A1YG 3PV8A 4C6AA 1IBMF 3CCJS 1NAQA 1UKUA 2B7BB 3CJKB 4U6PA 1REGX 4ANDA 4ECRA 3DHWC 5FLXU 1TKDA 1RU2A 5I3UB 4WTYA 2ZH8A 3EPIA 4RX6A 2NREA 3AOBA 2IAJA 3MURP 5KT5A 4LRFA 4DU7A 2XMTA 4NE9C 3W2WB 2YNFB 4HEA9 2NXJA 1S1UA 2UP1A 5EDWA 1S6OA 3ZZTA 3DYAB 4ED4A 2A18A 5C42A 2NLWA 1P94A 4YR0A 3IBFB 4DPYA 2FJVA 4NOHA 1KRPA 2HHQA 1UETA 4GKKJ 2JEJA 4IO9Q 3KLVA 3NGKA 4B9NA 4WE1A 2VJVA 4F0MA 3RRGA 1SL0A 2O3DA 4EGLA 2B43A 4AQYF 4L72B 1LWEA 2CQPA 1YBUA 2VFVA 3R3TA 2KFZA 4USTA 2AX1A 4NLPA 5AJ3F 2VFRA 2XS5A 2HWIA 3G5OA 2PI5A 2J8SA 1PBUA 1RE1B 2XHCA 1S5ZA 2NXUA 2R7XA 3DOMA 1LFPA 2B5JA 5AE2A 1FVQA 2FHJA 3NS5A 4KGXB 5DS7A 2C42A 5CD4A 2VG5A 4K2JA 2KFYA 4NCAA 4ID5A 4O3OA 3RBXA 3ZTRA 5KFHA 5EGYA 1N32J 1TV6A 4RWWA 4FF3A 3KMSA 3FMWA 4UQTA 1OYEA 2GHVC 4X66F 4NRTA 2IRUA 3M8PB 5E7OB 3QJJA 2NXCA 2YKNB 2IRXA 3KG4A 4FYVB 1ZYQA 1NJYA 3P49B 3PKMA 4U7UD 1RTIB 4TY9A 1N48A 2DB1A 3FBFA 1SIWB 3DRSA 3DXSX 2VPZB 1R89A 2FZCB 2QSWA 3NS6A 4HTJA 3CULA 3MCSA 2I6WA 2JVOA 1R8HA 1K1SA 3T5LA 5IV3A 4EBDA 4QU6A 2KZMA 1T8EA 2GQ2A 3O44A 3VZHA 1U6ZA 2CJQA 2V2KA 3W7BA 2H5IB 1HL6A 2CIMA 2AGOA 4LF1A 2V34A 4J5OA 4ZJOA 1S99A 3MPDA 3DCAA 2ZVIA 1FK9B 3DRRA 3M30B 1Y3KA 3MF5A 2BVZA 4KYZA 5SUHA 3K5MA 4Y3CA 2XY7A 4Z7YA 3KTQA 4O23A 4O3SA 3PDNA 1GNKA 4F4WA 4OI0A 4MK7A 3CWJA 1RT1B 4G1IA 3CCWA 4EMDA 1X8DA 3CEDA 3FZBA 4ZP9A 1DLOB 1R6VA 5JVHQ 3B54A 2YQ3A 4PXDA 3B82A 2WSFC 4HKQA 3CDAA 4Z7CA 2OP5A 4O0NA 2AJQA 2ZH5A 3LJPA 4WXOA 4MJWA 1FTRA 2DJWA 3FQKA 3CC2S 3LP2A 4AXIA 2YKNA 4CO2A 3PR5B 4EZ9A 1BXNA 2ZH3A 1F5AA 2AJ0A 1SC3B 1GFWB 3PYDA 3T9ZA 1H3DA 2B8QA 3ZXWA 4B9MA 2C3MA 3J81Y 2DRAA 3M2RB 3BH6B 4FNHA 4IQMA 4DR4J 3UR0A 1FE4A 2LQBA 4KAIA 4WFNQ 3SZ2A 2XWXA 2PEHA 3CCES 4NLQA 2F65A 2C2OB 5A8WB 1RAFB 4IRKA 1NPPA 1HARA 2DO4A 1VC6A 4LFAF 2IMOA 1FD2A 3MPUB 4XPEA 2R7WA 4OYWA 1YDLA 4A48A 1U9PA 5A8KB 2BMBA 3ICLA 4WFBQ 4B3RJ 1VRUB 4CTAB 4PG8A 3G71S 5H9EJ 1TK8A 4WWSA 5D4LA 2JEFA 2OKQA 1Z1ZA 1UJ4A 1MWYA 4L3KA 1TL7A 4BLGA 4WK1A 5M2UA 3I9V9 4A8MP 4OX9F 5D0EA 3J7ZT 1B64A 1TAQA 4FDFA 5LJ3Y 2I0XA 3BSCA 4OYMA 1FHTA 3RW7A 5D3GA 4JV5F 1TMJA 1VC5A 5ETKA 2G0IA 4B17A 2VG7A 3LWMA 4DSLA 3DDKA 1U1OA 1UVIA 4DL2A 1S6PB 1D8ZA 2FVCA 2DR6A 3KUEA 4K2XA 3I6PA 4LSNA 4OI1A 1BQMB 2XS7A 5H9EK 3EZOA 2UVWA 1HWUA 1RABB 3D0HE 1CJTA 1JLQB 2CZVC 1DQ9A 3PEJA 1U48A 1UVJA 4JI4J 4DJBA 2MLYA 1WI6A 4NCGA 4B08A 4B9UA 2AGPA 1V9OA 5GAHU 1S4EA 4HYKA 2JX2A 2M2BA 4DV1F 1M1HA 2BA9A 5B08A 4DS4A 2HHXA 2DHGA 1F6TA 2V8GA 2VPYB 3ITHB 4I4BA 3UQSA 3JYTA 3PO5A 2GJ2A 2UZAA 2D3ZA 4NYZA 4UOHA 4OHXA 5D4NA 4JI3F 3MM8B 2FGCA 3TWZA 3GJTB 2VICA 1WOSA 1HW9A 5DQIA 1U2RA 3T9NA 1TK5A 3GPAA 3NXZA 3QPIA 2ZZNA 1P1TA 3IG1B 3GV8B 4P10A 2XBPA 1FFWB 3KG1A 3OVAA 2R8HA 1S76D 2RH3A 1Q86T 2LXIA 1FX2A 1KBRA 1S1WB 4QBUA 4K4WA 1AROP 1JIHA 1OSCA 3ETMA 3LP0A 2F4FA 3R1HA 1IKWA 1TAUA 3NBPB 2GIQA 2YPYA 4O3PA 1K73T 4C2MA 3NNCA 2OPSB 3GV7B 4IRCA 3BGRB 2KJWA 3AD7C 3DGPA 4C7QA 1FJ7A 3IBWA 2DBBA 3LA0A 1WOPA 3KNGA 3PACA 4C11A 2XZTB 1L3VA 2E9TA 1AFIA 1PAEX 3B4DA 3LQVA 3M9NB 2GVZA 1T95A 3D1HA 2HG4A 2VBZA 4O4GB 4F26A 1VQNS 1B28A 5HATA 2WVFA 1H7XA 1M5SA 5HAOA 2X1AA 1WTBA 4FN5A 2HGLA 5A76A 1KLMA 4M5GA 2GHWA 3LTOA 2Y1IA 5MAOA 2ZHOA 5DETA 5J1PA 4NLXA 1NRKA 2HZCA 4H54A 1KDNA 2VDIA 1RT3B 3RJMB 5AXNA 5KG7A 3D54A 2ILYA 2X1GA 2V94A 1V3SA 3IGVA 1CJKB 1BLUA 3LGMA 2E5GA 1LW2A 1JJ4A 1HW8A 1Q8KA 3D3CJ 1R0CB 2BYCA 3UW1A 1U24A 1VBKA 3MMAA 4DCOB 2OAUA 2EFGA 1CLFA 4OX9J 3DLKB 1G2EA 2H1OE 4PZVA 4LQ3A 1G1XA 4ES1A 4LFBJ 4W4MA 4K4VA 3QGIA 1RXOB 1PJ6A 2CQBA 1Q95G 2OO4A 5ETPA 2MKKA 1MU2A 4H4OB 3CC4S 4QWBA 4PQUB 1YITS 2E66A 1K0VA 3I5BA 3CCUS 1HBUB 3CCMS 2UUWA 5ADZA 1L3SA 3PYGA 4S0MA 3ZZRA 3TA0A 5HROA 3R27A 3K8VA 1MG7A 1RT2A 2BJ8A 3CJ2A 4DFPA 4E98A 1PIEA 2BOAA 1UEKA 4HH0A 2RAQA 5KFOA 1FKOB 1HBUA 2EBEA 5E33A 1Y7PA 4P74A 4CWBA 4ZHRA 5GMEA 4DU8A 1WC6A 4NZ0A 3HVAA 3CE8A 3NY0A 3S8SA 4TQRA 1TKXA 2GIRA 3NEKA 4Z2XA 5T14A 3MOJB 1SJ1A 4TU8A 2HNDB 4U96A 1P9QC 3IO1A 1BHNA 1Q81T 2UXDJ 3IM8A 4JP8A 1XR6A 1U1MA 3GQCA 2K8GA 4IR9A 4ZMMA 4K4XA 1XNRJ 3IFEA 1CJKA 4W92B 1P27B 4ED3A 5HMYA 2PIIA 2AEFA 2DNPA 2UUBF 4NA2A 2Q79A 2IM3A 5CYQB 1N0VC 1VJWA 3QWUA 4UY85 1M5OC 3BQ1A 1SB6A 5IM0A 1PJ7A 2MPUA 3ZTPA 1OPIA 1M1GA 2EC2A 1XR5A 3PNIA 3W5XA 4BC7A 5KFNA 3GCWP 2VQEJ 4DR6F 1WC0A 1XQIA 2MQLA 3OHBA 1EP4A 5HMXA 3D0GE 4DR4F 3NMRA 2V8DA 4CH0S 1WHWA 1ZOTA 3O5TB 3OUYA 5DLFA 1R8PA 1VK8A 2ZD1A 3C15A 3OFHA 3LOUA 3D6TB 1X31C 4OQJA 3JAMU 1WSVA 5AXLA 1JX4A 4ECZA 4ED0A 2KJVA 3IR7A 3QYYA 3GJRB 1UEVA 2A3JA 3Q24A 3PEHA 4ATNA 1F3FA 4ZVPB 2XY6A 1IKWB 3D4JA 2JC1A 2ZD1B 1HI8A 1U0SA 5ETOA 5CD4H 5L9XA 1S7IA 3CJQA 3K8WA 5KOXA 1FD8A 1HKAA 1JQGA 2CPZA 4DFKA 5HK4A 1WORA 2KT5A 2P5VA 4WFYA 3VF0B 2V9KA 3FUYA 3SQOP 4DUYJ 3CJRA 3E01B 1TL5A 5AE1A 3SV4A 3NCQA 3OR1B 3HMJG 1N52B 2WVDA 5CHCB 2C22A 3JSBA 1IRQA 3W9JA 4RW9B 2V2ZA 5HMWA 2MLZA 4DS5A 5T41A 4B9VA 1X4GA 1YZ6A 3QT6A 3G6ES 2XI2A 5JJBA 1FDBA 4DPWA 5HJXA 1OMSA 3VEBA 1C4CA 3BGUA 1EAYC 2IC3A 5DRKA 1RT5B 3FCHA 4I64A 3BKFA 2PN6A 2IYGA 5LT5A 5E3CA 1X60A 5F3TA 2BQRA 4W90B 3DM2A 1V3RA 1H6KX 3IWNC 1OYDA 4WKRA 1D09B 1HQEB 2DEIA 3SDEA 2FLLA 5F8JA 2X1FA 3BR9A 1M5HA 2CAXA 3TANA 3D6MB 3THTA 2ZE2B 4JI1F 3TUPA 3CVKA 2ROGA 1NBEB 2J9DA 2MQNA 3QQCD 4CP5A 5K8PA 5DG7A 1SPBP 2D69A 5KFVA 3NCPA 5RUBA 3W61A 2MQOA 1KHWA 1Q79A 4DFJA 3NWRA 3EZ5A 3K57A 2RQ4A 5F8GA 1FVSA 1PC5A 3NAIA 1LK7A 2HRYA 3HD1A 2AJFE 5D3GB 4GKJF 3BYPA 3QIPB 4C0BA 2K9IA 3J81U 3UD5A 4B02A 3CMAS 4C8ZA 4Q0BB 1VHIA 4IRDA 2EC0A 3IP0A 1RT4B 4NYOA 5J2MB 2WW8A 2CPHA 2PGCA 1Y3JA 4DX5A 1MYLA 2OHDA 3ZZZA 4Y2KA 2HYIB 1RDRA 2OGUA 4F2RA 4FF4A 2K7KA 3W2VB 3J7YI 2YKMB 3ZZUA 1DJ0A 3CCSS 5FLXY 4JV5J 3KLIA 3MMBB 5GMDA 1WC4A 2HK3A 4ZLNA 1KTQA 1N5YA 2ASJA 3M8QB 5A8WA 2YKQA 1TL3A 2C3YA 3A3NB 1I3OB 1RWOB 3J80U 1KLMB 4V19J 3G9CA 4M5HA 4RPFA 3L09A 1FFGB 1XNQJ 1SV5A 3V4IB 3DU6A 3TJ8A 2OMOA 1H72C 4JB8B 4NA3A 1IN0A 3K58A 4WP9A 4P6QA 1RAAB 1WG1A 2HHPA 2YNIA 1MYKA 3L95X 4MYTA 4EI2A 2Y1RI 4J9NA 2OH2A 4HDHA 4UT4A 2G4BA 3O3LA 2V50A 1Y5NB 5ETQA 1JXLA 2HHWA 4JI8J 1PAUB 2V68A 4KTQA 2L08A 3HT3A 4EBEA 1RLCL 4LF6F 2RDJA 3VAJA 3CCZA 1G7CB 2CQDA 1G3OA 5IQ6A 2RU9A 1JLGB 4O0IA 1APSA 2FB0A 2W2PP 3FFIB 2PA3A 2NCKL 4RW8A 4C48A 4PXBA 4CH1A 1OSDA 2O67A 2DKOB 3NGDA 3VAHA 2MHNA 1ZTTA 4I7FA 4F04B 1VQPS 1XERA 3HPOA 1VK3A 4PPZA 1OPZA 1BD6A 1G6BA 4CO3A 4RNFA 3X1LB 1ZAWA 4IFVA 2BANB 3T41A 2NYIA 3AQPA 2JOQA 2X51A 1NO8A 3D3BJ 2DYAA 2LYVA 3TUJC 1FWKA 2XO7A 6AT1B 2OUGA 3PX6A 1YBTA 2GAHC 1A6LA 1F9EB 1P6TA 4DX6A 4TQSA 2KXNB 4B9SA 5DG8A 4F4KA 1KQSR 1SIWA 3DRSB 3Q2SC 4G6VB 3MM5A 4ZP7A 3ZZOA 3M9MB 2FUG9 2V9WA 4NZ7A 1SJFA 1IBKF 1LNQA 1HNWF 1H98A 1LOUA 2YBVA 2HGMA 4NASA 2Y8WA 1T11A 4FVCA 3TJAA 3VALA 3NCRA 4QU7A 1RAHB 5KFWA 3HHLD 1RA7A 1BUXA 3Q8YA 2XMAA 1JB0C 3GSIA 4ETZA 5IZHA 4C4WA 3BGOP 1KVJA 2ADBA 5LL6d 4ELUA 3HCXA 2FHMA 1W25A 2DR7A 1XNRF 3GJSB 3DOMB 4X84A 1GXTA 1HFEL 4D3HA 4B3RF 2VJUA 2DXDA 1BWEA 1WG4A 4EK2A 4RNNA 1RT4A 2HNYB 4DN0A 4XAKA 1JLCB 4DV6J 3SV3A 1T7PA 4EU0A 2L3MA 1X4BA 2ZDPA 3AAWB 4Y2CA 1ZM9A 1VC0A 1IBLF 5KG4A 2UU9J 2XI3A 2PMZD 2ZJPQ 3OV7A 3N5BA 1R6YA 1KQFB 1WHXA 1U0HA 2VONA 5KT2A 4LF9J 4AFFA 2QA1A 2W24A 1S57A 2PDAA 2Y1LB 1I1GA 3W2WA 3NRBA 4LF5J 2GVDA 1UEUA 3I0RB 5C5JA 1RYSA 1REVA 3QMQA 4K4ZA 5BYRA 4YY3F 3C6UA 3IRWP 2D3O1 1PSDA 4RWXA 4TU9A 5CXTA 3H5YA 2OMLA 2OLWA 2Z2YB 3PG9A 3VGUA 2PI4A 4KJIA 1RU1A 4G65A 2MQPA 4B3TJ 2I8EA 1LKZA 1XIQA 2CQ2A 2HIQA 4RW7B 3DLJA 1M90T 3DLEA 1BE4A 1FX4A 2IM0A 1EETA 4NMXA 4X4NA 2OPRA 1KOHA 4JI0J 3SMZA 1R7IA 2AX0A 5L38A 1ICEB 1RSCA 1PCAA 2B9WA 3K5OA 4DSEA 1FDAA 3C19A 5KT6A 3UNGC 1S97A 4RW8B 4G1QB 4NZ6A 2BXJA 1RKJA 3R1LA 1C0TA 2GO8A 2YPZA 4CH7A 4O4RA 2DNQA 3VGVA 4DZ6A 2CJXB 2J9EA 2WSEC 5J2QB 2WCXA 5KFCA 2QLWA 3I0RA 2B6AA 2DNGA 2ATLA 2R7TA 5EX0A 3TAMA 4X4QA 3GIRA 4PWUA 2COLA 3AHPA 3KYLA 3SI8A 1LV5A 5HJYA 3K89A 4OHVA 3KLHA 1AB8A 2I38A 1UAWA 2M0GB 3MD3A 5F0WA 4HH1A 2BKNA 5F9NA 2RU3A 4Y2AA 3W5YA 4FF2A 1UFWA 2V0NA 1T3OA 3EVMA 3MM6A 3TVZA 1RT7B 2C3OA 4RW6A 3C15B 4ZPDA 3C16A 5K8MA 4QWAA 4QQBA 2R7SA 3D6FB 2XNRA 2P2CB 4JUZA 4GKKF 3GZ7A 2QJ3A 5IC4B 1BQNA 1FCAA 1NMEB 4KSEB 1JLCA 2D3UA 3DHXA 4Q2LA 3W9HA 5KFKA 3VR1A 2ZHAA 1SJ4P 2NUHA 2OPQA 4F2SA 4TYBA 4PQAA 4KHPJ 1WHVA 2BNWA 1FDNA 2HQGA 2J7WA 2RRNA 2Z56B 5IC6B 3WZ0A 2M52A 4DL6A 1T03A 2KRRA 3ZNUA 1XNQF 2L9DA 2W9AA 1RACB 2LVWA 5DDOC 4ID5B 5ETLA 3TX8A 3VQTA 3AA9A 3IM9A 1A9NB 4FVMA 5DDPC 3DRPA 5GMKa 2ZBQA 4KT0C 5CYMA 4YR2A 1O0PA 2V2VA 1S72S 1YJ9S 1LXNA 3TNVA 1TVRA 3Q8SB 4JV1A 2VDHA 4O3QA 3M8YA 1RT6B 4X64F 5HQLA 4AAIA 2J0QD 2V4JA 1Q5VA 1RP5A 3N5FA 1TUWA 1BAZA 3BQ2A 1QUVA 2KH9A 1VQ8S 2MJNA 3I5AA 5KT4A 4OYPA 5DGBA 5C42B 1IKYB 4OYXA 3H0PA 4CLYA 2CADA 4DV0F 4MK8A 2M5YA 3S6EA 9RUBA 4DUYF 3R5AA 3S7RA 3GIMA 4I7FB 1AYEA 1NPRA 4LRAA 1X5OA 3OR1A 4JBCA 3IRXB 5D6GA 3A8JA 2VQFF 3QGGA 2HWTA 5D4OA 2QG9B 4LRCA 3I55S 4DV4J 5HP1B 3JB9k 2IRYA 1ZPWX 3EDRB 3HP6A 1YJUA 5E41A 1U1QA 2DGTA 1NHUA 3GFZA 2F3JA 1ZPVA 3PTWA 3J7Z5 3JQKA 2ALZA 5GAEI 1NKCA 2ZBIA 4Q5VA 1EQ0A 2GS8A 4UZBA 4OYBA 3UCZP 1T9YA 4WIIA 4ES3A 4OHZA 2K6LA 1YJWS 1W7WA 4A46A 4MTPA 3HJVA 2MEWA 3UDLA 4PXEA 2NR0A 4E0DA 2W1BA 4OI6A 4F7VA 3LALA 4DWIA 1GXLA 1JLEA 1N0UA 1RT3A 2LA4A 3TEHB 1UZDA 2U1AA 2WONA 2HS0A 3H98A 4WFAQ 3M8RA 3KHGA 3OL9A 2DO0A 2PSZA 5KG6A 3AOCA 4OZ0A 3ZZ0A 2B4VA 4CNYA 4LFCJ 4Q8FA 3ILLA 2DNRA 4NXNF 4B3OA 2OEMA 1IJFB 1AT1B 4XDCA 2ZZMA 3C6TB 4B3SJ 3IMQJ 1NSPA 4IYQA 5KFIA 1RA6A 3MUMP 2QMXA 1GMWD 3MGJA 5KFYA 3G6YA 2R9LA 4USUA 2CPYA 3GLJA 1JXEA 2AMCB 4NEZA 4KV8A 4ILLA 3W8GA 3ILJA 4LIWA 1KD1T 3OXGA 2Z8QA 1X5SA 3FT7A 4IH7A 4DEZA 3UD4P 1NK8A 5LSOA 2BR0A 2Z2ZA 1B7YB 2CVEA 1RUSA 2HRTA 3IBCB 4MYUA 3BN7A 3RBZA 1H74A 2ILZA 3HM9A 6FD1A 1KVIA 5CA5A 2M4MA 2EVZA 2RNEA 1E6YA 2K29A 1Z4UA 3C14B 2FC9A 4DX7A 5AJ3J 2FJBB 4A8KA 1Q8BA 3VEAA 2JZ5A 4MIWA 4C8YA 1NH7A 2QYGA 4OL8A 1LWFA 1CC8A 4OZ1A 2CJKA 2ZE2A 1V3ZA 1FRMA 4BDPA 2MY7A 1FI4A 1U1RA 4GKJJ 3MEEA 2DHAA 3N28A 3OTCA 4K59A 3FBCA 1JJ2R 1DAXA 2KKEA 2QZ8A 4LF5F 4LF4J 5KFGA 3IA0A 2ZHBA 2LDIA 1RADB 2JFKA 1DFDA 4RKUC 2EK1A 2W9CA 3DRPB 5G0RB 3MMAB 3ISZA 1LEOA 2R3VA 3MEEB 4ZHRB 1BGXT 2G9OA 1KLNA 1KOOA 1FKOA 2GO9A 5I42A 1DHMA 3TA2A 4QYZJ 4TY8A 5F8LA 4ECYA 2J6TA 3CO0P 5HBMA 3CCLS 5KFDA 1NB7A 4O3RA 1UVNA 4TU7A 2YWFA 4H4MA 1S6PA 1J5OA 1S77D 1ITPA 5KG3A 2AIRB 3HSDA 5KFUA 2Q2KA 1X5TA 3E01A 1H38A 2IBOA 4JI5F 3SSSA 2DR8A 2E7VA 3NGSA 2MDAA 4YMEA 3SIPB 3OR2A 4OZLA 4P7VA 4JI6F 3CCVS 5L1LA 1M5PC 3U02A 3ETOA 2XMVA 3MCMA 1KQKA 4CLUA 1SXLA 2VFSA 4M5MA 1WWHA 3RBEA 2BW7A 1RT7A 4RW6B 3VV2B 2QN6B 4RLEA 1RK8A 4CO5A 1CSJA 4N41A 3EUNA 1S9GA 2FJEB 4ZP8A 3CD6S 4MKBA 2DGXA 4CTAA 2ZH6A 5DM7Q 1U45A 2FIUA 3P6YC 5A8KA 1K1QA 1YRXA 3C46A 1JLFB 3G82A 3SCJE 3KLEB 4LREA 2EG2A 1UVMA 3HHLB 2Z2MA 4C3KA 3PX4A 1NLKL 2OPPA 1S9EB 2OELA 2Y9HA 1SQFA 2VG6A 3JQJA 3JXOA 3KLFA 2NPFA 1QVFR 1TQLA 2LCWA 2Z4PA 4ANEA 5IT9Y 1NEEA 5BR8F 2JEGA 2BNZA 4RNHA 5SZTA 3KK3A 2R8JA 4ITSA 3NWGA 1VRTA 4OZJA 2FLPA 2DNYA 1L3TA 3GIJA 4ZCKA 2HBYB 2G1HA 2LXUA 4YY3J 2AW0A 1KVKA 2JHEA 3CDBA 3KG0A 3RUBL 2GFFA 2CNOB 2K1OA 2C1EB 2HQCA 1BY9A 4ECQA 3L3CA 2AWZA 2AZ3A 5HQ8A 4CRJA 3QT7A 4U95A 2WRMA 3GYGA 3TAQA 2AHOB 3IRXA 2VBWA 4X62J 5A2QY 3Q8VA 1H2VZ 3TZYA 5GAHI 4ECUA 2QMWA 2RHQB 4OV1A 1TL1A 4IG3A 3ILOA 4JOUA 2F9DA 2QL7B 4XK8C 3M30A 3PJXA 4OMFG 4WCEQ 3G4SS 4ZPAA 1T05A 4LRVA 3RGIA 2R7RA 2YNHB 1S7HA 2HWHA 1D9AA 3SCLE 1MU2B 4H4OA 5J2PA 3QFHA 2AD9A 1DZ5A 4I68A 1FKPB 1WC1A 3MPWA 1RTIA 1CC7A 4C8MA 2BJ3A 1S1TA 3Q8QB 4K4TA 3KJVB 4JI4F 2VOOA 1QTMA 2V67A 2A1BA 2N4DA 1CULA 4LSLA 2DT9A 1RHQB 2ZWOA 4LVOP 2PMWA 3AQOA 4KHRA 3BO3A 5B0BA 3DXBA 5THWA 3CD7A 2XQCA 1N5VA 1V5VA 5D15A 2HGNA 5H9FK 4ZVQB 4LSNB 4NLRA 4FBTA 4KGKA 4OYZA 2BRKA 1WEZA 1RWWB 3WBZA 1WC5A 2HFSA 2QC3A 5J2NB 2YWKA 3PXGa 1TELA 2VG7B 3KHHA 1IR2A 2CPFA 2H1YA 2HVDA 3R6GB 3MCOA 2D9PA 3P96A 3RW6A 1R8AA 1I94F 3TI0A 2ZOFA 2XMWA 4BHQA 1S6QA 3DU5A 2CJYB 2BUNA 2RBFA 1C1CB 1W2IA 2KB2A 2ZKTA 1P8GA 3GYNA 3M6WA 1SC1B 3C8YA 1SH2A 2XWYA 2MJUA 1MMDA 4MJKA 3QT5A 4NMLA 4A8FA 1OY8A 4FP9A 9ATCB 2GHPA 1FRLA 2GA7A 4DV3J 3GFHA 1B0PA 4FYYB 3NBPA 2IA0A 1UWBB 2YXLA 4M94A 2GAGC 3TQEA 3MPVA 4KH1B 5BXIA 2UVRA 2LECA 1S10A 2HBZB 2MQMA 5J2QA 2HRUA 2ABYA 4USMA 1VR6A 5KAKA 3CF5Q 1WEYA 1F60B 2BE7D 4DR5F 3FSXA 5HVFA 2KVQE 4J7CA 4F4AA 4CIOA 3OL7A 4DUZJ 3GWCA 1TL1B 2CQ1A 4IG3B 3QZ7A 3HFZB 5KFAA 2V8VA 2VV5A 1X4AA 1NPKA 3QNWB 3VVUA 4KC5A 3V5RA 1FK9A 3DRRB 2ADCA 2HAIA 3J7AN 3NNAA 1FJGF 4USJC 3PW7A 4P2FA 3LANA 1E6VB 2VC0A 5IFMA 1F9FA 5JUMA 3CJSA 3D7SB 5ETMA 1B70B 5A2QU 3J7A1 1XJWB 2KM8C 2OTLS 4YUDA 1UA0A 1VQOS 1Y00A 2LMIA 1X0PA 1WACA 4JI3J 2BEFA 2DNKA 3RBDA 4F3QA 1HHTP 3A4TA 1M5KC 1RT1A 1REVB 1FXDA 5U47A 2RS2A 4WTOB 4DR1F 3KDOA 1UZHA 1XMQF 1N5YB 1LW0B 5K8OA 4TNOA 1JK9B 2FPHX 4YHHF 2HW3A 3OVBA 2NXNA 1SJQA 3E2EA 1U25A 2EFQA 5ETTA 3HHLC 1RTHA 2IJNA 1Q16B 3SFUA 4BWMA 3UD3P 2Y0SD 3EVWA 1F5CA 3KLEA 1XMOF 5HN0A 3H40A 1KNZA 3M2UA 4GO5X 1RAJA 4IFYB 3TA1A 3K2YA 3W65A 2MKCA 1N88A 3IR5B 2H48B 2XMUA 3QIPA 5T7LA 2RUSA 2KHDA 4MH8A 3W63A 4F0KA 4Y6IA 3AD8C 2QLFB 2WSCC 2KELA 7FDRA 1V6HA 1SKUB 2JLFA 4Y0FA 4HVZA 4YB1P 1R43A 3JTPA 4RW4B 2Y0BB 2ZNZA 3AOAA 2Z57B 3RB4A 2R8GA 3W66A 3OR2B 5HMZA 4KFBB 1X0FA 3I0SA 1A0OB 3GTYX 4LF4F 2ZH4A 1EZZB 5E3RA 1VBYA 5I3QA 2B0GA 1QTNB 1HQEA 4J91A 3SDEB 3W64A 1X4HA 3R5JB 4QR2A 3KNAA 3MM5B 3PR4A 1LWEB 2RF2A 2UXCF 4DI6A 4ZKAA 2EK6A 5I42B 1CJUB 4PG4A 1HBMA 1ZS6A 3D2WA 1JJCB 2B4PA 3E3XA 4DF4A 3PW0A 2AYGA 2IFXA 3MEDB 4ZPCA 2VBYA 3MR6A 4IO1A 3WQPA 1IR1A 4LF2A 3W8PA 2ACMA 1JNRB 3OT9A 2CQHA 4RW9A 4I6WA 4NLOA 3V6HA 4ZCLA 3RB0A 1NK5A 4Q43A 1IKVA 2E1MC 4CZCA 1NK4A 2ZBCA 4PWDA 3DRYA 2AEJA 3D66A 1VQYA 5LXRA 2YKOA 3OL8A 3MFIA 1HNXF 2HEKA 2CJAA 2ZUGA 1JMTA 1GQEA 4HI2A 5AXMA 2C2DA 1NJWA 2AJ2A 2X3GA 4JI2J 1PBAA 2IJFA 4F36A 1R0AB 1C1BA 2IVYA 3P5TL 1RBAA 2CZ9A 2LEPA 3CJ4A 2Z58B 4ZJQA 2HVHA 4X62F 2FZKB 3IR7B 1TMMA 2YKPA 3V81B 1N8RT 2YNIB 2VQEF 4LRDA 4DR6J 1NUEA 3FCVA 3T5JA 1X7VA 4ID8A 1S12A 1ULRA 4HT7A 2HS3A 1RHJB 2QO3A 2RDIA 2JXHA 1OY6A 4R8UB 5DM6Q 2C2RA 4TN2A 1CQMA 1U4BA 4NXNJ 3G87A 1XR7A 4ERDA 3MTKA 1HYSB 4DPXA 2XM3A 1TL3B 3TEGA 2MGZA 2UV8A 3KK1A 1CS4B 3DLBA 4DSKA 4WU3A 2FC8A 3L4BC 4CO0A 3K5PA 5A0YA 2J6UA 2XSJA 2RS8A 4OIXA 2BZ2A 1UJ6A 3WIVA 4PCQA 2XY5A 3PYFA 2RVJA 4IOCQ 2E1AA 2G13A 4R0JA 4TLQA 2UUCJ 3CDWA 4M63A 4R8UA 2WONB 4RJVA 5BR8J 3Q8PB 2MZQA 4FBUA 1JKHA 4UOCA 1D9DA 1DURA 4WIQA 2R7OA 4DQRA 4G1PA 1CJVA 1RWKB 1VLYA 2H65B 2MKJA 2DGUA 3CCTA 5E3PA 5F0UA 1S9GB 2QX0A 4NPOA 4UQGA 4Q0BA 4X4VA 2RRBA 3VAGA 2V8PA 3HHDA 4QIVA 1N5SA 2DIVA 5DLGA 4O44A 4DOZA 1WTFA 2N3LA 2Q43A 2R2SA 4ZITA 2CA9A 3N6LA 4AL7A 4FS2A 2CG8A 2G1DA 3LW5C 3MECA 3FRYA 4ZPBA 3UDCA 4C97A 1YSJA 2W2OP 2K2PA 5LMNF 2UXBJ 3R5BA 3MM7A 4LRBA 4WFXA 4USVA 2OFHX 1L5UA 4LR9A 3FDSA 2A0FB 3JTOA 1QSSA 1HHSA 1R8BA 2VKZG 2UUTA 1AXQA 1C0UA 1U49A 1J5OB 3VQSA 3DKDA 4ICLA 3H20A 1FEEA 3T6JA 1HNVB 2NPIA 3CDUA 4QIEA 1HQUB 2P6TA 3JSYA 2W9BA 2DTJA 3GMGA 2ZITA 3MEDA 5EWFA 4YFUA 2CXEA 4A8SA 2UXDF 5H1SV 3DMJB 3KMQA 1N5QA 2ZH2A 1HNIB 4LUBA 4EO8A 1N36F 2MKYA 1RT6A 3HSGA 2H3EB 1TVRB 4ECVA 1S59A 3RR8A 3U1MA 3MM9B 5CH7B 3UVJA 1C0UB 1I94J 1WKLA 1VI7A 2GMLA 4I69A 5B0EA 2ASYA 4Z37A 2CUYA 3AODA 3OSNA 4NEYA 3EGWB 2E7XA 4P72A 4N47A 1M0SA 2AEMA 3M1VA 4UOGA 1EB0A 2ROPA 1YVFA 1B3TA 1N4LA 3K59A 2VA2A 1WD6A 4A4JA 3AB4B 2B3TB 2V6AA 3F41A 1HNZF 1U26A 2C2NA 3OLBA 3QGPA 1PKUA 3VAFA 2KFNA 3QLHA 5I4MA 3K0JA 3DGPB 2KM8B 2R2RA 1LWCB 2FD2A 1BDVA 4F4ZA 1XMQJ 2WOMB 1HI0P 3M2UB 3FGVA 3DDIA 4PWDB 2CQGA 3MM6B 2CQ0A 4MKAA 4OI3A 1W26A 2G2OA 3H4DA 3FJ2A 3GXQA 1KC8T 1LQ9A 2F5GA 1UL3A 3BB5A 2JDJA 3MR7A 2EBGA 3R7BB 4OHWA 5ETRA 5DQHA 4DR2J 3ET6A 4KPYA 4LVNP 4I2QA 1XN9A 1C1BB 3C6TA 2IVFB 4FXWA 2BABA 1NZAA 2BM1A 2B6AB 3CB4A 3H59A 3PRBA 4OI2A 1VRQC 4OJ3A 2QFIA 3M4XA 1TL4A 1VIXA 1HYSA 2HFOA 2QE5A 4B3TF 3NMAA 5KG5A 2B4UA 1S49A 1AFJA 1UJ5A 2DNHA 3CIZA 4C3MA 2ASLA 3IAM9 4DUZF 2HURA 2L41A 1QAYA 4ECTA 1KQGB 2DH9A 1IKXB 1SUQA 3CJTA 1MW7A 3PHTA 2EW9A 1TZ0A 3L7PA 2Q6BA 3QRQA 3J81j 2AV5A 4OX8A 4Y00A 1U47A 3E51A 2W7OA 5KFZA 5C25B 4UTGA 5J1EA 2BM0A 5HO4A 4KKOB 1F1BB 4LF9F 4ED2A 2IJRA 2EEYA 4CM2A 4DX8H 2O01C 1DBDA 3CO9A 2VU5A 1QVGR 1IKVB 3CNQP 1B0TA 3DI6B 5E3AA 2GVDB 3VGSA 4PQUA 2VQFJ 3LGHA 3FEZA 3HKWA 5EN1A 3CJ8A 1SL1A 3PHEA 3BQ0A 2DGVA 1Z2ZA 1KR4A 3POTB 1RQ0A 2LQJA 4J90A 1I51B 1YRUA 1IKYA 2PA8D 2RKIB 4ZPTR 5BJRA 2UUAJ 5EUHA 2D1CA 3IGNA 1UW4A 2ACYA 2DISA 4RO0A 4ZVHA 3M8WA 2ZJRQ 2BQ3A 4EO6A 1VQ5S 4QW9A 2LA6A 2IBKA 3FBEA 1NK9A 4NLYA 4YB5A 5I3PA 2CNLB 4K4YA 2MQQA 4AQYJ 2NZ4A 1QAIA 3NGUA 5CCLA 5EHHA 4USHA 4NLUA 1YBAA 4LF7J 3KDNA 5KT3A 3N9UC 5GAGU 4YS2A 3IS9B 3QJLA 3MD1A 3A8IA 3AH6A 1EQMA 1FNOA 1Q1KA 3LGNA 3SEOA 1LW0A 3OFEA 4RW4A 4CLTA 3P8BB 2V4QA 1B4SA 1H73A 1SQEA 4DR2F 3H5XA 4OJHA 2O5DA 1YRTA 4DSJA 2MMYA 1TUGB 3LO3A 3EICA 4R5PB 3KJVA 3MAQA 2XMKA 3RAXA 2FY1A 2QL9B 5KFTA 5A6PA 4AD6A 3VHQA 2N3OA 3UDEA 1DTQA 3TR5A 3KK2B 2BA3A 3FMTA 1XEZA 2ZJQQ 4FS1A 5A8RA 2FLOA 2K1RA 5G4DA 1NZ8A 8RUCA 5KFXA 1EJ7L 1FEHA 5K9FA 1T05B 1RTDA 3JAMY 1UVLA 4WZQA 2XEXA 2CPIA 3DNCA 3K5LA 4FF1A 2XULA 3ELHA 2JBVA 1R27B 1ZAXA 3FVYA 2W8KA 3R9LA 1TU0B 1OO0B 3JSMA 3EWGA 4YHHJ 1Y11A 4N5SA 4DL5A 3TQ1A 1S0MA 1U2CA 3MM8A 3GFYA 4KQZA 2B7CB 3CJ5A 2DXEA 4OX7A 4WJBA 4CLSA 4V19X 2BX6A 4K0KF 2D41A 3J7YU 2IYIA 1Q4RA 5FIIA 3O1LA 3AJ1A 2F8HA 2IMWP 1RWVB 5K20B 1NKEA 2FDNA 4DL0C 1PGZA 1N36J 3QRRA 4NCGB 3R6LB 2DNOA 4ZLLA 4GMKA 3KKFA 4PEOA 2XG8A 3EGNA 1EETB 4NL5A 2VC1A 3G6VA 4DCPB 5F9LA 1X9MA 2VODA 1YJ7A 1MN9A 1T9UA 1B0VA 1YK9A 2WBMA 1SKWA 3NOCA 2R7VA 2YVSA 4HT5A 1NH8A 4JI0F 1QSYA 3EZUA 1CEZA 4YOEA 3V6DB 1S6QB 4A8QA 2K06A 2DR9A 1P9YA 1X4FA 2VG6B 4LBPA 4M5DB 2DRDA 1LFWA 4CLLA 4DCJB 1X93A 4ETXA 2BBEA 4NXMJ 4KB7A 5K5MA 3TZXA 4QWEA 2BJ1A 1RAGB 1YJVA 3OBIA 4R0EA 1IBKJ 4WF9Q 1BC6A 1TKZA 4MIAA 2VD3A 4AE5A 1L3UA 2DRBA 4YQWA 4OYIA 5IV4A 2FHKA 3FQLA 3HFKA 3DLGB 2QV6A 4XDDA 1NNDA 4DG1A 3ADAC 4N8OA 3TP2A 1WC3A 2D7SA 2RJZA 5T7LB 3QAEA 3R8YA 3RRKA 5L1JA 5KG1A 1J5EF 3C66A 4I2PB 1XTZA 1MWZA 3GJQB 4IFYA 3PO4A 4QCLA 2PC6A 4H4KA 4Y2IA 2HQDA 2HVZA 3GG0A 4P73A 3QOQA 3DI6A 4EWTA 2HFNA 4DV6F 2J6SA 5DO2A 3OJSA 4YDDB 1FNMA 2H54B 4H4MB 2H9ZA 1OQ6A 2RSQA 5JXSA 2N7CA 1U1LA 3CJ0A 1DRZA 1MLAA 3AJ2A 4WK3A 3A3OB 4P7TA 4ZCIA 4TY8B 4RR5A 4M5IA 4J9OA 2Y8YA 1BMQB 2I1RA 3MCNA 4WP3A 4Y28C 2KG0A 2KVIA 4HLBA 2GJIA 3I87A 5A6WA 1WI8A 3QRPA 2GMHA 5B0GA 5KTQA 3T5HA 4C98A 2BJDA 1WJ9A 2DD8S 1FKPA 2DGQA 4MIBA 4HDGA 2PFDA 4QR0A 4PABA 3PYEA 2CQ4A 2X7IA 4ZVOB 4TKTA 7FD1A 5E3QA 4EUVA 2XC9A 3G8SA 2KOEA 2XLIA 2HZVA 2WVCA 4MAKA 1S9FA 2JXIA 1KFSA 3WX8A 4IFVB 3JTNA 4Q7AA 2DPIA 3AFGA 2GQQA 4LF8F 1DQ8A 1VRTB 4QIFA 2JC0A 3HZGA 2FHOB 4QPXA 3L9ZA 2HK2A 4M5JA 3C14A 1T9XA 3RAMA 3V2UC 2MZTA 2VHGA 3P5BP 3KLGB 2GNKA 3K5NA 3Q86A 4HACA 4DV1J 3ZFVA 2U2FA 3EE3A 5E5NA 2MZSA 2RRAA 4DPOA 8AT1B 2HHSA 1VHFA 4YB6A 4C8LA 5J1NA 1HNZJ 2CDQA 2E1RA 4ZVGA 2L48A 1FRKA 4QR1A 1R8CA 4KV8B 4NWBA 2OEJA 2XGQA 2KHCA 3LPYA 4K7QA 3QLHB 2R2TA 1S0NA 3BGFA 2IHR1 3GIIA 4D3GA 4JI5J 1KTVA 3NO7A 2G0CA 3MI7X 4A8XA 3T1HJ 3C2PA 4JI6J 5L46A 1EP4B 1NJIT 3WC0A 2KT3A 5KG2A 3AB2B 2M9KA 1T94A 4ILMA 4DSIA 1NHKL 1S9EA 2OD6A 1F9HA 5KFEA 2ALYB 5IM0B 5L1IA 1FESA 1F0XA 1NSKL 1NSQA 2Z2LA 1KFDA 3G82B 4ZK7M 3CIMA 3UVJB 5HVHA 1NJZA 2PD1A 2KKHA 1VQMS 1VFJA 3O8WA 5HLFB 2VUGA 2XZDB 2BE9B 1FWPA 1HNIA 1XWLA 3K7RA 2CKWA 1N34J 2XS2A 3NP5A 3GONA 4DQIA 5IT9U 3I82A 4O3NA 3MAAA 3QT8A 5L8RC 3M9OB 2QL5B 1S1TB 5CZXA 2W9BB 1MROB 3FSIA 4DV7F 2FJWA 2KTQA 3QBCA 3RB6A 1VQ4S 2E1PA 1FXLA 1R0BG 2R2UA 3IWXA 3UDVA 1HPZB 2A10A 2LU2A 2RDDA 3D9BA 3PCOB 4MMOA 4I0WA 1GX6A 3EDQB 2XLJA 2UXBF 2EI5A 4X64J 2YTCA 3MMCA 3NS7B 3OTOJ 1S4FA 1HLWA 2MZRA 1QE1A 2QMUB 1H0HB 4WXWA 2MXYA 3UPFA 4MKVA 1QAJA 1RT2B 2V63A 3PX0A 1NJXA 2DH8A 5LSRA 4RU2A 2R7UA 3HULA 3O6QA 4X4UA 3EGVA 1Y5IB 1URNA 2OI2A 3JQMA 4ZCMA 1N54B 2MKHA 4CLFA 4I1TA 4DR3J 4JYAJ 3FCWA 2NXEA 4CNZA 1JKHB 5CYMB 1XBWA 3MAAB 2H5JB 2RHSB 4A8OA 3LUYA 4BCAA 3JSRA 3H87C 1YHQS 1YIJS 1JWWA 1PILA 5HLFA 1LWFB 2CPJA 2VB6A 3D1OA 4IG0A 2MB0B 1UP1A 1RWXB 2KDOA 1OS5A 3LF0A 3MTJA 1HD1A 1RTJB 4FNIA 5JMNA 1XK8A 2VOPA 3BGLA 2FJDB 2FVRA 2Q3PA 4UUXA 1TKTB 3QO9A 2HQFA 3M2VB 4HTIA 4PR6A 4DN9A 4ZVUB 2I9SA 4IDKA 4R25A 3P45B 1EIYB 1VCTA 1QUPA 1GX5A 1URRA 2KI2A 2BJ7A 3C16B 1GTHA 3H5SA 3GV5B 2E9RX 1AA1B 2C2ZB 2WAQD 3MWBA 1JLBB 2MQ8A 3TRGA 3I5CA 1RHMB 4J9MA 3LPEA 3ZNJ1 2RQCA 4ES2A 2HVIA 3BR8A 3BN4A 2WB4A 3TAMB 3OUYB 4DV5F 2C2MB 4K0KJ 2ZWPA 3L7UA 3EXCX 2C2EA 2HMIA 3PM9A 4PAAA 2WK4A 1GMWA 4NX9A 1MWQA 3KFWX 3QZ8A 4DL4A 4G1QA 4J9RA 1BWVA 5FDLA 5LMUF 1NHVA 4P52A 1PO6A 4KGMA 5CYQA 1QY7A 3PY8A 4W98A 3QSYB 4DL7A 1VGYA 1AUDA 4F8RA 1QDUB 4IG0B 4CYUB 4X2BA 2W7AA 2EFVA 1DTTA 2DGSA 1GTEA 2ZOMA 4RNOA 3DLEB 2R8KA 3HVRA 1FXRA 2UXCJ 2HKEA 1O5JA 2DHSA 2V69A 5G0RA 4OZ5A 4K5RA 5GAGI 2ZH9A 4WZMA 2OFGX 3UN3A 2AT1B 3SCKE 3LAKA 1SL2A 1DQAA 3KJQB 2I5JB 3AY0A 4IR1A 2G2ZA 2XO6A 1KP6A 2CJBA 1S79A 2EFOA 2M88A 3U1LA 1ZETA 4JI1J 1RAIB 3D28A 3NNEA 5F41A 4KRWA 2VZ9A 2E5LJ 1MMNA 1FJCA 2JRSA 1IBMJ 3MECB 1HNXJ 3EYZA 1ZM3A 2HLTA 1FFSB 2POKA 3DOLA 3FC9A 5IT4A 1T03B 4X4PA 1L3KA 4ELTA 4L75A 1FWLA 2KO1A 3LAMA 3NAHA 2RB7A 1HPZA 2KU7A 4NXMF 4CLKA 4WFZA 3Q83A 2DEJA 2GMJA 2EKNA 3I32A 3HF5A 1JNZB 2YX1A 2FZGB 4LBHA 2W7PA 3OD2A 4LSZB 3VWSA 4USWA 1HBNB 4DG1B 1RWMB 3A13A 3MDFA 4GVBA 4ZPVR 1RTHB 4P2SA 2PO4A 1HIYA 3CCQS 2AZ1A 2Q66A 4DQPA 2MHEA 3B4MA 2QRRA 2F1FA 2XMMA 3KLHB 3MR5A 4C8OA 2VIHA 2B8PA 1FRIA 3BPDA 1X9SA 1OWXA 2VASA 3FK4A 4K8RA 1Y0HA 2BE2B 2KL8A 3SYZA 4U67Q 1U1NA 1NDLA 4EEYA 4KIAA 4M5DA 3GP9A 4QWDA 1NDPA 3W9IA 3M32B 1EX8A 1BQNB 1OY9A 4QWCA 2BOPA 3G96A 2E5JA 2XYGB 2UUCF 4ZIVA 1SJ3P 1HQ2A 4C8KA 4WP8A 2GGPA 1QSLA 4YEAA 3EPGA 1IQTA 5L1KA 4URQU 2OPRB 3OXLA 3ZZPA 1FJGJ 1Q8IA 1PYTA 2IIHA 4KO0B 4HL9A 1YKWA 2A6OA 1EA4A 1NB2A 3HSZA 3BO2A 2JVRA 2IDLA 4BWJA 1H2TZ 3F0NA 4LF6J 4JI8F 2FYXA 5KG0A 2KG1A 4DXLA 5D0HA 4L74A 4HACB 2VPXB 2YH0A 2XCAA 3BBCA 4WKYA 2ZOGA 3G6XA 4XPCA 4ECXA 2HNZA 3DDNA 1SI9A 3AT1B 1K47A 3IG1A 1NLAA 1U02A 2CVIA 2ZM6F 2HHTA 3PKYA 1RBLA 2J0XA 2R8IA 2ZC3A 1U1KA 2CPXA 4DR3F 5ETNA 3MUTP 4JYAF 5IWAJ 3CMQA 4ME7E 3TARA 2ZVSA 4RUHA 1HI1A 4FPIA 1FO1A 3G2XA 3JYTB 1GXUA 2AGQA 1U1PA 2HBQB 1Q82T 4K4UA 3PJ9A 1OJ4A 2N4CA 3K17A 2K1RB 4RW7A 4WPAA 3SCIE 3X3UA 2H4WB 1CJUA 3FZ2A 3U1NA 2AYMA 3NKYA 4C8NA 3I56S 2CG4A 2DK2A 2VPWB 1OIAA 3HSJA 4IH5A 4ZVFA 1Q7YT 4ZOSA 4B9LA 3M8SA 1CJTB 1JLQA 2J76E 2VKRA 2ZBRA 5IXUA 5J2NA 4F4YA 2CPEA 2XZWA 4FYXB 2EKYA 2PE8A 2YKMA 3UO0A 1TK0A 2XLKA 2LDYA 4UY8T 2NYHA 4RBTA 2QYCA 3UCGA 1CULB 4LSLB 3VZIA 2JH3A 3R5CA 2OPQB 3LWLA 3MOZA 4C3LA 1QD1A 4EYIB 3BJYA 5CABA 4DQSA 2D74B 1JLAA 2QLJB 3PFEA 3RTVA 2BKOA 2DNZA 1ZZNA 1Q5YA 4IQXA 2HNYA 1WKKA 2LXFA 2MKIA 1D3WA 4QPTA 5J2PB 4DLGA 2NQPA 2YX4A 4GRSA 4OZNA 4U7CA 2YNHA 2CAJA 2P9CA 1IXKA 1TL7B 1Q16A 1ELOA 2EG1A 5C2GA 2B51A 2OJ3A 1RJJA 4Y65A 3POTA 3ZZYA 1NU4A 2J9DE 2F4VJ 2Y3YA 3FNNA 3HD2A 1PYSB 1RHUB 2QLXA 3H2VE 3OJUA 4B3MF 2IAJB 1ZAVA 2P9GA 3VGTA 2J7UA 2MKSA 2P8IA 1HWLA 3BBFA 3D5MA 4F50A 3ISNC 1PYOB 4M8LA 5C7PA 4ILRA 3TUIC 4Q44A 4X4SA 2ZH7A 3R2DJ 2GPEA 3R7SB 2HBRB 2V5HG 4FKXA 1FRHA 1SCJB 3V6DA 4F02A 1Q78A 2AJ4A 1ZA2B 4DL3A 3DRXA 4LIRA 4M95A 3MZIA 1RWPB 5D78A 2XCPA 3MFHA 4DV7J 4MKYA 2IVMA 1F3VA 2P9EA 3H2LA 2FLNA 4ZVRB 1DTTB 2UU9F 5AXKA 1UTAA 3ZTOA 3P4UB 2GGPB 2BW2A 3VAKA 2W4CA 1KWMA 4WU2A 2ZH1A 1HWJA 1YX2A 1ZH5A 1VQSA 2VA3A 3BV8A 1KEKA 2DHHA 2JJ4D 4X4TA 4OZ3A 4ECWA 4ZA1A 4AXJA 1T02A 1YWXA 2I2YA 3V6JA 1GT8A 2ZZTA 1JLGA 2DH7A 2K7JA 2OPPB 4J9VA 1X4DA 3W1YC 1NXIA 3ZC4A 2BE2A 1NKBA 4WYWA 3UE2A 2KZZA 1FNXH 4U8VA 5ITHA 3PIOQ 1FTCA 1OQ3A 2C3PA 3JSMB 3MMBA 3OFGA 1HD0A 3D0IE 1CPZA 2WVBA 1S1XB 2HQ3A 1RTDB 4KO0A 1TUVA 3BKTA 3L7OA 2JLEA 1VISA 1TFYA 2JEIA 4GVBB 3NNHA 1ROFA 4LFCF 4C9DA 4CCHA 2PMHA 2DGWA 4HR2A 3PJWA 3B8HA 3MPYA 3OLAA 3GG1A 1RWNB 3I96A 4H4KC 3WX4A 2K3KA 1SV5B 3F44A 1WF1A 1SVDA 1JLAB 3M32A 2FQQB 4M5LA 3T6BA 4DMZA 5HSPA 2ZEJA 3MAHA 4EFAC 4BS2A 4F3OA 3CDEA 2VFTA 1TKTA 1V5IB 2XYHB 3QO9B 4HHUA 4LR8A 2ASDA 3PW5A 1VQ9S 1WG5A 3M8PA 4TYAA 5KT7A 4PG5A 5FJ4A 3CD5A 3H90A 2XHWA 1NK0A 3FMBA 2XNQA 2CQ3A 3CTRA 3FEXB 2E7WA 3KLIB 2V2QA 3IN5A 2EXUA 2KXFA 4LMZA 1HBOB 4OZ2A 4NA1A 1HA1A 1MN7A 1O8BA 2HFVA 3IS9A 4U8YA 4CLZA 1IBLJ 1K8AT 2MYFA 1N33J 1R3NA 1YJTA 2B5JB 2CNNB 4MT1A 3VAIA 2M7SA 1CBKA 1HBNA 4LQ9A 3GU0A 5B0CA 5J2MA 2W9CB 3NGTA 2JWNA 5LJ5Y 3DM2B 4J9QA 4ELVA 3T5KA 5ETVA 3ENVA 1WF0A 2NS1B 1TKXB 1WDDA 4TLRA 4IUFA 4G3IA 5CZVA 3KJFB 2CPGA 4PXCA 5DZ7A 1YZ7A 4J9UE 2HHUA 3ZTQA 3HK2A 1JJHA 2HS4A 3T3FA 1U7LA 4JV0A 3TZZA 4PG6A 2BANA 3QATA 3T1YF 3IR6B 4FYDA 4YB7A 5DZ6A 1BDTA 1K0TA 2R4FA 2YKAA 2K3IA 4YN3B 3ENAA 5ETSA 4RNMA 1H2UX 2UV8G 2M8HA 4BBYA 1X5PA 1Y5LB 2AP6A 3MMCB 4GVLA 3ENQA 5HANA 2A6MA 1VYAA 3MEKA 1XMBA 1KHVA 1SC4B 4M1KA 2WBRA 3DFEA 4P9SA 1RCXB 4HHHA 2PT0A 1PJ5A 1RKIA 4FXEA 3HLUA 1EHWA 1I5OB 5LM7E 4FZVA 3Q23A 3BO4A 2FTRA 1GK8A 1S1VB 2GW8A 3GE9A 4KKOA 4X4OA 2DCUB 2E5LF 2HMIB 1RTZA 1YQHA 1MROA 3AA8A 1UCNA 2PEBA 2IM2A 1VJQA 4CM0A 5AE3A 5F8NA 2EWHA 1SBRA 3H7HB 3HHKA 4I6AA 5CQGA 3A8KA 2RMLA 2VFUA 4B3SF 4Q8EA 6FDRA 5GADU 3I4HX 3GR1A 4OI4A 3GFXA 3H8YA 1HMVB 3CW2C 3QAUA 1GMUA 2ZM6J 1CJVB 4QIGA 2LQ5A 5HVGA 1H7WA 2CJ9A 5C2CA 2MZ1A 3V4IA 2RQMA 2VH7A 3NGRA 5DJBA 1U8SA 4DPUA 2J0SD 2DY1A 2W2QP 4IDKB 4FYWB 5FDLB 4GC7A 4QJVA 2HAFA 4P71A 1TTHB 4YP3A 1KSPA 4OJ1A 2B9EA 1NK6A 4LJMA 5D0RA 3HHLA 3J80Y 5JVGQ 2KN4A 3W3SA 3ILIA 4I6YA 2ZNYA 3RRHA 3GR0A 1RYRA 2YX7A 1JLEB 3AD9C 3IWLA 4KR0B 2H4YB 4DV2F 1SIZA 4C11B 3I31A 5FD1A 3W2VA 4KH0B 1RAEB 2OPSA 4GC6A 2L9WA 4UOFA 3SFGA 5GVQA 1FDDA 2GZOA 3OHAA 1QTGA 2XMJA 1GAOA 4X65F 1IJEB 1IWGA 1WSRA 3BH7B 5D4PA 4ZJLA 3Q8RB 1YI2S 1AZSB 1A7GE 2LQ9A 2YY3A 3KOAA 4ED8A 3ZTSA 3CUNA 3UN2A 5KFQA 1NM2A 3KUHA 2LU1A 4JI7F 4ZDNA 4DR7F 3FEYB 3V81A 2LEBA 4CDIA 4L6V3 3DOLB 2MTLA 4F67A 1ACMB 2AY0A 5HBMB 1ZTWA 1YLXA 3MHYA 3T1YJ 2PFFB 3HHNB 3TVKA 4NI2A 4OJGA 3ITHA 5B0FA 3OVSA 5IOLA 2JFDA 2D9OA 3N01A 1YJRA 3R5GA 5E0OA 2BACA 4RBUA 3US5A 5HL7Q 2V4JB 2I5JA 2LFVA 3BZQA 4QOTA 4Q45A 3G8TA 2M70A 2ZDOA 1Y4ZB 2DNMA 1VBZA 5MLCV 4EYHB 5CYJA 2GCFA 4L73A 5BYSA 4X4RA 3HDSA 2WVEA 3M05A 1VBXA 5B0DA 2Z0GA 2CFXA 2IC3B 2ADLA 3LP1B 3NG8A 3G86A 1HNVA 3BYRA 2CWXA 1HBOA 2RF2B 5E2QA 2K5JA 3RZAA 3A8EA 2ZKUA 4ZLPA 3T19A 1VS3A 3PFOA 1T9VA 4QZVB 1BQXA 4ED5A 3V6KA 2M3DA 3Q0AA 3PRDA 5EX3A 5DGAA 2BV3A 1RI7A 4RZRA 1F2GA 3IC1A 4J9SA 5M2PA 1AZSA 3OTEA 4QYRA 2G0JA 4N76A 2SXLA 4I2PA 4LBIA 3KHRA 1FERA 1QJHA 2HFUA 1VMBA 2B56A 2HIYA 2L9NA 2V8HA 1PC4A 2BRLA 2GVZB 3BS9A 4M5NA 4AUKA 4EZ6A 2WTFA 2QA4S 1VQKS 2HPUA 3OFFA 4KHMA 1TFWA 3D1QA 4C0HA 3DLGA 4RL1A 5HQMA 5KFBA 2GJFA 1JLBA 1YGYA 2FHJD 1RWUA 3THVA 3HHEA 2DNLA 2NZCA 1VOMA 2ZC4A 3NLCA 4UW2A 2F40A 3M7VA 3UFCX 3DN9A 1RISA 2DCLA 2QLBB 1JXVA 4A8YA 4USIA 3S01A 1SKSA 1LK5A 4PG7A 1N33F 2YQ0A 4OX6A 4UF4A 3Q89A 3UI3A 4X65J 5L9NA 3CCRS 2OTJS 3H42A 1GMVA 3OPKA 1C0TB 5B7WA 4PUOB 4DPTA 4DF8A 2GC8A 3VVTA 2EFNA 1B01A 5EWGA 4YR3A 5A0YB 4K50A 1RTJA 3OW2R 4YDXA 4O4GA 2FJXA 4U7UK 1CS4A 2W01A 1SKRA 2OSRA 2LQ8A 4J37A 1EKRA 3TX0A 2GX8A 2YWHA 1EKSA 7AT1B 4A47A 1RHKB 2HVEA 4E2FB 1FA0A 4N8NA 2E5HA 2W2MP 3BM7A 1N5TA 2YWGA 3W60A 1B99A 4PYDA 5LSLA 3MUVP 2WZ1A 4DR5J 5D8HB 1VLOA 4QW8A 3RU0A 4IKAA 1IVZA 1HR0J 1E6VA 2VBXA 2BJ9A 3G8QA 4CO1A 3C6UB 5DG9A 2F4VF 1VQLS 5HP1A 1EARA 3ULHA 4NLWA 3HJFA 2YWEA 4KPCA 4Y34A 3VCDA 2H51B 2JLGA 4DV3F 3AXMA 3RAQA 3CT9A 4RUAA 3H4BA 1XC9A 3FSYA 4UUWA 3GYXB 1QE1B 1UFLA 1VDHA 2IM1A 4KY3A 5KOWA 3AJDA 2CRLA 2QIFA 5HROB 2DVIA 1QM9A 1RAOA 2DNNA 3GSDA 1WUUA 4LF8J 2E9ZA 3RYLA 4NRUA 3Q8UA 4FXDA 1M5VC 2WB1D 4K5SA 2C3UA 2H3AA 1UWBA 1ZBTA 3DLHA 3RG6A 1WKJA 5B09A 2FGOA 1YG0A 1N6QA 2BQUA 4PWWA 3DLKA 2D3OR 1ARRA 4OLPA 4FKYA 3TVYA 1PG5B 2F8MA 2MLXA 3KWMA 3CXCR 1XMOJ 4LF7F 2J0WA 1LW2B 3D6HB 4IOBA 4K4SA 4QYZK 2A2BA 1TKZB 2VL1A 1BQMA 3F56A 3EX7B 1N56A 2BJEA 2UUBJ 2QTWA 3M6UA 4JV2A 3OSPA 4P75A 2C2KB 1IWAA 2KT2A 5M2RA 3M8ZA 4NYPA 5C24B 4DR1J 3I0SB 4KFBA 2W8LA 3R97A 4TVAB 1VQ6S 2XB2D 3RB3A 5F8HA 2FVPA 2APOA 4CO4A 1Q0NA 4WE1B 1DY3A 2F9JA 3EJMA 1J27A 2G2YA 3V4MA 1ZA1B 1ZM2A 3MEGA 3QWPA 1IM4A 1J5EJ 3UWTA 4RU9A 3I9ZA 1N6QB 3SBMA 3BSNA 1VRUA 3B6BA 4P2XA 2WW4A 2A2DA 3BF4A 3CSKA 3EVOA 5BYQA 1KONA 1UA1A 1CQNA 1B7FA 2AYEA 1WDTA 1FJEB 2ROEA 1S48A 4I56A 5I3UA
chains in the Genus database with same CATH topology
2CAXA 2K29A 2BSQE 2Y3YA 3VEAA 2AY0A 1X93A 1NLAA 2BJ8A 2WVDA 2WVFA 4HV0A 2HZAA 1B01A 1IRQA 1MNTA 3LGHA 4FXEA 2BNZA 2BJ1A 1U9PA 2WVBA 2GPEA 4ME7E 3BKUA 3BKTA 2F1FA 2BJ7A 3VEBA 2RBFA 1P94A 2K9IA 3VW4A 1BDVA 3PHTA 1Q5YA 2NZCA 2K6LA 1MYKA 1QTGA 2BJ3A 3QSIA 3FMTA 1Q5VA 2BA3A 2JXGA 1ARRA 2CPGA 1BAZA 2JXHA 2K1OA 2WVEA 2KELA 1MYLA 2CAJA 3FT7A 3OD2A 1EA4A 2BJ9A 2HZVA 2WVCA 3H87C 2H1OE 2JXIA 3GXQA 2PC6A 1ARQA 1PARA 2CADA 4D8JA 3QOQA 1BDTA 1B28A 3BKFA 2CA9A 2FGCA 2BNWA 2K5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CAX A;  2K29 A;  2BSQ E;  2Y3Y A;  3VEA A;  2AY0 A;  1X93 A;  1NLA A;  2BJ8 A;  2WVD A;  2WVF A;  4HV0 A;  2HZA A;  1B01 A;  1IRQ A;  1MNT A;  3LGH A;  4FXE A;  2BNZ A;  2BJ1 A;  1U9P A;  2WVB A;  2GPE A;  4ME7 E;  3BKU A;  3BKT A;  2F1F A;  2BJ7 A;  3VEB A;  2RBF A;  1P94 A;  2K9I A;  3VW4 A;  1BDV A;  3PHT A;  1Q5Y A;  2NZC A;  2K6L A;  1MYK A;  1QTG A;  2BJ3 A;  3QSI A;  3FMT A;  1Q5V A;  2BA3 A;  2JXG A;  1ARR A;  2CPG A;  1BAZ A;  2JXH A;  2K1O A;  2WVE A;  2KEL A;  1MYL A;  2CAJ A;  3FT7 A;  3OD2 A;  1EA4 A;  2BJ9 A;  2HZV A;  2WVC A;  3H87 C;  2H1O E;  2JXI A;  3GXQ A;  2PC6 A;  1ARQ A;  1PAR A;  2CAD A;  4D8J A;  3QOQ A;  1BDT A;  1B28 A;  3BKF A;  2CA9 A;  2FGC A;  2BNW A;  2K5J A; 
#chains in the Genus database with same CATH topology
 2HNZ B;  3H2U B;  3KLG A;  4DQQ A;  2DY9 A;  2IA6 A;  1LXJ A;  5IQQ A;  4ENO A;  3M2R A;  3MMJ A;  3WDO A;  5DQG A;  2HHH F;  4DSF A;  2UVU A;  4P2M A;  5L39 A;  4Y2M A;  2HSE B;  1T9T A;  4OLO A;  3SSQ A;  5F8M A;  3OL6 A;  2W2N P;  3NOG A;  4MFB B;  4JI7 J;  4DR7 J;  2EFP A;  1MML A;  2CQC A;  3TOQ A;  2R42 A;  4ER8 A;  2E44 A;  5HI7 A;  3WHI A;  4WBF A;  3PZP A;  3HO1 A;  3KJN B;  1FF2 A;  1FT8 A;  2R7Q A;  3KXD A;  3N6M A;  1DLO A;  5DDR C;  3CPW R;  3CJ3 A;  4JI2 F;  1T0T V;  3D67 A;  4OYO A;  4DUT A;  5EWE A;  1C4A A;  4PPD A;  4XO0 A;  1IM6 A;  1D1U A;  3ONQ A;  4NLG A;  2MY8 A;  1WEX A;  4NLT A;  3ZO7 A;  1RZM A;  2DIU A;  2ZUA A;  3N4W A;  3B78 A;  3R7N B;  5DDQ C;  2XTJ P;  3WIU A;  1X9W A;  3C3L A;  4I2Q B;  4OV6 A;  1U2F A;  2W4P A;  1F5B A;  3HT0 A;  2ZFH A;  4U9R A;  1Q7L B;  4ZIW A;  3GIL A;  2YQ1 A;  1U0H B;  4M5K A;  2QA2 A;  2UVV A;  1KN6 A;  3GB0 A;  4CLP A;  5A8R B;  2N82 B;  1WHY A;  5IS2 A;  2JNJ A;  1D0E A;  4ED1 A;  3QJP A;  1WEL A;  1GH8 A;  2WOM A;  3IXQ A;  3W62 A;  3VW4 A;  3DGV A;  4MK9 A;  5B0A A;  8ATC B;  1YJN S;  3KHL A;  1HWI A;  2ATC B;  1FKA F;  3MEG B;  1SH0 A;  2RIJ A;  5KFS A;  3PW4 A;  3HI9 A;  3FBB A;  1N34 F;  1D8Y A;  2AYB A;  1DAR A;  1C1C A;  5KFR A;  4FXV A;  1PAR A;  1I6J A;  1RGV A;  1TV6 B;  4X66 J;  1U09 A;  2YNF A;  2J8A A;  1IQZ A;  2BSQ E;  1M1K T;  1U6B A;  5C24 A;  5D0G A;  1Y9O A;  4DDF A;  5F3Z A;  1SJR A;  1QLN A;  1UVK A;  4F4X A;  2A2C A;  3OTB A;  4J9P A;  2GQC A;  3MM9 A;  4OYA A;  4RBV A;  3CJK A;  3R2C J;  1MSW D;  3OTO F;  1ZZF A;  1U6F A;  4DHV A;  5J1E B;  1RLD A;  3ISN D;  2DXF A;  1K44 A;  3LP1 A;  4Q2M A;  2FVQ A;  2MST A;  2YNG A;  3DLL Q;  2N7Y A;  2BDP A;  4ZS6 A;  3LP2 B;  1W2B R;  2Y1J A;  1S6U A;  2B9X A;  1HQU A;  1Q53 A;  2W25 A;  2RKI A;  3H5U A;  4N7T A;  2AJ1 A;  5LMN J;  1S1U B;  5LMU J;  4CYU A;  2OIH A;  3HFV A;  1HNW J;  3QSI A;  1OHN A;  1P1L A;  3SXL A;  4D8J A;  1FRX A;  4N56 A;  1CG2 A;  2XYP B;  4QIW D;  4PKD B;  3BRE A;  3FFI A;  3SSR A;  4ANC A;  4F3M A;  2EPI A;  4AYB D;  1RHR B;  3BPS P;  4KGZ B;  3CD0 A;  3T1A A;  4ZLJ A;  1K9M T;  2DGO A;  3EGZ A;  4O44 B;  1F2H A;  1UPM B;  1ZM4 A;  2B9Y A;  2IDE A;  3PIP Q;  4DV2 J;  4ZVS B;  5IT0 A;  1WF2 A;  2O1P A;  2RIL A;  4B9T A;  2FVS A;  2CYY A;  3TJ9 A;  3PW2 A;  3FRZ A;  2QEX S;  5AT1 B;  5K14 B;  2IY5 B;  3KUG A;  4OFZ A;  3T1H F;  3TW0 A;  1IKX A;  1SUQ B;  5GAD I;  2YWW A;  1LWX A;  3MR3 A;  1OG7 A;  2LLZ A;  1DTQ B;  3KK2 A;  3A3P B;  3TYT A;  3TAP A;  3QGH A;  1LWC A;  4V1A k;  3NL0 A;  2HHV A;  5KFJ A;  4ED6 A;  4A8W A;  3BDE A;  3I4P A;  5KFM A;  4R5P A;  2RE1 A;  3ENW A;  2F63 A;  3BKU A;  3A12 A;  2DR5 A;  4J9L A;  3M8Q A;  4HI1 A;  2Z30 B;  4C0O C;  4ZN1 A;  3KK3 B;  4PRF A;  1KKH A;  3SQG B;  2ZBP A;  1G4C A;  2O66 A;  3KK1 B;  4NCB A;  2OSQ A;  3ET6 B;  1X4C A;  2LP4 A;  4HV0 A;  4AL5 A;  4DLE A;  4B3O B;  2WHO A;  2CNK B;  3N79 A;  1O6X A;  1KS2 A;  2IPO B;  2VG5 B;  3U27 A;  3W5Z A;  3KLF B;  2XGP A;  4PUO A;  1NDC A;  2H5E A;  2F7V A;  2NSB A;  4KGV B;  2V4R A;  1VQ7 S;  3M6X A;  3E8O A;  4USK A;  1JLF A;  3BDP A;  3S1T A;  2GV1 A;  1UFK A;  1NCL A;  2HND A;  3DOK B;  1N32 F;  3BSO A;  2JL9 A;  2B4O A;  2VF3 A;  4KE5 A;  5K14 A;  1TR0 A;  4F25 A;  3OXF A;  2J9C A;  4E8U A;  2KYZ A;  3DMJ A;  4LT6 A;  4TXS A;  4CT9 A;  2QGF B;  3EM1 A;  2W4D A;  4ECS A;  1AUS L;  1FE0 A;  3DYA A;  4UZC A;  3TO8 A;  4DV0 J;  2AF6 A;  2C28 A;  1R0A A;  3PVX A;  2E1C A;  2KXH A;  4ICL B;  1S1V A;  4ZVT B;  3M1V B;  1RBO B;  4XIU A;  3TUZ C;  2HHH J;  1FRJ A;  3MXH P;  2J5A A;  2KYX A;  3N0V A;  2FY8 A;  2NSC A;  3BEG B;  3O2I A;  4HHJ A;  3VTI A;  3H25 A;  2AQ4 A;  4LFB F;  4B3M J;  2OD4 A;  1SQG A;  2RQK A;  4DZD A;  2Q1L A;  1O51 A;  4ZP6 A;  2QFJ A;  1IUJ A;  3VAM A;  5H9F J;  1T3N A;  4IH6 A;  3QFW A;  2MZJ A;  4N77 A;  1UPP A;  2J7K A;  4RUB A;  4URG A;  5C25 A;  3DC2 A;  4LR7 A;  2YH1 A;  3IAS 9;  3TZW A;  2FJA B;  1D9F A;  4IOA Q;  3PRV A;  3N6N A;  1RT5 A;  4RUC A;  3QID A;  2RUG A;  1GEH A;  1NDK A;  1R31 A;  4ZN3 A;  2MSS A;  5IWA F;  2DPJ A;  4KHP F;  1VIO A;  2QT7 A;  4FPR A;  1Q8L A;  5CAA A;  4KBI A;  3JS9 A;  3OQ2 A;  5KFL A;  3WC2 A;  1HWK A;  2GIF A;  1IR0 A;  3MM7 B;  2RD5 C;  3UN5 A;  2ERR A;  2LEA A;  4NI2 B;  3U7J A;  1NK7 A;  4ZVE A;  3HKZ D;  3OTD A;  2RT3 A;  2HQI A;  2DHX A;  2Q6C A;  2XSJ B;  1RCO B;  2CWK A;  2P6S A;  2HZA A;  3EMT A;  4PYA A;  3SQG A;  2CPD A;  1MNT A;  1C2P A;  3HVT A;  2KRB A;  3EXY A;  4CLW A;  3UNY A;  1E6Y B;  4F0H A;  5F8I A;  2MGZ B;  4J9K A;  1S0O A;  4OHY A;  3M6V A;  2CDR B;  2HLU A;  4LFA J;  3MR2 A;  3P3D A;  2CQI A;  4NLS A;  3Q2T C;  1NSA A;  4ED7 A;  1T9W A;  5D77 A;  2JSX A;  1UMJ A;  3BGR A;  4L76 A;  4ALZ A;  4BC9 A;  1WNE A;  1AW0 A;  1IBC B;  2LKZ A;  3FKB A;  2M8D B;  1CVJ A;  3DOK A;  2OEK A;  2E29 A;  3BSA A;  3LP0 B;  4L3N A;  1UW9 A;  1Y10 A;  3CC7 S;  2JXG A;  3R5D A;  4DV5 J;  1QAX A;  1S1W A;  2HFZ A;  5K8N A;  2AU0 A;  4GO7 X;  4CI0 B;  2DIT A;  3GIK A;  3RR7 A;  3M2V A;  1SH3 A;  1UWA A;  2BKP A;  4CQ1 A;  3F73 A;  1S1X A;  4NLV A;  5KFP A;  2E5I A;  2CZ4 A;  2F8E X;  5LOQ A;  1MNE A;  4DV4 F;  4DBQ A;  1WOO A;  3HVT B;  1Z2L A;  2X1B A;  3LH2 S;  4WYL A;  4EBC A;  1YTY A;  2AKW B;  1HHQ A;  3HXM A;  1RB0 A;  5CCM A;  3HVW A;  1U8W A;  1TP7 A;  2X3D A;  3HZE A;  4ZPW R;  2QSF A;  4I67 A;  1X4E A;  3CGI A;  5KFF A;  3Q22 A;  3AXK A;  1HR0 F;  3HX9 A;  3BBB A;  4URS A;  4CT8 A;  5GAE U;  4AL6 A;  3UCU P;  1J2V A;  2QA4 G;  4XTT A;  4DFM A;  2NUU G;  3D68 A;  1HMV A;  3THP A;  1SC6 A;  2AN7 A;  2XSF A;  5LXY A;  3CME S;  4MFB A;  2YNG B;  1HBM B;  2UUA F;  3GCX P;  3UR3 C;  1S0V A;  4NLD A;  1ARQ A;  4AT1 B;  3A1Y G;  3PV8 A;  4C6A A;  1IBM F;  3CCJ S;  1NAQ A;  1UKU A;  2B7B B;  3CJK B;  4U6P A;  1REG X;  4AND A;  4ECR A;  3DHW C;  5FLX U;  1TKD A;  1RU2 A;  5I3U B;  4WTY A;  2ZH8 A;  3EPI A;  4RX6 A;  2NRE A;  3AOB A;  2IAJ A;  3MUR P;  5KT5 A;  4LRF A;  4DU7 A;  2XMT A;  4NE9 C;  3W2W B;  2YNF B;  4HEA 9;  2NXJ A;  1S1U A;  2UP1 A;  5EDW A;  1S6O A;  3ZZT A;  3DYA B;  4ED4 A;  2A18 A;  5C42 A;  2NLW A;  1P94 A;  4YR0 A;  3IBF B;  4DPY A;  2FJV A;  4NOH A;  1KRP A;  2HHQ A;  1UET A;  4GKK J;  2JEJ A;  4IO9 Q;  3KLV A;  3NGK A;  4B9N A;  4WE1 A;  2VJV A;  4F0M A;  3RRG A;  1SL0 A;  2O3D A;  4EGL A;  2B43 A;  4AQY F;  4L72 B;  1LWE A;  2CQP A;  1YBU A;  2VFV A;  3R3T A;  2KFZ A;  4UST A;  2AX1 A;  4NLP A;  5AJ3 F;  2VFR A;  2XS5 A;  2HWI A;  3G5O A;  2PI5 A;  2J8S A;  1PBU A;  1RE1 B;  2XHC A;  1S5Z A;  2NXU A;  2R7X A;  3DOM A;  1LFP A;  2B5J A;  5AE2 A;  1FVQ A;  2FHJ A;  3NS5 A;  4KGX B;  5DS7 A;  2C42 A;  5CD4 A;  2VG5 A;  4K2J A;  2KFY A;  4NCA A;  4ID5 A;  4O3O A;  3RBX A;  3ZTR A;  5KFH A;  5EGY A;  1N32 J;  1TV6 A;  4RWW A;  4FF3 A;  3KMS A;  3FMW A;  4UQT A;  1OYE A;  2GHV C;  4X66 F;  4NRT A;  2IRU A;  3M8P B;  5E7O B;  3QJJ A;  2NXC A;  2YKN B;  2IRX A;  3KG4 A;  4FYV B;  1ZYQ A;  1NJY A;  3P49 B;  3PKM A;  4U7U D;  1RTI B;  4TY9 A;  1N48 A;  2DB1 A;  3FBF A;  1SIW B;  3DRS A;  3DXS X;  2VPZ B;  1R89 A;  2FZC B;  2QSW A;  3NS6 A;  4HTJ A;  3CUL A;  3MCS A;  2I6W A;  2JVO A;  1R8H A;  1K1S A;  3T5L A;  5IV3 A;  4EBD A;  4QU6 A;  2KZM A;  1T8E A;  2GQ2 A;  3O44 A;  3VZH A;  1U6Z A;  2CJQ A;  2V2K A;  3W7B A;  2H5I B;  1HL6 A;  2CIM A;  2AGO A;  4LF1 A;  2V34 A;  4J5O A;  4ZJO A;  1S99 A;  3MPD A;  3DCA A;  2ZVI A;  1FK9 B;  3DRR A;  3M30 B;  1Y3K A;  3MF5 A;  2BVZ A;  4KYZ A;  5SUH A;  3K5M A;  4Y3C A;  2XY7 A;  4Z7Y A;  3KTQ A;  4O23 A;  4O3S A;  3PDN A;  1GNK A;  4F4W A;  4OI0 A;  4MK7 A;  3CWJ A;  1RT1 B;  4G1I A;  3CCW A;  4EMD A;  1X8D A;  3CED A;  3FZB A;  4ZP9 A;  1DLO B;  1R6V A;  5JVH Q;  3B54 A;  2YQ3 A;  4PXD A;  3B82 A;  2WSF C;  4HKQ A;  3CDA A;  4Z7C A;  2OP5 A;  4O0N A;  2AJQ A;  2ZH5 A;  3LJP A;  4WXO A;  4MJW A;  1FTR A;  2DJW A;  3FQK A;  3CC2 S;  3LP2 A;  4AXI A;  2YKN A;  4CO2 A;  3PR5 B;  4EZ9 A;  1BXN A;  2ZH3 A;  1F5A A;  2AJ0 A;  1SC3 B;  1GFW B;  3PYD A;  3T9Z A;  1H3D A;  2B8Q A;  3ZXW A;  4B9M A;  2C3M A;  3J81 Y;  2DRA A;  3M2R B;  3BH6 B;  4FNH A;  4IQM A;  4DR4 J;  3UR0 A;  1FE4 A;  2LQB A;  4KAI A;  4WFN Q;  3SZ2 A;  2XWX A;  2PEH A;  3CCE S;  4NLQ A;  2F65 A;  2C2O B;  5A8W B;  1RAF B;  4IRK A;  1NPP A;  1HAR A;  2DO4 A;  1VC6 A;  4LFA F;  2IMO A;  1FD2 A;  3MPU B;  4XPE A;  2R7W A;  4OYW A;  1YDL A;  4A48 A;  1U9P A;  5A8K B;  2BMB A;  3ICL A;  4WFB Q;  4B3R J;  1VRU B;  4CTA B;  4PG8 A;  3G71 S;  5H9E J;  1TK8 A;  4WWS A;  5D4L A;  2JEF A;  2OKQ A;  1Z1Z A;  1UJ4 A;  1MWY A;  4L3K A;  1TL7 A;  4BLG A;  4WK1 A;  5M2U A;  3I9V 9;  4A8M P;  4OX9 F;  5D0E A;  3J7Z T;  1B64 A;  1TAQ A;  4FDF A;  5LJ3 Y;  2I0X A;  3BSC A;  4OYM A;  1FHT A;  3RW7 A;  5D3G A;  4JV5 F;  1TMJ A;  1VC5 A;  5ETK A;  2G0I A;  4B17 A;  2VG7 A;  3LWM A;  4DSL A;  3DDK A;  1U1O A;  1UVI A;  4DL2 A;  1S6P B;  1D8Z A;  2FVC A;  2DR6 A;  3KUE A;  4K2X A;  3I6P A;  4LSN A;  4OI1 A;  1BQM B;  2XS7 A;  5H9E K;  3EZO A;  2UVW A;  1HWU A;  1RAB B;  3D0H E;  1CJT A;  1JLQ B;  2CZV C;  1DQ9 A;  3PEJ A;  1U48 A;  1UVJ A;  4JI4 J;  4DJB A;  2MLY A;  1WI6 A;  4NCG A;  4B08 A;  4B9U A;  2AGP A;  1V9O A;  5GAH U;  1S4E A;  4HYK A;  2JX2 A;  2M2B A;  4DV1 F;  1M1H A;  2BA9 A;  5B08 A;  4DS4 A;  2HHX A;  2DHG A;  1F6T A;  2V8G A;  2VPY B;  3ITH B;  4I4B A;  3UQS A;  3JYT A;  3PO5 A;  2GJ2 A;  2UZA A;  2D3Z A;  4NYZ A;  4UOH A;  4OHX A;  5D4N A;  4JI3 F;  3MM8 B;  2FGC A;  3TWZ A;  3GJT B;  2VIC A;  1WOS A;  1HW9 A;  5DQI A;  1U2R A;  3T9N A;  1TK5 A;  3GPA A;  3NXZ A;  3QPI A;  2ZZN A;  1P1T A;  3IG1 B;  3GV8 B;  4P10 A;  2XBP A;  1FFW B;  3KG1 A;  3OVA A;  2R8H A;  1S76 D;  2RH3 A;  1Q86 T;  2LXI A;  1FX2 A;  1KBR A;  1S1W B;  4QBU A;  4K4W A;  1ARO P;  1JIH A;  1OSC A;  3ETM A;  3LP0 A;  2F4F A;  3R1H A;  1IKW A;  1TAU A;  3NBP B;  2GIQ A;  2YPY A;  4O3P A;  1K73 T;  4C2M A;  3NNC A;  2OPS B;  3GV7 B;  4IRC A;  3BGR B;  2KJW A;  3AD7 C;  3DGP A;  4C7Q A;  1FJ7 A;  3IBW A;  2DBB A;  3LA0 A;  1WOP A;  3KNG A;  3PAC A;  4C11 A;  2XZT B;  1L3V A;  2E9T A;  1AFI A;  1PAE X;  3B4D A;  3LQV A;  3M9N B;  2GVZ A;  1T95 A;  3D1H A;  2HG4 A;  2VBZ A;  4O4G B;  4F26 A;  1VQN S;  1B28 A;  5HAT A;  2WVF A;  1H7X A;  1M5S A;  5HAO A;  2X1A A;  1WTB A;  4FN5 A;  2HGL A;  5A76 A;  1KLM A;  4M5G A;  2GHW A;  3LTO A;  2Y1I A;  5MAO A;  2ZHO A;  5DET A;  5J1P A;  4NLX A;  1NRK A;  2HZC A;  4H54 A;  1KDN A;  2VDI A;  1RT3 B;  3RJM B;  5AXN A;  5KG7 A;  3D54 A;  2ILY A;  2X1G A;  2V94 A;  1V3S A;  3IGV A;  1CJK B;  1BLU A;  3LGM A;  2E5G A;  1LW2 A;  1JJ4 A;  1HW8 A;  1Q8K A;  3D3C J;  1R0C B;  2BYC A;  3UW1 A;  1U24 A;  1VBK A;  3MMA A;  4DCO B;  2OAU A;  2EFG A;  1CLF A;  4OX9 J;  3DLK B;  1G2E A;  2H1O E;  4PZV A;  4LQ3 A;  1G1X A;  4ES1 A;  4LFB J;  4W4M A;  4K4V A;  3QGI A;  1RXO B;  1PJ6 A;  2CQB A;  1Q95 G;  2OO4 A;  5ETP A;  2MKK A;  1MU2 A;  4H4O B;  3CC4 S;  4QWB A;  4PQU B;  1YIT S;  2E66 A;  1K0V A;  3I5B A;  3CCU S;  1HBU B;  3CCM S;  2UUW A;  5ADZ A;  1L3S A;  3PYG A;  4S0M A;  3ZZR A;  3TA0 A;  5HRO A;  3R27 A;  3K8V A;  1MG7 A;  1RT2 A;  2BJ8 A;  3CJ2 A;  4DFP A;  4E98 A;  1PIE A;  2BOA A;  1UEK A;  4HH0 A;  2RAQ A;  5KFO A;  1FKO B;  1HBU A;  2EBE A;  5E33 A;  1Y7P A;  4P74 A;  4CWB A;  4ZHR A;  5GME A;  4DU8 A;  1WC6 A;  4NZ0 A;  3HVA A;  3CE8 A;  3NY0 A;  3S8S A;  4TQR A;  1TKX A;  2GIR A;  3NEK A;  4Z2X A;  5T14 A;  3MOJ B;  1SJ1 A;  4TU8 A;  2HND B;  4U96 A;  1P9Q C;  3IO1 A;  1BHN A;  1Q81 T;  2UXD J;  3IM8 A;  4JP8 A;  1XR6 A;  1U1M A;  3GQC A;  2K8G A;  4IR9 A;  4ZMM A;  4K4X A;  1XNR J;  3IFE A;  1CJK A;  4W92 B;  1P27 B;  4ED3 A;  5HMY A;  2PII A;  2AEF A;  2DNP A;  2UUB F;  4NA2 A;  2Q79 A;  2IM3 A;  5CYQ B;  1N0V C;  1VJW A;  3QWU A;  4UY8 5;  1M5O C;  3BQ1 A;  1SB6 A;  5IM0 A;  1PJ7 A;  2MPU A;  3ZTP A;  1OPI A;  1M1G A;  2EC2 A;  1XR5 A;  3PNI A;  3W5X A;  4BC7 A;  5KFN A;  3GCW P;  2VQE J;  4DR6 F;  1WC0 A;  1XQI A;  2MQL A;  3OHB A;  1EP4 A;  5HMX A;  3D0G E;  4DR4 F;  3NMR A;  2V8D A;  4CH0 S;  1WHW A;  1ZOT A;  3O5T B;  3OUY A;  5DLF A;  1R8P A;  1VK8 A;  2ZD1 A;  3C15 A;  3OFH A;  3LOU A;  3D6T B;  1X31 C;  4OQJ A;  3JAM U;  1WSV A;  5AXL A;  1JX4 A;  4ECZ A;  4ED0 A;  2KJV A;  3IR7 A;  3QYY A;  3GJR B;  1UEV A;  2A3J A;  3Q24 A;  3PEH A;  4ATN A;  1F3F A;  4ZVP B;  2XY6 A;  1IKW B;  3D4J A;  2JC1 A;  2ZD1 B;  1HI8 A;  1U0S A;  5ETO A;  5CD4 H;  5L9X A;  1S7I A;  3CJQ A;  3K8W A;  5KOX A;  1FD8 A;  1HKA A;  1JQG A;  2CPZ A;  4DFK A;  5HK4 A;  1WOR A;  2KT5 A;  2P5V A;  4WFY A;  3VF0 B;  2V9K A;  3FUY A;  3SQO P;  4DUY J;  3CJR A;  3E01 B;  1TL5 A;  5AE1 A;  3SV4 A;  3NCQ A;  3OR1 B;  3HMJ G;  1N52 B;  2WVD A;  5CHC B;  2C22 A;  3JSB A;  1IRQ A;  3W9J A;  4RW9 B;  2V2Z A;  5HMW A;  2MLZ A;  4DS5 A;  5T41 A;  4B9V A;  1X4G A;  1YZ6 A;  3QT6 A;  3G6E S;  2XI2 A;  5JJB A;  1FDB A;  4DPW A;  5HJX A;  1OMS A;  3VEB A;  1C4C A;  3BGU A;  1EAY C;  2IC3 A;  5DRK A;  1RT5 B;  3FCH A;  4I64 A;  3BKF A;  2PN6 A;  2IYG A;  5LT5 A;  5E3C A;  1X60 A;  5F3T A;  2BQR A;  4W90 B;  3DM2 A;  1V3R A;  1H6K X;  3IWN C;  1OYD A;  4WKR A;  1D09 B;  1HQE B;  2DEI A;  3SDE A;  2FLL A;  5F8J A;  2X1F A;  3BR9 A;  1M5H A;  2CAX A;  3TAN A;  3D6M B;  3THT A;  2ZE2 B;  4JI1 F;  3TUP A;  3CVK A;  2ROG A;  1NBE B;  2J9D A;  2MQN A;  3QQC D;  4CP5 A;  5K8P A;  5DG7 A;  1SPB P;  2D69 A;  5KFV A;  3NCP A;  5RUB A;  3W61 A;  2MQO A;  1KHW A;  1Q79 A;  4DFJ A;  3NWR A;  3EZ5 A;  3K57 A;  2RQ4 A;  5F8G A;  1FVS A;  1PC5 A;  3NAI A;  1LK7 A;  2HRY A;  3HD1 A;  2AJF E;  5D3G B;  4GKJ F;  3BYP A;  3QIP B;  4C0B A;  2K9I A;  3J81 U;  3UD5 A;  4B02 A;  3CMA S;  4C8Z A;  4Q0B B;  1VHI A;  4IRD A;  2EC0 A;  3IP0 A;  1RT4 B;  4NYO A;  5J2M B;  2WW8 A;  2CPH A;  2PGC A;  1Y3J A;  4DX5 A;  1MYL A;  2OHD A;  3ZZZ A;  4Y2K A;  2HYI B;  1RDR A;  2OGU A;  4F2R A;  4FF4 A;  2K7K A;  3W2V B;  3J7Y I;  2YKM B;  3ZZU A;  1DJ0 A;  3CCS S;  5FLX Y;  4JV5 J;  3KLI A;  3MMB B;  5GMD A;  1WC4 A;  2HK3 A;  4ZLN A;  1KTQ A;  1N5Y A;  2ASJ A;  3M8Q B;  5A8W A;  2YKQ A;  1TL3 A;  2C3Y A;  3A3N B;  1I3O B;  1RWO B;  3J80 U;  1KLM B;  4V19 J;  3G9C A;  4M5H A;  4RPF A;  3L09 A;  1FFG B;  1XNQ J;  1SV5 A;  3V4I B;  3DU6 A;  3TJ8 A;  2OMO A;  1H72 C;  4JB8 B;  4NA3 A;  1IN0 A;  3K58 A;  4WP9 A;  4P6Q A;  1RAA B;  1WG1 A;  2HHP A;  2YNI A;  1MYK A;  3L95 X;  4MYT A;  4EI2 A;  2Y1R I;  4J9N A;  2OH2 A;  4HDH A;  4UT4 A;  2G4B A;  3O3L A;  2V50 A;  1Y5N B;  5ETQ A;  1JXL A;  2HHW A;  4JI8 J;  1PAU B;  2V68 A;  4KTQ A;  2L08 A;  3HT3 A;  4EBE A;  1RLC L;  4LF6 F;  2RDJ A;  3VAJ A;  3CCZ A;  1G7C B;  2CQD A;  1G3O A;  5IQ6 A;  2RU9 A;  1JLG B;  4O0I A;  1APS A;  2FB0 A;  2W2P P;  3FFI B;  2PA3 A;  2NCK L;  4RW8 A;  4C48 A;  4PXB A;  4CH1 A;  1OSD A;  2O67 A;  2DKO B;  3NGD A;  3VAH A;  2MHN A;  1ZTT A;  4I7F A;  4F04 B;  1VQP S;  1XER A;  3HPO A;  1VK3 A;  4PPZ A;  1OPZ A;  1BD6 A;  1G6B A;  4CO3 A;  4RNF A;  3X1L B;  1ZAW A;  4IFV A;  2BAN B;  3T41 A;  2NYI A;  3AQP A;  2JOQ A;  2X51 A;  1NO8 A;  3D3B J;  2DYA A;  2LYV A;  3TUJ C;  1FWK A;  2XO7 A;  6AT1 B;  2OUG A;  3PX6 A;  1YBT A;  2GAH C;  1A6L A;  1F9E B;  1P6T A;  4DX6 A;  4TQS A;  2KXN B;  4B9S A;  5DG8 A;  4F4K A;  1KQS R;  1SIW A;  3DRS B;  3Q2S C;  4G6V B;  3MM5 A;  4ZP7 A;  3ZZO A;  3M9M B;  2FUG 9;  2V9W A;  4NZ7 A;  1SJF A;  1IBK F;  1LNQ A;  1HNW F;  1H98 A;  1LOU A;  2YBV A;  2HGM A;  4NAS A;  2Y8W A;  1T11 A;  4FVC A;  3TJA A;  3VAL A;  3NCR A;  4QU7 A;  1RAH B;  5KFW A;  3HHL D;  1RA7 A;  1BUX A;  3Q8Y A;  2XMA A;  1JB0 C;  3GSI A;  4ETZ A;  5IZH A;  4C4W A;  3BGO P;  1KVJ A;  2ADB A;  5LL6 d;  4ELU A;  3HCX A;  2FHM A;  1W25 A;  2DR7 A;  1XNR F;  3GJS B;  3DOM B;  4X84 A;  1GXT A;  1HFE L;  4D3H A;  4B3R F;  2VJU A;  2DXD A;  1BWE A;  1WG4 A;  4EK2 A;  4RNN A;  1RT4 A;  2HNY B;  4DN0 A;  4XAK A;  1JLC B;  4DV6 J;  3SV3 A;  1T7P A;  4EU0 A;  2L3M A;  1X4B A;  2ZDP A;  3AAW B;  4Y2C A;  1ZM9 A;  1VC0 A;  1IBL F;  5KG4 A;  2UU9 J;  2XI3 A;  2PMZ D;  2ZJP Q;  3OV7 A;  3N5B A;  1R6Y A;  1KQF B;  1WHX A;  1U0H A;  2VON A;  5KT2 A;  4LF9 J;  4AFF A;  2QA1 A;  2W24 A;  1S57 A;  2PDA A;  2Y1L B;  1I1G A;  3W2W A;  3NRB A;  4LF5 J;  2GVD A;  1UEU A;  3I0R B;  5C5J A;  1RYS A;  1REV A;  3QMQ A;  4K4Z A;  5BYR A;  4YY3 F;  3C6U A;  3IRW P;  2D3O 1;  1PSD A;  4RWX A;  4TU9 A;  5CXT A;  3H5Y A;  2OML A;  2OLW A;  2Z2Y B;  3PG9 A;  3VGU A;  2PI4 A;  4KJI A;  1RU1 A;  4G65 A;  2MQP A;  4B3T J;  2I8E A;  1LKZ A;  1XIQ A;  2CQ2 A;  2HIQ A;  4RW7 B;  3DLJ A;  1M90 T;  3DLE A;  1BE4 A;  1FX4 A;  2IM0 A;  1EET A;  4NMX A;  4X4N A;  2OPR A;  1KOH A;  4JI0 J;  3SMZ A;  1R7I A;  2AX0 A;  5L38 A;  1ICE B;  1RSC A;  1PCA A;  2B9W A;  3K5O A;  4DSE A;  1FDA A;  3C19 A;  5KT6 A;  3UNG C;  1S97 A;  4RW8 B;  4G1Q B;  4NZ6 A;  2BXJ A;  1RKJ A;  3R1L A;  1C0T A;  2GO8 A;  2YPZ A;  4CH7 A;  4O4R A;  2DNQ A;  3VGV A;  4DZ6 A;  2CJX B;  2J9E A;  2WSE C;  5J2Q B;  2WCX A;  5KFC A;  2QLW A;  3I0R A;  2B6A A;  2DNG A;  2ATL A;  2R7T A;  5EX0 A;  3TAM A;  4X4Q A;  3GIR A;  4PWU A;  2COL A;  3AHP A;  3KYL A;  3SI8 A;  1LV5 A;  5HJY A;  3K89 A;  4OHV A;  3KLH A;  1AB8 A;  2I38 A;  1UAW A;  2M0G B;  3MD3 A;  5F0W A;  4HH1 A;  2BKN A;  5F9N A;  2RU3 A;  4Y2A A;  3W5Y A;  4FF2 A;  1UFW A;  2V0N A;  1T3O A;  3EVM A;  3MM6 A;  3TVZ A;  1RT7 B;  2C3O A;  4RW6 A;  3C15 B;  4ZPD A;  3C16 A;  5K8M A;  4QWA A;  4QQB A;  2R7S A;  3D6F B;  2XNR A;  2P2C B;  4JUZ A;  4GKK F;  3GZ7 A;  2QJ3 A;  5IC4 B;  1BQN A;  1FCA A;  1NME B;  4KSE B;  1JLC A;  2D3U A;  3DHX A;  4Q2L A;  3W9H A;  5KFK A;  3VR1 A;  2ZHA A;  1SJ4 P;  2NUH A;  2OPQ A;  4F2S A;  4TYB A;  4PQA A;  4KHP J;  1WHV A;  2BNW A;  1FDN A;  2HQG A;  2J7W A;  2RRN A;  2Z56 B;  5IC6 B;  3WZ0 A;  2M52 A;  4DL6 A;  1T03 A;  2KRR A;  3ZNU A;  1XNQ F;  2L9D A;  2W9A A;  1RAC B;  2LVW A;  5DDO C;  4ID5 B;  5ETL A;  3TX8 A;  3VQT A;  3AA9 A;  3IM9 A;  1A9N B;  4FVM A;  5DDP C;  3DRP A;  5GMK a;  2ZBQ A;  4KT0 C;  5CYM A;  4YR2 A;  1O0P A;  2V2V A;  1S72 S;  1YJ9 S;  1LXN A;  3TNV A;  1TVR A;  3Q8S B;  4JV1 A;  2VDH A;  4O3Q A;  3M8Y A;  1RT6 B;  4X64 F;  5HQL A;  4AAI A;  2J0Q D;  2V4J A;  1Q5V A;  1RP5 A;  3N5F A;  1TUW A;  1BAZ A;  3BQ2 A;  1QUV A;  2KH9 A;  1VQ8 S;  2MJN A;  3I5A A;  5KT4 A;  4OYP A;  5DGB A;  5C42 B;  1IKY B;  4OYX A;  3H0P A;  4CLY A;  2CAD A;  4DV0 F;  4MK8 A;  2M5Y A;  3S6E A;  9RUB A;  4DUY F;  3R5A A;  3S7R A;  3GIM A;  4I7F B;  1AYE A;  1NPR A;  4LRA A;  1X5O A;  3OR1 A;  4JBC A;  3IRX B;  5D6G A;  3A8J A;  2VQF F;  3QGG A;  2HWT A;  5D4O A;  2QG9 B;  4LRC A;  3I55 S;  4DV4 J;  5HP1 B;  3JB9 k;  2IRY A;  1ZPW X;  3EDR B;  3HP6 A;  1YJU A;  5E41 A;  1U1Q A;  2DGT A;  1NHU A;  3GFZ A;  2F3J A;  1ZPV A;  3PTW A;  3J7Z 5;  3JQK A;  2ALZ A;  5GAE I;  1NKC A;  2ZBI A;  4Q5V A;  1EQ0 A;  2GS8 A;  4UZB A;  4OYB A;  3UCZ P;  1T9Y A;  4WII A;  4ES3 A;  4OHZ A;  2K6L A;  1YJW S;  1W7W A;  4A46 A;  4MTP A;  3HJV A;  2MEW A;  3UDL A;  4PXE A;  2NR0 A;  4E0D A;  2W1B A;  4OI6 A;  4F7V A;  3LAL A;  4DWI A;  1GXL A;  1JLE A;  1N0U A;  1RT3 A;  2LA4 A;  3TEH B;  1UZD A;  2U1A A;  2WON A;  2HS0 A;  3H98 A;  4WFA Q;  3M8R A;  3KHG A;  3OL9 A;  2DO0 A;  2PSZ A;  5KG6 A;  3AOC A;  4OZ0 A;  3ZZ0 A;  2B4V A;  4CNY A;  4LFC J;  4Q8F A;  3ILL A;  2DNR A;  4NXN F;  4B3O A;  2OEM A;  1IJF B;  1AT1 B;  4XDC A;  2ZZM A;  3C6T B;  4B3S J;  3IMQ J;  1NSP A;  4IYQ A;  5KFI A;  1RA6 A;  3MUM P;  2QMX A;  1GMW D;  3MGJ A;  5KFY A;  3G6Y A;  2R9L A;  4USU A;  2CPY A;  3GLJ A;  1JXE A;  2AMC B;  4NEZ A;  4KV8 A;  4ILL A;  3W8G A;  3ILJ A;  4LIW A;  1KD1 T;  3OXG A;  2Z8Q A;  1X5S A;  3FT7 A;  4IH7 A;  4DEZ A;  3UD4 P;  1NK8 A;  5LSO A;  2BR0 A;  2Z2Z A;  1B7Y B;  2CVE A;  1RUS A;  2HRT A;  3IBC B;  4MYU A;  3BN7 A;  3RBZ A;  1H74 A;  2ILZ A;  3HM9 A;  6FD1 A;  1KVI A;  5CA5 A;  2M4M A;  2EVZ A;  2RNE A;  1E6Y A;  2K29 A;  1Z4U A;  3C14 B;  2FC9 A;  4DX7 A;  5AJ3 J;  2FJB B;  4A8K A;  1Q8B A;  3VEA A;  2JZ5 A;  4MIW A;  4C8Y A;  1NH7 A;  2QYG A;  4OL8 A;  1LWF A;  1CC8 A;  4OZ1 A;  2CJK A;  2ZE2 A;  1V3Z A;  1FRM A;  4BDP A;  2MY7 A;  1FI4 A;  1U1R A;  4GKJ J;  3MEE A;  2DHA A;  3N28 A;  3OTC A;  4K59 A;  3FBC A;  1JJ2 R;  1DAX A;  2KKE A;  2QZ8 A;  4LF5 F;  4LF4 J;  5KFG A;  3IA0 A;  2ZHB A;  2LDI A;  1RAD B;  2JFK A;  1DFD A;  4RKU C;  2EK1 A;  2W9C A;  3DRP B;  5G0R B;  3MMA B;  3ISZ A;  1LEO A;  2R3V A;  3MEE B;  4ZHR B;  1BGX T;  2G9O A;  1KLN A;  1KOO A;  1FKO A;  2GO9 A;  5I42 A;  1DHM A;  3TA2 A;  4QYZ J;  4TY8 A;  5F8L A;  4ECY A;  2J6T A;  3CO0 P;  5HBM A;  3CCL S;  5KFD A;  1NB7 A;  4O3R A;  1UVN A;  4TU7 A;  2YWF A;  4H4M A;  1S6P A;  1J5O A;  1S77 D;  1ITP A;  5KG3 A;  2AIR B;  3HSD A;  5KFU A;  2Q2K A;  1X5T A;  3E01 A;  1H38 A;  2IBO A;  4JI5 F;  3SSS A;  2DR8 A;  2E7V A;  3NGS A;  2MDA A;  4YME A;  3SIP B;  3OR2 A;  4OZL A;  4P7V A;  4JI6 F;  3CCV S;  5L1L A;  1M5P C;  3U02 A;  3ETO A;  2XMV A;  3MCM A;  1KQK A;  4CLU A;  1SXL A;  2VFS A;  4M5M A;  1WWH A;  3RBE A;  2BW7 A;  1RT7 A;  4RW6 B;  3VV2 B;  2QN6 B;  4RLE A;  1RK8 A;  4CO5 A;  1CSJ A;  4N41 A;  3EUN A;  1S9G A;  2FJE B;  4ZP8 A;  3CD6 S;  4MKB A;  2DGX A;  4CTA A;  2ZH6 A;  5DM7 Q;  1U45 A;  2FIU A;  3P6Y C;  5A8K A;  1K1Q A;  1YRX A;  3C46 A;  1JLF B;  3G82 A;  3SCJ E;  3KLE B;  4LRE A;  2EG2 A;  1UVM A;  3HHL B;  2Z2M A;  4C3K A;  3PX4 A;  1NLK L;  2OPP A;  1S9E B;  2OEL A;  2Y9H A;  1SQF A;  2VG6 A;  3JQJ A;  3JXO A;  3KLF A;  2NPF A;  1QVF R;  1TQL A;  2LCW A;  2Z4P A;  4ANE A;  5IT9 Y;  1NEE A;  5BR8 F;  2JEG A;  2BNZ A;  4RNH A;  5SZT A;  3KK3 A;  2R8J A;  4ITS A;  3NWG A;  1VRT A;  4OZJ A;  2FLP A;  2DNY A;  1L3T A;  3GIJ A;  4ZCK A;  2HBY B;  2G1H A;  2LXU A;  4YY3 J;  2AW0 A;  1KVK A;  2JHE A;  3CDB A;  3KG0 A;  3RUB L;  2GFF A;  2CNO B;  2K1O A;  2C1E B;  2HQC A;  1BY9 A;  4ECQ A;  3L3C A;  2AWZ A;  2AZ3 A;  5HQ8 A;  4CRJ A;  3QT7 A;  4U95 A;  2WRM A;  3GYG A;  3TAQ A;  2AHO B;  3IRX A;  2VBW A;  4X62 J;  5A2Q Y;  3Q8V A;  1H2V Z;  3TZY A;  5GAH I;  4ECU A;  2QMW A;  2RHQ B;  4OV1 A;  1TL1 A;  4IG3 A;  3ILO A;  4JOU A;  2F9D A;  2QL7 B;  4XK8 C;  3M30 A;  3PJX A;  4OMF G;  4WCE Q;  3G4S S;  4ZPA A;  1T05 A;  4LRV A;  3RGI A;  2R7R A;  2YNH B;  1S7H A;  2HWH A;  1D9A A;  3SCL E;  1MU2 B;  4H4O A;  5J2P A;  3QFH A;  2AD9 A;  1DZ5 A;  4I68 A;  1FKP B;  1WC1 A;  3MPW A;  1RTI A;  1CC7 A;  4C8M A;  2BJ3 A;  1S1T A;  3Q8Q B;  4K4T A;  3KJV B;  4JI4 F;  2VOO A;  1QTM A;  2V67 A;  2A1B A;  2N4D A;  1CUL A;  4LSL A;  2DT9 A;  1RHQ B;  2ZWO A;  4LVO P;  2PMW A;  3AQO A;  4KHR A;  3BO3 A;  5B0B A;  3DXB A;  5THW A;  3CD7 A;  2XQC A;  1N5V A;  1V5V A;  5D15 A;  2HGN A;  5H9F K;  4ZVQ B;  4LSN B;  4NLR A;  4FBT A;  4KGK A;  4OYZ A;  2BRK A;  1WEZ A;  1RWW B;  3WBZ A;  1WC5 A;  2HFS A;  2QC3 A;  5J2N B;  2YWK A;  3PXG a;  1TEL A;  2VG7 B;  3KHH A;  1IR2 A;  2CPF A;  2H1Y A;  2HVD A;  3R6G B;  3MCO A;  2D9P A;  3P96 A;  3RW6 A;  1R8A A;  1I94 F;  3TI0 A;  2ZOF A;  2XMW A;  4BHQ A;  1S6Q A;  3DU5 A;  2CJY B;  2BUN A;  2RBF A;  1C1C B;  1W2I A;  2KB2 A;  2ZKT A;  1P8G A;  3GYN A;  3M6W A;  1SC1 B;  3C8Y A;  1SH2 A;  2XWY A;  2MJU A;  1MMD A;  4MJK A;  3QT5 A;  4NML A;  4A8F A;  1OY8 A;  4FP9 A;  9ATC B;  2GHP A;  1FRL A;  2GA7 A;  4DV3 J;  3GFH A;  1B0P A;  4FYY B;  3NBP A;  2IA0 A;  1UWB B;  2YXL A;  4M94 A;  2GAG C;  3TQE A;  3MPV A;  4KH1 B;  5BXI A;  2UVR A;  2LEC A;  1S10 A;  2HBZ B;  2MQM A;  5J2Q A;  2HRU A;  2ABY A;  4USM A;  1VR6 A;  5KAK A;  3CF5 Q;  1WEY A;  1F60 B;  2BE7 D;  4DR5 F;  3FSX A;  5HVF A;  2KVQ E;  4J7C A;  4F4A A;  4CIO A;  3OL7 A;  4DUZ J;  3GWC A;  1TL1 B;  2CQ1 A;  4IG3 B;  3QZ7 A;  3HFZ B;  5KFA A;  2V8V A;  2VV5 A;  1X4A A;  1NPK A;  3QNW B;  3VVU A;  4KC5 A;  3V5R A;  1FK9 A;  3DRR B;  2ADC A;  2HAI A;  3J7A N;  3NNA A;  1FJG F;  4USJ C;  3PW7 A;  4P2F A;  3LAN A;  1E6V B;  2VC0 A;  5IFM A;  1F9F A;  5JUM A;  3CJS A;  3D7S B;  5ETM A;  1B70 B;  5A2Q U;  3J7A 1;  1XJW B;  2KM8 C;  2OTL S;  4YUD A;  1UA0 A;  1VQO S;  1Y00 A;  2LMI A;  1X0P A;  1WAC A;  4JI3 J;  2BEF A;  2DNK A;  3RBD A;  4F3Q A;  1HHT P;  3A4T A;  1M5K C;  1RT1 A;  1REV B;  1FXD A;  5U47 A;  2RS2 A;  4WTO B;  4DR1 F;  3KDO A;  1UZH A;  1XMQ F;  1N5Y B;  1LW0 B;  5K8O A;  4TNO A;  1JK9 B;  2FPH X;  4YHH F;  2HW3 A;  3OVB A;  2NXN A;  1SJQ A;  3E2E A;  1U25 A;  2EFQ A;  5ETT A;  3HHL C;  1RTH A;  2IJN A;  1Q16 B;  3SFU A;  4BWM A;  3UD3 P;  2Y0S D;  3EVW A;  1F5C A;  3KLE A;  1XMO F;  5HN0 A;  3H40 A;  1KNZ A;  3M2U A;  4GO5 X;  1RAJ A;  4IFY B;  3TA1 A;  3K2Y A;  3W65 A;  2MKC A;  1N88 A;  3IR5 B;  2H48 B;  2XMU A;  3QIP A;  5T7L A;  2RUS A;  2KHD A;  4MH8 A;  3W63 A;  4F0K A;  4Y6I A;  3AD8 C;  2QLF B;  2WSC C;  2KEL A;  7FDR A;  1V6H A;  1SKU B;  2JLF A;  4Y0F A;  4HVZ A;  4YB1 P;  1R43 A;  3JTP A;  4RW4 B;  2Y0B B;  2ZNZ A;  3AOA A;  2Z57 B;  3RB4 A;  2R8G A;  3W66 A;  3OR2 B;  5HMZ A;  4KFB B;  1X0F A;  3I0S A;  1A0O B;  3GTY X;  4LF4 F;  2ZH4 A;  1EZZ B;  5E3R A;  1VBY A;  5I3Q A;  2B0G A;  1QTN B;  1HQE A;  4J91 A;  3SDE B;  3W64 A;  1X4H A;  3R5J B;  4QR2 A;  3KNA A;  3MM5 B;  3PR4 A;  1LWE B;  2RF2 A;  2UXC F;  4DI6 A;  4ZKA A;  2EK6 A;  5I42 B;  1CJU B;  4PG4 A;  1HBM A;  1ZS6 A;  3D2W A;  1JJC B;  2B4P A;  3E3X A;  4DF4 A;  3PW0 A;  2AYG A;  2IFX A;  3MED B;  4ZPC A;  2VBY A;  3MR6 A;  4IO1 A;  3WQP A;  1IR1 A;  4LF2 A;  3W8P A;  2ACM A;  1JNR B;  3OT9 A;  2CQH A;  4RW9 A;  4I6W A;  4NLO A;  3V6H A;  4ZCL A;  3RB0 A;  1NK5 A;  4Q43 A;  1IKV A;  2E1M C;  4CZC A;  1NK4 A;  2ZBC A;  4PWD A;  3DRY A;  2AEJ A;  3D66 A;  1VQY A;  5LXR A;  2YKO A;  3OL8 A;  3MFI A;  1HNX F;  2HEK A;  2CJA A;  2ZUG A;  1JMT A;  1GQE A;  4HI2 A;  5AXM A;  2C2D A;  1NJW A;  2AJ2 A;  2X3G A;  4JI2 J;  1PBA A;  2IJF A;  4F36 A;  1R0A B;  1C1B A;  2IVY A;  3P5T L;  1RBA A;  2CZ9 A;  2LEP A;  3CJ4 A;  2Z58 B;  4ZJQ A;  2HVH A;  4X62 F;  2FZK B;  3IR7 B;  1TMM A;  2YKP A;  3V81 B;  1N8R T;  2YNI B;  2VQE F;  4LRD A;  4DR6 J;  1NUE A;  3FCV A;  3T5J A;  1X7V A;  4ID8 A;  1S12 A;  1ULR A;  4HT7 A;  2HS3 A;  1RHJ B;  2QO3 A;  2RDI A;  2JXH A;  1OY6 A;  4R8U B;  5DM6 Q;  2C2R A;  4TN2 A;  1CQM A;  1U4B A;  4NXN J;  3G87 A;  1XR7 A;  4ERD A;  3MTK A;  1HYS B;  4DPX A;  2XM3 A;  1TL3 B;  3TEG A;  2MGZ A;  2UV8 A;  3KK1 A;  1CS4 B;  3DLB A;  4DSK A;  4WU3 A;  2FC8 A;  3L4B C;  4CO0 A;  3K5P A;  5A0Y A;  2J6U A;  2XSJ A;  2RS8 A;  4OIX A;  2BZ2 A;  1UJ6 A;  3WIV A;  4PCQ A;  2XY5 A;  3PYF A;  2RVJ A;  4IOC Q;  2E1A A;  2G13 A;  4R0J A;  4TLQ A;  2UUC J;  3CDW A;  4M63 A;  4R8U A;  2WON B;  4RJV A;  5BR8 J;  3Q8P B;  2MZQ A;  4FBU A;  1JKH A;  4UOC A;  1D9D A;  1DUR A;  4WIQ A;  2R7O A;  4DQR A;  4G1P A;  1CJV A;  1RWK B;  1VLY A;  2H65 B;  2MKJ A;  2DGU A;  3CCT A;  5E3P A;  5F0U A;  1S9G B;  2QX0 A;  4NPO A;  4UQG A;  4Q0B A;  4X4V A;  2RRB A;  3VAG A;  2V8P A;  3HHD A;  4QIV A;  1N5S A;  2DIV A;  5DLG A;  4O44 A;  4DOZ A;  1WTF A;  2N3L A;  2Q43 A;  2R2S A;  4ZIT A;  2CA9 A;  3N6L A;  4AL7 A;  4FS2 A;  2CG8 A;  2G1D A;  3LW5 C;  3MEC A;  3FRY A;  4ZPB A;  3UDC A;  4C97 A;  1YSJ A;  2W2O P;  2K2P A;  5LMN F;  2UXB J;  3R5B A;  3MM7 A;  4LRB A;  4WFX A;  4USV A;  2OFH X;  1L5U A;  4LR9 A;  3FDS A;  2A0F B;  3JTO A;  1QSS A;  1HHS A;  1R8B A;  2VKZ G;  2UUT A;  1AXQ A;  1C0U A;  1U49 A;  1J5O B;  3VQS A;  3DKD A;  4ICL A;  3H20 A;  1FEE A;  3T6J A;  1HNV B;  2NPI A;  3CDU A;  4QIE A;  1HQU B;  2P6T A;  3JSY A;  2W9B A;  2DTJ A;  3GMG A;  2ZIT A;  3MED A;  5EWF A;  4YFU A;  2CXE A;  4A8S A;  2UXD F;  5H1S V;  3DMJ B;  3KMQ A;  1N5Q A;  2ZH2 A;  1HNI B;  4LUB A;  4EO8 A;  1N36 F;  2MKY A;  1RT6 A;  3HSG A;  2H3E B;  1TVR B;  4ECV A;  1S59 A;  3RR8 A;  3U1M A;  3MM9 B;  5CH7 B;  3UVJ A;  1C0U B;  1I94 J;  1WKL A;  1VI7 A;  2GML A;  4I69 A;  5B0E A;  2ASY A;  4Z37 A;  2CUY A;  3AOD A;  3OSN A;  4NEY A;  3EGW B;  2E7X A;  4P72 A;  4N47 A;  1M0S A;  2AEM A;  3M1V A;  4UOG A;  1EB0 A;  2ROP A;  1YVF A;  1B3T A;  1N4L A;  3K59 A;  2VA2 A;  1WD6 A;  4A4J A;  3AB4 B;  2B3T B;  2V6A A;  3F41 A;  1HNZ F;  1U26 A;  2C2N A;  3OLB A;  3QGP A;  1PKU A;  3VAF A;  2KFN A;  3QLH A;  5I4M A;  3K0J A;  3DGP B;  2KM8 B;  2R2R A;  1LWC B;  2FD2 A;  1BDV A;  4F4Z A;  1XMQ J;  2WOM B;  1HI0 P;  3M2U B;  3FGV A;  3DDI A;  4PWD B;  2CQG A;  3MM6 B;  2CQ0 A;  4MKA A;  4OI3 A;  1W26 A;  2G2O A;  3H4D A;  3FJ2 A;  3GXQ A;  1KC8 T;  1LQ9 A;  2F5G A;  1UL3 A;  3BB5 A;  2JDJ A;  3MR7 A;  2EBG A;  3R7B B;  4OHW A;  5ETR A;  5DQH A;  4DR2 J;  3ET6 A;  4KPY A;  4LVN P;  4I2Q A;  1XN9 A;  1C1B B;  3C6T A;  2IVF B;  4FXW A;  2BAB A;  1NZA A;  2BM1 A;  2B6A B;  3CB4 A;  3H59 A;  3PRB A;  4OI2 A;  1VRQ C;  4OJ3 A;  2QFI A;  3M4X A;  1TL4 A;  1VIX A;  1HYS A;  2HFO A;  2QE5 A;  4B3T F;  3NMA A;  5KG5 A;  2B4U A;  1S49 A;  1AFJ A;  1UJ5 A;  2DNH A;  3CIZ A;  4C3M A;  2ASL A;  3IAM 9;  4DUZ F;  2HUR A;  2L41 A;  1QAY A;  4ECT A;  1KQG B;  2DH9 A;  1IKX B;  1SUQ A;  3CJT A;  1MW7 A;  3PHT A;  2EW9 A;  1TZ0 A;  3L7P A;  2Q6B A;  3QRQ A;  3J81 j;  2AV5 A;  4OX8 A;  4Y00 A;  1U47 A;  3E51 A;  2W7O A;  5KFZ A;  5C25 B;  4UTG A;  5J1E A;  2BM0 A;  5HO4 A;  4KKO B;  1F1B B;  4LF9 F;  4ED2 A;  2IJR A;  2EEY A;  4CM2 A;  4DX8 H;  2O01 C;  1DBD A;  3CO9 A;  2VU5 A;  1QVG R;  1IKV B;  3CNQ P;  1B0T A;  3DI6 B;  5E3A A;  2GVD B;  3VGS A;  4PQU A;  2VQF J;  3LGH A;  3FEZ A;  3HKW A;  5EN1 A;  3CJ8 A;  1SL1 A;  3PHE A;  3BQ0 A;  2DGV A;  1Z2Z A;  1KR4 A;  3POT B;  1RQ0 A;  2LQJ A;  4J90 A;  1I51 B;  1YRU A;  1IKY A;  2PA8 D;  2RKI B;  4ZPT R;  5BJR A;  2UUA J;  5EUH A;  2D1C A;  3IGN A;  1UW4 A;  2ACY A;  2DIS A;  4RO0 A;  4ZVH A;  3M8W A;  2ZJR Q;  2BQ3 A;  4EO6 A;  1VQ5 S;  4QW9 A;  2LA6 A;  2IBK A;  3FBE A;  1NK9 A;  4NLY A;  4YB5 A;  5I3P A;  2CNL B;  4K4Y A;  2MQQ A;  4AQY J;  2NZ4 A;  1QAI A;  3NGU A;  5CCL A;  5EHH A;  4USH A;  4NLU A;  1YBA A;  4LF7 J;  3KDN A;  5KT3 A;  3N9U C;  5GAG U;  4YS2 A;  3IS9 B;  3QJL A;  3MD1 A;  3A8I A;  3AH6 A;  1EQM A;  1FNO A;  1Q1K A;  3LGN A;  3SEO A;  1LW0 A;  3OFE A;  4RW4 A;  4CLT A;  3P8B B;  2V4Q A;  1B4S A;  1H73 A;  1SQE A;  4DR2 F;  3H5X A;  4OJH A;  2O5D A;  1YRT A;  4DSJ A;  2MMY A;  1TUG B;  3LO3 A;  3EIC A;  4R5P B;  3KJV A;  3MAQ A;  2XMK A;  3RAX A;  2FY1 A;  2QL9 B;  5KFT A;  5A6P A;  4AD6 A;  3VHQ A;  2N3O A;  3UDE A;  1DTQ A;  3TR5 A;  3KK2 B;  2BA3 A;  3FMT A;  1XEZ A;  2ZJQ Q;  4FS1 A;  5A8R A;  2FLO A;  2K1R A;  5G4D A;  1NZ8 A;  8RUC A;  5KFX A;  1EJ7 L;  1FEH A;  5K9F A;  1T05 B;  1RTD A;  3JAM Y;  1UVL A;  4WZQ A;  2XEX A;  2CPI A;  3DNC A;  3K5L A;  4FF1 A;  2XUL A;  3ELH A;  2JBV A;  1R27 B;  1ZAX A;  3FVY A;  2W8K A;  3R9L A;  1TU0 B;  1OO0 B;  3JSM A;  3EWG A;  4YHH J;  1Y11 A;  4N5S A;  4DL5 A;  3TQ1 A;  1S0M A;  1U2C A;  3MM8 A;  3GFY A;  4KQZ A;  2B7C B;  3CJ5 A;  2DXE A;  4OX7 A;  4WJB A;  4CLS A;  4V19 X;  2BX6 A;  4K0K F;  2D41 A;  3J7Y U;  2IYI A;  1Q4R A;  5FII A;  3O1L A;  3AJ1 A;  2F8H A;  2IMW P;  1RWV B;  5K20 B;  1NKE A;  2FDN A;  4DL0 C;  1PGZ A;  1N36 J;  3QRR A;  4NCG B;  3R6L B;  2DNO A;  4ZLL A;  4GMK A;  3KKF A;  4PEO A;  2XG8 A;  3EGN A;  1EET B;  4NL5 A;  2VC1 A;  3G6V A;  4DCP B;  5F9L A;  1X9M A;  2VOD A;  1YJ7 A;  1MN9 A;  1T9U A;  1B0V A;  1YK9 A;  2WBM A;  1SKW A;  3NOC A;  2R7V A;  2YVS A;  4HT5 A;  1NH8 A;  4JI0 F;  1QSY A;  3EZU A;  1CEZ A;  4YOE A;  3V6D B;  1S6Q B;  4A8Q A;  2K06 A;  2DR9 A;  1P9Y A;  1X4F A;  2VG6 B;  4LBP A;  4M5D B;  2DRD A;  1LFW A;  4CLL A;  4DCJ B;  1X93 A;  4ETX A;  2BBE A;  4NXM J;  4KB7 A;  5K5M A;  3TZX A;  4QWE A;  2BJ1 A;  1RAG B;  1YJV A;  3OBI A;  4R0E A;  1IBK J;  4WF9 Q;  1BC6 A;  1TKZ A;  4MIA A;  2VD3 A;  4AE5 A;  1L3U A;  2DRB A;  4YQW A;  4OYI A;  5IV4 A;  2FHK A;  3FQL A;  3HFK A;  3DLG B;  2QV6 A;  4XDD A;  1NND A;  4DG1 A;  3ADA C;  4N8O A;  3TP2 A;  1WC3 A;  2D7S A;  2RJZ A;  5T7L B;  3QAE A;  3R8Y A;  3RRK A;  5L1J A;  5KG1 A;  1J5E F;  3C66 A;  4I2P B;  1XTZ A;  1MWZ A;  3GJQ B;  4IFY A;  3PO4 A;  4QCL A;  2PC6 A;  4H4K A;  4Y2I A;  2HQD A;  2HVZ A;  3GG0 A;  4P73 A;  3QOQ A;  3DI6 A;  4EWT A;  2HFN A;  4DV6 F;  2J6S A;  5DO2 A;  3OJS A;  4YDD B;  1FNM A;  2H54 B;  4H4M B;  2H9Z A;  1OQ6 A;  2RSQ A;  5JXS A;  2N7C A;  1U1L A;  3CJ0 A;  1DRZ A;  1MLA A;  3AJ2 A;  4WK3 A;  3A3O B;  4P7T A;  4ZCI A;  4TY8 B;  4RR5 A;  4M5I A;  4J9O A;  2Y8Y A;  1BMQ B;  2I1R A;  3MCN A;  4WP3 A;  4Y28 C;  2KG0 A;  2KVI A;  4HLB A;  2GJI A;  3I87 A;  5A6W A;  1WI8 A;  3QRP A;  2GMH A;  5B0G A;  5KTQ A;  3T5H A;  4C98 A;  2BJD A;  1WJ9 A;  2DD8 S;  1FKP A;  2DGQ A;  4MIB A;  4HDG A;  2PFD A;  4QR0 A;  4PAB A;  3PYE A;  2CQ4 A;  2X7I A;  4ZVO B;  4TKT A;  7FD1 A;  5E3Q A;  4EUV A;  2XC9 A;  3G8S A;  2KOE A;  2XLI A;  2HZV A;  2WVC A;  4MAK A;  1S9F A;  2JXI A;  1KFS A;  3WX8 A;  4IFV B;  3JTN A;  4Q7A A;  2DPI A;  3AFG A;  2GQQ A;  4LF8 F;  1DQ8 A;  1VRT B;  4QIF A;  2JC0 A;  3HZG A;  2FHO B;  4QPX A;  3L9Z A;  2HK2 A;  4M5J A;  3C14 A;  1T9X A;  3RAM A;  3V2U C;  2MZT A;  2VHG A;  3P5B P;  3KLG B;  2GNK A;  3K5N A;  3Q86 A;  4HAC A;  4DV1 J;  3ZFV A;  2U2F A;  3EE3 A;  5E5N A;  2MZS A;  2RRA A;  4DPO A;  8AT1 B;  2HHS A;  1VHF A;  4YB6 A;  4C8L A;  5J1N A;  1HNZ J;  2CDQ A;  2E1R A;  4ZVG A;  2L48 A;  1FRK A;  4QR1 A;  1R8C A;  4KV8 B;  4NWB A;  2OEJ A;  2XGQ A;  2KHC A;  3LPY A;  4K7Q A;  3QLH B;  2R2T A;  1S0N A;  3BGF A;  2IHR 1;  3GII A;  4D3G A;  4JI5 J;  1KTV A;  3NO7 A;  2G0C A;  3MI7 X;  4A8X A;  3T1H J;  3C2P A;  4JI6 J;  5L46 A;  1EP4 B;  1NJI T;  3WC0 A;  2KT3 A;  5KG2 A;  3AB2 B;  2M9K A;  1T94 A;  4ILM A;  4DSI A;  1NHK L;  1S9E A;  2OD6 A;  1F9H A;  5KFE A;  2ALY B;  5IM0 B;  5L1I A;  1FES A;  1F0X A;  1NSK L;  1NSQ A;  2Z2L A;  1KFD A;  3G82 B;  4ZK7 M;  3CIM A;  3UVJ B;  5HVH A;  1NJZ A;  2PD1 A;  2KKH A;  1VQM S;  1VFJ A;  3O8W A;  5HLF B;  2VUG A;  2XZD B;  2BE9 B;  1FWP A;  1HNI A;  1XWL A;  3K7R A;  2CKW A;  1N34 J;  2XS2 A;  3NP5 A;  3GON A;  4DQI A;  5IT9 U;  3I82 A;  4O3N A;  3MAA A;  3QT8 A;  5L8R C;  3M9O B;  2QL5 B;  1S1T B;  5CZX A;  2W9B B;  1MRO B;  3FSI A;  4DV7 F;  2FJW A;  2KTQ A;  3QBC A;  3RB6 A;  1VQ4 S;  2E1P A;  1FXL A;  1R0B G;  2R2U A;  3IWX A;  3UDV A;  1HPZ B;  2A10 A;  2LU2 A;  2RDD A;  3D9B A;  3PCO B;  4MMO A;  4I0W A;  1GX6 A;  3EDQ B;  2XLJ A;  2UXB F;  2EI5 A;  4X64 J;  2YTC A;  3MMC A;  3NS7 B;  3OTO J;  1S4F A;  1HLW A;  2MZR A;  1QE1 A;  2QMU B;  1H0H B;  4WXW A;  2MXY A;  3UPF A;  4MKV A;  1QAJ A;  1RT2 B;  2V63 A;  3PX0 A;  1NJX A;  2DH8 A;  5LSR A;  4RU2 A;  2R7U A;  3HUL A;  3O6Q A;  4X4U A;  3EGV A;  1Y5I B;  1URN A;  2OI2 A;  3JQM A;  4ZCM A;  1N54 B;  2MKH A;  4CLF A;  4I1T A;  4DR3 J;  4JYA J;  3FCW A;  2NXE A;  4CNZ A;  1JKH B;  5CYM B;  1XBW A;  3MAA B;  2H5J B;  2RHS B;  4A8O A;  3LUY A;  4BCA A;  3JSR A;  3H87 C;  1YHQ S;  1YIJ S;  1JWW A;  1PIL A;  5HLF A;  1LWF B;  2CPJ A;  2VB6 A;  3D1O A;  4IG0 A;  2MB0 B;  1UP1 A;  1RWX B;  2KDO A;  1OS5 A;  3LF0 A;  3MTJ A;  1HD1 A;  1RTJ B;  4FNI A;  5JMN A;  1XK8 A;  2VOP A;  3BGL A;  2FJD B;  2FVR A;  2Q3P A;  4UUX A;  1TKT B;  3QO9 A;  2HQF A;  3M2V B;  4HTI A;  4PR6 A;  4DN9 A;  4ZVU B;  2I9S A;  4IDK A;  4R25 A;  3P45 B;  1EIY B;  1VCT A;  1QUP A;  1GX5 A;  1URR A;  2KI2 A;  2BJ7 A;  3C16 B;  1GTH A;  3H5S A;  3GV5 B;  2E9R X;  1AA1 B;  2C2Z B;  2WAQ D;  3MWB A;  1JLB B;  2MQ8 A;  3TRG A;  3I5C A;  1RHM B;  4J9M A;  3LPE A;  3ZNJ 1;  2RQC A;  4ES2 A;  2HVI A;  3BR8 A;  3BN4 A;  2WB4 A;  3TAM B;  3OUY B;  4DV5 F;  2C2M B;  4K0K J;  2ZWP A;  3L7U A;  3EXC X;  2C2E A;  2HMI A;  3PM9 A;  4PAA A;  2WK4 A;  1GMW A;  4NX9 A;  1MWQ A;  3KFW X;  3QZ8 A;  4DL4 A;  4G1Q A;  4J9R A;  1BWV A;  5FDL A;  5LMU F;  1NHV A;  4P52 A;  1PO6 A;  4KGM A;  5CYQ A;  1QY7 A;  3PY8 A;  4W98 A;  3QSY B;  4DL7 A;  1VGY A;  1AUD A;  4F8R A;  1QDU B;  4IG0 B;  4CYU B;  4X2B A;  2W7A A;  2EFV A;  1DTT A;  2DGS A;  1GTE A;  2ZOM A;  4RNO A;  3DLE B;  2R8K A;  3HVR A;  1FXR A;  2UXC J;  2HKE A;  1O5J A;  2DHS A;  2V69 A;  5G0R A;  4OZ5 A;  4K5R A;  5GAG I;  2ZH9 A;  4WZM A;  2OFG X;  3UN3 A;  2AT1 B;  3SCK E;  3LAK A;  1SL2 A;  1DQA A;  3KJQ B;  2I5J B;  3AY0 A;  4IR1 A;  2G2Z A;  2XO6 A;  1KP6 A;  2CJB A;  1S79 A;  2EFO A;  2M88 A;  3U1L A;  1ZET A;  4JI1 J;  1RAI B;  3D28 A;  3NNE A;  5F41 A;  4KRW A;  2VZ9 A;  2E5L J;  1MMN A;  1FJC A;  2JRS A;  1IBM J;  3MEC B;  1HNX J;  3EYZ A;  1ZM3 A;  2HLT A;  1FFS B;  2POK A;  3DOL A;  3FC9 A;  5IT4 A;  1T03 B;  4X4P A;  1L3K A;  4ELT A;  4L75 A;  1FWL A;  2KO1 A;  3LAM A;  3NAH A;  2RB7 A;  1HPZ A;  2KU7 A;  4NXM F;  4CLK A;  4WFZ A;  3Q83 A;  2DEJ A;  2GMJ A;  2EKN A;  3I32 A;  3HF5 A;  1JNZ B;  2YX1 A;  2FZG B;  4LBH A;  2W7P A;  3OD2 A;  4LSZ B;  3VWS A;  4USW A;  1HBN B;  4DG1 B;  1RWM B;  3A13 A;  3MDF A;  4GVB A;  4ZPV R;  1RTH B;  4P2S A;  2PO4 A;  1HIY A;  3CCQ S;  2AZ1 A;  2Q66 A;  4DQP A;  2MHE A;  3B4M A;  2QRR A;  2F1F A;  2XMM A;  3KLH B;  3MR5 A;  4C8O A;  2VIH A;  2B8P A;  1FRI A;  3BPD A;  1X9S A;  1OWX A;  2VAS A;  3FK4 A;  4K8R A;  1Y0H A;  2BE2 B;  2KL8 A;  3SYZ A;  4U67 Q;  1U1N A;  1NDL A;  4EEY A;  4KIA A;  4M5D A;  3GP9 A;  4QWD A;  1NDP A;  3W9I A;  3M32 B;  1EX8 A;  1BQN B;  1OY9 A;  4QWC A;  2BOP A;  3G96 A;  2E5J A;  2XYG B;  2UUC F;  4ZIV A;  1SJ3 P;  1HQ2 A;  4C8K A;  4WP8 A;  2GGP A;  1QSL A;  4YEA A;  3EPG A;  1IQT A;  5L1K A;  4URQ U;  2OPR B;  3OXL A;  3ZZP A;  1FJG J;  1Q8I A;  1PYT A;  2IIH A;  4KO0 B;  4HL9 A;  1YKW A;  2A6O A;  1EA4 A;  1NB2 A;  3HSZ A;  3BO2 A;  2JVR A;  2IDL A;  4BWJ A;  1H2T Z;  3F0N A;  4LF6 J;  4JI8 F;  2FYX A;  5KG0 A;  2KG1 A;  4DXL A;  5D0H A;  4L74 A;  4HAC B;  2VPX B;  2YH0 A;  2XCA A;  3BBC A;  4WKY A;  2ZOG A;  3G6X A;  4XPC A;  4ECX A;  2HNZ A;  3DDN A;  1SI9 A;  3AT1 B;  1K47 A;  3IG1 A;  1NLA A;  1U02 A;  2CVI A;  2ZM6 F;  2HHT A;  3PKY A;  1RBL A;  2J0X A;  2R8I A;  2ZC3 A;  1U1K A;  2CPX A;  4DR3 F;  5ETN A;  3MUT P;  4JYA F;  5IWA J;  3CMQ A;  4ME7 E;  3TAR A;  2ZVS A;  4RUH A;  1HI1 A;  4FPI A;  1FO1 A;  3G2X A;  3JYT B;  1GXU A;  2AGQ A;  1U1P A;  2HBQ B;  1Q82 T;  4K4U A;  3PJ9 A;  1OJ4 A;  2N4C A;  3K17 A;  2K1R B;  4RW7 A;  4WPA A;  3SCI E;  3X3U A;  2H4W B;  1CJU A;  3FZ2 A;  3U1N A;  2AYM A;  3NKY A;  4C8N A;  3I56 S;  2CG4 A;  2DK2 A;  2VPW B;  1OIA A;  3HSJ A;  4IH5 A;  4ZVF A;  1Q7Y T;  4ZOS A;  4B9L A;  3M8S A;  1CJT B;  1JLQ A;  2J76 E;  2VKR A;  2ZBR A;  5IXU A;  5J2N A;  4F4Y A;  2CPE A;  2XZW A;  4FYX B;  2EKY A;  2PE8 A;  2YKM A;  3UO0 A;  1TK0 A;  2XLK A;  2LDY A;  4UY8 T;  2NYH A;  4RBT A;  2QYC A;  3UCG A;  1CUL B;  4LSL B;  3VZI A;  2JH3 A;  3R5C A;  2OPQ B;  3LWL A;  3MOZ A;  4C3L A;  1QD1 A;  4EYI B;  3BJY A;  5CAB A;  4DQS A;  2D74 B;  1JLA A;  2QLJ B;  3PFE A;  3RTV A;  2BKO A;  2DNZ A;  1ZZN A;  1Q5Y A;  4IQX A;  2HNY A;  1WKK A;  2LXF A;  2MKI A;  1D3W A;  4QPT A;  5J2P B;  4DLG A;  2NQP A;  2YX4 A;  4GRS A;  4OZN A;  4U7C A;  2YNH A;  2CAJ A;  2P9C A;  1IXK A;  1TL7 B;  1Q16 A;  1ELO A;  2EG1 A;  5C2G A;  2B51 A;  2OJ3 A;  1RJJ A;  4Y65 A;  3POT A;  3ZZY A;  1NU4 A;  2J9D E;  2F4V J;  2Y3Y A;  3FNN A;  3HD2 A;  1PYS B;  1RHU B;  2QLX A;  3H2V E;  3OJU A;  4B3M F;  2IAJ B;  1ZAV A;  2P9G A;  3VGT A;  2J7U A;  2MKS A;  2P8I A;  1HWL A;  3BBF A;  3D5M A;  4F50 A;  3ISN C;  1PYO B;  4M8L A;  5C7P A;  4ILR A;  3TUI C;  4Q44 A;  4X4S A;  2ZH7 A;  3R2D J;  2GPE A;  3R7S B;  2HBR B;  2V5H G;  4FKX A;  1FRH A;  1SCJ B;  3V6D A;  4F02 A;  1Q78 A;  2AJ4 A;  1ZA2 B;  4DL3 A;  3DRX A;  4LIR A;  4M95 A;  3MZI A;  1RWP B;  5D78 A;  2XCP A;  3MFH A;  4DV7 J;  4MKY A;  2IVM A;  1F3V A;  2P9E A;  3H2L A;  2FLN A;  4ZVR B;  1DTT B;  2UU9 F;  5AXK A;  1UTA A;  3ZTO A;  3P4U B;  2GGP B;  2BW2 A;  3VAK A;  2W4C A;  1KWM A;  4WU2 A;  2ZH1 A;  1HWJ A;  1YX2 A;  1ZH5 A;  1VQS A;  2VA3 A;  3BV8 A;  1KEK A;  2DHH A;  2JJ4 D;  4X4T A;  4OZ3 A;  4ECW A;  4ZA1 A;  4AXJ A;  1T02 A;  1YWX A;  2I2Y A;  3V6J A;  1GT8 A;  2ZZT A;  1JLG A;  2DH7 A;  2K7J A;  2OPP B;  4J9V A;  1X4D A;  3W1Y C;  1NXI A;  3ZC4 A;  2BE2 A;  1NKB A;  4WYW A;  3UE2 A;  2KZZ A;  1FNX H;  4U8V A;  5ITH A;  3PIO Q;  1FTC A;  1OQ3 A;  2C3P A;  3JSM B;  3MMB A;  3OFG A;  1HD0 A;  3D0I E;  1CPZ A;  2WVB A;  1S1X B;  2HQ3 A;  1RTD B;  4KO0 A;  1TUV A;  3BKT A;  3L7O A;  2JLE A;  1VIS A;  1TFY A;  2JEI A;  4GVB B;  3NNH A;  1ROF A;  4LFC F;  4C9D A;  4CCH A;  2PMH A;  2DGW A;  4HR2 A;  3PJW A;  3B8H A;  3MPY A;  3OLA A;  3GG1 A;  1RWN B;  3I96 A;  4H4K C;  3WX4 A;  2K3K A;  1SV5 B;  3F44 A;  1WF1 A;  1SVD A;  1JLA B;  3M32 A;  2FQQ B;  4M5L A;  3T6B A;  4DMZ A;  5HSP A;  2ZEJ A;  3MAH A;  4EFA C;  4BS2 A;  4F3O A;  3CDE A;  2VFT A;  1TKT A;  1V5I B;  2XYH B;  3QO9 B;  4HHU A;  4LR8 A;  2ASD A;  3PW5 A;  1VQ9 S;  1WG5 A;  3M8P A;  4TYA A;  5KT7 A;  4PG5 A;  5FJ4 A;  3CD5 A;  3H90 A;  2XHW A;  1NK0 A;  3FMB A;  2XNQ A;  2CQ3 A;  3CTR A;  3FEX B;  2E7W A;  3KLI B;  2V2Q A;  3IN5 A;  2EXU A;  2KXF A;  4LMZ A;  1HBO B;  4OZ2 A;  4NA1 A;  1HA1 A;  1MN7 A;  1O8B A;  2HFV A;  3IS9 A;  4U8Y A;  4CLZ A;  1IBL J;  1K8A T;  2MYF A;  1N33 J;  1R3N A;  1YJT A;  2B5J B;  2CNN B;  4MT1 A;  3VAI A;  2M7S A;  1CBK A;  1HBN A;  4LQ9 A;  3GU0 A;  5B0C A;  5J2M A;  2W9C B;  3NGT A;  2JWN A;  5LJ5 Y;  3DM2 B;  4J9Q A;  4ELV A;  3T5K A;  5ETV A;  3ENV A;  1WF0 A;  2NS1 B;  1TKX B;  1WDD A;  4TLR A;  4IUF A;  4G3I A;  5CZV A;  3KJF B;  2CPG A;  4PXC A;  5DZ7 A;  1YZ7 A;  4J9U E;  2HHU A;  3ZTQ A;  3HK2 A;  1JJH A;  2HS4 A;  3T3F A;  1U7L A;  4JV0 A;  3TZZ A;  4PG6 A;  2BAN A;  3QAT A;  3T1Y F;  3IR6 B;  4FYD A;  4YB7 A;  5DZ6 A;  1BDT A;  1K0T A;  2R4F A;  2YKA A;  2K3I A;  4YN3 B;  3ENA A;  5ETS A;  4RNM A;  1H2U X;  2UV8 G;  2M8H A;  4BBY A;  1X5P A;  1Y5L B;  2AP6 A;  3MMC B;  4GVL A;  3ENQ A;  5HAN A;  2A6M A;  1VYA A;  3MEK A;  1XMB A;  1KHV A;  1SC4 B;  4M1K A;  2WBR A;  3DFE A;  4P9S A;  1RCX B;  4HHH A;  2PT0 A;  1PJ5 A;  1RKI A;  4FXE A;  3HLU A;  1EHW A;  1I5O B;  5LM7 E;  4FZV A;  3Q23 A;  3BO4 A;  2FTR A;  1GK8 A;  1S1V B;  2GW8 A;  3GE9 A;  4KKO A;  4X4O A;  2DCU B;  2E5L F;  2HMI B;  1RTZ A;  1YQH A;  1MRO A;  3AA8 A;  1UCN A;  2PEB A;  2IM2 A;  1VJQ A;  4CM0 A;  5AE3 A;  5F8N A;  2EWH A;  1SBR A;  3H7H B;  3HHK A;  4I6A A;  5CQG A;  3A8K A;  2RML A;  2VFU A;  4B3S F;  4Q8E A;  6FDR A;  5GAD U;  3I4H X;  3GR1 A;  4OI4 A;  3GFX A;  3H8Y A;  1HMV B;  3CW2 C;  3QAU A;  1GMU A;  2ZM6 J;  1CJV B;  4QIG A;  2LQ5 A;  5HVG A;  1H7W A;  2CJ9 A;  5C2C A;  2MZ1 A;  3V4I A;  2RQM A;  2VH7 A;  3NGR A;  5DJB A;  1U8S A;  4DPU A;  2J0S D;  2DY1 A;  2W2Q P;  4IDK B;  4FYW B;  5FDL B;  4GC7 A;  4QJV A;  2HAF A;  4P71 A;  1TTH B;  4YP3 A;  1KSP A;  4OJ1 A;  2B9E A;  1NK6 A;  4LJM A;  5D0R A;  3HHL A;  3J80 Y;  5JVG Q;  2KN4 A;  3W3S A;  3ILI A;  4I6Y A;  2ZNY A;  3RRH A;  3GR0 A;  1RYR A;  2YX7 A;  1JLE B;  3AD9 C;  3IWL A;  4KR0 B;  2H4Y B;  4DV2 F;  1SIZ A;  4C11 B;  3I31 A;  5FD1 A;  3W2V A;  4KH0 B;  1RAE B;  2OPS A;  4GC6 A;  2L9W A;  4UOF A;  3SFG A;  5GVQ A;  1FDD A;  2GZO A;  3OHA A;  1QTG A;  2XMJ A;  1GAO A;  4X65 F;  1IJE B;  1IWG A;  1WSR A;  3BH7 B;  5D4P A;  4ZJL A;  3Q8R B;  1YI2 S;  1AZS B;  1A7G E;  2LQ9 A;  2YY3 A;  3KOA A;  4ED8 A;  3ZTS A;  3CUN A;  3UN2 A;  5KFQ A;  1NM2 A;  3KUH A;  2LU1 A;  4JI7 F;  4ZDN A;  4DR7 F;  3FEY B;  3V81 A;  2LEB A;  4CDI A;  4L6V 3;  3DOL B;  2MTL A;  4F67 A;  1ACM B;  2AY0 A;  5HBM B;  1ZTW A;  1YLX A;  3MHY A;  3T1Y J;  2PFF B;  3HHN B;  3TVK A;  4NI2 A;  4OJG A;  3ITH A;  5B0F A;  3OVS A;  5IOL A;  2JFD A;  2D9O A;  3N01 A;  1YJR A;  3R5G A;  5E0O A;  2BAC A;  4RBU A;  3US5 A;  5HL7 Q;  2V4J B;  2I5J A;  2LFV A;  3BZQ A;  4QOT A;  4Q45 A;  3G8T A;  2M70 A;  2ZDO A;  1Y4Z B;  2DNM A;  1VBZ A;  5MLC V;  4EYH B;  5CYJ A;  2GCF A;  4L73 A;  5BYS A;  4X4R A;  3HDS A;  2WVE A;  3M05 A;  1VBX A;  5B0D A;  2Z0G A;  2CFX A;  2IC3 B;  2ADL A;  3LP1 B;  3NG8 A;  3G86 A;  1HNV A;  3BYR A;  2CWX A;  1HBO A;  2RF2 B;  5E2Q A;  2K5J A;  3RZA A;  3A8E A;  2ZKU A;  4ZLP A;  3T19 A;  1VS3 A;  3PFO A;  1T9V A;  4QZV B;  1BQX A;  4ED5 A;  3V6K A;  2M3D A;  3Q0A A;  3PRD A;  5EX3 A;  5DGA A;  2BV3 A;  1RI7 A;  4RZR A;  1F2G A;  3IC1 A;  4J9S A;  5M2P A;  1AZS A;  3OTE A;  4QYR A;  2G0J A;  4N76 A;  2SXL A;  4I2P A;  4LBI A;  3KHR A;  1FER A;  1QJH A;  2HFU A;  1VMB A;  2B56 A;  2HIY A;  2L9N A;  2V8H A;  1PC4 A;  2BRL A;  2GVZ B;  3BS9 A;  4M5N A;  4AUK A;  4EZ6 A;  2WTF A;  2QA4 S;  1VQK S;  2HPU A;  3OFF A;  4KHM A;  1TFW A;  3D1Q A;  4C0H A;  3DLG A;  4RL1 A;  5HQM A;  5KFB A;  2GJF A;  1JLB A;  1YGY A;  2FHJ D;  1RWU A;  3THV A;  3HHE A;  2DNL A;  2NZC A;  1VOM A;  2ZC4 A;  3NLC A;  4UW2 A;  2F40 A;  3M7V A;  3UFC X;  3DN9 A;  1RIS A;  2DCL A;  2QLB B;  1JXV A;  4A8Y A;  4USI A;  3S01 A;  1SKS A;  1LK5 A;  4PG7 A;  1N33 F;  2YQ0 A;  4OX6 A;  4UF4 A;  3Q89 A;  3UI3 A;  4X65 J;  5L9N A;  3CCR S;  2OTJ S;  3H42 A;  1GMV A;  3OPK A;  1C0T B;  5B7W A;  4PUO B;  4DPT A;  4DF8 A;  2GC8 A;  3VVT A;  2EFN A;  1B01 A;  5EWG A;  4YR3 A;  5A0Y B;  4K50 A;  1RTJ A;  3OW2 R;  4YDX A;  4O4G A;  2FJX A;  4U7U K;  1CS4 A;  2W01 A;  1SKR A;  2OSR A;  2LQ8 A;  4J37 A;  1EKR A;  3TX0 A;  2GX8 A;  2YWH A;  1EKS A;  7AT1 B;  4A47 A;  1RHK B;  2HVE A;  4E2F B;  1FA0 A;  4N8N A;  2E5H A;  2W2M P;  3BM7 A;  1N5T A;  2YWG A;  3W60 A;  1B99 A;  4PYD A;  5LSL A;  3MUV P;  2WZ1 A;  4DR5 J;  5D8H B;  1VLO A;  4QW8 A;  3RU0 A;  4IKA A;  1IVZ A;  1HR0 J;  1E6V A;  2VBX A;  2BJ9 A;  3G8Q A;  4CO1 A;  3C6U B;  5DG9 A;  2F4V F;  1VQL S;  5HP1 A;  1EAR A;  3ULH A;  4NLW A;  3HJF A;  2YWE A;  4KPC A;  4Y34 A;  3VCD A;  2H51 B;  2JLG A;  4DV3 F;  3AXM A;  3RAQ A;  3CT9 A;  4RUA A;  3H4B A;  1XC9 A;  3FSY A;  4UUW A;  3GYX B;  1QE1 B;  1UFL A;  1VDH A;  2IM1 A;  4KY3 A;  5KOW A;  3AJD A;  2CRL A;  2QIF A;  5HRO B;  2DVI A;  1QM9 A;  1RAO A;  2DNN A;  3GSD A;  1WUU A;  4LF8 J;  2E9Z A;  3RYL A;  4NRU A;  3Q8U A;  4FXD A;  1M5V C;  2WB1 D;  4K5S A;  2C3U A;  2H3A A;  1UWB A;  1ZBT A;  3DLH A;  3RG6 A;  1WKJ A;  5B09 A;  2FGO A;  1YG0 A;  1N6Q A;  2BQU A;  4PWW A;  3DLK A;  2D3O R;  1ARR A;  4OLP A;  4FKY A;  3TVY A;  1PG5 B;  2F8M A;  2MLX A;  3KWM A;  3CXC R;  1XMO J;  4LF7 F;  2J0W A;  1LW2 B;  3D6H B;  4IOB A;  4K4S A;  4QYZ K;  2A2B A;  1TKZ B;  2VL1 A;  1BQM A;  3F56 A;  3EX7 B;  1N56 A;  2BJE A;  2UUB J;  2QTW A;  3M6U A;  4JV2 A;  3OSP A;  4P75 A;  2C2K B;  1IWA A;  2KT2 A;  5M2R A;  3M8Z A;  4NYP A;  5C24 B;  4DR1 J;  3I0S B;  4KFB A;  2W8L A;  3R97 A;  4TVA B;  1VQ6 S;  2XB2 D;  3RB3 A;  5F8H A;  2FVP A;  2APO A;  4CO4 A;  1Q0N A;  4WE1 B;  1DY3 A;  2F9J A;  3EJM A;  1J27 A;  2G2Y A;  3V4M A;  1ZA1 B;  1ZM2 A;  3MEG A;  3QWP A;  1IM4 A;  1J5E J;  3UWT A;  4RU9 A;  3I9Z A;  1N6Q B;  3SBM A;  3BSN A;  1VRU A;  3B6B A;  4P2X A;  2WW4 A;  2A2D A;  3BF4 A;  3CSK A;  3EVO A;  5BYQ A;  1KON A;  1UA1 A;  1CQN A;  1B7F A;  2AYE A;  1WDT A;  1FJE B;  2ROE A;  1S48 A;  4I56 A;  5I3U A; 
#chains in the Genus database with same CATH homology
 2CAX A;  2K29 A;  2BSQ E;  2Y3Y A;  3VEA A;  2AY0 A;  1X93 A;  1NLA A;  2BJ8 A;  2WVD A;  2WVF A;  4HV0 A;  2HZA A;  1B01 A;  1IRQ A;  1MNT A;  3LGH A;  4FXE A;  2BNZ A;  2BJ1 A;  1U9P A;  2WVB A;  2GPE A;  4ME7 E;  3BKU A;  3BKT A;  2F1F A;  2BJ7 A;  3VEB A;  2RBF A;  1P94 A;  2K9I A;  3VW4 A;  1BDV A;  3PHT A;  1Q5Y A;  2NZC A;  2K6L A;  1MYK A;  1QTG A;  2BJ3 A;  3QSI A;  3FMT A;  1Q5V A;  2BA3 A;  2JXG A;  1ARR A;  2CPG A;  1BAZ A;  2JXH A;  2K1O A;  2WVE A;  2KEL A;  1MYL A;  2CAJ A;  3FT7 A;  3OD2 A;  1EA4 A;  2BJ9 A;  2HZV A;  2WVC A;  3H87 C;  2H1O E;  2JXI A;  3GXQ A;  2PC6 A;  1ARQ A;  1PAR A;  2CAD A;  4D8J A;  3QOQ A;  1BDT A;  1B28 A;  3BKF A;  2CA9 A;  2FGC A;  2BNW A;  2K5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...